BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c45045_g1_i1 len=424 path=[1:0-423]

Length=424
                                                                      Score     E

emb|CDP02835.1|  unnamed protein product                                184   2e-51   
ref|XP_006343621.1|  PREDICTED: pentatricopeptide repeat-containi...    174   4e-48   
ref|XP_009622820.1|  PREDICTED: pentatricopeptide repeat-containi...    173   1e-47   
ref|XP_009777622.1|  PREDICTED: pentatricopeptide repeat-containi...    172   4e-47   
ref|XP_008243021.1|  PREDICTED: pentatricopeptide repeat-containi...    159   2e-42   
ref|XP_004242990.1|  PREDICTED: pentatricopeptide repeat-containi...    157   1e-41   
ref|XP_009366209.1|  PREDICTED: pentatricopeptide repeat-containi...    151   1e-39   
ref|XP_008362867.1|  PREDICTED: pentatricopeptide repeat-containi...    150   2e-39   
ref|XP_009358417.1|  PREDICTED: pentatricopeptide repeat-containi...    147   6e-38   
ref|XP_004288724.1|  PREDICTED: pentatricopeptide repeat-containi...    146   1e-37   
ref|XP_004152852.1|  PREDICTED: pentatricopeptide repeat-containi...    144   8e-37   
ref|XP_008394295.1|  PREDICTED: pentatricopeptide repeat-containi...    143   2e-36   
ref|XP_010273675.1|  PREDICTED: pentatricopeptide repeat-containi...    141   4e-36   
ref|XP_004163058.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    141   5e-36   
ref|XP_010273676.1|  PREDICTED: pentatricopeptide repeat-containi...    140   2e-35   
ref|XP_011079379.1|  PREDICTED: pentatricopeptide repeat-containi...    138   8e-35   
ref|XP_008450522.1|  PREDICTED: pentatricopeptide repeat-containi...    138   1e-34   
emb|CBI36552.3|  unnamed protein product                                137   1e-34   
ref|XP_002275298.1|  PREDICTED: pentatricopeptide repeat-containi...    137   1e-34   Vitis vinifera
ref|XP_010684217.1|  PREDICTED: pentatricopeptide repeat-containi...    135   6e-34   
ref|XP_010689303.1|  PREDICTED: pentatricopeptide repeat-containi...    135   1e-33   
gb|KGN61216.1|  hypothetical protein Csa_2G070330                       134   3e-33   
ref|XP_011033388.1|  PREDICTED: pentatricopeptide repeat-containi...    131   3e-32   
gb|KCW78811.1|  hypothetical protein EUGRSUZ_C00245                     130   3e-32   
ref|XP_010047061.1|  PREDICTED: pentatricopeptide repeat-containi...    131   3e-32   
gb|KDO62295.1|  hypothetical protein CISIN_1g044131mg                   130   4e-32   
ref|XP_006474049.1|  PREDICTED: pentatricopeptide repeat-containi...    129   8e-32   
ref|XP_010447678.1|  PREDICTED: pentatricopeptide repeat-containi...    129   9e-32   
ref|XP_006453556.1|  hypothetical protein CICLE_v10007511mg             129   1e-31   
ref|XP_010438137.1|  PREDICTED: pentatricopeptide repeat-containi...    128   3e-31   
ref|XP_010432951.1|  PREDICTED: pentatricopeptide repeat-containi...    128   4e-31   
ref|XP_007013861.1|  Pentatricopeptide repeat (PPR) superfamily p...    127   5e-31   
gb|KDP38705.1|  hypothetical protein JCGZ_04058                         127   8e-31   
ref|XP_010091160.1|  hypothetical protein L484_013952                   126   1e-30   
ref|NP_194799.1|  pentatricopeptide repeat-containing protein           124   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb|EYU34329.1|  hypothetical protein MIMGU_mgv1a001967mg                124   8e-30   
ref|XP_002867333.1|  pentatricopeptide repeat-containing protein        123   1e-29   
ref|XP_006285932.1|  hypothetical protein CARUB_v10007444mg             123   2e-29   
gb|KFK29652.1|  hypothetical protein AALP_AA7G161100                    119   3e-28   
ref|XP_010548633.1|  PREDICTED: pentatricopeptide repeat-containi...    119   4e-28   
ref|XP_009127635.1|  PREDICTED: pentatricopeptide repeat-containi...    119   4e-28   
emb|CDY28212.1|  BnaA01g06370D                                          119   7e-28   
ref|XP_003610281.1|  Pentatricopeptide repeat-containing protein        118   8e-28   
ref|XP_004507756.1|  PREDICTED: pentatricopeptide repeat-containi...    117   2e-27   
emb|CDX68689.1|  BnaC01g07640D                                          117   3e-27   
ref|XP_007154866.1|  hypothetical protein PHAVU_003G154400g             110   6e-25   
ref|XP_002533229.1|  pentatricopeptide repeat-containing protein,...    106   8e-24   Ricinus communis
emb|CDX72264.1|  BnaC07g42860D                                          106   1e-23   
ref|XP_009138114.1|  PREDICTED: pentatricopeptide repeat-containi...    106   2e-23   
ref|XP_003550682.1|  PREDICTED: pentatricopeptide repeat-containi...    105   4e-23   
ref|XP_006412675.1|  hypothetical protein EUTSA_v10024455mg             104   6e-23   
gb|EPS60782.1|  hypothetical protein M569_14020                         102   5e-22   
gb|KFK22524.1|  hypothetical protein AALP_AAs39623U000200             99.8    3e-21   
gb|KCW69344.1|  hypothetical protein EUGRSUZ_F02828                   85.1    4e-16   
ref|XP_010062241.1|  PREDICTED: pentatricopeptide repeat-containi...  85.1    4e-16   
ref|XP_007037335.1|  Tetratricopeptide repeat (TPR)-like superfam...  82.4    2e-15   
emb|CDP12308.1|  unnamed protein product                              79.3    2e-14   
ref|XP_007139254.1|  hypothetical protein PHAVU_008G014200g           79.7    2e-14   
ref|XP_009768191.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    3e-14   
ref|XP_010105982.1|  hypothetical protein L484_007616                 79.3    4e-14   
ref|XP_010255189.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    7e-14   
emb|CDP11859.1|  unnamed protein product                              77.8    1e-13   
gb|EYU29595.1|  hypothetical protein MIMGU_mgv1a025435mg              76.3    2e-13   
ref|XP_004492095.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    3e-13   
ref|XP_010267212.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    3e-13   
gb|KEH21904.1|  editing factor 22                                     76.3    4e-13   
ref|XP_010653985.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    9e-13   
ref|XP_009610515.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    1e-12   
gb|KDP33607.1|  hypothetical protein JCGZ_07178                       74.7    1e-12   
ref|XP_004304934.1|  PREDICTED: pentatricopeptide repeat-containi...  74.3    2e-12   
ref|XP_003551818.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    2e-12   
emb|CDY59706.1|  BnaCnng35430D                                        73.6    3e-12   
ref|XP_010326841.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    4e-12   
emb|CDP06172.1|  unnamed protein product                              72.8    4e-12   
gb|EPS69071.1|  hypothetical protein M569_05691                       73.2    4e-12   
ref|XP_007155315.1|  hypothetical protein PHAVU_003G190600g           72.8    5e-12   
ref|XP_006847830.1|  hypothetical protein AMTR_s00029p00051540        69.7    5e-12   
ref|XP_008348079.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    5e-12   
ref|XP_008379840.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    5e-12   
ref|XP_010915642.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    7e-12   
ref|XP_008457379.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    7e-12   
ref|XP_008379591.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  72.4    8e-12   
ref|XP_009353362.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    8e-12   
ref|XP_010246108.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    9e-12   
emb|CDY02013.1|  BnaC04g14880D                                        72.0    1e-11   
ref|XP_006844858.1|  hypothetical protein AMTR_s00058p00105900        68.9    1e-11   
ref|XP_002522705.1|  pentatricopeptide repeat-containing protein,...  71.2    1e-11   Ricinus communis
ref|XP_002276196.1|  PREDICTED: pentatricopeptide repeat-containi...  71.6    1e-11   Vitis vinifera
ref|XP_010538069.1|  PREDICTED: pentatricopeptide repeat-containi...  71.6    1e-11   
ref|XP_011082908.1|  PREDICTED: pentatricopeptide repeat-containi...  70.9    2e-11   
ref|XP_010243684.1|  PREDICTED: pentatricopeptide repeat-containi...  70.9    2e-11   
ref|XP_010068636.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    2e-11   
ref|XP_008230115.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    2e-11   
ref|NP_187883.2|  mitochondrial editing factor 22                     71.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94552.1|  hypothetical protein                                 71.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EYU45383.1|  hypothetical protein MIMGU_mgv1a023657mg              70.9    2e-11   
ref|XP_010316250.1|  PREDICTED: pentatricopeptide repeat-containi...  70.5    2e-11   
ref|XP_002884209.1|  pentatricopeptide repeat-containing protein      70.5    3e-11   
ref|XP_008219702.1|  PREDICTED: pentatricopeptide repeat-containi...  70.5    3e-11   
ref|XP_007224904.1|  hypothetical protein PRUPE_ppa022022mg           70.5    3e-11   
ref|XP_006601432.1|  PREDICTED: putative pentatricopeptide repeat...  70.9    3e-11   
ref|XP_009144348.1|  PREDICTED: pentatricopeptide repeat-containi...  70.5    3e-11   
emb|CDY70113.1|  BnaAnng32650D                                        70.5    3e-11   
ref|XP_009349981.1|  PREDICTED: putative pentatricopeptide repeat...  70.1    3e-11   
ref|XP_011100283.1|  PREDICTED: pentatricopeptide repeat-containi...  70.5    3e-11   
ref|XP_009376288.1|  PREDICTED: pentatricopeptide repeat-containi...  70.1    4e-11   
gb|KDP39353.1|  hypothetical protein JCGZ_01110                       70.1    4e-11   
ref|XP_006350917.1|  PREDICTED: pentatricopeptide repeat-containi...  70.1    4e-11   
ref|XP_006856097.1|  hypothetical protein AMTR_s00059p00132030        67.4    5e-11   
ref|XP_010487003.1|  PREDICTED: pentatricopeptide repeat-containi...  70.1    5e-11   
ref|XP_003624556.1|  Pentatricopeptide repeat-containing protein      69.3    5e-11   
ref|XP_010266937.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    5e-11   
gb|EPS72721.1|  hypothetical protein M569_02036                       69.7    5e-11   
ref|XP_004241167.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    6e-11   
ref|XP_002522388.1|  pentatricopeptide repeat-containing protein,...  69.3    6e-11   Ricinus communis
ref|XP_009383182.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    6e-11   
ref|XP_010937211.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    6e-11   
ref|XP_010254272.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    7e-11   
ref|XP_006410036.1|  hypothetical protein EUTSA_v10016305mg           69.7    7e-11   
ref|XP_003548483.1|  PREDICTED: pentatricopeptide repeat-containi...  68.9    7e-11   
ref|XP_002284834.1|  PREDICTED: putative pentatricopeptide repeat...  69.3    7e-11   Vitis vinifera
ref|XP_008394135.1|  PREDICTED: pentatricopeptide repeat-containi...  69.3    8e-11   
ref|XP_010092397.1|  hypothetical protein L484_023776                 68.9    9e-11   
emb|CBI36755.3|  unnamed protein product                              69.3    9e-11   
ref|XP_006356395.1|  PREDICTED: pentatricopeptide repeat-containi...  68.9    1e-10   
ref|XP_002282982.1|  PREDICTED: pentatricopeptide repeat-containi...  68.9    1e-10   Vitis vinifera
ref|XP_006431200.1|  hypothetical protein CICLE_v10011436mg           68.9    1e-10   
ref|XP_009379156.1|  PREDICTED: pentatricopeptide repeat-containi...  68.9    1e-10   
gb|KDO72618.1|  hypothetical protein CISIN_1g041942mg                 68.6    1e-10   
ref|XP_006484869.1|  PREDICTED: pentatricopeptide repeat-containi...  68.6    1e-10   
ref|XP_009598200.1|  PREDICTED: pentatricopeptide repeat-containi...  68.6    1e-10   
ref|XP_006482626.1|  PREDICTED: pentatricopeptide repeat-containi...  68.6    1e-10   
ref|XP_010255010.1|  PREDICTED: pentatricopeptide repeat-containi...  68.9    1e-10   
ref|XP_010499449.1|  PREDICTED: pentatricopeptide repeat-containi...  68.9    1e-10   
ref|XP_009341449.1|  PREDICTED: pentatricopeptide repeat-containi...  68.9    1e-10   
ref|XP_004306116.1|  PREDICTED: pentatricopeptide repeat-containi...  68.6    1e-10   
ref|XP_009128053.1|  PREDICTED: pentatricopeptide repeat-containi...  68.6    1e-10   
ref|XP_007048864.1|  Pentatricopeptide repeat (PPR-like) superfam...  68.6    1e-10   
ref|XP_006299513.1|  hypothetical protein CARUB_v10015683mg           68.6    1e-10   
ref|XP_004145320.1|  PREDICTED: pentatricopeptide repeat-containi...  68.6    2e-10   
ref|XP_007208480.1|  hypothetical protein PRUPE_ppa018503mg           68.2    2e-10   
ref|XP_006299486.1|  hypothetical protein CARUB_v10015651mg           68.2    2e-10   
ref|XP_004305832.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    2e-10   
ref|XP_008353912.1|  PREDICTED: pentatricopeptide repeat-containi...  67.8    2e-10   
ref|XP_003541414.2|  PREDICTED: pentatricopeptide repeat-containi...  68.2    2e-10   
ref|XP_002300166.1|  pentatricopeptide repeat-containing family p...  68.2    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006593838.1|  PREDICTED: pentatricopeptide repeat-containi...  67.4    2e-10   
ref|XP_009355807.1|  PREDICTED: pentatricopeptide repeat-containi...  67.8    2e-10   
ref|XP_008230793.1|  PREDICTED: pentatricopeptide repeat-containi...  67.8    2e-10   
ref|XP_003558728.1|  PREDICTED: pentatricopeptide repeat-containi...  67.8    2e-10   
ref|XP_008811169.1|  PREDICTED: pentatricopeptide repeat-containi...  67.4    3e-10   
ref|XP_008388588.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  67.4    3e-10   
ref|XP_011045639.1|  PREDICTED: pentatricopeptide repeat-containi...  67.8    3e-10   
ref|XP_007215675.1|  hypothetical protein PRUPE_ppa003946mg           67.4    3e-10   
ref|XP_006360955.1|  PREDICTED: pentatricopeptide repeat-containi...  67.8    3e-10   
ref|XP_002533114.1|  pentatricopeptide repeat-containing protein,...  67.0    3e-10   Ricinus communis
ref|XP_010938918.1|  PREDICTED: pentatricopeptide repeat-containi...  67.4    3e-10   
ref|XP_010940355.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    3e-10   
ref|XP_010692438.1|  PREDICTED: pentatricopeptide repeat-containi...  67.4    4e-10   
ref|XP_009765478.1|  PREDICTED: pentatricopeptide repeat-containi...  67.4    4e-10   
ref|XP_010104643.1|  hypothetical protein L484_022020                 67.4    4e-10   
ref|XP_006844721.1|  hypothetical protein AMTR_s00016p00252780        66.6    4e-10   
ref|XP_010313232.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    4e-10   
ref|XP_011035790.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    4e-10   
ref|XP_010313231.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    4e-10   
emb|CBI35966.3|  unnamed protein product                              67.0    4e-10   
ref|XP_003632853.2|  PREDICTED: pentatricopeptide repeat-containi...  67.0    4e-10   
ref|XP_006437177.1|  hypothetical protein CICLE_v10031197mg           67.0    4e-10   
ref|XP_008459333.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    4e-10   
ref|XP_003588753.1|  Pentatricopeptide repeat-containing protein      67.0    4e-10   
ref|XP_004250888.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    5e-10   
ref|XP_006407296.1|  hypothetical protein EUTSA_v10020185mg           67.0    5e-10   
ref|XP_010465057.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    5e-10   
ref|XP_007216409.1|  hypothetical protein PRUPE_ppa022709mg           66.6    5e-10   
ref|NP_179644.1|  mitochondrial editing factor 21                     66.6    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008783875.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    5e-10   
ref|XP_002324070.1|  pentatricopeptide repeat-containing family p...  66.6    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010935185.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    5e-10   
ref|XP_006483347.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    6e-10   
ref|XP_006483346.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    6e-10   
ref|XP_010467800.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    6e-10   
ref|XP_002884925.1|  predicted protein                                66.6    6e-10   
gb|KFK37135.1|  hypothetical protein AALP_AA4G217600                  66.2    7e-10   
ref|XP_010274819.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    7e-10   
ref|XP_009379143.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    7e-10   
ref|XP_008784659.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    8e-10   
emb|CDY52870.1|  BnaCnng23580D                                        63.5    8e-10   
ref|XP_009350396.1|  PREDICTED: putative pentatricopeptide repeat...  66.2    8e-10   
ref|XP_007139556.1|  hypothetical protein PHAVU_008G039700g           66.2    8e-10   
ref|XP_006293749.1|  hypothetical protein CARUB_v10022711mg           66.6    8e-10   
ref|XP_010250014.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    8e-10   
ref|XP_006395295.1|  hypothetical protein EUTSA_v10003866mg           66.2    8e-10   
ref|XP_009794324.1|  PREDICTED: pentatricopeptide repeat-containi...  65.9    8e-10   
ref|XP_003533068.2|  PREDICTED: putative pentatricopeptide repeat...  66.2    9e-10   
emb|CBI17228.3|  unnamed protein product                              66.2    9e-10   
ref|XP_010542851.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    1e-09   
ref|XP_002270439.2|  PREDICTED: pentatricopeptide repeat-containi...  66.2    1e-09   Vitis vinifera
ref|XP_007023277.1|  Pentatricopeptide repeat superfamily protein     66.2    1e-09   
gb|KGN52474.1|  hypothetical protein Csa_5G636660                     65.9    1e-09   
ref|XP_010428453.1|  PREDICTED: pentatricopeptide repeat-containi...  65.9    1e-09   
ref|XP_010428452.1|  PREDICTED: pentatricopeptide repeat-containi...  65.9    1e-09   
ref|XP_006842814.1|  hypothetical protein AMTR_s00081p00056740        65.1    1e-09   
ref|XP_007216544.1|  hypothetical protein PRUPE_ppb007734mg           64.3    1e-09   
ref|XP_011044784.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    1e-09   
ref|XP_006290812.1|  hypothetical protein CARUB_v10016917mg           65.5    1e-09   
ref|XP_008380208.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    1e-09   
ref|XP_010419202.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    1e-09   
ref|XP_006468953.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    1e-09   
ref|XP_010095598.1|  hypothetical protein L484_007437                 65.5    1e-09   
gb|KHN18567.1|  Pentatricopeptide repeat-containing protein           65.5    1e-09   
ref|XP_010091451.1|  hypothetical protein L484_000760                 65.5    1e-09   
ref|XP_003550788.2|  PREDICTED: pentatricopeptide repeat-containi...  65.5    1e-09   
ref|XP_004141574.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    1e-09   
ref|XP_009377436.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  65.1    1e-09   
ref|XP_011039733.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    1e-09   
ref|XP_008344823.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    1e-09   
ref|XP_010678470.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    1e-09   
ref|XP_002276684.1|  PREDICTED: putative pentatricopeptide repeat...  65.1    2e-09   Vitis vinifera
gb|KDO60957.1|  hypothetical protein CISIN_1g046039mg                 65.1    2e-09   
ref|XP_002515531.1|  pentatricopeptide repeat-containing protein,...  64.7    2e-09   Ricinus communis
ref|XP_010070463.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    2e-09   
ref|XP_006338776.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    2e-09   
ref|XP_004306131.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    2e-09   
ref|XP_007208504.1|  hypothetical protein PRUPE_ppa026555mg           65.1    2e-09   
ref|XP_009762871.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    2e-09   
ref|XP_010258267.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    2e-09   
ref|XP_010931854.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    2e-09   
ref|XP_008356438.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    2e-09   
ref|XP_003552546.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    2e-09   
ref|XP_007034318.1|  Tetratricopeptide repeat-like superfamily pr...  65.1    2e-09   
ref|XP_010651252.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    2e-09   
ref|XP_011075783.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    2e-09   
ref|XP_010489024.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    2e-09   
gb|KFK23272.1|  hypothetical protein AALP_AAs55729U000100             65.1    2e-09   
ref|XP_009117485.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    2e-09   
ref|XP_010255448.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    2e-09   
ref|XP_006450458.1|  hypothetical protein CICLE_v10010438mg           64.7    2e-09   
gb|EMT31807.1|  hypothetical protein F775_12997                       65.1    2e-09   
emb|CBI35029.3|  unnamed protein product                              65.1    3e-09   
ref|XP_006408981.1|  hypothetical protein EUTSA_v10001958mg           64.3    3e-09   
emb|CDY08404.1|  BnaA05g26400D                                        64.7    3e-09   
gb|KDP31247.1|  hypothetical protein JCGZ_11623                       64.7    3e-09   
ref|XP_003551738.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    3e-09   
ref|XP_007132588.1|  hypothetical protein PHAVU_011G107600g           64.7    3e-09   
ref|XP_007133846.1|  hypothetical protein PHAVU_011G213900g           64.7    3e-09   
ref|XP_006411565.1|  hypothetical protein EUTSA_v10017572mg           64.3    3e-09   
ref|XP_003530418.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    3e-09   
ref|XP_010257292.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    3e-09   
ref|XP_006395538.1|  hypothetical protein EUTSA_v10004197mg           63.9    3e-09   
ref|XP_008365629.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  64.7    3e-09   
ref|XP_006446854.1|  hypothetical protein CICLE_v10018065mg           63.9    3e-09   
ref|XP_011042533.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    4e-09   
gb|KHM98813.1|  Pentatricopeptide repeat-containing protein           64.3    4e-09   
ref|XP_008230712.1|  PREDICTED: putative pentatricopeptide repeat...  63.9    4e-09   
ref|XP_011002251.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    4e-09   
ref|XP_010473971.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    4e-09   
ref|XP_004301874.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    4e-09   
ref|XP_010936605.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    4e-09   
ref|XP_006338488.1|  PREDICTED: putative pentatricopeptide repeat...  63.9    4e-09   
ref|XP_002306741.1|  pentatricopeptide repeat-containing family p...  63.9    4e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010257116.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    4e-09   
ref|XP_009627120.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    4e-09   
ref|XP_009764895.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    5e-09   
ref|XP_010665683.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    5e-09   
ref|XP_002532904.1|  pentatricopeptide repeat-containing protein,...  63.9    5e-09   Ricinus communis
emb|CDP13497.1|  unnamed protein product                              63.9    5e-09   
ref|XP_007217279.1|  hypothetical protein PRUPE_ppa017633mg           63.9    5e-09   
emb|CBI16398.3|  unnamed protein product                              63.9    5e-09   
ref|XP_004301138.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    5e-09   
dbj|BAD93880.1|  hypothetical protein                                 63.9    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177601.1|  pentatricopeptide repeat-containing protein         63.9    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161786.1|  hypothetical protein PHAVU_001G097900g           63.5    5e-09   
ref|XP_010250460.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    5e-09   
ref|XP_006433083.1|  hypothetical protein CICLE_v10003904mg           63.5    6e-09   
ref|XP_010414340.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    6e-09   
ref|XP_010545581.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    6e-09   
ref|XP_008231210.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    6e-09   
emb|CDM84714.1|  unnamed protein product                              63.9    6e-09   
ref|NP_178260.1|  pentatricopeptide repeat-containing protein         63.5    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502875.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    6e-09   
ref|XP_010103685.1|  hypothetical protein L484_011738                 63.5    7e-09   
ref|XP_006583750.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    7e-09   
ref|XP_010260860.1|  PREDICTED: putative pentatricopeptide repeat...  63.5    7e-09   
gb|KDP46908.1|  hypothetical protein JCGZ_10399                       63.2    7e-09   
ref|XP_008438067.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    7e-09   
ref|XP_006390406.1|  hypothetical protein EUTSA_v10018254mg           63.5    7e-09   
ref|XP_010255237.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    7e-09   
gb|KHN27212.1|  Pentatricopeptide repeat-containing protein           63.2    7e-09   
ref|NP_001146230.1|  uncharacterized protein LOC100279802             63.2    7e-09   
gb|AFW89565.1|  hypothetical protein ZEAMMB73_426720                  63.2    7e-09   
ref|XP_006339048.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    7e-09   
ref|XP_008230824.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    7e-09   
ref|XP_010514638.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    8e-09   
ref|XP_010670638.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  63.2    8e-09   
ref|XP_010652286.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    8e-09   
gb|KHN44640.1|  Pentatricopeptide repeat-containing protein           62.8    8e-09   
emb|CDP17003.1|  unnamed protein product                              63.2    8e-09   
ref|XP_006847829.1|  hypothetical protein AMTR_s00029p00051450        60.1    8e-09   
ref|XP_009770229.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    8e-09   
gb|KGN56532.1|  hypothetical protein Csa_3G122560                     63.5    8e-09   
ref|XP_009146589.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    8e-09   
ref|NP_189568.1|  pentatricopeptide repeat-containing protein         63.2    8e-09   
ref|XP_002458675.1|  hypothetical protein SORBIDRAFT_03g037910        63.5    9e-09   
ref|XP_010695212.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    9e-09   
ref|XP_009101340.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    9e-09   
ref|XP_004508741.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    9e-09   
gb|KHN46372.1|  Pentatricopeptide repeat-containing protein, chlo...  62.8    9e-09   
ref|XP_010547511.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    9e-09   
ref|XP_004155878.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    9e-09   
ref|XP_006290777.1|  hypothetical protein CARUB_v10016882mg           63.2    1e-08   
ref|XP_003520007.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    1e-08   
ref|XP_011087503.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    1e-08   
ref|XP_008241871.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    1e-08   
ref|XP_002518071.1|  pentatricopeptide repeat-containing protein,...  62.4    1e-08   
ref|XP_010510463.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    1e-08   
ref|XP_008229419.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-08   
gb|KDO47074.1|  hypothetical protein CISIN_1g047480mg                 63.2    1e-08   
ref|XP_006491677.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    1e-08   
ref|XP_006428441.1|  hypothetical protein CICLE_v10011174mg           63.2    1e-08   
ref|XP_002511576.1|  pentatricopeptide repeat-containing protein,...  62.4    1e-08   
ref|XP_010525501.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-08   
ref|XP_010034279.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    1e-08   
ref|XP_007210969.1|  hypothetical protein PRUPE_ppa022615mg           62.8    1e-08   
ref|XP_011098650.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-08   
ref|XP_007032594.1|  Pentatricopeptide repeat (PPR) superfamily p...  62.8    1e-08   
ref|XP_010471554.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-08   
ref|NP_189297.1|  pentatricopeptide repeat-containing protein         62.4    1e-08   
ref|XP_009386141.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  63.2    1e-08   
ref|XP_008227182.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-08   
ref|XP_007214270.1|  hypothetical protein PRUPE_ppa026204mg           62.8    1e-08   
ref|XP_004236477.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-08   
ref|XP_008246495.1|  PREDICTED: putative pentatricopeptide repeat...  62.8    1e-08   
ref|XP_004236840.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-08   
ref|XP_004134328.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-08   
ref|XP_008809829.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    1e-08   
ref|XP_002299231.1|  pentatricopeptide repeat-containing family p...  62.8    1e-08   
ref|XP_006290671.1|  hypothetical protein CARUB_v10016762mg           62.8    1e-08   
ref|XP_010430870.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-08   
ref|XP_010263631.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-08   
ref|XP_008779853.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    1e-08   
ref|XP_010088539.1|  hypothetical protein L484_002079                 62.4    1e-08   
ref|XP_006346080.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    1e-08   
ref|XP_004244333.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    1e-08   
ref|XP_002876755.1|  pentatricopeptide repeat-containing protein      62.4    1e-08   
ref|XP_009607911.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-08   
emb|CDX85257.1|  BnaC07g25680D                                        62.4    1e-08   
ref|XP_002275048.2|  PREDICTED: pentatricopeptide repeat-containi...  62.4    1e-08   
ref|XP_006400050.1|  hypothetical protein EUTSA_v10015396mg           62.4    2e-08   
gb|KGN61250.1|  hypothetical protein Csa_2G074120                     62.4    2e-08   
ref|XP_008218537.1|  PREDICTED: putative pentatricopeptide repeat...  62.4    2e-08   
gb|EYU37582.1|  hypothetical protein MIMGU_mgv1a024354mg              62.0    2e-08   
ref|XP_010656122.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-08   
ref|XP_006353228.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-08   
ref|XP_010905026.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  62.4    2e-08   
ref|XP_004155125.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-08   
ref|XP_004152881.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-08   
ref|XP_002279693.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-08   
ref|XP_002534070.1|  pentatricopeptide repeat-containing protein,...  62.0    2e-08   
ref|XP_008239983.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-08   
gb|EYU28838.1|  hypothetical protein MIMGU_mgv1a003966mg              62.0    2e-08   
ref|XP_009417951.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-08   
ref|XP_002279360.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-08   
gb|EYU34053.1|  hypothetical protein MIMGU_mgv1a004068mg              62.0    2e-08   
emb|CDY53649.1|  BnaC04g52830D                                        62.0    2e-08   
ref|XP_010274081.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-08   
ref|XP_011087264.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-08   
ref|XP_010258338.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-08   
ref|XP_009356621.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-08   
emb|CAN72716.1|  hypothetical protein VITISV_032470                   62.0    2e-08   
gb|EYU37585.1|  hypothetical protein MIMGU_mgv1a003900mg              62.0    2e-08   
ref|XP_009374255.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-08   
gb|KCW64271.1|  hypothetical protein EUGRSUZ_G01907                   60.8    2e-08   
ref|XP_008447140.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-08   
ref|XP_008370927.1|  PREDICTED: putative pentatricopeptide repeat...  62.0    2e-08   
ref|XP_004295750.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-08   
ref|XP_009609036.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    2e-08   
ref|XP_010644678.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    2e-08   
ref|XP_010259248.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-08   
gb|KDO44240.1|  hypothetical protein CISIN_1g035659mg                 62.0    2e-08   
emb|CAN62262.1|  hypothetical protein VITISV_013985                   61.6    2e-08   
ref|NP_180537.1|  RNA editing factor OTP81                            62.0    2e-08   
ref|XP_006480615.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-08   
ref|XP_008798486.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-08   
emb|CBI15973.3|  unnamed protein product                              62.0    2e-08   
ref|XP_002465797.1|  hypothetical protein SORBIDRAFT_01g045970        61.6    2e-08   
ref|XP_004304947.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    2e-08   
ref|XP_006428806.1|  hypothetical protein CICLE_v10011151mg           62.0    2e-08   
ref|XP_008803539.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    2e-08   
gb|EYU44038.1|  hypothetical protein MIMGU_mgv1a001643mg              62.0    3e-08   
ref|XP_009797557.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-08   
gb|KFK41901.1|  hypothetical protein AALP_AA2G187100                  62.0    3e-08   
emb|CBI15227.3|  unnamed protein product                              61.6    3e-08   
ref|XP_006341682.1|  PREDICTED: putative pentatricopeptide repeat...  61.6    3e-08   
ref|XP_008787062.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-08   
ref|XP_010112442.1|  hypothetical protein L484_013826                 60.1    3e-08   
ref|XP_006826680.1|  hypothetical protein AMTR_s00137p00065090        60.8    3e-08   
ref|XP_007046316.1|  Pentatricopeptide repeat (PPR) superfamily p...  61.2    3e-08   
ref|XP_003555200.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    3e-08   
ref|XP_008450440.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-08   
ref|XP_010502131.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-08   
gb|KFK25192.1|  hypothetical protein AALP_AA8G079200                  61.2    3e-08   
ref|XP_011070868.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-08   
ref|XP_010670177.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-08   
ref|XP_002282084.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-08   
ref|XP_010066412.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    3e-08   
ref|XP_008219204.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    3e-08   
ref|XP_006287429.1|  hypothetical protein CARUB_v10000633mg           61.2    3e-08   
ref|XP_010926521.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    3e-08   
ref|XP_010677398.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    3e-08   
ref|XP_003592711.1|  Pentatricopeptide repeat-containing protein      61.2    3e-08   
ref|XP_006301886.1|  hypothetical protein CARUB_v10022358mg           61.2    3e-08   
ref|XP_004301149.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    3e-08   
ref|XP_002523226.1|  pentatricopeptide repeat-containing protein,...  61.2    4e-08   
ref|XP_002274432.2|  PREDICTED: pentatricopeptide repeat-containi...  61.2    4e-08   
ref|XP_007207414.1|  hypothetical protein PRUPE_ppa014644mg           61.2    4e-08   
ref|XP_010047809.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    4e-08   
ref|XP_010039610.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    4e-08   
ref|XP_007032637.1|  Tetratricopeptide repeat (TPR)-like superfam...  61.2    4e-08   
ref|XP_010931403.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  61.2    4e-08   
ref|XP_006848936.1|  hypothetical protein AMTR_s00166p00033330        59.3    4e-08   
ref|XP_004249810.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    4e-08   
ref|XP_010502600.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    4e-08   
ref|XP_007016122.1|  Tetratricopeptide repeat (TPR)-like superfam...  61.2    4e-08   
ref|XP_003598017.1|  Pentatricopeptide repeat-containing protein      60.8    4e-08   
ref|XP_010066922.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    4e-08   
ref|XP_003520267.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    4e-08   
ref|XP_009349397.1|  PREDICTED: putative pentatricopeptide repeat...  60.8    4e-08   
ref|XP_004233685.2|  PREDICTED: putative pentatricopeptide repeat...  60.8    4e-08   
ref|XP_008387666.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    4e-08   
ref|XP_009350387.1|  PREDICTED: putative pentatricopeptide repeat...  60.8    4e-08   
ref|XP_009336304.1|  PREDICTED: putative pentatricopeptide repeat...  61.2    4e-08   
ref|XP_004136090.1|  PREDICTED: putative pentatricopeptide repeat...  61.2    4e-08   
ref|XP_010550036.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    4e-08   
ref|XP_004158817.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  61.2    4e-08   
gb|KCW60575.1|  hypothetical protein EUGRSUZ_H03306                   60.8    5e-08   
ref|XP_010688051.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    5e-08   
ref|XP_010416999.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    5e-08   
ref|XP_009773472.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    5e-08   
ref|XP_008228774.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    5e-08   
ref|XP_004139110.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    5e-08   
ref|XP_003553320.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    5e-08   
ref|XP_007046082.1|  Pentatricopeptide repeat (PPR) superfamily p...  60.8    5e-08   
ref|XP_006836748.1|  hypothetical protein AMTR_s00088p00149930        60.5    5e-08   
emb|CDY69260.1|  BnaCnng62680D                                        60.5    5e-08   
ref|XP_008782323.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    5e-08   
ref|XP_010024144.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    5e-08   
ref|XP_004292867.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    5e-08   
emb|CDP19378.1|  unnamed protein product                              60.8    5e-08   
emb|CAN70142.1|  hypothetical protein VITISV_032085                   60.8    5e-08   
ref|XP_007013319.1|  Pentatricopeptide repeat-containing protein,...  60.8    5e-08   
ref|XP_003592111.1|  Pentatricopeptide repeat-containing protein      57.8    5e-08   
ref|XP_010256994.1|  PREDICTED: putative pentatricopeptide repeat...  60.8    5e-08   
ref|XP_010059384.1|  PREDICTED: putative pentatricopeptide repeat...  60.8    5e-08   
ref|XP_002319950.1|  hypothetical protein POPTR_0013s14820g           60.8    5e-08   
emb|CDX79839.1|  BnaA05g03170D                                        60.5    6e-08   
ref|XP_010090943.1|  hypothetical protein L484_007578                 60.5    6e-08   
ref|XP_010423113.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    6e-08   
emb|CAN62155.1|  hypothetical protein VITISV_032407                   60.5    6e-08   
ref|XP_006293939.1|  hypothetical protein CARUB_v10022931mg           60.5    6e-08   
ref|XP_009624280.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    6e-08   
gb|KGN45255.1|  hypothetical protein Csa_7G432370                     60.8    6e-08   
ref|XP_010272458.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    6e-08   
ref|XP_010051238.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    6e-08   
ref|XP_004150015.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    6e-08   
ref|XP_006364580.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    6e-08   
ref|XP_009142893.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    6e-08   
ref|XP_007155292.1|  hypothetical protein PHAVU_003G188600g           60.5    6e-08   
ref|XP_010429162.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    7e-08   
tpg|DAA57121.1|  TPA: putative NAC domain and pentatricopeptide r...  60.8    7e-08   
ref|XP_007156866.1|  hypothetical protein PHAVU_002G024100g           60.5    7e-08   
ref|XP_010662774.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    7e-08   
ref|XP_002880012.1|  pentatricopeptide repeat-containing protein      60.5    7e-08   
ref|NP_197034.2|  pentatricopeptide repeat-containing protein         60.5    7e-08   
ref|XP_009151793.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    7e-08   
ref|XP_010029354.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    7e-08   
ref|XP_011020996.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    7e-08   
ref|XP_010258291.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    7e-08   
ref|XP_007029178.1|  Pentatricopeptide repeat (PPR) superfamily p...  60.5    7e-08   
ref|XP_007226900.1|  hypothetical protein PRUPE_ppa016366mg           60.5    7e-08   
ref|XP_008806168.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    7e-08   
ref|XP_009766763.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    7e-08   
ref|XP_007219543.1|  hypothetical protein PRUPE_ppa022784mg           60.1    7e-08   
ref|XP_006573426.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    8e-08   
ref|XP_004233812.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    8e-08   
ref|XP_009360575.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    8e-08   
ref|XP_010425378.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    8e-08   
ref|XP_006481967.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    8e-08   
ref|XP_008787091.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    8e-08   
emb|CDP13054.1|  unnamed protein product                              60.1    8e-08   
ref|XP_007038050.1|  Tetratricopeptide repeat (TPR)-like superfam...  60.1    8e-08   
ref|XP_008446357.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    8e-08   
ref|XP_008220011.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    8e-08   
gb|ACU21153.1|  unknown                                               60.1    9e-08   
ref|XP_008374571.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    9e-08   
ref|XP_003516589.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    9e-08   
ref|XP_002283796.2|  PREDICTED: pentatricopeptide repeat-containi...  60.1    9e-08   
ref|XP_003545143.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    9e-08   
ref|XP_002887548.1|  hypothetical protein ARALYDRAFT_339650           60.5    9e-08   
ref|XP_002876985.1|  pentatricopeptide repeat-containing protein      59.7    9e-08   
ref|XP_006438782.1|  hypothetical protein CICLE_v10033549mg           60.1    9e-08   



>emb|CDP02835.1| unnamed protein product [Coffea canephora]
Length=793

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 108/142 (76%), Gaps = 2/142 (1%)
 Frame = -3

Query  422  MICRAAAATVL--RDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSD  249
            MICRA AA     RDRNFFLSL+    NLSQLNQTHAQ+ILNGL  DLIA+TKLT +  D
Sbjct  1    MICRAIAAAAAPQRDRNFFLSLLKSTTNLSQLNQTHAQVILNGLSKDLIAITKLTHKLFD  60

Query  248  LNAIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFT  69
            + AI+ AKL+F + +   PPD FLYNV++RGFSQN SP DSLS+Y HLR KT L+PDNFT
Sbjct  61   VKAISQAKLLFTSLSNQIPPDKFLYNVLIRGFSQNKSPLDSLSVYAHLREKTTLRPDNFT  120

Query  68   YAFVVSGVSSSGYEKFGGLLHG  3
            YAFVVS VSS   EK G LLHG
Sbjct  121  YAFVVSAVSSPELEKVGILLHG  142



>ref|XP_006343621.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006343622.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
isoform X2 [Solanum tuberosum]
Length=791

 Score =   174 bits (442),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            MI R  A+   RDRNFF+SLI +A  LSQLNQ HA LI NGL NDLI +TKLT +FSD  
Sbjct  1    MIYRTIASIAQRDRNFFISLINQATTLSQLNQIHANLIRNGLSNDLITITKLTHKFSDFK  60

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            +I+ AK +F  FN  +PPDLFLYNV++RG S+N    ++LS+YL L   +KLKPDNFT+A
Sbjct  61   SISKAKNLFTTFNNTNPPDLFLYNVLIRGLSRNGLGVEALSLYLDLLKGSKLKPDNFTFA  120

Query  62   FVVSGVSSSGYEKFGGLLHG  3
            FVVSG SSSG EK G L+HG
Sbjct  121  FVVSGFSSSGCEKVGILIHG  140



>ref|XP_009622820.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Nicotiana tomentosiformis]
Length=791

 Score =   173 bits (439),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 83/140 (59%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            MI R  A+   RDR+FF+SLI +A  LS LNQTHA LI + L  DLI +TKLT +  D  
Sbjct  1    MIYRTIASIAQRDRSFFVSLINQATTLSHLNQTHAHLIRHSLSTDLITITKLTHKLFDFK  60

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            AI+ AK +F  FN  +PPDLFLYNV++RG+S+NN PF+SL +YL L   T+L+PDNFT+A
Sbjct  61   AISKAKNVFTTFNKTNPPDLFLYNVLIRGYSKNNLPFESLQLYLQLIKNTRLRPDNFTFA  120

Query  62   FVVSGVSSSGYEKFGGLLHG  3
            FVVS  SSSGYEK G L+HG
Sbjct  121  FVVSAFSSSGYEKVGILIHG  140



>ref|XP_009777622.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Nicotiana sylvestris]
 ref|XP_009777623.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Nicotiana sylvestris]
Length=791

 Score =   172 bits (435),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 83/140 (59%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            MI R  A+   RDR+FF+SLI +A  LSQLNQTHA LI + L  DLI +TKLT +F D  
Sbjct  1    MIYRTIASIAQRDRSFFVSLINQATTLSQLNQTHAHLIRHSLSTDLITITKLTHKFFDFK  60

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            AI+ AK +F  FN  +PPDLFLYNV++RG+S+NN PF+SLS+YL L   T LKPDNFT+A
Sbjct  61   AISKAKNLFTTFNKTNPPDLFLYNVLIRGYSKNNLPFESLSLYLQLIKNTTLKPDNFTFA  120

Query  62   FVVSGVSSSGYEKFGGLLHG  3
            F+VS   S+ YEK G L+HG
Sbjct  121  FIVSAFCSNEYEKIGILIHG  140



>ref|XP_008243021.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Prunus mume]
Length=788

 Score =   159 bits (402),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 80/141 (57%), Positives = 100/141 (71%), Gaps = 4/141 (3%)
 Frame = -3

Query  422  MICR-AAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDL  246
            MICR  ++    RDRNFFLSL++KA +LS L QTHAQ+ILNG  +DL AVTKLT +FSDL
Sbjct  1    MICRNISSCYAQRDRNFFLSLLSKATSLSHLTQTHAQIILNGYQDDLAAVTKLTHKFSDL  60

Query  245  NAIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTY  66
             AI H++ +F +   +  PDLFL+NV++RGF+ N SP  SLS+Y HLR  T L PD FTY
Sbjct  61   KAIRHSRDLFLS---IPKPDLFLFNVLIRGFASNASPLSSLSLYTHLRKNTSLNPDKFTY  117

Query  65   AFVVSGVSSSGYEKFGGLLHG  3
            AF +S  S    EK+G LLH 
Sbjct  118  AFAISAASGFKDEKYGLLLHA  138



>ref|XP_004242990.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Solanum lycopersicum]
Length=791

 Score =   157 bits (397),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 85/140 (61%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            MI R  A+   RDRNFF+SLI +A  LSQLNQ HA LI NGL NDLI +TKLT +FSD  
Sbjct  1    MIYRTIASIAQRDRNFFISLINQATTLSQLNQLHANLIRNGLSNDLITITKLTHKFSDFK  60

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            +I+ AK +F  FN  +PPDLFLYNV++RG S+N    ++LS+YL L    KLKPDNFT+A
Sbjct  61   SISKAKNLFTTFNNTNPPDLFLYNVLIRGLSRNGLGVEALSLYLDLLKGNKLKPDNFTFA  120

Query  62   FVVSGVSSSGYEKFGGLLHG  3
            FVVS  SSSG EK G L+HG
Sbjct  121  FVVSSFSSSGCEKVGILIHG  140



>ref|XP_009366209.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Pyrus x bretschneideri]
Length=789

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 95/138 (69%), Gaps = 7/138 (5%)
 Frame = -3

Query  416  CRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAI  237
            CRA       DRNFFL L+ KA  LS L QTHAQ+ILNG  NDL AVTKLT +FSDL A+
Sbjct  9    CRAPQL----DRNFFLGLLNKATCLSHLTQTHAQIILNGYQNDLAAVTKLTHKFSDLKAM  64

Query  236  AHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFV  57
             HA+ +F +   +  PDLFL+NVV+RGF+ N +PF ++S+Y HLR  T LKPD FTYAF 
Sbjct  65   RHARDLFLS---IPRPDLFLFNVVIRGFAANAAPFSAISLYTHLRKNTNLKPDKFTYAFA  121

Query  56   VSGVSSSGYEKFGGLLHG  3
            VS  S    EK+G LLH 
Sbjct  122  VSAASGFKDEKYGILLHA  139



>ref|XP_008362867.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Malus domestica]
Length=789

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 95/138 (69%), Gaps = 7/138 (5%)
 Frame = -3

Query  416  CRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAI  237
            CRA       DRNFFL L+ KA  LS L QTHAQ+ILNG  NDL  VTKLT +FSDL A+
Sbjct  9    CRAPQL----DRNFFLGLLNKATCLSHLTQTHAQIILNGYQNDLATVTKLTHKFSDLKAM  64

Query  236  AHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFV  57
             HA+ +F +   ++ PDLFL+NVV+RGF+ N +PF ++S+Y HLR  T LKPD FTYAF 
Sbjct  65   RHARDLFLS---IARPDLFLFNVVIRGFAANAAPFSAISLYTHLRKNTNLKPDKFTYAFA  121

Query  56   VSGVSSSGYEKFGGLLHG  3
            VS  S    EK+G LLH 
Sbjct  122  VSAASGFKDEKYGVLLHA  139



>ref|XP_009358417.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Pyrus x bretschneideri]
Length=789

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 94/138 (68%), Gaps = 7/138 (5%)
 Frame = -3

Query  416  CRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAI  237
            CRA       DRNFFL L+ K   LSQL QTHAQ+ILNG  NDL  VTKLT +FSDL A+
Sbjct  9    CRAPQF----DRNFFLGLLNKVTCLSQLTQTHAQIILNGYQNDLATVTKLTHKFSDLKAM  64

Query  236  AHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFV  57
             +A+ +F +   +  PDLFL+NVV+RGF+ N +PF ++S+Y HLR  T LKPD FTYAF 
Sbjct  65   RNARDLFLS---IPRPDLFLFNVVIRGFAANAAPFSAISLYTHLRKNTNLKPDKFTYAFA  121

Query  56   VSGVSSSGYEKFGGLLHG  3
            VS  S    EK+G LLH 
Sbjct  122  VSAASGFKDEKYGILLHA  139



>ref|XP_004288724.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Fragaria vesca subsp. vesca]
Length=790

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 89/129 (69%), Gaps = 3/129 (2%)
 Frame = -3

Query  389  RDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNA  210
            RDRN FLS++ KA  LS L QTHAQ+ILNG  NDL+ +TKLT +FSDL AI HA+ +  +
Sbjct  15   RDRNLFLSILKKATTLSHLTQTHAQIILNGYQNDLVIITKLTHKFSDLKAIRHARDLVFS  74

Query  209  FNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGY  30
            F     PDLFL+NV+++GF+ N SP  S+S+Y HLR  T L PD +TYAF VS  S    
Sbjct  75   F---PKPDLFLFNVLIKGFAANASPLSSVSLYTHLRKNTTLSPDKYTYAFAVSAASGFND  131

Query  29   EKFGGLLHG  3
            EK G LLH 
Sbjct  132  EKHGALLHA  140



>ref|XP_004152852.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Cucumis sativus]
Length=788

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 94/140 (67%), Gaps = 3/140 (2%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            MIC   A + +R + FFL+L+  A  LSQL Q  AQLIL+G+  DL ++TKLT +F DL 
Sbjct  1    MICTNTATSAIRGQRFFLTLLNNATTLSQLLQIQAQLILHGIHYDLSSITKLTHKFFDLG  60

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            A+AH + +FN    VS PDLFL+NV++RGFS N  P  S+ +Y HLR KT L+PDNFTYA
Sbjct  61   AVAHVRQLFNK---VSKPDLFLFNVLIRGFSDNGLPKSSIFLYTHLRKKTNLRPDNFTYA  117

Query  62   FVVSGVSSSGYEKFGGLLHG  3
            F +S  S    E+ G LLH 
Sbjct  118  FAISAASRLEDERVGVLLHA  137



>ref|XP_008394295.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Malus domestica]
Length=789

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 93/138 (67%), Gaps = 7/138 (5%)
 Frame = -3

Query  416  CRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAI  237
            CRA       DRNFFL L+  A  LS L QTHAQ+ILNG  NDL  VTKLT +FSDL A+
Sbjct  9    CRAPKF----DRNFFLGLLNNATCLSHLTQTHAQIILNGYQNDLATVTKLTHKFSDLKAM  64

Query  236  AHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFV  57
             +A+ +F +   +  PDLFL+NVV+RGF+ N +P+ ++S+Y HLR  T LKPD FTYAF 
Sbjct  65   RNARDLFLS---IPRPDLFLFNVVIRGFAANAAPYSAISLYTHLRKNTNLKPDKFTYAFA  121

Query  56   VSGVSSSGYEKFGGLLHG  3
            VS  S    EK+G LLH 
Sbjct  122  VSAXSGFKDEKYGILLHA  139



>ref|XP_010273675.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
isoform X1 [Nelumbo nucifera]
Length=788

 Score =   141 bits (356),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 77/140 (55%), Positives = 100/140 (71%), Gaps = 3/140 (2%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            MICR   ++    RN FL+LI KA+ ++Q NQ HAQ+ILNGL NDLI VTKLTQ+ +D  
Sbjct  1    MICRNLISSTAPSRNIFLNLIGKASTINQFNQIHAQVILNGLHNDLITVTKLTQKLADFG  60

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            AI  A L+F+    +S PDLFL+NV++RGFS N+S   ++S+Y HLR  T LKPDNFTYA
Sbjct  61   AIDQAHLLFST---ISEPDLFLFNVLIRGFSLNSSSSSAISLYSHLRRNTSLKPDNFTYA  117

Query  62   FVVSGVSSSGYEKFGGLLHG  3
            F +S  SS G ++ G +LHG
Sbjct  118  FAISASSSLGSKETGRILHG  137



>ref|XP_004163058.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g30700-like [Cucumis sativus]
Length=788

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 93/140 (66%), Gaps = 3/140 (2%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            MIC   A + +R + FFL+L+  A  LSQL Q  AQLIL+G+  DL ++TKLT +F DL 
Sbjct  1    MICTNTATSAIRGQRFFLTLLNNATTLSQLLQIQAQLILHGIHYDLSSITKLTHKFFDLG  60

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            A+AH + +FN    VS PDLFL+NV++RGFS N  P  S+ +Y HLR  T L+PDNFTYA
Sbjct  61   AVAHVRQLFNK---VSKPDLFLFNVLIRGFSDNGLPKSSIFLYTHLRKXTNLRPDNFTYA  117

Query  62   FVVSGVSSSGYEKFGGLLHG  3
            F +S  S    E+ G LLH 
Sbjct  118  FAISAASRLEDERVGVLLHA  137



>ref|XP_010273676.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
isoform X2 [Nelumbo nucifera]
Length=786

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 100/140 (71%), Gaps = 3/140 (2%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            MICR   ++    RN FL+LI KA+ ++Q NQ HAQ+ILNGL NDLI VTKLTQ+ +D  
Sbjct  1    MICRNLISSTAPSRNIFLNLIGKASTINQFNQIHAQVILNGLHNDLITVTKLTQKLADFG  60

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            AI  A L+F+    +S PDLFL+NV++RGFS N+S   ++S+Y HLR  T LKPDNFTYA
Sbjct  61   AIDQAHLLFST---ISEPDLFLFNVLIRGFSLNSSSSSAISLYSHLRRNTSLKPDNFTYA  117

Query  62   FVVSGVSSSGYEKFGGLLHG  3
            F +S  SS G ++ G +LHG
Sbjct  118  FAISASSSLGSKETGRILHG  137



>ref|XP_011079379.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Sesamum indicum]
Length=784

 Score =   138 bits (347),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 77/132 (58%), Positives = 91/132 (69%), Gaps = 8/132 (6%)
 Frame = -3

Query  389  RDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNA  210
            RD NFFLSLI KA  L  LNQ HA +I + L ND I +TKL QR  DL A A AKL+F +
Sbjct  7    RDTNFFLSLIKKAVTLPHLNQIHAYIIHSNLVNDNIIITKLIQRLLDLKATARAKLLFAS  66

Query  209  FNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVV---SGVSS  39
               V+ PDLFLYNV+++G    NSPF+SLS+Y  L  KT  KPDNFTY+FV+   SG+ S
Sbjct  67   ---VASPDLFLYNVLIKGL--RNSPFESLSVYNSLLSKTGFKPDNFTYSFVIAAFSGLPS  121

Query  38   SGYEKFGGLLHG  3
            SG EK G LLHG
Sbjct  122  SGSEKVGVLLHG  133



>ref|XP_008450522.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Cucumis melo]
Length=788

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 91/140 (65%), Gaps = 3/140 (2%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            MIC     + +R + FFL+L+  A  L QL Q  AQLIL+G+  DL ++TKLT +F DL 
Sbjct  1    MICTNTTTSAIRGQKFFLTLLNNATTLPQLLQIQAQLILHGIQYDLSSITKLTHKFFDLG  60

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            A+ H + +FN    VS PDLFL+NV++RGFS N  P  S+ +Y HLR +T L+PDNFTYA
Sbjct  61   AVVHVRQLFNK---VSKPDLFLFNVLIRGFSDNGLPKSSIFLYTHLRKRTNLRPDNFTYA  117

Query  62   FVVSGVSSSGYEKFGGLLHG  3
            F +S  S    E+ G LLH 
Sbjct  118  FAISAASRLEDERVGVLLHA  137



>emb|CBI36552.3| unnamed protein product [Vitis vinifera]
Length=726

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 88/123 (72%), Gaps = 7/123 (6%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            M+ R  A+T    RN FL+LI + + L QLNQTHAQ+ILNGL NDL+ VTKLT + S L 
Sbjct  1    MLYRGIAST----RNLFLTLINRVSTLHQLNQTHAQIILNGLHNDLVTVTKLTHKLSHLK  56

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            AI  A L+F+    +  PDLFLYNV++R FS NNSP  ++S+Y HLR  T L+PDNFTYA
Sbjct  57   AIDQASLLFST---IPNPDLFLYNVLIRAFSLNNSPSSAVSLYTHLRKSTPLEPDNFTYA  113

Query  62   FVV  54
            FV+
Sbjct  114  FVI  116



>ref|XP_002275298.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Vitis vinifera]
Length=781

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 88/123 (72%), Gaps = 7/123 (6%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            M+ R  A+T    RN FL+LI + + L QLNQTHAQ+ILNGL NDL+ VTKLT + S L 
Sbjct  1    MLYRGIAST----RNLFLTLINRVSTLHQLNQTHAQIILNGLHNDLVTVTKLTHKLSHLK  56

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            AI  A L+F+    +  PDLFLYNV++R FS NNSP  ++S+Y HLR  T L+PDNFTYA
Sbjct  57   AIDQASLLFST---IPNPDLFLYNVLIRAFSLNNSPSSAVSLYTHLRKSTPLEPDNFTYA  113

Query  62   FVV  54
            FV+
Sbjct  114  FVI  116



>ref|XP_010684217.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Beta vulgaris subsp. vulgaris]
Length=789

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 97/142 (68%), Gaps = 6/142 (4%)
 Frame = -3

Query  422  MICRA-AAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDL  246
            M+ RA  +AT+  +RNFFL+LI+K+   + L Q HAQ+I+N L +D I VTKLTQ+  D+
Sbjct  1    MLNRAIVSATLTCERNFFLNLISKSTTFTNLKQIHAQIIINSLNSDNITVTKLTQKLCDI  60

Query  245  NAIAHAKLIFNAFNCVSP-PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFT  69
             A+ HA L+ +A    +P PD+FLYNV++RGFS N  P  S+ +Y  LR  T +KP+NFT
Sbjct  61   GAVHHANLLVSA----TPNPDIFLYNVLIRGFSHNYLPSSSVLVYARLRRNTTIKPNNFT  116

Query  68   YAFVVSGVSSSGYEKFGGLLHG  3
            YAF +S   S GYEK G LLH 
Sbjct  117  YAFGISASGSLGYEKIGMLLHA  138



>ref|XP_010689303.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Beta vulgaris subsp. vulgaris]
Length=789

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 6/142 (4%)
 Frame = -3

Query  422  MICRA-AAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDL  246
            M+ RA  +AT   +RNFFL+LI+K+   + L Q HAQ+I+N L +D I VTKLTQ+  D+
Sbjct  1    MLNRAIVSATSTCERNFFLNLISKSTTFTNLKQIHAQIIVNSLNSDTITVTKLTQKLCDI  60

Query  245  NAIAHAKLIFNAFNCVSP-PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFT  69
             A+ HA L+ +A    +P PD+FLYNV++RGFS N  P  S+ +Y  LR  T +KP+NFT
Sbjct  61   GAVHHANLLVSA----TPNPDIFLYNVLIRGFSHNYLPSSSVLVYDRLRRNTTIKPNNFT  116

Query  68   YAFVVSGVSSSGYEKFGGLLHG  3
            YAF +S   S GYEK G LLH 
Sbjct  117  YAFGISASGSLGYEKIGMLLHA  138



>gb|KGN61216.1| hypothetical protein Csa_2G070330 [Cucumis sativus]
Length=784

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 87/128 (68%), Gaps = 3/128 (2%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAF  207
            +  FFL+L+  A  LSQL Q  AQLIL+G+  DL ++TKLT +F DL A+AH + +FN  
Sbjct  9    EEGFFLTLLNNATTLSQLLQIQAQLILHGIHYDLSSITKLTHKFFDLGAVAHVRQLFNK-  67

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
              VS PDLFL+NV++RGFS N  P  S+ +Y HLR KT L+PDNFTYAF +S  S    E
Sbjct  68   --VSKPDLFLFNVLIRGFSDNGLPKSSIFLYTHLRKKTNLRPDNFTYAFAISAASRLEDE  125

Query  26   KFGGLLHG  3
            + G LLH 
Sbjct  126  RVGVLLHA  133



>ref|XP_011033388.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Populus euphratica]
 ref|XP_011033389.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Populus euphratica]
Length=800

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = -3

Query  389  RDRNFFLSLITKAANLSQLNQTHAQLILNGLG-NDLIAVTKLTQRFSDLNAIAHAKLIFN  213
            R R+FF++L+ KAA LS L Q  AQLI + L  ND+   TKLT +F D NA  HA+ +F 
Sbjct  22   RTRDFFINLLRKAATLSHLTQLQAQLIHHSLLLNDISITTKLTHKFFDFNATLHARALFF  81

Query  212  AFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSG  33
            +   V  PDLFL+NV+++GFS NN P  ++S++ HLR  T+LKPD+++YAFVVS  +S G
Sbjct  82   S---VPKPDLFLFNVLIKGFSTNNKPLSAISLFTHLRKSTRLKPDDYSYAFVVSAAASLG  138

Query  32   YEKFGGLLHG  3
              + GG+LHG
Sbjct  139  DARIGGILHG  148



>gb|KCW78811.1| hypothetical protein EUGRSUZ_C00245 [Eucalyptus grandis]
Length=735

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 90/135 (67%), Gaps = 3/135 (2%)
 Frame = -3

Query  410  AAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAH  231
            A  A + R+RNFFLSL+  +  LS L Q HAQ+I+ G  ND+  VTKLT +  DL AI +
Sbjct  6    ALPAALERNRNFFLSLLNASTTLSHLAQAHAQIIVGGYRNDISTVTKLTHKLCDLRAIGY  65

Query  230  AKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVS  51
            A+ +F +   VS PDLFL+NVV++G+S N SP  S+S++ HLR  T L+PDNFTY F VS
Sbjct  66   ARDLFLS---VSKPDLFLFNVVIKGYSTNGSPRSSMSLFAHLRKNTGLRPDNFTYFFAVS  122

Query  50   GVSSSGYEKFGGLLH  6
              +    EK G +LH
Sbjct  123  ASAGFRDEKVGTVLH  137



>ref|XP_010047061.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Eucalyptus grandis]
Length=790

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 90/135 (67%), Gaps = 3/135 (2%)
 Frame = -3

Query  410  AAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAH  231
            A  A + R+RNFFLSL+  +  LS L Q HAQ+I+ G  ND+  VTKLT +  DL AI +
Sbjct  6    ALPAALERNRNFFLSLLNASTTLSHLAQAHAQIIVGGYRNDISTVTKLTHKLCDLRAIGY  65

Query  230  AKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVS  51
            A+ +F +   VS PDLFL+NVV++G+S N SP  S+S++ HLR  T L+PDNFTY F VS
Sbjct  66   ARDLFLS---VSKPDLFLFNVVIKGYSTNGSPRSSMSLFAHLRKNTGLRPDNFTYFFAVS  122

Query  50   GVSSSGYEKFGGLLH  6
              +    EK G +LH
Sbjct  123  ASAGFRDEKVGTVLH  137



>gb|KDO62295.1| hypothetical protein CISIN_1g044131mg [Citrus sinensis]
Length=784

 Score =   130 bits (328),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 65/129 (50%), Positives = 82/129 (64%), Gaps = 3/129 (2%)
 Frame = -3

Query  389  RDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNA  210
            + RN FLSL+  A   SQL QTHAQ+I++G  NDL  VTKL  R SD  A  +A+ +F +
Sbjct  7    QSRNLFLSLLKGAKTQSQLTQTHAQIIIHGFQNDLSTVTKLAHRLSDFKATCYARALFFS  66

Query  209  FNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGY  30
               +  PDLFL+NV++RGFS N  P  S+  Y HLR  T L PDNFTY+FV+S  S+   
Sbjct  67   ---IPKPDLFLFNVIIRGFSNNEMPKSSICFYTHLRKNTALTPDNFTYSFVLSAASACCD  123

Query  29   EKFGGLLHG  3
               G LLHG
Sbjct  124  RSIGVLLHG  132



>ref|XP_006474049.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Citrus sinensis]
Length=784

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 82/129 (64%), Gaps = 3/129 (2%)
 Frame = -3

Query  389  RDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNA  210
            + RN FLSL+  A   SQL QTHAQ+I++G  NDL  VTKL  R SD  A  +A+ +F +
Sbjct  7    QSRNLFLSLLKGAKTQSQLTQTHAQIIIHGFQNDLSTVTKLAHRLSDFKATCYARALFFS  66

Query  209  FNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGY  30
               +  PDLFL+NV++RGFS N  P  S+  Y HLR  T L PDNFTY+FV+S  S+   
Sbjct  67   ---IPKPDLFLFNVIIRGFSNNEMPKSSICFYTHLRKNTALTPDNFTYSFVLSAASACCD  123

Query  29   EKFGGLLHG  3
               G LLHG
Sbjct  124  RSIGVLLHG  132



>ref|XP_010447678.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Camelina sativa]
Length=790

 Score =   129 bits (325),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 93/139 (67%), Gaps = 3/139 (2%)
 Frame = -3

Query  419  ICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA  240
            +  A A T +  +N FL L  ++ ++S L QTHAQ+IL+G  ND+  +TKLTQR SDL A
Sbjct  6    VSAATAETTVASKNNFLDLFKRSTSVSHLAQTHAQIILHGFRNDISLLTKLTQRLSDLGA  65

Query  239  IAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAF  60
            I +A+ +F +   V  PD+FL+NV++RGFS N SP  SLS++ HLR  T LKP++ TYAF
Sbjct  66   IYYARDLFLS---VRRPDVFLFNVLMRGFSVNESPHSSLSVFAHLRKSTDLKPNSSTYAF  122

Query  59   VVSGVSSSGYEKFGGLLHG  3
             +S  S    E+ G ++HG
Sbjct  123  AISAASGFRDERAGCVIHG  141



>ref|XP_006453556.1| hypothetical protein CICLE_v10007511mg [Citrus clementina]
 gb|ESR66796.1| hypothetical protein CICLE_v10007511mg [Citrus clementina]
Length=784

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 82/129 (64%), Gaps = 3/129 (2%)
 Frame = -3

Query  389  RDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNA  210
            + RN FLSL+  A   SQL QTHAQ+I++G  NDL  VTKL  R SD  A  +A+ +F +
Sbjct  7    QSRNLFLSLLKGAKTQSQLTQTHAQIIIHGFQNDLSTVTKLAHRLSDFKATCYARALFFS  66

Query  209  FNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGY  30
               +  PDLFL+NV++RGFS N  P  S+  Y HLR  T L PDNFTY+FV+S  S+   
Sbjct  67   ---IPKPDLFLFNVIIRGFSNNEMPKSSICFYTHLRKNTALTPDNFTYSFVLSAASACCD  123

Query  29   EKFGGLLHG  3
               G LLHG
Sbjct  124  RSIGVLLHG  132



>ref|XP_010438137.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Camelina sativa]
Length=790

 Score =   128 bits (321),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 92/139 (66%), Gaps = 3/139 (2%)
 Frame = -3

Query  419  ICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA  240
            +  A A T +  +N FL L  ++ ++S L QTHAQ+IL G  ND+  +TKLTQR SDL A
Sbjct  6    VSAATAETTVASKNNFLDLFKRSTSVSHLAQTHAQIILYGFRNDISLLTKLTQRLSDLGA  65

Query  239  IAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAF  60
            I +A+ +F +   V  PD+FL+NV++RGFS N SP  SLS++ HLR  T LKP++ TYAF
Sbjct  66   IYYARDLFLS---VRRPDVFLFNVLMRGFSVNESPHSSLSVFAHLRKSTDLKPNSSTYAF  122

Query  59   VVSGVSSSGYEKFGGLLHG  3
             +S  S    E+ G ++HG
Sbjct  123  AISAASGFRDERAGCVIHG  141



>ref|XP_010432951.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Camelina sativa]
Length=790

 Score =   128 bits (321),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 93/139 (67%), Gaps = 3/139 (2%)
 Frame = -3

Query  419  ICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA  240
            +  A A T +  +N FL L  ++ ++S L QTHAQ+IL+G  ND+  +TKLTQR SDL A
Sbjct  6    VSAATAETTVASKNNFLDLFKRSTSVSHLAQTHAQIILHGFRNDISLLTKLTQRLSDLGA  65

Query  239  IAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAF  60
            I +A+ +F +   V  PD+FL+NV++RGFS N SP  SLS++ HLR  T LKP++ TYAF
Sbjct  66   IYYARDLFLS---VRRPDVFLFNVLMRGFSVNESPHFSLSVFAHLRKSTDLKPNSSTYAF  122

Query  59   VVSGVSSSGYEKFGGLLHG  3
             +S  S    E+ G ++HG
Sbjct  123  AISAASGFHDERAGCVIHG  141



>ref|XP_007013861.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOY31480.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=801

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 90/135 (67%), Gaps = 7/135 (5%)
 Frame = -3

Query  410  AAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAH  231
            A+  +  R RNFFL+L+ K+  L QL QTHAQLILNG  NDL  +TKLT R  DLNA ++
Sbjct  21   ASTYSPTRSRNFFLNLLKKSTTLPQLTQTHAQLILNGFRNDLSTITKLTHRLFDLNATSY  80

Query  230  AKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVS  51
            A+   + F  +  PDLFL+NV+++GFS  +    S+S+Y HLR  T+L PDNFTYAF ++
Sbjct  81   AR---DVFLSIPNPDLFLFNVLIKGFSNTH----SISLYTHLRKCTRLNPDNFTYAFAIA  133

Query  50   GVSSSGYEKFGGLLH  6
              S+   EK G  L+
Sbjct  134  SASTLSDEKVGMFLY  148



>gb|KDP38705.1| hypothetical protein JCGZ_04058 [Jatropha curcas]
Length=791

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 88/135 (65%), Gaps = 3/135 (2%)
 Frame = -3

Query  407  AAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA  228
            A   V R R FFL+ + K+  LS L Q HAQL+L+GL +DL   TKLT +  D ++  HA
Sbjct  8    AITCVPRTRYFFLNFLNKSTTLSHLTQLHAQLLLSGLQDDLAVATKLTHKLFDFSSTHHA  67

Query  227  KLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSG  48
            + +F     V  PDLFL+NV+++G S NNSP  ++S++ HLR  T L PDNFTYAF++S 
Sbjct  68   RALFFT---VPKPDLFLFNVLIKGLSVNNSPLSAISIFTHLRKSTDLYPDNFTYAFIISA  124

Query  47   VSSSGYEKFGGLLHG  3
             +S G  + G +LHG
Sbjct  125  ATSFGDMRVGLVLHG  139



>ref|XP_010091160.1| hypothetical protein L484_013952 [Morus notabilis]
 gb|EXB42930.1| hypothetical protein L484_013952 [Morus notabilis]
Length=781

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 84/126 (67%), Gaps = 3/126 (2%)
 Frame = -3

Query  383  RNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFN  204
            RNF + ++  A  L +L+QTHAQ I++GL NDL  +TKLT + SDL AI  A    + F 
Sbjct  8    RNFLVGILKTAGTLPELSQTHAQAIVHGLQNDLAFLTKLTHKLSDLKAIRQA---CDLFL  64

Query  203  CVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEK  24
             V  PDLFL+NV+L+GFS N SPF ++S+Y HLR  T L PD FTYAF VS  SS    +
Sbjct  65   TVPNPDLFLFNVLLKGFSTNKSPFSAISLYTHLRINTSLVPDEFTYAFAVSAASSFKDPR  124

Query  23   FGGLLH  6
            +G LLH
Sbjct  125  YGILLH  130



>ref|NP_194799.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SUH6.1|PP341_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g30700; 
AltName: Full=Protein DYW9 [Arabidopsis thaliana]
 emb|CAB52443.1| putative protein [Arabidopsis thaliana]
 emb|CAB79788.1| putative protein [Arabidopsis thaliana]
 gb|AEE85798.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=792

 Score =   124 bits (312),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 89/136 (65%), Gaps = 3/136 (2%)
 Frame = -3

Query  410  AAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAH  231
            A     L  +N +L    ++ ++S L QTHAQ+IL+G  ND+  +TKLTQR SDL AI +
Sbjct  11   AETTAALISKNTYLDFFKRSTSISHLAQTHAQIILHGFRNDISLLTKLTQRLSDLGAIYY  70

Query  230  AKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVS  51
            A+ IF +   V  PD+FL+NV++RGFS N SP  SLS++ HLR  T LKP++ TYAF +S
Sbjct  71   ARDIFLS---VQRPDVFLFNVLMRGFSVNESPHSSLSVFAHLRKSTDLKPNSSTYAFAIS  127

Query  50   GVSSSGYEKFGGLLHG  3
              S    ++ G ++HG
Sbjct  128  AASGFRDDRAGRVIHG  143



>gb|EYU34329.1| hypothetical protein MIMGU_mgv1a001967mg [Erythranthe guttata]
Length=732

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 85/129 (66%), Gaps = 7/129 (5%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            MICRA +    RDRNFFLSLI +A  +S L+QTHAQ+I N L  D I +TKL Q+  D  
Sbjct  1    MICRAISPP--RDRNFFLSLIKQATTISHLDQTHAQIIHNNLVTDNITITKLIQKLLDFK  58

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            +   AKL+F+       PDLFLYNV+++G    NSPFDSL MY  L  K   +PDNFTY+
Sbjct  59   SHVRAKLLFSN---TDSPDLFLYNVLIKGL--RNSPFDSLCMYRSLLQKHGFEPDNFTYS  113

Query  62   FVVSGVSSS  36
            FV++ +S +
Sbjct  114  FVIAALSDT  122



>ref|XP_002867333.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH43592.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=792

 Score =   123 bits (309),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 62/130 (48%), Positives = 89/130 (68%), Gaps = 3/130 (2%)
 Frame = -3

Query  392  LRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFN  213
            L  +N FL L  ++ ++S L QTHAQ++L+G  ND+  +TKLTQR SDL AI +A+ IF 
Sbjct  17   LISKNNFLDLFKRSTSISHLAQTHAQIVLHGFRNDISLLTKLTQRLSDLGAIYYARDIFL  76

Query  212  AFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSG  33
            +   V  PD+FL+NV++RGFS N SP  SL+++ HLR  T LKP++ TYAF +S  S   
Sbjct  77   S---VQRPDVFLFNVLMRGFSVNESPHSSLAVFAHLRKSTDLKPNSSTYAFAISAASGFR  133

Query  32   YEKFGGLLHG  3
             ++ G ++HG
Sbjct  134  DDRAGCVIHG  143



>ref|XP_006285932.1| hypothetical protein CARUB_v10007444mg [Capsella rubella]
 gb|EOA18830.1| hypothetical protein CARUB_v10007444mg [Capsella rubella]
Length=790

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 63/139 (45%), Positives = 93/139 (67%), Gaps = 3/139 (2%)
 Frame = -3

Query  419  ICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA  240
            +  A A T +  +N FL L  ++ +++ L QTHAQ+I++G   D+  +TKLTQR SDL A
Sbjct  6    VSAATAETTVASKNNFLDLFKRSTSVAHLAQTHAQVIVHGFRYDISLLTKLTQRLSDLGA  65

Query  239  IAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAF  60
            I +A+ +F +   V  PD+FL+NV++RGFS N SP  SLS++ HLR  T+LKP++ TYAF
Sbjct  66   IYYARDLFLS---VRRPDVFLFNVLMRGFSVNESPHSSLSVFAHLRKSTELKPNSSTYAF  122

Query  59   VVSGVSSSGYEKFGGLLHG  3
             +S  S    E+ G ++HG
Sbjct  123  AISAASGLRDERPGCVIHG  141



>gb|KFK29652.1| hypothetical protein AALP_AA7G161100 [Arabis alpina]
Length=736

 Score =   119 bits (299),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 63/133 (47%), Positives = 91/133 (68%), Gaps = 5/133 (4%)
 Frame = -3

Query  401  ATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKL  222
            ATV+ ++NFF  L  ++ +LS L QTHAQ+IL+G   D+  +TKLTQR SDL A+ +A+ 
Sbjct  16   ATVI-NKNFF-DLFKRSTSLSHLTQTHAQIILHGFQYDISLLTKLTQRLSDLGAMYYARD  73

Query  221  IFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS  42
            IF +   V  PD+FL+NV++RGFS+N SP  SLS++ HLR  T LKP++ TY + +S  S
Sbjct  74   IFLS---VQKPDVFLFNVLMRGFSKNESPHTSLSVFTHLRKSTDLKPNSTTYTYAISAAS  130

Query  41   SSGYEKFGGLLHG  3
                E+   ++HG
Sbjct  131  GFRDERVARVVHG  143



>ref|XP_010548633.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Tarenaya hassleriana]
Length=797

 Score =   119 bits (298),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 89/139 (64%), Gaps = 3/139 (2%)
 Frame = -3

Query  419  ICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA  240
            I  A  +   R+++  L L  +++ +S L QTHAQ++++G  ND+  +TKL QR SDL A
Sbjct  10   IAEAGVSCRTRNKDLLLDLFKRSSTVSHLTQTHAQILVHGFRNDVALLTKLIQRLSDLGA  69

Query  239  IAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAF  60
            +++A+ +F +   VS PDLFL+NVV+R FS N  P  S+SM+ H+R  T L PD+FTYA 
Sbjct  70   MSYARDLFLS---VSEPDLFLFNVVIRSFSANELPLSSISMFTHIRKFTNLMPDSFTYAS  126

Query  59   VVSGVSSSGYEKFGGLLHG  3
             ++  S    E+ G + HG
Sbjct  127  AITAASGFQDERAGLVWHG  145



>ref|XP_009127635.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Brassica rapa]
Length=783

 Score =   119 bits (298),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 87/130 (67%), Gaps = 3/130 (2%)
 Frame = -3

Query  392  LRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFN  213
            + ++N F  L   + +LS L QTHAQ+IL+G  ND+  +TKLTQR SDL AI +A+ +  
Sbjct  18   INNKNSFFDLFKASTSLSHLAQTHAQIILHGHQNDIQLLTKLTQRLSDLGAIPYARDLVL  77

Query  212  AFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSG  33
            +F+    PD+FL+NV++ GFS+N SP  SLS++ HLR  T LKP++ TY + +S  SS  
Sbjct  78   SFH---KPDVFLFNVLMLGFSKNGSPHSSLSLFSHLRKHTDLKPNSSTYTYAISAASSIH  134

Query  32   YEKFGGLLHG  3
             E+ G  +HG
Sbjct  135  DERAGRSVHG  144



>emb|CDY28212.1| BnaA01g06370D [Brassica napus]
Length=1342

 Score =   119 bits (299),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 60/128 (47%), Positives = 86/128 (67%), Gaps = 3/128 (2%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAF  207
            ++N F  L   + +LS L QTHAQ+IL+G  ND+  +TKLTQR SDL AI +A+ +  +F
Sbjct  602  NKNSFFDLFKTSTSLSHLAQTHAQIILHGHQNDIQLLTKLTQRLSDLGAIPYARSLVLSF  661

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
            +    PD+FL+NV++ GFS+N SP  SLS++ HLR  T LKP++ TY + +S  SS   E
Sbjct  662  H---KPDVFLFNVLMLGFSKNGSPHSSLSLFSHLRKHTDLKPNSSTYTYAISAASSIHDE  718

Query  26   KFGGLLHG  3
            + G  +HG
Sbjct  719  RAGRSVHG  726



>ref|XP_003610281.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES92478.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=783

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 82/127 (65%), Gaps = 6/127 (5%)
 Frame = -3

Query  383  RNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFN  204
            RN   SLI KA+    L QTHAQ ILNG   DL  +TKLTQ+  D +A  HA+ +F +  
Sbjct  12   RNTLFSLINKASTFPHLAQTHAQFILNGYRFDLATLTKLTQKLFDFSATRHARALFFS--  69

Query  203  CVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEK  24
             V  PD+FL+NV++RGFS N+SP  S+S+Y HLR  T L PDNFTYAF V+  S+   +K
Sbjct  70   -VPKPDIFLFNVLVRGFSLNDSPSSSISLYTHLRRNTNLSPDNFTYAFAVAACSN---DK  125

Query  23   FGGLLHG  3
               LLH 
Sbjct  126  HLMLLHA  132



>ref|XP_004507756.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Cicer arietinum]
Length=783

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 81/127 (64%), Gaps = 5/127 (4%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            MI  + + T+   RN  +SLI K+     L QTHAQLILNG   DL  +TKLTQ+  D  
Sbjct  1    MILNSMSGTL--SRNTLISLINKSLTFPHLAQTHAQLILNGYHFDLATITKLTQKLFDFG  58

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            A  HA+ IF +   V  PD+FL+NV++RGFS N SP  S+S+Y HLR  T L PDNFTYA
Sbjct  59   ATRHARAIFFS---VPKPDIFLFNVLVRGFSLNASPSSSISLYTHLRRNTNLSPDNFTYA  115

Query  62   FVVSGVS  42
            F ++  +
Sbjct  116  FAIAACA  122



>emb|CDX68689.1| BnaC01g07640D [Brassica napus]
Length=1235

 Score =   117 bits (293),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 58/132 (44%), Positives = 87/132 (66%), Gaps = 3/132 (2%)
 Frame = -3

Query  398  TVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLI  219
            +++ ++N F  L   + +LS L QTH Q+IL+G  ND+  +TKLTQR SDL AI +A+ +
Sbjct  479  SLINNKNSFFDLFKASTSLSHLAQTHTQIILHGHQNDIQLLTKLTQRLSDLGAIPYARSL  538

Query  218  FNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSS  39
              +F+    PD+FL+NV++ G S+N SP  SLS++ HLR  T LKP++ TY + +S  S 
Sbjct  539  VLSFH---KPDVFLFNVLMLGLSKNGSPHSSLSLFSHLRKHTDLKPNSSTYTYAISAASG  595

Query  38   SGYEKFGGLLHG  3
            S  E+ G  +HG
Sbjct  596  SRDERAGRAVHG  607



>ref|XP_007154866.1| hypothetical protein PHAVU_003G154400g [Phaseolus vulgaris]
 gb|ESW26860.1| hypothetical protein PHAVU_003G154400g [Phaseolus vulgaris]
Length=778

 Score =   110 bits (274),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 64/128 (50%), Positives = 81/128 (63%), Gaps = 11/128 (9%)
 Frame = -3

Query  383  RNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFN  204
            RN  L+LI KA     L +THAQLI NG  +DL  VTKLTQ+  D+ A  HA+ +F +  
Sbjct  8    RNTLLALINKACTFPHLAETHAQLIRNGYHHDLATVTKLTQKLFDVGAAHHARALFFS--  65

Query  203  CVSPPDLFLYNVVLRGFS--QNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGY  30
             V  PD+FL+NVV++GFS   N S   S+S+Y HLR  T L PDNFTYAF    V++S  
Sbjct  66   -VPKPDIFLFNVVIKGFSFFPNAS---SVSLYTHLRKNTSLSPDNFTYAF---AVAASPD  118

Query  29   EKFGGLLH  6
            +K G  LH
Sbjct  119  DKLGMCLH  126



>ref|XP_002533229.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF29150.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=575

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 85/127 (67%), Gaps = 3/127 (2%)
 Frame = -3

Query  383  RNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFN  204
            R+FFL+L+ K+  LS L Q HA L+L+GL ND+   TKLT +  + NA +HA  +F    
Sbjct  16   RHFFLNLLNKSTTLSHLTQLHAHLLLHGLQNDIAVATKLTHKLFNFNATSHASALFFT--  73

Query  203  CVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEK  24
             +  PDLFL+NV+++GFS NNSP  ++S++ HLR  T L PDNFTYAFVVS   + G  K
Sbjct  74   -IPKPDLFLFNVLIKGFSNNNSPLSAISLFTHLRKSTDLYPDNFTYAFVVSAARNFGDAK  132

Query  23   FGGLLHG  3
             G  LHG
Sbjct  133  IGFSLHG  139



>emb|CDX72264.1| BnaC07g42860D [Brassica napus]
Length=790

 Score =   106 bits (265),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 55/128 (43%), Positives = 80/128 (63%), Gaps = 3/128 (2%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAF  207
            ++N    L   +++LS L QTHAQ+  +G  ND+  +TKLTQR S+L AI +A    N  
Sbjct  17   NKNTISDLFKISSSLSHLTQTHAQITTHGFQNDIRLLTKLTQRLSELGAIHYAH---NLV  73

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
              V  PD+FL+NV++ GFS N SP  SLS++ HLR  T L P++ TY + +S  S +  E
Sbjct  74   LSVHSPDVFLFNVLMGGFSNNGSPHSSLSLFSHLRKSTDLVPNSSTYTYAISAASGARDE  133

Query  26   KFGGLLHG  3
            + G ++HG
Sbjct  134  RAGRVVHG  141



>ref|XP_009138114.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700, 
partial [Brassica rapa]
Length=784

 Score =   106 bits (264),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 55/129 (43%), Positives = 84/129 (65%), Gaps = 5/129 (4%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAK-LIFNA  210
            ++N    L   +++LS L QTHAQ+  +G  ND+  +TKLTQR S+L AI +A+ L+ + 
Sbjct  11   NKNTISDLFKISSSLSHLTQTHAQITTHGFQNDIRLLTKLTQRLSELGAIHYARDLVLS-  69

Query  209  FNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGY  30
               V  PD+FL+NV++ GFS N SP  SLS++ HLR  T L P++ TY + +S  S++  
Sbjct  70   ---VHQPDVFLFNVLMGGFSNNGSPRSSLSLFSHLRKSTDLVPNSSTYTYAISAASAARD  126

Query  29   EKFGGLLHG  3
            E+ G ++HG
Sbjct  127  ERAGRVVHG  135



>ref|XP_003550682.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like 
[Glycine max]
Length=778

 Score =   105 bits (261),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 59/127 (46%), Positives = 78/127 (61%), Gaps = 7/127 (6%)
 Frame = -3

Query  383  RNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFN  204
            RN  L+LI+KA     L +THAQLI NG  +DL  VTKLTQ+  D+ A  HA+ +F +  
Sbjct  8    RNTLLALISKACTFPHLAETHAQLIRNGYQHDLATVTKLTQKLFDVGATRHARALFFS--  65

Query  203  CVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEK  24
             V  PD+FL+NV+++GFS +     S+S Y HL   T L PDNFTYAF    +S+S  + 
Sbjct  66   -VPKPDIFLFNVLIKGFSFSPDA-SSISFYTHLLKNTTLSPDNFTYAF---AISASPDDN  120

Query  23   FGGLLHG  3
             G  LH 
Sbjct  121  LGMCLHA  127



>ref|XP_006412675.1| hypothetical protein EUTSA_v10024455mg [Eutrema salsugineum]
 gb|ESQ54128.1| hypothetical protein EUTSA_v10024455mg [Eutrema salsugineum]
Length=790

 Score =   104 bits (260),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 59/135 (44%), Positives = 83/135 (61%), Gaps = 5/135 (4%)
 Frame = -3

Query  410  AAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAH  231
            A     + ++N F  L  +   LS LNQTHAQ+IL+G  N++  +TKLTQR SDL AI +
Sbjct  11   AETTVAVINKNNFFDLFKRLTCLSHLNQTHAQIILHG--NNIELLTKLTQRLSDLGAIHY  68

Query  230  AKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVS  51
            A+ +F +   V  PD FL+NV++RGFS N  P  SLS++  LR  T LKP++ TY   +S
Sbjct  69   ARDLFLS---VQRPDEFLFNVLIRGFSNNKLPHSSLSLFALLRKSTDLKPNSSTYTCAIS  125

Query  50   GVSSSGYEKFGGLLH  6
              S    E+ G ++H
Sbjct  126  AASCFRDERPGRVIH  140



>gb|EPS60782.1| hypothetical protein M569_14020, partial [Genlisea aurea]
Length=774

 Score =   102 bits (253),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 57/127 (45%), Positives = 74/127 (58%), Gaps = 8/127 (6%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
            F SLI KA  +S +NQ HAQ+I +GL  D I VT + Q+  D  A   AK +F  F    
Sbjct  1    FGSLIKKAVTISHINQCHAQIIQSGLSGDCIIVTGIIQKLLDFKAATQAKRLFAGFR---  57

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVV---SGVSSSGYEK  24
             PDLFLYN +++G    + P DSL+ Y  L   T  KPDNFT++ +V   +G  S G EK
Sbjct  58   SPDLFLYNALIKGL--KDDPLDSLNAYTALLRVTPFKPDNFTFSSIVAAFAGFPSPGMEK  115

Query  23   FGGLLHG  3
             G L+HG
Sbjct  116  LGRLIHG  122



>gb|KFK22524.1| hypothetical protein AALP_AAs39623U000200 [Arabis alpina]
Length=797

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 49/105 (47%), Positives = 71/105 (68%), Gaps = 3/105 (3%)
 Frame = -3

Query  317  QLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNS  138
            Q+IL+G   D+  +TKLTQR SDL A+ +A+ IF +   V  PD+FL+NV++RGFS+N S
Sbjct  135  QIILHGFQYDISLLTKLTQRLSDLGAMYYARDIFLS---VQKPDVFLFNVLMRGFSKNES  191

Query  137  PFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLLHG  3
            P  SLS++ HLR  T LKP++ TY + +S  S    E+   ++HG
Sbjct  192  PHSSLSVFTHLRKSTDLKPNSSTYTYAISAASGFRDERVARVVHG  236



>gb|KCW69344.1| hypothetical protein EUGRSUZ_F02828 [Eucalyptus grandis]
Length=734

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/125 (35%), Positives = 74/125 (59%), Gaps = 4/125 (3%)
 Frame = -3

Query  377  FFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCV  198
            FF SLI  + +L  LNQ HA+L++ GL  D   +TKL    S+L  I +++ +F+ F   
Sbjct  75   FFASLIENSTSLRHLNQIHAKLLVLGLHKDSFLITKLVNWSSNLGEIRYSRKVFDEF---  131

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
            S PD+FL+N ++RG+S++N   D++ +Y  + G T + PD FT+ +++   +       G
Sbjct  132  SDPDVFLWNAIIRGYSRHNMFSDAVELYSEMLG-TGVSPDGFTFPYILRACTGLPALGIG  190

Query  17   GLLHG  3
              +HG
Sbjct  191  RCVHG  195



>ref|XP_010062241.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 
[Eucalyptus grandis]
Length=744

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/125 (35%), Positives = 74/125 (59%), Gaps = 4/125 (3%)
 Frame = -3

Query  377  FFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCV  198
            FF SLI  + +L  LNQ HA+L++ GL  D   +TKL    S+L  I +++ +F+ F   
Sbjct  75   FFASLIENSTSLRHLNQIHAKLLVLGLHKDSFLITKLVNWSSNLGEIRYSRKVFDEF---  131

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
            S PD+FL+N ++RG+S++N   D++ +Y  + G T + PD FT+ +++   +       G
Sbjct  132  SDPDVFLWNAIIRGYSRHNMFSDAVELYSEMLG-TGVSPDGFTFPYILRACTGLPALGIG  190

Query  17   GLLHG  3
              +HG
Sbjct  191  RCVHG  195



>ref|XP_007037335.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOY21836.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=643

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 74/124 (60%), Gaps = 5/124 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA--IAHAKLIFNAFNCV  198
            LSL+T   NL  LNQ HA L+  GL +D     KL    +  N+  + +A+  F  F   
Sbjct  9    LSLLTSCKNLKTLNQIHASLVKTGLNSDPFIAGKLILHCAVTNSDVLDYARRFFLHF---  65

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              PD+F++N ++RGFS++++P +S+  ++ +R K+ + PD+F++AFV+   S+ G  + G
Sbjct  66   PNPDVFMHNTLIRGFSESSTPQNSIFTFIDMRRKSMVPPDSFSFAFVLKAASNYGSLRAG  125

Query  17   GLLH  6
              LH
Sbjct  126  IQLH  129



>emb|CDP12308.1| unnamed protein product [Coffea canephora]
Length=518

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/132 (33%), Positives = 69/132 (52%), Gaps = 9/132 (7%)
 Frame = -3

Query  389  RDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL----TQRFSDLNAIAHAKL  222
            + R F LS++T    L  L Q HAQ++  GL +D     KL    +   SD    AH   
Sbjct  3    KPRQFSLSVLTNCKTLKSLKQIHAQVLKKGLDSDPFVAGKLLLHCSINLSDSLDYAH---  59

Query  221  IFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS  42
                F     PD F+YN ++RG  ++ +P  SLS++ H+ G +   PD+F++AF++ G +
Sbjct  60   --RLFTYTPNPDAFMYNTLIRGLGESETPQKSLSIFTHMLGYSNFPPDSFSFAFLLKGAA  117

Query  41   SSGYEKFGGLLH  6
            ++   + G  LH
Sbjct  118  NARCLRMGSQLH  129



>ref|XP_007139254.1| hypothetical protein PHAVU_008G014200g [Phaseolus vulgaris]
 ref|XP_007139255.1| hypothetical protein PHAVU_008G014200g [Phaseolus vulgaris]
 gb|ESW11248.1| hypothetical protein PHAVU_008G014200g [Phaseolus vulgaris]
 gb|ESW11249.1| hypothetical protein PHAVU_008G014200g [Phaseolus vulgaris]
Length=727

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SLI  + +   L+Q H QL+++GL ++   +TKL    S+L  I +A+ +F+ F C
Sbjct  57   SFYASLIDNSTHKRHLDQIHNQLVVSGLQHNGFLMTKLVNGSSNLAQICYARKLFDGF-C  115

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
               PD+F++N ++R +S+NN   D++ MY  +R  T + PD FT+ +V+   +       
Sbjct  116  F--PDVFMWNAIIRSYSRNNMFRDTIDMYRWMRW-TGVHPDGFTFPYVLKACTELLDFGL  172

Query  20   GGLLHG  3
             GL+HG
Sbjct  173  SGLIHG  178



>ref|XP_009768191.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840 
[Nicotiana sylvestris]
 ref|XP_009768192.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840 
[Nicotiana sylvestris]
 ref|XP_009768194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840 
[Nicotiana sylvestris]
Length=674

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 44/123 (36%), Positives = 66/123 (54%), Gaps = 4/123 (3%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
            F+SLI    N  QL Q HAQ+I   L ++   +T+L    S   +I +A    + FNC  
Sbjct  40   FISLIHNCKNTHQLQQIHAQIIRQNLSSNSRIITQLISSASVRKSIDYA---LSIFNCFR  96

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             P+L+L+N ++RG  + NS F+    Y  L  K  +KPD  TY FV+  +++ G    GG
Sbjct  97   DPNLYLFNALIRGLKE-NSCFEKSVAYFKLMLKMGVKPDRLTYPFVLKSLTALGENGVGG  155

Query  14   LLH  6
             +H
Sbjct  156  SVH  158



>ref|XP_010105982.1| hypothetical protein L484_007616 [Morus notabilis]
 gb|EXC06936.1| hypothetical protein L484_007616 [Morus notabilis]
Length=734

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 42/128 (33%), Positives = 74/128 (58%), Gaps = 4/128 (3%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAF  207
            D +F+  L+  + +   L+Q HAQL+++GL  +   +TKL    SD+    +A+ +F+ F
Sbjct  62   DISFYAYLLGSSTHKKHLDQIHAQLLISGLQQNGFLITKLVNVSSDIGCNFYARKLFDEF  121

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
               + PD+FL+N ++RG+S++N   D+L MY  ++    + PD FT+  V+   S     
Sbjct  122  ---TDPDVFLWNAIVRGYSKHNMFGDALEMYSRMQA-MGVSPDAFTFPHVLKACSGLQAL  177

Query  26   KFGGLLHG  3
            +FG  +HG
Sbjct  178  EFGRRVHG  185



>ref|XP_010255189.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
Length=526

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 68/117 (58%), Gaps = 6/117 (5%)
 Frame = -3

Query  347  NLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAFNCVSPPDLFLY  174
            N+S+  QTHA +I +GL  D+    +L      S+  ++++A+++F+    +  P LF+Y
Sbjct  27   NMSEFKQTHAHIITSGLFKDIFTTARLLAFAAISESGSLSYAEILFDQ---IKHPTLFMY  83

Query  173  NVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLLHG  3
            N ++RGFSQ+  P +SL  Y+ +  +  + PDNFT+ F++   S S     G LLH 
Sbjct  84   NSMIRGFSQSTKPLESLKYYVRML-RVGISPDNFTFPFLIRSCSISSLLFQGQLLHA  139



>emb|CDP11859.1| unnamed protein product [Coffea canephora]
Length=747

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/125 (34%), Positives = 73/125 (58%), Gaps = 4/125 (3%)
 Frame = -3

Query  377  FFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCV  198
            ++ SL++K+ + S LNQ HAQL   GL N+   +TK     S++  I +A+ IF+ F   
Sbjct  78   YYTSLLSKSTHKSFLNQIHAQLFTFGLQNNGYIITKFIHVGSNIGEIIYARKIFDEF---  134

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
            S P +FL+N ++RG+S +N   +++ MY +++ +  + PD FT+  V+   S     KFG
Sbjct  135  SDPYVFLWNAIIRGYSSHNMFHEAIDMYNNMQ-EAYVSPDCFTFPHVLKACSGLSAVKFG  193

Query  17   GLLHG  3
              +H 
Sbjct  194  QAVHA  198



>gb|EYU29595.1| hypothetical protein MIMGU_mgv1a025435mg [Erythranthe guttata]
Length=505

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 66/125 (53%), Gaps = 1/125 (1%)
 Frame = -3

Query  374  FLSLI-TKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCV  198
            FLSL+ T    +  L + HAQLI  GL  D IAV+++    +           F+ F+ +
Sbjct  7    FLSLLETNCHTIKDLTKIHAQLIKTGLAKDTIAVSRILAFCAAPGPARDLDYAFSVFSHI  66

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P+LF +N ++RGF Q++ P  ++S+++ +   + L+P+N TY  V    +  G    G
Sbjct  67   EKPNLFTWNTIIRGFCQSSHPHVAISLFVDMLTNSTLEPENLTYPSVFKAYTQLGLAGDG  126

Query  17   GLLHG  3
              LHG
Sbjct  127  AQLHG  131



>ref|XP_004492095.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Cicer arietinum]
Length=724

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 68/117 (58%), Gaps = 4/117 (3%)
 Frame = -3

Query  392  LRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFN  213
             +  +F+ SLI  + ++  LNQ H QLI++GL +D   +TKL    S+L  I +A+ +F+
Sbjct  50   FKSHSFYASLIDNSTHIRHLNQIHNQLIVSGLQHDRFVMTKLVTESSNLGHIFYARKLFD  109

Query  212  AFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS  42
             F     PD F+ N ++R +S+N+   D++ MY  +R    + PD FT++ VV   +
Sbjct  110  KFPI---PDCFMLNAIIRSYSRNSMFRDTIEMYRWMRW-VGMCPDRFTFSCVVKACT  162



>ref|XP_010267212.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic [Nelumbo nucifera]
Length=724

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/114 (32%), Positives = 72/114 (63%), Gaps = 6/114 (5%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRF---SDLNAIAHAKLIFNAFN  204
             +SL+    ++ Q  Q HAQLIL GL +++ ++++L   F   S  +A+ HA+L+ +   
Sbjct  14   LISLLESCKSIKQALQIHAQLILKGLNHNIFSLSRLISFFALSSSRDALDHARLLLSQ--  71

Query  203  CVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS  42
             +  P+LF++N V+RG+S++ SP +++ +Y  +  +  + P+NFTY F+++  +
Sbjct  72   -IDRPNLFIWNTVIRGYSRSESPREAIVLYKSMVAEGVVSPNNFTYPFLLNSCA  124



>gb|KEH21904.1| editing factor 22 [Medicago truncatula]
Length=719

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 69/117 (59%), Gaps = 4/117 (3%)
 Frame = -3

Query  392  LRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFN  213
             +  +F+ SLI  + +++ L Q H QL+L+GL ++   +TKL  + S+L  I +A+ +F+
Sbjct  44   FKSHSFYASLIDNSTHITHLYQVHNQLVLSGLQHNRFLMTKLVNQSSNLGQIFYARKLFD  103

Query  212  AFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS  42
             F     PDLF++N ++R +S+NN   + + MY  ++    L PD FT+  V+   S
Sbjct  104  EF---PDPDLFMWNAIIRTYSRNNMYRNVIEMYRWMKW-VGLHPDKFTFPCVLKACS  156



>ref|XP_010653985.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Vitis vinifera]
 ref|XP_010653986.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Vitis vinifera]
Length=723

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 34/110 (31%), Positives = 71/110 (65%), Gaps = 6/110 (5%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDL---NAIAHAKLIFNAFNC  201
            L L+    +  Q  Q HAQ I+NGL + + ++++L   FS L   + + H++L+F+  +C
Sbjct  14   LCLLESCKSFKQGLQIHAQTIVNGLHHQIFSISRLISFFSLLGSKDGLDHSRLLFSQIDC  73

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVS  51
               P+LF++N ++RG+S++++P +++ +Y+ +  K    P+NFT+ F+++
Sbjct  74   ---PNLFMWNTMIRGYSRSDNPREAIVLYMSMIAKGIAPPNNFTFPFLLN  120



>ref|XP_009610515.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840 
[Nicotiana tomentosiformis]
Length=675

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 45/123 (37%), Positives = 67/123 (54%), Gaps = 4/123 (3%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
            F+SLI    N  QL + HAQ+I   L ++   VT+L    S   +I +A  IFN F    
Sbjct  41   FISLIHTCKNTLQLQKIHAQIIRQNLSSNSRIVTQLISSASLRKSIDYALSIFNYFR---  97

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             P+L+L+N ++RG  + NS F+    Y  L  K  +KPD  TY FV+  +++ G +  GG
Sbjct  98   GPNLYLFNALIRGLKE-NSCFEKSIGYFKLMLKMGVKPDRLTYPFVLKSLTALGEKGVGG  156

Query  14   LLH  6
             +H
Sbjct  157  SVH  159



>gb|KDP33607.1| hypothetical protein JCGZ_07178 [Jatropha curcas]
Length=612

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 45/125 (36%), Positives = 73/125 (58%), Gaps = 3/125 (2%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAK-LIFNAFNCVS  195
            L+L+    +LS+L Q H  ++ +GL N+ + +TKLT   SDL+AI +A   +F+  +   
Sbjct  39   LALLQDCNSLSKLTQVHTYILKSGLQNNPLVLTKLTATSSDLHAIDYASSFLFSPESDTG  98

Query  194  PPDLFLYNVVLRGFSQ-NNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              D FL+N ++R ++Q NNS   ++ MY +L  K  + P+ FTY FV+   +  G  K G
Sbjct  99   LYDTFLFNTIIRAYAQTNNSKVIAIFMY-NLMLKYNILPNKFTYPFVLKACAGIGNLKLG  157

Query  17   GLLHG  3
              +HG
Sbjct  158  KSVHG  162



>ref|XP_004304934.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Fragaria vesca subsp. vesca]
Length=739

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 69/124 (56%), Gaps = 4/124 (3%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
            F S I  +   + L Q HAQL++ G       +TKL    S+L  I++A+ +F+ F   +
Sbjct  71   FASFIDSSTRRTHLTQIHAQLLVLGFQASAFLITKLVNCSSNLGHISYARQVFDEF---T  127

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             P +FL+N ++RG+S++N+  D++ MY  ++ +  + PD FT+  V+      G  + G 
Sbjct  128  DPGVFLWNAIIRGYSKHNAYADAVQMYCGMQ-EMGVGPDGFTFPHVLKACGGLGAVEIGR  186

Query  14   LLHG  3
             +HG
Sbjct  187  RVHG  190



>ref|XP_003551818.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Glycine max]
Length=727

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/113 (34%), Positives = 70/113 (62%), Gaps = 4/113 (4%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SLI  + +   L+Q H +L+++GL ++   +TKL    S+L  I +A+ +F+ F C
Sbjct  57   SFYASLIDNSTHKRHLDQIHNRLVISGLQHNGFLMTKLVNGSSNLGQICYARKLFDEF-C  115

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS  42
               PD+F++N ++R +S+NN   D++ MY  +R  T + PD FT+ +V+   +
Sbjct  116  Y--PDVFMWNAIIRSYSRNNMYRDTVEMYRWMRW-TGVHPDGFTFPYVLKACT  165



>emb|CDY59706.1| BnaCnng35430D [Brassica napus]
Length=583

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 70/123 (57%), Gaps = 5/123 (4%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQR--FSDLNAIAHAKLIFNAFNCVS  195
            SL+T    L  L Q HA  I +GL  D     KL  +   S   A+ +A+ +  ++    
Sbjct  10   SLLTSCKTLRALTQIHASFIKSGLDTDSYFTGKLILQCSISIPGALPYARRLLLSY---P  66

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             PD F++N ++RG+SQ+++P  S+S+++ +  K ++ PD+F++AFV+   +S G  + G 
Sbjct  67   RPDAFMFNTLVRGYSQSDNPQSSISVFVEMMRKARIFPDSFSFAFVIKAAASFGSLRTGF  126

Query  14   LLH  6
             LH
Sbjct  127  QLH  129



>ref|XP_010326841.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840 
[Solanum lycopersicum]
 ref|XP_010326842.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840 
[Solanum lycopersicum]
 ref|XP_004247960.2| PREDICTED: pentatricopeptide repeat-containing protein At1g04840 
[Solanum lycopersicum]
 ref|XP_010326843.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840 
[Solanum lycopersicum]
 ref|XP_010326844.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840 
[Solanum lycopersicum]
Length=666

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 70/127 (55%), Gaps = 4/127 (3%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAF  207
            + + F+SLI  + N+ QL Q H Q+I     ++   VT+L    S   +I +     + F
Sbjct  27   NESHFISLIHSSRNILQLQQIHGQIIRKNFSSNSRIVTQLISSASLHKSINYG---LSIF  83

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
            +C    ++FL+NV++RG  +N S F+   +Y     K  ++PD  TY FV+  V++ G +
Sbjct  84   SCFLDKNVFLFNVLIRGLKEN-SLFEKSILYFRKMVKMGVRPDKLTYPFVLKSVTALGDK  142

Query  26   KFGGLLH  6
            + GG++H
Sbjct  143  RVGGVVH  149



>emb|CDP06172.1| unnamed protein product [Coffea canephora]
Length=526

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 45/141 (32%), Positives = 73/141 (52%), Gaps = 11/141 (8%)
 Frame = -3

Query  410  AAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL-----TQRFSDL  246
            A+ +  + D  +   L TK   +  L   HAQLI  GL  D IA +++     T    D+
Sbjct  13   ASISKFISDNPYLSMLETKCTTMKDLKLIHAQLIKTGLIQDKIAASRVLAFCATSPAGDV  72

Query  245  NAIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTY  66
            N   +A L+F+  +    P+LF +N ++RGFSQ++SP  SLS+++ +   + ++P+  TY
Sbjct  73   N---YAYLVFSQMD---NPNLFTWNTMIRGFSQSSSPETSLSLFVQMLESSLVQPERLTY  126

Query  65   AFVVSGVSSSGYEKFGGLLHG  3
              V    +  G    G  LHG
Sbjct  127  PSVFKAYTQLGLAAEGAQLHG  147



>gb|EPS69071.1| hypothetical protein M569_05691, partial [Genlisea aurea]
Length=726

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAFNCV  198
            ++LI +  +  QL Q H Q++ +GL +D  A +KL      SD +++A+A+ +F+    +
Sbjct  14   VTLIDRCTSQKQLKQIHCQMLRSGLLDDPFAASKLISLSALSDFSSLAYAQKVFDQ---M  70

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P+LF +N+++R ++  + P  SLS+++ L   +   PD FTY F +   +     + G
Sbjct  71   PRPNLFSWNILVRAYASASRPLHSLSLFIRLLHHSPDPPDKFTYPFAIKACADLSDLRLG  130

Query  17   GLLHG  3
              +HG
Sbjct  131  RGIHG  135



>ref|XP_007155315.1| hypothetical protein PHAVU_003G190600g [Phaseolus vulgaris]
 gb|ESW27309.1| hypothetical protein PHAVU_003G190600g [Phaseolus vulgaris]
Length=626

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 41/129 (32%), Positives = 72/129 (56%), Gaps = 5/129 (4%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQR--FSDLNAIAHAKLIFN  213
            +  + +S++ K +NL Q  Q H  ++ +GL  D     KL      S  +A+ ++  +F+
Sbjct  2    EEEWVVSVLRKCSNLKQTKQIHGHILKSGLRTDPFVFGKLLLHCAVSISDALHYSLRLFH  61

Query  212  AFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSG  33
             F     PD F++N ++RG S + +P  SL  ++ LR +  L PD+F++AFV+ GV++S 
Sbjct  62   HF---PNPDTFMHNTLIRGLSLSQTPLLSLHPFIQLRRQPSLSPDSFSFAFVLKGVANSR  118

Query  32   YEKFGGLLH  6
              + G  LH
Sbjct  119  QLRPGIQLH  127



>ref|XP_006847830.1| hypothetical protein AMTR_s00029p00051540 [Amborella trichopoda]
 gb|ERN09411.1| hypothetical protein AMTR_s00029p00051540 [Amborella trichopoda]
Length=181

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 72/136 (53%), Gaps = 14/136 (10%)
 Frame = -3

Query  395  VLRDRNFFLSLITKAANLSQLNQTHAQLILNGL------GNDLIAVTKLTQRFSDLNAIA  234
            + R     LSL+    +++QL Q HA +I+ GL      G+ LIA   +    S   +I 
Sbjct  7    IARKLPPILSLLDSCTHMNQLKQIHAHIIIQGLSRSNFTGSRLIAFCAV----SPYASID  62

Query  233  HAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVV  54
            HAKLIF     +  P +F +N ++RG S +++P +++  Y  L  K   +P+NFT+ FV+
Sbjct  63   HAKLIFAQ---IQEPSIFTWNSMIRGLSMSSNPKEAIVFYSQLLCKNT-QPNNFTFPFVI  118

Query  53   SGVSSSGYEKFGGLLH  6
               + +   + G LLH
Sbjct  119  KACTEAAAVETGLLLH  134



>ref|XP_008348079.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like 
[Malus domestica]
Length=539

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 66/123 (54%), Gaps = 4/123 (3%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCVSP  192
            SL  K  NL  L Q HA +++NG  ++  A+ +L   F    AI+         F+ VS 
Sbjct  18   SLWQKCTNLRALKQVHASMVVNGFNSNYSAIRELI--FCSAMAISGTIDYAHQVFDHVSE  75

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            PD FL+N ++RG +Q+ SP +++ +Y  +  +   +PD FT+ FV+   +   + K G  
Sbjct  76   PDNFLWNTMIRGSAQSQSPLNAVLLYTRMENR-HARPDGFTFPFVLKACTKLSWVKMGMG  134

Query  11   LHG  3
            +HG
Sbjct  135  IHG  137



>ref|XP_008379840.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300 
[Malus domestica]
Length=502

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 66/123 (54%), Gaps = 4/123 (3%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCVSP  192
            SL  K  NL  L Q HA +++NG  ++  A+ +L   F    AI+         F+ VS 
Sbjct  18   SLWQKCTNLRALKQVHASMVVNGFNSNYSAIRELI--FCSAMAISGTIDYAHQVFDHVSE  75

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            PD FL+N ++RG +Q+ SP +++ +Y  +  +   +PD FT+ FV+   +   + K G  
Sbjct  76   PDNFLWNTMIRGSAQSQSPLNAVLLYTRMENR-HARPDGFTFPFVLKACTKLSWVKMGMG  134

Query  11   LHG  3
            +HG
Sbjct  135  IHG  137



>ref|XP_010915642.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Elaeis guineensis]
Length=650

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 46/122 (38%), Positives = 73/122 (60%), Gaps = 7/122 (6%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPP  189
            SLIT+ A L    Q HA+LIL+GLG D +  TKL   +S  N++ +A    N F+ +   
Sbjct  84   SLITRKA-LEPGKQLHARLILSGLGFDTVLATKLVNLYSVCNSLPNAH---NLFDRIHKG  139

Query  188  DLFLYNVVLRGFSQNNSPFD-SLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            +LFL+NV++RG++  N P++ +L +Y  +     L+PDNFT+ FV+   S+    + G  
Sbjct  140  NLFLWNVLIRGYAW-NGPYEVALKLYYQMLDH-GLQPDNFTFPFVLKACSALSALEVGRD  197

Query  11   LH  6
            +H
Sbjct  198  IH  199



>ref|XP_008457379.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic [Cucumis melo]
Length=733

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 69/125 (55%), Gaps = 5/125 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL--TQRFSDLNAIAHAKLIFNAFNCV  198
            LS I K ++  QL + HA+++  GL  D  + +KL      S  + + +A+   N F+ +
Sbjct  29   LSAIDKCSSSKQLKEVHARMLRTGLFFDPFSASKLFTASALSSFSTLDYAR---NVFDQI  85

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P+L+ +N+++R ++ ++ PF S  ++L L  K +  P+NFT+ FV+   S     + G
Sbjct  86   PQPNLYTWNILIRAYASSSDPFQSFVIFLDLLDKCEDLPNNFTFPFVIKAASELKASRVG  145

Query  17   GLLHG  3
              +HG
Sbjct  146  TAVHG  150



>ref|XP_008379591.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g12770-like [Malus domestica]
Length=758

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 71/126 (56%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +FF SLI  +   SQL Q HAQL++ GL +    +TKL    S+L  I++A+ +F+ F  
Sbjct  68   SFFGSLIDGSTRKSQLGQIHAQLVVLGLIDSGFLITKLVNASSNLGYISYARQVFDEF--  125

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
             + PD+F +N ++R +S++N    ++ MY  ++    + PD FT+  V+   S     + 
Sbjct  126  -TDPDVFQWNAIIRCYSRHNVFSQAIEMYSRMQ-VMGVSPDGFTFPHVLKACSGMPDLEM  183

Query  20   GGLLHG  3
            G  +HG
Sbjct  184  GRRVHG  189



>ref|XP_009353362.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Pyrus x bretschneideri]
Length=753

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 70/126 (56%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +FF SLI  +   SQL Q HAQL++ GL +    +TKL    S+L  I +A+ +F+ F  
Sbjct  83   SFFASLIDSSTRESQLGQIHAQLVVLGLIDSGFLITKLVNASSNLGYIWYARQVFDEF--  140

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
             + PD+F +N ++R +S++N    ++ MY  ++    + PD FT+  V+   S     + 
Sbjct  141  -TDPDVFQWNAIIRCYSRHNVFSQAIEMYSRMQ-VMGVSPDGFTFPHVLKACSGMPDLEM  198

Query  20   GGLLHG  3
            G  +HG
Sbjct  199  GRRVHG  204



>ref|XP_010246108.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 
[Nelumbo nucifera]
Length=738

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 40/126 (32%), Positives = 67/126 (53%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+  L+    +   L Q HAQLI+ G  N     TK     S+   I +A+ +F     
Sbjct  67   SFYAFLLDNLTHKKHLVQIHAQLIVAGFQNSNYLATKFVHASSNAGEIHYARSLFEE---  123

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            +  P++FL+N ++RG+SQNN   D+L MY  ++ + ++ PD FT+ +V+   SS    + 
Sbjct  124  IPEPNVFLWNAIVRGYSQNNLFSDALEMYSRMQVE-RMNPDRFTFPYVLKACSSLSDLRM  182

Query  20   GGLLHG  3
            G  +H 
Sbjct  183  GFRIHA  188



>emb|CDY02013.1| BnaC04g14880D [Brassica napus]
Length=739

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 1/123 (1%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            LSLI + +NL QL Q HAQ++  GL ND  + +KL    S L+  A        F+ +  
Sbjct  35   LSLIDRCSNLRQLKQIHAQMVRTGLFNDPYSASKLFA-ISALSHFASLDYACKVFDQIPQ  93

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            P+ F +N ++R ++    P  S+S++L +    +  P+ +T+ F++   +       G  
Sbjct  94   PNSFTWNTLIRAYASGPDPLRSISVFLDMVSDGQFGPNKYTFPFLIKAAAEVSSLSLGQS  153

Query  11   LHG  3
            LHG
Sbjct  154  LHG  156



>ref|XP_006844858.1| hypothetical protein AMTR_s00058p00105900 [Amborella trichopoda]
 gb|ERN06533.1| hypothetical protein AMTR_s00058p00105900 [Amborella trichopoda]
Length=192

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 64/122 (52%), Gaps = 4/122 (3%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPP  189
            SL+   +  + + + HA++ + GL  +     K+    S ++AI HA L   AF   S P
Sbjct  23   SLLDHCSTHNHIREAHARIFVLGLHQNNFLAAKILGACSSVSAINHAIL---AFKHASNP  79

Query  188  DLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLL  9
             + LYN ++R  +QNN PF+++ +Y  +R +  L PDNFTY FV    ++      G  +
Sbjct  80   TICLYNTLIRALAQNNLPFETIDLYTAMR-RNSLPPDNFTYPFVAKACAALSALSLGQAI  138

Query  8    HG  3
            H 
Sbjct  139  HA  140



>ref|XP_002522705.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF39667.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=501

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 70/127 (55%), Gaps = 5/127 (4%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
             FF SLI  + N S LNQ HAQL ++ L  +   +TKL    + L  I +A+   N F+ 
Sbjct  47   TFFASLIDNSVNRSHLNQIHAQLFVSRLQYNGFLITKLVNCCATLGEIRYAR---NVFDY  103

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSS-GYEK  24
               PD+FL+N ++R +++ N   +++ MY  ++    ++PD FT+  V+   ++S  +  
Sbjct  104  YPDPDVFLWNAIIRCYTRQNLFCNAIEMYARMQIAC-IRPDGFTFPLVLKACTASLAFLD  162

Query  23   FGGLLHG  3
             G  +HG
Sbjct  163  IGRRVHG  169



>ref|XP_002276196.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 
[Vitis vinifera]
 emb|CBI17979.3| unnamed protein product [Vitis vinifera]
Length=742

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/126 (32%), Positives = 68/126 (54%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +FF SL+  + +   LNQ HAQL+++GL      VTK      ++  I +A+ +F+ F  
Sbjct  72   SFFSSLLDHSVHKRHLNQIHAQLVVSGLVESGFLVTKFVNASWNIGEIGYARKVFDEF--  129

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
               P +FL+N ++RG+S +N   D++ MY  ++  + + PD FT   V+   S     + 
Sbjct  130  -PEPSVFLWNAIIRGYSSHNFFGDAIEMYSRMQA-SGVNPDGFTLPCVLKACSGVPVLEV  187

Query  20   GGLLHG  3
            G  +HG
Sbjct  188  GKRVHG  193



>ref|XP_010538069.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630 
[Tarenaya hassleriana]
Length=643

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 69/124 (56%), Gaps = 5/124 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQR--FSDLNAIAHAKLIFNAFNCV  198
            +S+++K  NL  L Q HA LI +G   D     KL      +  + + +A  +F +F   
Sbjct  9    ISILSKCKNLRTLTQIHASLIKSGADTDPFFAGKLLLHGAVAISDGLRYAHRLFLSF---  65

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              PD+F++N ++RGFS+++SP +S+  Y+ +R +    PD+F++AFV+   ++    K G
Sbjct  66   PDPDVFMFNTLVRGFSESDSPRNSILTYIEMRKRALAPPDSFSFAFVIKAAANLRCLKIG  125

Query  17   GLLH  6
               H
Sbjct  126  FQTH  129



>ref|XP_011082908.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic [Sesamum indicum]
Length=520

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/130 (28%), Positives = 66/130 (51%), Gaps = 1/130 (1%)
 Frame = -3

Query  392  LRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFN  213
            + D+ F   L T    +  L + HA +I  GL  D +A +++   F            F+
Sbjct  19   ISDQPFLSMLETNCHTIKDLKKIHAHIIKTGLAKDAVAASRVLA-FCATGPDRDLVYAFS  77

Query  212  AFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSG  33
             F  +  P+LF++N V+RGFSQ++ P  ++S+++ +   ++++P+  TY  V    +  G
Sbjct  78   VFRQIEEPNLFIWNTVIRGFSQSSDPHVAISLFVEMLVDSRVQPEKLTYPSVFKAYTQLG  137

Query  32   YEKFGGLLHG  3
              + G  LHG
Sbjct  138  LAEDGAQLHG  147



>ref|XP_010243684.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic [Nelumbo nucifera]
Length=547

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 66/124 (53%), Gaps = 2/124 (2%)
 Frame = -3

Query  371  LSLITK-AANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
            LS++ K   N+S L + HA +I  GL  D IA +++   FS  +        ++ F+ + 
Sbjct  26   LSMLEKRCTNMSDLQKLHAHIIKTGLAKDTIAASRVLA-FSATSPAGDINYAYSVFSQIQ  84

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             P+LF +N ++RGFSQ+++P  ++S++  +   + ++P   TY  +    +  G    G 
Sbjct  85   NPNLFTWNTIIRGFSQSSTPLRAISLFTDMLQSSPIEPQRLTYPSLFKAYAQLGLAHDGT  144

Query  14   LLHG  3
             LHG
Sbjct  145  QLHG  148



>ref|XP_010068636.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Eucalyptus grandis]
 gb|KCW64279.1| hypothetical protein EUGRSUZ_G01917 [Eucalyptus grandis]
Length=628

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 3/116 (3%)
 Frame = -3

Query  353  AANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPPDLFLY  174
              +L+ L   HA ++   L  +L  +T L  R++ L ++ HA+ +F       PPD+FL+
Sbjct  45   GGSLASLKAVHAAVLRAHLHLNLTFLTHLVARYASLGSLPHARALFAL--SAEPPDVFLW  102

Query  173  NVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLLH  6
            NVV+RG         +L +Y  +RG+  + PDNFTY FV+      G  K G L+H
Sbjct  103  NVVVRGCVDGLRFRPALGLYARMRGQ-GIGPDNFTYPFVLKACGCLGDVKSGALVH  157



>ref|XP_008230115.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 
[Prunus mume]
Length=740

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/124 (33%), Positives = 68/124 (55%), Gaps = 4/124 (3%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
            F SLI  +   S L Q HAQL++ GL +    +TKL    S+L  + +A+ +F+ F   +
Sbjct  72   FASLIDGSTQKSHLGQIHAQLLVLGLQDSGFLITKLVNASSNLGFVTYARRVFDEF---T  128

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             PD+FL+N ++R +S++    D+L MY  ++    + PD FT+  V+   S     + G 
Sbjct  129  DPDVFLWNAIIRCYSRHIVFADALGMYARMQA-MGVSPDGFTFPHVLKACSGLPDLEMGR  187

Query  14   LLHG  3
             +HG
Sbjct  188  RVHG  191



>ref|NP_187883.2| mitochondrial editing factor 22 [Arabidopsis thaliana]
 sp|Q9LTV8.1|PP224_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g12770 
[Arabidopsis thaliana]
 dbj|BAB02421.1| selenium-binding protein-like [Arabidopsis thaliana]
 gb|AEE75244.1| mitochondrial editing factor 22 [Arabidopsis thaliana]
Length=694

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/126 (31%), Positives = 70/126 (56%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SLI  A + +QL Q HA+L++ GL      +TKL    S    I  A+ +F+    
Sbjct  22   SFYASLIDSATHKAQLKQIHARLLVLGLQFSGFLITKLIHASSSFGDITFARQVFDD---  78

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            +  P +F +N ++RG+S+NN   D+L MY +++   ++ PD+FT+  ++   S   + + 
Sbjct  79   LPRPQIFPWNAIIRGYSRNNHFQDALLMYSNMQ-LARVSPDSFTFPHLLKACSGLSHLQM  137

Query  20   GGLLHG  3
            G  +H 
Sbjct  138  GRFVHA  143



>dbj|BAD94552.1| hypothetical protein [Arabidopsis thaliana]
Length=694

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/126 (31%), Positives = 70/126 (56%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SLI  A + +QL Q HA+L++ GL      +TKL    S    I  A+ +F+    
Sbjct  22   SFYASLIDSATHKAQLKQIHARLLVLGLQFSGFLITKLIHASSSFGDITFARQVFDD---  78

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            +  P +F +N ++RG+S+NN   D+L MY +++   ++ PD+FT+  ++   S   + + 
Sbjct  79   LPRPQIFPWNAIIRGYSRNNHFQDALLMYSNMQ-LARVSPDSFTFPHLLKACSGLSHLQM  137

Query  20   GGLLHG  3
            G  +H 
Sbjct  138  GRFVHA  143



>gb|EYU45383.1| hypothetical protein MIMGU_mgv1a023657mg [Erythranthe guttata]
Length=701

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 75/138 (54%), Gaps = 9/138 (7%)
 Frame = -3

Query  398  TVLRDRNF----FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRF--SDLNAI  237
            TV  DR F     ++LI K +N  QL Q HAQ++  GL  D  + +KL Q +  S+L+++
Sbjct  13   TVNNDRYFANHPTVTLIEKCSNSRQLKQIHAQMLRCGLFFDPFSASKLVQSYALSELSSL  72

Query  236  AHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFV  57
             +A   +  F+ +  P+L+ +N+++R  + +  P + L M++ L      KP+ FTY FV
Sbjct  73   HYA---YKVFDQIPQPNLYSWNILIRASASSPQPINCLLMFIRLLHVGGEKPNKFTYPFV  129

Query  56   VSGVSSSGYEKFGGLLHG  3
            +   +     + G  +HG
Sbjct  130  IKASAKLDDFQLGKGIHG  147



>ref|XP_010316250.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300 
[Solanum lycopersicum]
Length=539

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 70/122 (57%), Gaps = 2/122 (2%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPP  189
            SL +K  +L  L Q HA +I+NG  ++ IA+ +L    S +   A        F  ++ P
Sbjct  18   SLWSKCKDLQSLKQIHALMIINGFNSNRIALRELIYA-SAVTFSASIHYAHKLFAQITQP  76

Query  188  DLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLL  9
            DLF++N +LRG +Q++ P  ++S+Y H+  K  ++PD++T+ F++   +   +   G ++
Sbjct  77   DLFMWNTMLRGSAQSHRPSLAVSVYTHME-KRSIRPDSYTFPFLLKACTKLSWLVSGLVV  135

Query  8    HG  3
            HG
Sbjct  136  HG  137



>ref|XP_002884209.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH60468.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=534

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 3/126 (2%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            N+F+  + +  + ++  + HA +I++GL      VTK+      L  + +A  +FN    
Sbjct  11   NYFIPFLQRVKSRNEWKKIHACIIVHGLSQSSFMVTKMVDLCDKLGDMDYATRLFNQ---  67

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            VS P++FLYN ++R ++ N+   D + +Y  L  KT   PD FT+ F+    +S G    
Sbjct  68   VSNPNVFLYNSIIRAYTHNSLYCDVIRIYKQLLRKTIEFPDRFTFPFMFKSCASLGSCYL  127

Query  20   GGLLHG  3
            G  +HG
Sbjct  128  GKQVHG  133



>ref|XP_008219702.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Prunus mume]
Length=604

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 67/124 (54%), Gaps = 3/124 (2%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
             L+LI    +L+QL Q HA+ I++GL  +   +T++   F    ++ +A  I        
Sbjct  9    LLALIETCTSLNQLKQMHAKSIISGLSYNHFILTQIANSFLFPQSLNYATRILVQ---TQ  65

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             P +F+YN +++ +SQ+ +PF +LSMY ++R +     D FTY FV    +S    + G 
Sbjct  66   EPSIFIYNSMIKAYSQSETPFVALSMYNNMRVRENAVGDQFTYPFVFKACASELAVEKGR  125

Query  14   LLHG  3
             +HG
Sbjct  126  EVHG  129



>ref|XP_007224904.1| hypothetical protein PRUPE_ppa022022mg [Prunus persica]
 gb|EMJ26103.1| hypothetical protein PRUPE_ppa022022mg [Prunus persica]
Length=604

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 67/124 (54%), Gaps = 3/124 (2%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
             L+LI    +L+QL Q HA+ I++GL  +   +T++   F    ++ +A  I        
Sbjct  9    LLALIETCTSLNQLKQIHAKSIISGLSYNHFILTQIANSFLFPQSLNYATRILVQ---TQ  65

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             P +F+YN +++ +SQ+ +PF +LSMY ++R +     D FTY FV    +S    + G 
Sbjct  66   EPSIFIYNSMIKAYSQSETPFVALSMYNNMRVRENAVGDQFTYPFVFKACASELAVEKGR  125

Query  14   LLHG  3
             +HG
Sbjct  126  EVHG  129



>ref|XP_006601432.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g74580-like [Glycine max]
Length=1428

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQR--FSDLNAIAHAKLIFNAFNC  201
            ++SL++K ++L    Q HAQ+   GL  D +   KL      +  +A+ +A  +F+ F  
Sbjct  793  WVSLLSKCSSLKPTKQIHAQICKTGLHTDPLVFGKLLLHCAITISDALHYALRLFHHF--  850

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
               PD F++N ++R  S + +P  SL  ++ LR +  L PD+FT+AF +  V++S + + 
Sbjct  851  -PNPDTFMHNTLIRSLSLSQTPLSSLHPFIQLRRQPTLSPDSFTFAFALKAVANSRHLRP  909

Query  20   GGLLH  6
            G  LH
Sbjct  910  GIQLH  914



>ref|XP_009144348.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic [Brassica rapa]
Length=739

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 64/123 (52%), Gaps = 1/123 (1%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            +SLI + +NL QL Q HAQ++  GL +D  + +KL    S L+  A        F+ +  
Sbjct  35   ISLIDRCSNLRQLKQIHAQMVRTGLFSDPYSASKLFA-ISALSHFASLDYACKVFDQIPQ  93

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            P+ F +N ++R ++    P  S+S++L +   ++  P+ +T+ F++   +       G  
Sbjct  94   PNSFTWNTLIRAYASGPDPLRSISVFLDMVSDSRFGPNKYTFPFLIKAAAEVSSLSLGQS  153

Query  11   LHG  3
            LHG
Sbjct  154  LHG  156



>emb|CDY70113.1| BnaAnng32650D [Brassica napus]
Length=739

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 64/123 (52%), Gaps = 1/123 (1%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            +SLI + +NL QL Q HAQ++  GL +D  + +KL    S L+  A        F+ +  
Sbjct  35   ISLIDRCSNLRQLKQIHAQMVRTGLFSDPYSASKLFA-ISALSHFASLDYACKVFDQIPQ  93

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            P+ F +N ++R ++    P  S+S++L +   ++  P+ +T+ F++   +       G  
Sbjct  94   PNSFTWNTLIRAYASGPDPLRSISVFLDMVSDSRFGPNKYTFPFLIKAAAEVSSLSLGQS  153

Query  11   LHG  3
            LHG
Sbjct  154  LHG  156



>ref|XP_009349981.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g05240 [Pyrus x bretschneideri]
Length=548

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 38/124 (31%), Positives = 71/124 (57%), Gaps = 6/124 (5%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA--IAHAKLIFNAFNCV  198
            LSL+ K   +S+L Q H  +I   + N++I +++L    ++  A  + +AK +F     +
Sbjct  9    LSLLEKCRRMSELKQIHGLMITTSVVNNVIQLSRLVDFCTNSEARDLGYAKKVFQQ---I  65

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
            S P ++++N ++RG+S + +P +SL MY  +  +  L PDNFT+ FV+   S     ++G
Sbjct  66   SQPSVYIWNSMIRGYSNSENPVESLIMYREMLQRGYL-PDNFTFPFVLKSCSVIADYRYG  124

Query  17   GLLH  6
              +H
Sbjct  125  KCVH  128



>ref|XP_011100283.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 
[Sesamum indicum]
Length=715

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 42/128 (33%), Positives = 70/128 (55%), Gaps = 8/128 (6%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SL+ K+ ++  L Q H QL  +GL N+   VTKL    S+L  I +A+ +F  F  
Sbjct  45   SFYTSLLEKSTHIIHLRQIHCQLYTHGLQNNGFIVTKLIHVTSNLKEIHYARHLFEEF--  102

Query  200  VSPPD--LFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
               PD  +FL+N ++RG+S +N     + MY  +R +  + PD FT+  V+    S   +
Sbjct  103  ---PDQYVFLWNAIIRGYSMHNIFDKVVEMYSRMR-QAFVSPDTFTFPHVLKACGSLLAK  158

Query  26   KFGGLLHG  3
            ++G  +H 
Sbjct  159  RYGRAVHA  166



>ref|XP_009376288.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300 
[Pyrus x bretschneideri]
Length=539

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 65/123 (53%), Gaps = 4/123 (3%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCVSP  192
            SL  K  NL  L Q HA +++NG  ++  A+ +L   F    AI+         F+ VS 
Sbjct  18   SLWQKCTNLRALKQVHASMVVNGFNSNYSAIRELI--FCGAMAISGTIDYAHQVFDHVSE  75

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            PD FL+N ++RG +Q+  P +++ +Y  +  +   +PD FT+ FV+   +   + K G  
Sbjct  76   PDNFLWNTMIRGSAQSQCPLNAVLLYTRMENR-HARPDGFTFPFVLKACTKLSWVKMGMG  134

Query  11   LHG  3
            +HG
Sbjct  135  IHG  137



>gb|KDP39353.1| hypothetical protein JCGZ_01110 [Jatropha curcas]
Length=674

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 42/124 (34%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
             +SLI  +    QL+Q HAQ+ L+ L       T+L    S    I +A  +FN +    
Sbjct  40   LISLIHASKTSRQLHQIHAQIFLHNLSTSSQIATQLISSSSSRKFIDYAITVFNHY---Y  96

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
            P + FL+N ++RG + NNS F+S   +  L  ++ +KPD  TY FV+  +++   E  G 
Sbjct  97   PKNSFLFNALIRGLT-NNSLFESAISHFILMLRSDVKPDQLTYPFVLKSIATLCSEGLGR  155

Query  14   LLHG  3
             LHG
Sbjct  156  ALHG  159



>ref|XP_006350917.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Solanum tuberosum]
Length=744

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 41/138 (30%), Positives = 71/138 (51%), Gaps = 5/138 (4%)
 Frame = -3

Query  404  AATVLRDRNF----FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAI  237
            + TV+ DR F     + LI K  ++ QL Q HA ++  GL +D  + +KL +  S L+  
Sbjct  24   SKTVINDRYFENHPLVLLIDKCQSIKQLKQIHAYMLRIGLFSDPFSASKLIEA-SSLSHF  82

Query  236  AHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFV  57
            +        F+ +  P+LF +N ++R +S +  P  S+ M++++  + +  P  FTY FV
Sbjct  83   SSLDYAHKVFDEIPQPNLFSWNALIRAYSSSQDPIQSILMFVNMICEGREFPSKFTYPFV  142

Query  56   VSGVSSSGYEKFGGLLHG  3
                +     +FG  LHG
Sbjct  143  FKASAKMKALRFGRGLHG  160



>ref|XP_006856097.1| hypothetical protein AMTR_s00059p00132030 [Amborella trichopoda]
 gb|ERN17564.1| hypothetical protein AMTR_s00059p00132030 [Amborella trichopoda]
Length=236

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 69/126 (55%), Gaps = 8/126 (6%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC---  201
            LSL+ K  +L QL Q  AQ     +G D   ++KL     +  A++ + L+F AF+    
Sbjct  29   LSLLNKCTSLKQLKQVQAQTFKEAIGTDPYTLSKLI----EFCALSTSNLLFYAFSLFIL  84

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            +  P+LF+YN ++RG  +N+ P +++ +Y  +R +  L P+NF+Y F+ +    +     
Sbjct  85   IPEPNLFVYNTMIRGSVRNDRPCEAILLYNQMRERNIL-PNNFSYPFLFNACEKTLAINH  143

Query  20   GGLLHG  3
            G  LHG
Sbjct  144  GLKLHG  149



>ref|XP_010487003.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Camelina sativa]
Length=695

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 68/126 (54%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SLI  +   S L Q HA+L++ GL      +TKL Q  S    +  A+ +F+    
Sbjct  23   SFYASLIDSSTRKSHLRQIHARLLVLGLQFSGFLITKLIQASSSFGDVTFARQVFDG---  79

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            +  P +F +N ++RG+S+NN   D+L MY  ++   ++ PD+FT+  ++       +   
Sbjct  80   LPHPQIFPWNAIIRGYSRNNYFQDALLMYSKMQ-LARVPPDSFTFPHLLKACGGLSHLPV  138

Query  20   GGLLHG  3
            GG++H 
Sbjct  139  GGVVHA  144



>ref|XP_003624556.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES80774.1| PPR containing plant-like protein [Medicago truncatula]
Length=476

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 41/115 (36%), Positives = 63/115 (55%), Gaps = 4/115 (3%)
 Frame = -3

Query  347  NLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPPDLFLYNV  168
            N  QL Q HA++I   L +D + + KL Q  S    I +A L+F+  N    PD+F +NV
Sbjct  32   NFKQLKQIHARIIRFRLTHDQLLIRKLCQISSSYGKIDYASLVFDQLN---DPDIFTWNV  88

Query  167  VLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLLHG  3
            ++R ++ +  P  S+ ++  +     L PD FTY FV++   +SG   FG L HG
Sbjct  89   MIRAYNTSGLPQKSIFLFKDMICCGFL-PDKFTYPFVINACIASGVIDFGRLTHG  142



>ref|XP_010266937.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630 
[Nelumbo nucifera]
Length=642

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 41/126 (33%), Positives = 63/126 (50%), Gaps = 5/126 (4%)
 Frame = -3

Query  377  FFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTK--LTQRFSDLNAIAHAKLIFNAFN  204
             F S +     L  L Q HA     GL ND     K  L    S  NA+ +A+ +   F 
Sbjct  7    LFFSALRDCRTLKTLKQLHAYASKTGLDNDPFIAGKFILLSAVSIANALDYARRLLLHF-  65

Query  203  CVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEK  24
              S PD+F+YN ++RG S++ +P  SL  Y+ +R ++   PD+FT+AF++   ++     
Sbjct  66   --SSPDVFMYNTLVRGLSESETPQQSLLTYIEMRRRSTPTPDSFTFAFILKAAANYRSLS  123

Query  23   FGGLLH  6
             G  LH
Sbjct  124  SGTQLH  129



>gb|EPS72721.1| hypothetical protein M569_02036 [Genlisea aurea]
Length=625

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 74/130 (57%), Gaps = 8/130 (6%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAF  207
            + +F+ S++ +  + S L+Q H Q+  NG+ N+   +TKL  R SD+  I HA+ +F+ F
Sbjct  69   NESFYASVVNQCTHRSHLSQIHGQIYSNGMQNNGFIITKLINRCSDIGEIEHARKLFDVF  128

Query  206  NCVSPPD--LFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSG  33
                 PD  +FL+N ++RG+S+++   + + MY  ++    + PD+F+   V+    +  
Sbjct  129  -----PDKYIFLWNGIIRGYSKHHMLNEVVGMYSRMQLDL-VNPDSFSLLHVLKACGNLM  182

Query  32   YEKFGGLLHG  3
              ++G  +HG
Sbjct  183  AVEYGRAVHG  192



>ref|XP_004241167.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic [Solanum lycopersicum]
Length=744

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 41/138 (30%), Positives = 72/138 (52%), Gaps = 5/138 (4%)
 Frame = -3

Query  404  AATVLRDRNF----FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAI  237
            + TV+ DR F     + LI K+ +++QL Q HA ++  GL  D  + +KL +  S L+  
Sbjct  24   SKTVINDRYFENHPLVLLIDKSQSINQLKQIHAYMLRIGLFFDPFSASKLIEA-SSLSHF  82

Query  236  AHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFV  57
            +        F+ +  P+LF +N ++R +S +  P  S+ M++++  + +  P  FTY FV
Sbjct  83   SSLDYAHKVFDEIPQPNLFSWNALIRAYSSSQDPIQSILMFVNMLCEGREFPSKFTYPFV  142

Query  56   VSGVSSSGYEKFGGLLHG  3
                +     +FG  LHG
Sbjct  143  FKASAKMKAIRFGRGLHG  160



>ref|XP_002522388.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF40072.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=472

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 39/116 (34%), Positives = 63/116 (54%), Gaps = 6/116 (5%)
 Frame = -3

Query  344  LSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAFNCVSPPDLFLYN  171
            + Q  Q HAQ+ILN L +  + + KL      SD   + +A L+FN    +S P+ F+YN
Sbjct  1    MKQSKQIHAQIILNNLTDQTLTLGKLVSFCAVSDAGNLDYAHLVFNQ---ISIPNKFMYN  57

Query  170  VVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLLHG  3
             ++RG+  +NSP  S+ +Y  L   + L P+ FT+ FV+   +S        ++HG
Sbjct  58   SLIRGYCNSNSPIKSMFLYRQLI-DSGLSPNEFTFPFVLKACASKSAHWMSMIVHG  112



>ref|XP_009383182.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 
[Musa acuminata subsp. malaccensis]
Length=782

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 58/116 (50%), Gaps = 5/116 (4%)
 Frame = -3

Query  383  RNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFN  204
            +  +L LI+ A  L  L+Q  A  I+ G   DLI  T L +R SDL   A A      F+
Sbjct  8    KALYLGLISAATTLHHLDQILAHSIVTGYHPDLITATALLRRVSDLGGTAAAPRALRLFS  67

Query  203  CVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHL-RGKTKLKPDNFTYAFVVSGVSS  39
             V  PDLFL NV+LR       P  +L +   L R    L+P+ FTYA V S  S+
Sbjct  68   SVPDPDLFLLNVLLRSL----PPSTALPLLSSLPRHHPHLRPNTFTYAAVASAASN  119



>ref|XP_010937211.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Elaeis guineensis]
Length=652

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 40/126 (32%), Positives = 63/126 (50%), Gaps = 5/126 (4%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
              S++    +  +L Q HAQL++NG       +TKL       N + HA     AF+ V 
Sbjct  36   LFSILQGCKSTRELAQMHAQLLVNGFSQKNFLITKLLSFCVSSNNLYHAT---QAFDMVK  92

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE--KF  21
             P   LYN ++R FS++  P  SL  Y  +R     +P++FT+AF++   +++G    K 
Sbjct  93   EPSTTLYNQMIRAFSRSAMPETSLKFYNRMRASAMAQPNSFTFAFLLGACAAAGTSLLKQ  152

Query  20   GGLLHG  3
            G  LH 
Sbjct  153  GEQLHA  158



>ref|XP_010254272.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22690-like 
[Nelumbo nucifera]
Length=675

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 42/129 (33%), Positives = 66/129 (51%), Gaps = 5/129 (4%)
 Frame = -3

Query  383  RNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFN  204
            R   +SLI   + +  L+Q HAQ I  GL  D   V+++   F+  +   +       F+
Sbjct  17   RQNIISLIQNCSKIEILHQIHAQTIRTGLIEDTFVVSRIIAFFTVPSTQFNVHYARRIFD  76

Query  203  CVSPPDLFLYNVVLRGFSQNNSPFDSLSMY--LHLRGKTKLKPDNFTYAFVVSGVSSSGY  30
             V  P+LF++N ++R ++Q  +P D+L +Y  + +RG     PDNFTY  V    S    
Sbjct  77   QVHHPNLFIWNSMIRSYTQTCAPKDALLLYKEMLIRG---FSPDNFTYPIVTKACSHLHA  133

Query  29   EKFGGLLHG  3
             + G LLHG
Sbjct  134  LECGSLLHG  142



>ref|XP_006410036.1| hypothetical protein EUTSA_v10016305mg [Eutrema salsugineum]
 gb|ESQ51489.1| hypothetical protein EUTSA_v10016305mg [Eutrema salsugineum]
Length=739

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 64/123 (52%), Gaps = 1/123 (1%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            LSLI + A+L QL Q HAQ++  GL ND  + +KL    + L+  A        F+ +  
Sbjct  35   LSLIDRCADLRQLKQIHAQMVRTGLFNDHYSASKLFA-IAALSPFASLDYACKVFDQIPQ  93

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            P+ F +N ++R ++    P  S+ ++L +  +++  P+ +T+ F++   +       G  
Sbjct  94   PNSFTWNTLIRAYASGPDPLRSICVFLDMVSESQCYPNTYTFPFLIKAAAEVSSLSLGQS  153

Query  11   LHG  3
            LHG
Sbjct  154  LHG  156



>ref|XP_003548483.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, 
chloroplastic-like isoform X1 [Glycine max]
 ref|XP_006598987.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, 
chloroplastic-like isoform X2 [Glycine max]
 gb|KHN46817.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=483

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 64/123 (52%), Gaps = 4/123 (3%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            L L+ K +N  QL Q H ++I  GL  D + + KL Q  S    + +A L+F+  N    
Sbjct  29   LVLLQKCSNFKQLKQVHGKIIRFGLTYDQLLMRKLIQLSSSYGKMKYATLVFDQLNA---  85

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            PD+F +NV++R F+   SP  +L ++  +  +    PD FTY FV++   +S     G +
Sbjct  86   PDVFTWNVMIRAFTIGGSPKMALLLFKAMLCQ-GFAPDKFTYPFVINACMASSALDLGIV  144

Query  11   LHG  3
             H 
Sbjct  145  AHA  147



>ref|XP_002284834.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g05240 [Vitis vinifera]
 ref|XP_010659837.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g05240 [Vitis vinifera]
Length=565

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 38/127 (30%), Positives = 70/127 (55%), Gaps = 6/127 (5%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAF  207
            N  LSL+ K   +++L + H  +I   +  D+I +++L     +SD   + +AK +FN  
Sbjct  6    NSILSLLEKCKTMAELKRLHGLMITTSVIQDVIPLSRLVDFCAYSDSGNLNYAKSVFNQ-  64

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
              +  P L+++N +++G+S + SP ++L+MY  +R K    PD+FT+ FV+   S     
Sbjct  65   --IDRPSLYIWNSMIKGYSISESPDEALTMYREMRQK-GYAPDHFTFPFVLKACSLVNGY  121

Query  26   KFGGLLH  6
              G  +H
Sbjct  122  NLGQCVH  128



>ref|XP_008394135.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Malus domestica]
Length=603

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 67/125 (54%), Gaps = 5/125 (4%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCV  198
             L+LI    +L QL Q HA+ I++GL  +   +T++T  F    ++ +A +L+       
Sbjct  9    LLTLIETCTSLQQLKQIHAKSIISGLSYNQFILTQITNSFLLPQSLNYATRLLIRT----  64

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P +F+YN ++R  SQ+ +PF +LS+Y  +R +     D FTY FV+   +S      G
Sbjct  65   QEPSVFVYNSIIRAHSQSETPFVALSIYNMMRVQENALGDRFTYPFVLKACASESDMDKG  124

Query  17   GLLHG  3
              +HG
Sbjct  125  REVHG  129



>ref|XP_010092397.1| hypothetical protein L484_023776 [Morus notabilis]
 gb|EXB51073.1| hypothetical protein L484_023776 [Morus notabilis]
Length=523

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 57/108 (53%), Gaps = 4/108 (4%)
 Frame = -3

Query  365  LITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPPD  186
            L+    N  ++ Q HAQL+++GL N      +L + +  ++   +A  IFN    +  PD
Sbjct  15   LLQMCHNFHEVRQVHAQLVVSGLVNRPPNGGRLVESYVRVSQTQYALAIFNT---IHSPD  71

Query  185  LFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS  42
            +F YN ++RG      P++SL MY  L     L PDNFTY FV+   S
Sbjct  72   VFAYNTIMRGLMLGKDPYNSLLMYEKLL-MNGLIPDNFTYTFVLKACS  118



>emb|CBI36755.3| unnamed protein product [Vitis vinifera]
Length=751

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 38/127 (30%), Positives = 70/127 (55%), Gaps = 6/127 (5%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAF  207
            N  LSL+ K   +++L + H  +I   +  D+I +++L     +SD   + +AK +FN  
Sbjct  6    NSILSLLEKCKTMAELKRLHGLMITTSVIQDVIPLSRLVDFCAYSDSGNLNYAKSVFNQ-  64

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
              +  P L+++N +++G+S + SP ++L+MY  +R K    PD+FT+ FV+   S     
Sbjct  65   --IDRPSLYIWNSMIKGYSISESPDEALTMYREMRQK-GYAPDHFTFPFVLKACSLVNGY  121

Query  26   KFGGLLH  6
              G  +H
Sbjct  122  NLGQCVH  128



>ref|XP_006356395.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic-like [Solanum tuberosum]
Length=522

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/133 (28%), Positives = 72/133 (54%), Gaps = 6/133 (5%)
 Frame = -3

Query  392  LRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL---TQRFSDLNAIAHAKL  222
            + D+ +   L TK   ++ L + HA LI +GL  D IA +++   + +   +  I +A L
Sbjct  15   ISDQPYLHMLETKCTTMTDLKKIHAHLIKSGLIKDKIASSRVLAFSAKSPPIGDINYANL  74

Query  221  IFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS  42
            +F     +  P+LF +N ++RGFS++++P  ++ +++ +   ++++P   TY  V    +
Sbjct  75   VFTH---IENPNLFTWNTIIRGFSESSTPQYAIHLFIEMLNNSQVQPHLLTYPSVFKAYA  131

Query  41   SSGYEKFGGLLHG  3
              G  K G  LHG
Sbjct  132  RGGLVKNGAQLHG  144



>ref|XP_002282982.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Vitis vinifera]
 ref|XP_010648711.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Vitis vinifera]
 ref|XP_010648712.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 
[Vitis vinifera]
Length=599

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/125 (31%), Positives = 64/125 (51%), Gaps = 7/125 (6%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIF--NAFNCV  198
            L+LI    N+ QL Q HA+ I++ L      +TK+   F     ++HA L +    FN  
Sbjct  10   LALIETCTNIQQLKQIHAKSIISSLSYTQFIITKIINSF-----LSHACLDYATQVFNQT  64

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              PD F+YN ++R +S + +P  ++S+Y  +R    +  D +TY FV    +S    + G
Sbjct  65   QEPDGFIYNAMIRAYSSSQTPCVAISIYNKMRACQNILGDKYTYPFVFKACASQFAVEKG  124

Query  17   GLLHG  3
              +HG
Sbjct  125  KEVHG  129



>ref|XP_006431200.1| hypothetical protein CICLE_v10011436mg [Citrus clementina]
 gb|ESR44440.1| hypothetical protein CICLE_v10011436mg [Citrus clementina]
Length=540

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 66/123 (54%), Gaps = 6/123 (5%)
 Frame = -3

Query  365  LITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDL--NAIAHAKLIFNAFNCVSP  192
            L  K  NL  L Q  A + +NG  +D  A+ +L    S +   AI +A  +F     ++ 
Sbjct  14   LWKKCTNLRTLKQIQALVTINGFNSDSSALRELIYSGSVVIPGAINYAHKMFVK---ITE  70

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            PD F+YN ++RG +Q+ +P D++ +Y  +  K  +KP+ FT++FV+   +   Y   G  
Sbjct  71   PDTFMYNTIIRGSAQSQNPLDAVFLYTQME-KCSIKPNKFTFSFVLKACTRLLYRNMGFC  129

Query  11   LHG  3
            +HG
Sbjct  130  VHG  132



>ref|XP_009379156.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like [Pyrus x bretschneideri]
Length=663

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 68/115 (59%), Gaps = 7/115 (6%)
 Frame = -3

Query  365  LITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAFNCVSP  192
            L+ + +++ +L Q HAQ+IL+ L N+ + + KL      SD   + +A+L+F+    +  
Sbjct  44   LLEQCSSMRELKQLHAQIILHSLTNENLTLGKLISFCSVSDPRNLHYAQLVFDQ---IPE  100

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVS-GVSSSGY  30
            P+ F+YN ++RG+S ++ PF + S+Y  + G + L P+ FT  FV+   V  S Y
Sbjct  101  PNKFMYNSLIRGYSNSDDPFKAFSLYCQMVG-SGLSPNEFTLPFVLKVCVGQSAY  154



>gb|KDO72618.1| hypothetical protein CISIN_1g041942mg, partial [Citrus sinensis]
Length=498

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 66/123 (54%), Gaps = 6/123 (5%)
 Frame = -3

Query  365  LITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDL--NAIAHAKLIFNAFNCVSP  192
            L  K  NL  L Q  A + +NG  +D  A+ +L    S +   AI +A  +F     ++ 
Sbjct  11   LWKKCTNLRTLKQIQALVTINGFNSDSSALRELIYSGSVVIPGAINYAHKMFVK---ITE  67

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            PD F+YN ++RG +Q+ +P D++ +Y  +  K  +KP+ FT++FV+   +   Y   G  
Sbjct  68   PDTFMYNTIIRGSAQSQNPLDAVFLYTQME-KCSIKPNKFTFSFVLKACTRLLYRNMGFC  126

Query  11   LHG  3
            +HG
Sbjct  127  VHG  129



>ref|XP_006484869.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic-like [Citrus sinensis]
Length=534

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/126 (31%), Positives = 69/126 (55%), Gaps = 5/126 (4%)
 Frame = -3

Query  374  FLSLITK-AANLSQLNQTHAQLILNGLGNDLIAVTK-LTQRFSDLNAIAHAKLIFNAFNC  201
             LSL+ K   ++  L + HA LI  GL  D IA ++ LT   S    I +A L+F     
Sbjct  22   LLSLLDKQCTSMKDLKKIHAHLIKTGLAKDPIAASRILTFCTSPAGDINYAYLVFTQ---  78

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            +  P+LF++N ++RGFSQ+++P +++ +++ +   + ++P   TY  +    +  G  + 
Sbjct  79   IKKPNLFIWNTIIRGFSQSSTPRNAILLFIDMLVTSPIQPQRLTYPSLFKAYAQLGLARD  138

Query  20   GGLLHG  3
            G  LHG
Sbjct  139  GAQLHG  144



>ref|XP_009598200.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic [Nicotiana tomentosiformis]
Length=526

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/132 (29%), Positives = 71/132 (54%), Gaps = 5/132 (4%)
 Frame = -3

Query  392  LRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLT--QRFSDLNAIAHAKLI  219
            + D+ +   L TK   ++ L + HAQLI  GL  D IA +++      S    I +A ++
Sbjct  19   ISDQPYLYMLETKCTTITDLKKIHAQLIKTGLIKDKIASSRVLAFSAKSPTGDINYANMV  78

Query  218  FNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSS  39
            F     +  P+LF++N ++RGFS++++P  ++ +++ +   ++++P   TY  V    + 
Sbjct  79   FTQ---IENPNLFIWNTIIRGFSESSTPQYAIHLFIEMLTISEIQPQLLTYPSVFKAYTR  135

Query  38   SGYEKFGGLLHG  3
             G  K G  LHG
Sbjct  136  LGLAKSGTQLHG  147



>ref|XP_006482626.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like 
[Citrus sinensis]
Length=540

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 66/123 (54%), Gaps = 6/123 (5%)
 Frame = -3

Query  365  LITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDL--NAIAHAKLIFNAFNCVSP  192
            L  K  NL  L Q  A + +NG  +D  A+ +L    S +   AI +A  +F     ++ 
Sbjct  14   LWKKCTNLRTLKQIQALVTINGFNSDSSALRELIYSGSVVIPGAINYAHKMFVK---ITE  70

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            PD F+YN ++RG +Q+ +P D++ +Y  +  K  +KP+ FT++FV+   +   Y   G  
Sbjct  71   PDTFMYNTIIRGSAQSQNPLDAVFLYTQME-KCSIKPNKFTFSFVLKACTRLLYRNMGFC  129

Query  11   LHG  3
            +HG
Sbjct  130  VHG  132



>ref|XP_010255010.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like [Nelumbo nucifera]
Length=675

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 72/123 (59%), Gaps = 6/123 (5%)
 Frame = -3

Query  365  LITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAFNCVSP  192
            L+ + +++++L   HAQ+I+NGL  + + V KL      SD   +++A+L+F+    ++ 
Sbjct  53   LLARCSSMAELKHLHAQIIVNGLLQENLTVGKLIAFCAISDAGNLSYARLVFDQ---IAE  109

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            P+ F++N ++RG+S++N P +   +Y  +RG   L P+ FT  FV+   +S    +   L
Sbjct  110  PNRFMWNSLIRGYSKSNFPREVFPLYHRMRG-LGLSPNEFTLPFVLKACASELAYRESLL  168

Query  11   LHG  3
            +H 
Sbjct  169  IHA  171



>ref|XP_010499449.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 
[Camelina sativa]
Length=695

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 67/126 (53%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SLI  +   SQL Q HA L++ GL      +TKL Q  S    +  A+ +F+    
Sbjct  23   SFYASLIDSSTRKSQLRQIHAHLLVLGLQFSGFLITKLIQASSSFGDVTFARQVFDG---  79

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            +  P ++ +N ++RG+S+NN   D+L MY  ++   ++ PD+FT+  ++       +   
Sbjct  80   LPHPQIYPWNAIIRGYSRNNYFQDALLMYSKMQ-LARVSPDSFTFPHLLKACGGLSHLPV  138

Query  20   GGLLHG  3
            G L+H 
Sbjct  139  GRLVHA  144



>ref|XP_009341449.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Pyrus x bretschneideri]
Length=737

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 70/128 (55%), Gaps = 4/128 (3%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAF  207
            D + F SLI  +   SQL Q HAQL++ GL +    +TKL    S+L  I +A+ +F+ F
Sbjct  65   DPDSFASLIDSSTRKSQLGQIHAQLVVLGLIDSGFLITKLVNASSNLGYIWYARQVFDEF  124

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
               + PD+F +N ++R +S+++    ++ MY  ++    + PD FT+  V+   S     
Sbjct  125  ---TDPDVFQWNAIIRCYSRHSVFSQAIEMYSRMQ-VMGVSPDGFTFPHVLKACSGMPDL  180

Query  26   KFGGLLHG  3
            + G  +HG
Sbjct  181  EMGRRVHG  188



>ref|XP_004306116.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like 
[Fragaria vesca subsp. vesca]
Length=605

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 44/136 (32%), Positives = 64/136 (47%), Gaps = 17/136 (13%)
 Frame = -3

Query  392  LRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFN  213
            L D+N  LS + +  NL+ + Q HAQ++   L  D     KL   FS      H  L  N
Sbjct  18   LLDQN--LSDLHRCTNLAHIKQVHAQILKAHLHQDPHTAPKLIAAFS---LCRHMALAVN  72

Query  212  AFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSG  33
             FN V  P++ LYN ++R    NN P  + + +  ++    + PDNFT+ F++   S  G
Sbjct  73   VFNQVHHPNVHLYNTLIRAHIHNNQPSQAFAAFFDMQAH-GVYPDNFTFPFLLKACSGKG  131

Query  32   Y-----------EKFG  18
            Y           EKFG
Sbjct  132  YLHVVLMIHAQIEKFG  147



>ref|XP_009128053.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630 
[Brassica rapa]
Length=644

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 69/123 (56%), Gaps = 5/123 (4%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQR--FSDLNAIAHAKLIFNAFNCVS  195
            SL+T    L  L Q HA  I +G+  D     KL  +   S  NA+ +A+ +  ++    
Sbjct  10   SLLTTCKTLRALTQIHASFIKSGVDTDSYFTGKLILQCSISIPNALPYARRLLLSY---P  66

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             PD F++N ++RG+SQ+++P  S+ +++ +  K ++ PD+F++AFVV   +S    + G 
Sbjct  67   HPDAFMFNTLVRGYSQSDNPQSSIPVFVEMMRKGRIFPDSFSFAFVVKAAASFRDLRTGF  126

Query  14   LLH  6
             LH
Sbjct  127  QLH  129



>ref|XP_007048864.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
 gb|EOX93021.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
Length=538

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 72/137 (53%), Gaps = 4/137 (3%)
 Frame = -3

Query  410  AAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTK-LTQRFSDLNAIA  234
            A+    + D+ +   L     ++  L + HAQLI  GL ND+IA ++ L    S    + 
Sbjct  13   ASITKFISDQPYLSLLENNCTSMKDLKKLHAQLIKTGLVNDIIAASRVLAFCVSPAGDMN  72

Query  233  HAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVV  54
            +A L+F     +  P+LF +N ++RGFSQ+++P  ++S+++ +   + ++P+  TY  V 
Sbjct  73   YAYLVFTQ---IKNPNLFTWNTIIRGFSQSSNPQIAISLFIDMLVGSSIQPERLTYPSVF  129

Query  53   SGVSSSGYEKFGGLLHG  3
               +  G    G  LHG
Sbjct  130  KAYAQLGLACDGRQLHG  146



>ref|XP_006299513.1| hypothetical protein CARUB_v10015683mg [Capsella rubella]
 gb|EOA32411.1| hypothetical protein CARUB_v10015683mg [Capsella rubella]
Length=694

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 70/125 (56%), Gaps = 4/125 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SLI  + + +QL Q HA+L++ GL      +TKL Q  S    +  A+ +F+    
Sbjct  22   SFYASLIDSSTHKAQLRQIHARLLVLGLHFSGFLITKLIQASSSFGDVTFARQVFDD---  78

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            +  P +F +N ++RG+S+N+   D+L MY  ++   ++ PD+FT+  ++   S   +   
Sbjct  79   LPRPQIFPWNAIIRGYSRNSYFQDALLMYSKMQ-LARVSPDSFTFPHLLKACSGLSHLPM  137

Query  20   GGLLH  6
            G L+H
Sbjct  138  GRLVH  142



>ref|XP_004145320.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004152961.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004168552.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Cucumis sativus]
 gb|KGN65801.1| hypothetical protein Csa_1G530130 [Cucumis sativus]
Length=733

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/125 (29%), Positives = 67/125 (54%), Gaps = 5/125 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL--TQRFSDLNAIAHAKLIFNAFNCV  198
            LS I K ++  QL + HA+++  GL  D  + +KL      S  + + +A+   N F+ +
Sbjct  29   LSTIDKCSSSKQLKEVHARMLRTGLFFDPFSASKLFTASALSSFSTLDYAR---NLFDQI  85

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P+L+ +N ++R ++ ++ PF S  ++L L  K +  P+ FT+ FV+   S     + G
Sbjct  86   PQPNLYTWNTLIRAYASSSDPFQSFVIFLDLLDKCEDLPNKFTFPFVIKAASELKASRVG  145

Query  17   GLLHG  3
              +HG
Sbjct  146  TAVHG  150



>ref|XP_007208480.1| hypothetical protein PRUPE_ppa018503mg [Prunus persica]
 gb|EMJ09679.1| hypothetical protein PRUPE_ppa018503mg [Prunus persica]
Length=509

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/112 (36%), Positives = 63/112 (56%), Gaps = 8/112 (7%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            L  +   +N  ++ Q HAQL+++GL +      +L Q +  ++ I HA  +F+  +C   
Sbjct  5    LVFLRMCSNFLEVRQVHAQLVVSGLLDRPPNAGRLLQSYVTVSQIYHASSVFDRISC---  61

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMY--LHLRGKTKLKPDNFTYAFVVSGVS  42
            PD+F YN ++RG      P +SL +Y  L L G   LKPD++TYAFV+   S
Sbjct  62   PDVFAYNNMIRGLILGKCPNNSLLLYNKLVLDG---LKPDSYTYAFVLKACS  110



>ref|XP_006299486.1| hypothetical protein CARUB_v10015651mg [Capsella rubella]
 gb|EOA32384.1| hypothetical protein CARUB_v10015651mg [Capsella rubella]
Length=534

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 68/126 (54%), Gaps = 3/126 (2%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            N F+SL+ +  + ++L + HA +I++GL      VTK+      +  + +A  +FN    
Sbjct  11   NCFVSLLQRFRSRNELKKIHASIIIHGLSQSSFMVTKMVDSCDKIGDMEYATRLFNQ---  67

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            VS P++FLYN ++R ++ ++   + + +Y  L  K+   PD FT+ F+    +S G    
Sbjct  68   VSYPNVFLYNSIIRAYTHHSLYCEVIRIYRQLFMKSIELPDRFTFPFMFKSCASLGSCYL  127

Query  20   GGLLHG  3
            G  +HG
Sbjct  128  GKQVHG  133



>ref|XP_004305832.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=550

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 67/131 (51%), Gaps = 4/131 (3%)
 Frame = -3

Query  392  LRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTK-LTQRFSDLNAIAHAKLIF  216
            + D+     L  +  N+  L + HA LI  GL ND +A ++ L    S    I +A ++F
Sbjct  18   ISDKPHLFMLENQCTNMKDLQKIHAHLIKTGLANDTVAASRVLAFCASPAGDINYAYMVF  77

Query  215  NAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSS  36
                 +  P+LF++N ++RGFS +++P  ++S+++ +   + ++P   TY  V    +  
Sbjct  78   RH---IHNPNLFIWNTIIRGFSNSSNPEAAISLFIDMLVTSTVQPQRLTYPSVFKAYAQL  134

Query  35   GYEKFGGLLHG  3
            G    G  LHG
Sbjct  135  GLAHDGAQLHG  145



>ref|XP_008353912.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Malus domestica]
Length=559

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 4/110 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            L L+    N  ++ Q HAQL+++GL +  +   +L Q +  ++ I HA  IF+    +S 
Sbjct  30   LVLLQMCCNFQEVRQVHAQLVVSGLLDRPLNAGRLLQSYVIISQIHHALSIFBR---ISY  86

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS  42
            PD+F YN ++RG     SP+ SL +Y  L    +LKPDN+TY FV+   S
Sbjct  87   PDVFAYNNMIRGLILVKSPYHSLLLYNKLL-LDRLKPDNYTYTFVLKACS  135



>ref|XP_003541414.2| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like [Glycine max]
Length=636

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/128 (30%), Positives = 69/128 (54%), Gaps = 6/128 (5%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFS--DLNAIAHAKLIFNAF  207
            N   +L++    + Q  Q HAQ+++ G  +D   +T L   F+  + NA+ H+ L+F   
Sbjct  2    NGLKTLLSSCRTIHQALQIHAQMVVTGRHHDPFLMTPLISFFAAANSNALHHSHLLFTQ-  60

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLH-LRGKTKLKPDNFTYAFVVSGVSSSGY  30
              +  PDLFL+N+++R FS + +P ++LS+Y   L     + PD FT+ F++   +    
Sbjct  61   --IPNPDLFLFNLIIRAFSLSQTPHNALSLYKKMLSSSPPIFPDTFTFPFLLKSCAKLSL  118

Query  29   EKFGGLLH  6
             + G  +H
Sbjct  119  PRLGLQVH  126



>ref|XP_002300166.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE84971.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=719

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 68/123 (55%), Gaps = 4/123 (3%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
            F+SLI  +  + QL+Q HAQ+I++ L +  +  T+L    S   +I H+  +FN      
Sbjct  84   FISLIHGSKTILQLHQIHAQIIIHNLSSSSLITTQLISSSSLRKSINHSLAVFNHHK---  140

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
            P +LF +N ++RG + N+  F+++  +  L  ++ +KPD  TY FV+  ++     + G 
Sbjct  141  PKNLFTFNALIRGLTTNSHFFNAI-FHFRLMLRSGIKPDRLTYPFVLKSMAGLFSTELGM  199

Query  14   LLH  6
             +H
Sbjct  200  AIH  202



>ref|XP_006593838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, 
mitochondrial-like isoform X1 [Glycine max]
 ref|XP_006593839.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, 
mitochondrial-like isoform X2 [Glycine max]
Length=478

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 68/125 (54%), Gaps = 6/125 (5%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            L+L  + +++  L + HA+++ +G G   + V K+ + F  ++           F+ +  
Sbjct  16   LTLFKQCSSMKHLKEMHARVVQSGFGKTPLVVGKIIE-FCAVSGQGDMNYALRVFDRIDK  74

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFV---VSGVSSSGYEKF  21
            PD F++N ++RGF + + P+ ++ +Y  ++G   +  D FT++FV   ++G+  S   KF
Sbjct  75   PDAFMWNTMIRGFGKTHQPYMAIHLYRRMQGNGDVPADTFTFSFVLKIIAGLECS--LKF  132

Query  20   GGLLH  6
            G  LH
Sbjct  133  GKQLH  137



>ref|XP_009355807.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Pyrus x bretschneideri]
 ref|XP_009355808.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Pyrus x bretschneideri]
Length=603

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 39/125 (31%), Positives = 68/125 (54%), Gaps = 5/125 (4%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCV  198
             L+LI    +L QL Q HA+ +++GL  +   +T++T  F    ++ +A +L+       
Sbjct  9    LLTLIETCTSLQQLKQIHAKSLISGLSYNQFILTQITNSFLLPQSLNYATRLLIRT----  64

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P +F+YN ++R  SQ+++PF +LS+Y  +R +     D FTY FV+   +S      G
Sbjct  65   QEPSVFVYNSMIRAHSQSDTPFVALSIYNMMRVQENALGDRFTYPFVLKACASESDMDKG  124

Query  17   GLLHG  3
              +HG
Sbjct  125  REVHG  129



>ref|XP_008230793.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300 
[Prunus mume]
Length=539

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 66/123 (54%), Gaps = 4/123 (3%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCVSP  192
            S   K  NL  L Q HA +++NG  ++  A+ +L   F+   AI+         F  V+ 
Sbjct  18   SFWQKCTNLRALKQVHASMVVNGFNSNYSAIRELI--FAGAMAISGTIDYAHQLFVHVAE  75

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            PD F++N ++RG +Q+ +P +++ +Y  +  +   +PD+FT+ F++   +   + K G  
Sbjct  76   PDTFMWNTMIRGSAQSQNPLNAIVLYTQMENR-HARPDSFTFPFILKACTKLSWVKMGMG  134

Query  11   LHG  3
            +HG
Sbjct  135  IHG  137



>ref|XP_003558728.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300 
[Brachypodium distachyon]
Length=532

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/126 (32%), Positives = 68/126 (54%), Gaps = 8/126 (6%)
 Frame = -3

Query  365  LITKAANLSQLNQTHAQLILNGLGNDLIAVTKL--TQRFSDLNAIAHAKLIFNAFNCVSP  192
            L  +  +L Q+ Q HA ++L G  +D  A+ +L      +   AIAHA L+F+    +  
Sbjct  14   LWRRCRSLRQIKQVHALMVLRGFLSDPSALRELLFASAVAVRGAIAHAYLVFDQ---IPR  70

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHL--RGKT-KLKPDNFTYAFVVSGVSSSGYEKF  21
            PDLF+YN ++RG +   +P D++S+Y  +  RG    ++PD  T+ FV+   ++ G    
Sbjct  71   PDLFMYNTLIRGAAHTAAPRDAVSLYARMARRGSCGGVRPDKITFPFVLRACTAMGAGGT  130

Query  20   GGLLHG  3
            G  +H 
Sbjct  131  GAQVHA  136



>ref|XP_008811169.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Phoenix dactylifera]
Length=531

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 71/121 (59%), Gaps = 6/121 (5%)
 Frame = -3

Query  362  ITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA--IAHAKLIFNAFNCVSPP  189
            +T   ++S+L +THA +I +GL +D   + +L    +   +  + +AKL+F+A   V+ P
Sbjct  23   LTAFLSMSELKRTHAHIITSGLSSDPFTLARLLAAAAIAPSGDLRYAKLLFDA---VAHP  79

Query  188  DLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLL  9
             LF+YN ++R FSQ+  P DS++ YL +  ++ + PD  T+ F++   ++ G    G  +
Sbjct  80   TLFMYNTMIRAFSQSPEPIDSINYYLRML-RSGISPDRLTFPFLLKSCAALGLAGLGRGV  138

Query  8    H  6
            H
Sbjct  139  H  139



>ref|XP_008388588.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At3g05240 [Malus domestica]
Length=566

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 72/130 (55%), Gaps = 6/130 (5%)
 Frame = -3

Query  389  RDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA--IAHAKLIF  216
            + +   LSL+ K  ++S+L Q H  +I   + N++I +++L    ++  A  + +AK +F
Sbjct  3    KHQKIILSLLEKCRSMSELKQIHGLMITASVVNNVIQLSRLVDFCTNSEARDLGYAKKVF  62

Query  215  NAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSS  36
                 +S P ++++N ++RG+S + +P  SL MY  +  +  L PDNFT+ FV+   S  
Sbjct  63   RQ---ISQPSVYIWNSMIRGYSNSGNPVASLIMYREMLQRGYL-PDNFTFPFVLKSCSVI  118

Query  35   GYEKFGGLLH  6
                +G  +H
Sbjct  119  ADYHYGKCVH  128



>ref|XP_011045639.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840 
[Populus euphratica]
Length=722

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 68/123 (55%), Gaps = 4/123 (3%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
            F+SLI  +  + QL+Q HAQ+I++ L +  +  T+L    S   +I H+  +FN      
Sbjct  87   FISLIHGSKTILQLHQIHAQIIIHKLSSSSLITTQLISSSSLRKSINHSLAVFNHHK---  143

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
            P +LF +N ++RG + N+  F+++  +  L  ++ +KPD  TY FV+  ++     + G 
Sbjct  144  PKNLFTFNALIRGLTTNSHFFNAI-FHFRLMLRSGIKPDRLTYPFVLKSMAGLFSTELGM  202

Query  14   LLH  6
             +H
Sbjct  203  AIH  205



>ref|XP_007215675.1| hypothetical protein PRUPE_ppa003946mg [Prunus persica]
 gb|EMJ16874.1| hypothetical protein PRUPE_ppa003946mg [Prunus persica]
Length=539

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 66/123 (54%), Gaps = 4/123 (3%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCVSP  192
            S   K  NL  L Q HA +++NG  ++  A+ +L   F+   AI+         F  V+ 
Sbjct  18   SFWQKCTNLRALKQVHASMVVNGFNSNYSAIRQLI--FAGAMAISGTIDYAHQLFVHVAE  75

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            PD F++N ++RG +Q+ +P +++ +Y  +  +  + PD+FT+ F++   +   + K G  
Sbjct  76   PDTFMWNTMIRGSAQSQNPLNAIVLYTRMENRHAM-PDSFTFPFILKACTKLSWVKMGMG  134

Query  11   LHG  3
            +HG
Sbjct  135  IHG  137



>ref|XP_006360955.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006360956.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like 
isoform X2 [Solanum tuberosum]
Length=666

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 61/114 (54%), Gaps = 4/114 (4%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
            F+SLI  + N  QL Q H Q+I   L ++   VT+L    S   +I +     + FNC  
Sbjct  31   FISLIHSSKNTLQLQQIHGQIIRKNLSSNSRIVTQLISSASLHKSINYG---LSIFNCFL  87

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSG  33
              ++FL+NV++RG  + NS F+   +Y     K  ++PD  TY FV+  V++ G
Sbjct  88   DKNVFLFNVLIRGLKE-NSLFEKSILYFRKMVKMGVRPDKLTYPFVLKSVTALG  140



>ref|XP_002533114.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF29259.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=480

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 38/124 (31%), Positives = 66/124 (53%), Gaps = 6/124 (5%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDL--NAIAHAKLIFNAFNCVS  195
            SL     NL  L Q HA LI+ G  +   A+ +L    + +    I +A  +F+    V+
Sbjct  18   SLWQNCTNLRSLKQIHASLIIKGFNSSSYALRELIFASAIVIPGTIDYAHQLFDQ---VA  74

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             PD+F++N ++RG SQ+ SP  ++S+Y  +     +KPD FT++F++   +   +   G 
Sbjct  75   EPDIFMWNTMMRGSSQSPSPIKAVSLYTQME-NCGIKPDKFTFSFLLKACTRLEWRNMGF  133

Query  14   LLHG  3
             +HG
Sbjct  134  CIHG  137



>ref|XP_010938918.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Elaeis guineensis]
Length=653

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/125 (29%), Positives = 63/125 (50%), Gaps = 6/125 (5%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQR---FSDLNAIAHAKLIFNAFNC  201
            +SLI +A  L QL Q H+ L+   L   +  + K  +R   FS   A+ H + IF+    
Sbjct  20   MSLIQEATTLPQLLQIHSLLLKTSLDRSIFVLAKFLRRCFAFSSPQALPHGRSIFDR---  76

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            +  PD FL+N ++R + Q+  P +SL ++  +R +  +  D+F+ +  +     SG    
Sbjct  77   IHAPDTFLWNTLIRAYLQSQEPVESLHLFHKMRLREGVTVDSFSISLALQACGRSGESTI  136

Query  20   GGLLH  6
            G  +H
Sbjct  137  GRAIH  141



>ref|XP_010940355.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Elaeis guineensis]
Length=531

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 37/121 (31%), Positives = 71/121 (59%), Gaps = 6/121 (5%)
 Frame = -3

Query  362  ITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA--IAHAKLIFNAFNCVSPP  189
            +T   ++S+L +THA +I +GL +D     +L    +   +  + +AKL+F++   V+ P
Sbjct  23   LTAFLSMSELKRTHAHIITSGLFSDPFTFARLLAAAAIAPSGDLRYAKLLFDS---VAHP  79

Query  188  DLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLL  9
            +LF+YN ++R FSQ+  P DS+  YL +  ++++ PD  T+ F++   ++ G    G  +
Sbjct  80   NLFMYNTMIRAFSQSTEPNDSVHYYLRML-RSRISPDRLTFPFLIKSCAALGLADLGRGV  138

Query  8    H  6
            H
Sbjct  139  H  139



>ref|XP_010692438.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 
[Beta vulgaris subsp. vulgaris]
Length=587

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            +S + K +NLSQL Q HAQ+I + L +D     KL   FS  + I    L  N FN +  
Sbjct  21   ISQLHKCSNLSQLKQLHAQIIKSDLHHDPFVAPKLISAFSLCHKIG---LAVNVFNQIQF  77

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTY  66
            P++  YN +++  +QN+  +++ +++ H+  K  + PDNFTY
Sbjct  78   PNVQSYNTLIKAHTQNSQSYEAFNIFFHML-KNGVYPDNFTY  118



>ref|XP_009765478.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Nicotiana sylvestris]
Length=680

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 42/132 (32%), Positives = 69/132 (52%), Gaps = 7/132 (5%)
 Frame = -3

Query  389  RDRNFFLSLITKAANLSQLNQT---HAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLI  219
            + ++  LSL+  + NL+ LN     H  L+  GL +   AV     R + L  +++A  +
Sbjct  10   QQKDIALSLLKSSHNLTTLNHLKSLHVYLLRTGLHHSSFAVGNFITRCASLGLMSYAAQL  69

Query  218  FNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSS  39
            F+    +S P+ F++N ++RGF QN+SP  +L  +  +R    ++PD FTY FV+   S 
Sbjct  70   FDQ---MSEPNSFVWNTLIRGFQQNHSPKCTLYYFDQMRAHN-VQPDKFTYPFVIRACSD  125

Query  38   SGYEKFGGLLHG  3
                  G  LHG
Sbjct  126  LLEFAKGLSLHG  137



>ref|XP_010104643.1| hypothetical protein L484_022020 [Morus notabilis]
 gb|EXC01449.1| hypothetical protein L484_022020 [Morus notabilis]
Length=739

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/140 (27%), Positives = 72/140 (51%), Gaps = 9/140 (6%)
 Frame = -3

Query  404  AATVLRDRNF----FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLN  243
            ++TV  D  F     LSLI +  +L +L Q HAQ++  GL  D  + +KL      S  +
Sbjct  20   SSTVNNDLRFPNYPLLSLIEQCTSLKELKQIHAQMLRTGLFFDPFSASKLITVCAMSSFS  79

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
            ++ +A  +F+    +  P+L+ +N ++R ++ ++ P  S+ ++L +  +    P+ +TY 
Sbjct  80   SLDYAHQVFDQ---IPKPNLYTWNTIIRAYASSSDPIQSIVVFLRMLDQCCESPNKYTYP  136

Query  62   FVVSGVSSSGYEKFGGLLHG  3
            FV+   S     + G   HG
Sbjct  137  FVLKAASELKASRVGRGFHG  156



>ref|XP_006844721.1| hypothetical protein AMTR_s00016p00252780 [Amborella trichopoda]
 gb|ERN06396.1| hypothetical protein AMTR_s00016p00252780 [Amborella trichopoda]
Length=428

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 46/124 (37%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            LSL+ K +  + L Q HA L   GL  D I +TKL    S    I HA L+FN    +  
Sbjct  35   LSLLQKCSTSNHLLQIHAHLFRTGLHRDYILITKLINLCSIHQKIDHATLVFNQ---IEN  91

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSG-VSSSGYEKFGG  15
            P  F +N ++R + ++N P +++ MY +L       PD FTY FV+   V+ S  EK G 
Sbjct  92   PLTFTWNTMIRAYFKSNYPEEAILMY-NLMVIHGFLPDKFTYPFVIKACVAFSSLEK-GK  149

Query  14   LLHG  3
             +HG
Sbjct  150  EIHG  153



>ref|XP_010313232.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic isoform X3 [Solanum lycopersicum]
Length=509

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL---TQRFSDLNAIAHAKLIF  216
            D+ +   L TK   ++ L + HA LI +GL  D IA +++   + +   +  I +A L+F
Sbjct  17   DQPYLHMLETKCTTMTDLKKIHAHLIKSGLIKDKIAASRVLAFSAKSPPIGDINYANLVF  76

Query  215  NAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSS  36
                 +  P+ F +N ++RGFS++++P  ++ +++ +   ++++P   TY  V    +  
Sbjct  77   TH---IENPNPFTWNTIIRGFSESSTPQYAIHLFIEMLNNSQVQPHLLTYPSVFKAYARG  133

Query  35   GYEKFGGLLHG  3
            G  K G  LHG
Sbjct  134  GIAKNGAQLHG  144



>ref|XP_011035790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300 
[Populus euphratica]
Length=546

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/124 (31%), Positives = 67/124 (54%), Gaps = 6/124 (5%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL--TQRFSDLNAIAHAKLIFNAFNCVS  195
            SL     NL  L Q HA LI+ G  ++  A+ +L      +   AI +A  +F     ++
Sbjct  18   SLWKNCNNLLTLKQIHATLIIKGFNSNRAALRELIFAGAMTICGAINYAHQVFAQ---IT  74

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             PD+F++N ++RG SQ+ +P   + +Y  +  +  +KPD FT++F++ G +   + K G 
Sbjct  75   EPDIFMWNTMMRGSSQSKNPSKVVFLYTQMENR-GVKPDKFTFSFLLKGCTRLEWRKTGF  133

Query  14   LLHG  3
             +HG
Sbjct  134  CVHG  137



>ref|XP_010313231.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic isoform X2 [Solanum lycopersicum]
Length=514

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL---TQRFSDLNAIAHAKLIF  216
            D+ +   L TK   ++ L + HA LI +GL  D IA +++   + +   +  I +A L+F
Sbjct  17   DQPYLHMLETKCTTMTDLKKIHAHLIKSGLIKDKIAASRVLAFSAKSPPIGDINYANLVF  76

Query  215  NAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSS  36
                 +  P+ F +N ++RGFS++++P  ++ +++ +   ++++P   TY  V    +  
Sbjct  77   TH---IENPNPFTWNTIIRGFSESSTPQYAIHLFIEMLNNSQVQPHLLTYPSVFKAYARG  133

Query  35   GYEKFGGLLHG  3
            G  K G  LHG
Sbjct  134  GIAKNGAQLHG  144



>emb|CBI35966.3| unnamed protein product [Vitis vinifera]
Length=624

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 71/123 (58%), Gaps = 8/123 (7%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
             LSL+  A +L+Q++Q HAQ +++GL       T L  +  DL++I +A+ + +     S
Sbjct  2    LLSLLRTATSLTQIHQIHAQTLIHGLP----LQTHLIPKLIDLHSIDYARFVLD--QTPS  55

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
            P D F +N ++R ++ + SP +SL +YL +  ++  KP NFT+ FV+   S+ G    G 
Sbjct  56   PTD-FSWNSLIRAYTVHGSPQNSLFLYLKML-RSSTKPSNFTFPFVLKACSTLGSVLEGE  113

Query  14   LLH  6
             +H
Sbjct  114  QIH  116



>ref|XP_003632853.2| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Vitis vinifera]
 ref|XP_010654543.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Vitis vinifera]
 ref|XP_010654544.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Vitis vinifera]
Length=626

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 71/123 (58%), Gaps = 8/123 (7%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
             LSL+  A +L+Q++Q HAQ +++GL       T L  +  DL++I +A+ + +     S
Sbjct  4    LLSLLRTATSLTQIHQIHAQTLIHGLP----LQTHLIPKLIDLHSIDYARFVLD--QTPS  57

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
            P D F +N ++R ++ + SP +SL +YL +  ++  KP NFT+ FV+   S+ G    G 
Sbjct  58   PTD-FSWNSLIRAYTVHGSPQNSLFLYLKML-RSSTKPSNFTFPFVLKACSTLGSVLEGE  115

Query  14   LLH  6
             +H
Sbjct  116  QIH  118



>ref|XP_006437177.1| hypothetical protein CICLE_v10031197mg [Citrus clementina]
 gb|ESR50417.1| hypothetical protein CICLE_v10031197mg [Citrus clementina]
Length=534

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 70/129 (54%), Gaps = 11/129 (9%)
 Frame = -3

Query  374  FLSLITK-AANLSQLNQTHAQLILNGLGNDLIAVTKL----TQRFSDLNAIAHAKLIFNA  210
             LSL+ K   ++  L + HA LI  GL  D IA +++    T    D+N   +A L+F  
Sbjct  22   LLSLLDKQCTSMKDLKKIHAHLIKTGLPKDPIAASRILAFCTSPAGDIN---YAYLVFTQ  78

Query  209  FNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGY  30
               +  P+LF++N ++RGFSQ+++P +++ +++ +   + ++P   TY  +    +  G 
Sbjct  79   ---IKKPNLFIWNTIIRGFSQSSTPRNAILLFIDMLVTSPIQPQRLTYPSLFKAYAQLGL  135

Query  29   EKFGGLLHG  3
             + G  LHG
Sbjct  136  ARDGAQLHG  144



>ref|XP_008459333.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300 
[Cucumis melo]
Length=542

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 69/128 (54%), Gaps = 14/128 (11%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGN------DLIAVTKLTQRFSDLNAIAHAKLIFNAF  207
            SL  K  N   L Q HA LI+NGL +      +LI V+ +    S     AH       F
Sbjct  18   SLWQKCTNFRALKQLHAFLIVNGLNSTNSVLRELIFVSAMV--VSGTMDYAH-----QLF  70

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
              ++ PD+F++N ++RG +Q+  P  ++S+Y  +  +  ++PD FT++FV+   +   ++
Sbjct  71   AQITQPDIFMWNTMIRGSTQSLKPATAVSLYTQMDNR-GVRPDKFTFSFVLKACTKLSWD  129

Query  26   KFGGLLHG  3
            K G ++HG
Sbjct  130  KLGIVIHG  137



>ref|XP_003588753.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES59004.1| PPR containing plant-like protein [Medicago truncatula]
Length=600

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 5/137 (4%)
 Frame = -3

Query  398  TVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KL  222
            T L ++     L +    LS+L Q HA ++  GL N+ + +TK T   S+LN+I +A   
Sbjct  13   TRLTEQTILTLLNSHCNTLSKLTQIHAFILKTGLQNNPLILTKFTSTSSNLNSIHYATSF  72

Query  221  IFNAFNCVSPP----DLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVV  54
            +F   +  S P    D FL+N ++R +SQ      +  ++     +  + P+ FT+ FV+
Sbjct  73   LFPPSHTTSTPTPSYDAFLFNTLIRAYSQTRDSKSNSFLFYRTMLRYGVTPNKFTFPFVL  132

Query  53   SGVSSSGYEKFGGLLHG  3
             G +  G  + G  +HG
Sbjct  133  KGCAGIGSLRLGKCVHG  149



>ref|XP_004250888.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic isoform X1 [Solanum lycopersicum]
Length=522

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL---TQRFSDLNAIAHAKLIF  216
            D+ +   L TK   ++ L + HA LI +GL  D IA +++   + +   +  I +A L+F
Sbjct  17   DQPYLHMLETKCTTMTDLKKIHAHLIKSGLIKDKIAASRVLAFSAKSPPIGDINYANLVF  76

Query  215  NAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSS  36
                 +  P+ F +N ++RGFS++++P  ++ +++ +   ++++P   TY  V    +  
Sbjct  77   TH---IENPNPFTWNTIIRGFSESSTPQYAIHLFIEMLNNSQVQPHLLTYPSVFKAYARG  133

Query  35   GYEKFGGLLHG  3
            G  K G  LHG
Sbjct  134  GIAKNGAQLHG  144



>ref|XP_006407296.1| hypothetical protein EUTSA_v10020185mg [Eutrema salsugineum]
 gb|ESQ48749.1| hypothetical protein EUTSA_v10020185mg [Eutrema salsugineum]
Length=694

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 39/126 (31%), Positives = 69/126 (55%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ +LI  + + SQL Q HA+L++ GL      +TKL    S    I  A+ +F+    
Sbjct  22   SFYAALIDGSTHKSQLRQIHARLLVLGLQFSGFLITKLIHASSSFGDICFARQVFDD---  78

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            +  P +F +N ++RG+S+NN   D+L MY  ++   ++ PD+FT+  ++   S     + 
Sbjct  79   LPRPQIFPWNAIIRGYSRNNLFQDALLMYSKMQ-LARVSPDSFTFPHLLKACSGLPNLQM  137

Query  20   GGLLHG  3
            G L+H 
Sbjct  138  GRLVHA  143



>ref|XP_010465057.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like 
[Camelina sativa]
Length=695

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 38/128 (30%), Positives = 68/128 (53%), Gaps = 8/128 (6%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SLI  +   S L Q HA+L++ GL      +TKL Q  S    +  A+ +F+    
Sbjct  23   SFYASLIDSSTRKSHLRQIHARLLVLGLQFSGFLITKLIQASSSFGDVTFARQVFDG---  79

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMY--LHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
            +  P ++ +N ++RG+S+NN   D+L MY  +HL    ++ PD+FT+  ++       + 
Sbjct  80   LPHPQIYPWNAIIRGYSRNNYFQDALLMYSKMHL---ARVSPDSFTFPHLLKACGGLSHL  136

Query  26   KFGGLLHG  3
              G ++H 
Sbjct  137  PMGRVVHA  144



>ref|XP_007216409.1| hypothetical protein PRUPE_ppa022709mg, partial [Prunus persica]
 gb|EMJ17608.1| hypothetical protein PRUPE_ppa022709mg, partial [Prunus persica]
Length=541

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 70/124 (56%), Gaps = 5/124 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAFNCV  198
            +SL    +N+ +L  THA  I NGL  +  A++KL      S+   +++A L+FN    +
Sbjct  1    MSLAQGCSNMRKLKATHAIFITNGLHLNNYAISKLIAFCALSNSGDLSYASLLFNQ---I  57

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P+ +LYN ++R +S+++ P  ++  +L +  ++ L PDN+T+ FV+   ++  +   G
Sbjct  58   QTPNSYLYNTLIRAYSRSSQPHLAVHYFLLMLKQSSLGPDNYTFNFVILACANCSWLVSG  117

Query  17   GLLH  6
              +H
Sbjct  118  RQIH  121



>ref|NP_179644.1| mitochondrial editing factor 21 [Arabidopsis thaliana]
 sp|Q9SIL5.1|PP165_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g20540 
[Arabidopsis thaliana]
 gb|AAD25654.1| unknown protein [Arabidopsis thaliana]
 gb|AAY78689.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 gb|AEC07025.1| mitochondrial editing factor 21 [Arabidopsis thaliana]
Length=534

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 35/126 (28%), Positives = 66/126 (52%), Gaps = 3/126 (2%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            N+F+  + +  + ++  + +A +I++GL      VTK+      +  + +A  +FN    
Sbjct  11   NYFIPFLQRVKSRNEWKKINASIIIHGLSQSSFMVTKMVDFCDKIEDMDYATRLFNQ---  67

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            VS P++FLYN ++R ++ N+   D + +Y  L  K+   PD FT+ F+    +S G    
Sbjct  68   VSNPNVFLYNSIIRAYTHNSLYCDVIRIYKQLLRKSFELPDRFTFPFMFKSCASLGSCYL  127

Query  20   GGLLHG  3
            G  +HG
Sbjct  128  GKQVHG  133



>ref|XP_008783875.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Phoenix dactylifera]
Length=648

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 44/122 (36%), Positives = 70/122 (57%), Gaps = 7/122 (6%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPP  189
            S +T+ A L    Q HA+LIL+GL  D I  TKL   +S  N++  A    N F+ +   
Sbjct  82   SFVTRKA-LEPGKQLHARLILSGLRFDTILATKLVNLYSVCNSLPDAH---NLFDRIHKG  137

Query  188  DLFLYNVVLRGFSQNNSPFD-SLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            +LFL+NV++RG++  N P++ +L +Y  +     L+PDNFT+ FV+   S+    + G  
Sbjct  138  NLFLWNVLIRGYAW-NGPYEVALKLYYQMLDH-GLEPDNFTFPFVLKACSALSALEVGRD  195

Query  11   LH  6
            +H
Sbjct  196  IH  197



>ref|XP_002324070.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEF04203.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=546

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 38/123 (31%), Positives = 66/123 (54%), Gaps = 4/123 (3%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCVSP  192
            SL     NL  L Q HA LI+ G  ++  A+ +L   F+    I+ A       F  ++ 
Sbjct  18   SLWKNCNNLLALKQIHATLIIKGFNSNRAALRELI--FAGAMTISGAINYAHQVFAQITE  75

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            PD+F++N ++RG SQ+ +P   + +Y  +  +  +KPD FT++F++ G +   + K G  
Sbjct  76   PDIFMWNTMMRGSSQSKNPSKVVLLYTQMENR-GVKPDKFTFSFLLKGCTRLEWRKTGFC  134

Query  11   LHG  3
            +HG
Sbjct  135  VHG  137



>ref|XP_010935185.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, 
chloroplastic-like [Elaeis guineensis]
Length=505

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 72/131 (55%), Gaps = 6/131 (5%)
 Frame = -3

Query  389  RDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA--IAHAKLIF  216
            RD  ++  L+   ++   + + HAQ+I  G G++    +KL  R++DL    I  A+ +F
Sbjct  16   RDSFYYSRLLQCHSSPKSVARIHAQIIATGHGHNPFLASKLVSRYTDLGGRGIDDARRVF  75

Query  215  NAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSS  36
            +        D+ L+NV++R ++ +    +++ +Y HLR +T ++P+ +TY FV+   ++ 
Sbjct  76   DR---APQRDILLWNVMIRSYANSGPQTEAIILYCHLR-RTSVRPNCYTYPFVIKACAAL  131

Query  35   GYEKFGGLLHG  3
            G E  G  +H 
Sbjct  132  GDENEGRAVHA  142



>ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, 
mitochondrial-like isoform X2 [Citrus sinensis]
Length=566

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 42/125 (34%), Positives = 71/125 (57%), Gaps = 3/125 (2%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCVS  195
            L+L+    +L +L Q H++++  GL N+ + +TK T   SDLNAI +A  +IF+  +   
Sbjct  27   LALLQSCNSLPKLAQIHSRILKLGLLNNPLVLTKFTATSSDLNAIDYATSVIFSPESDTL  86

Query  194  PPDLFLYNVVLRGFSQ-NNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              D FL+N ++R ++Q NN   +S+  Y +L  +  + P+ FTY FV+   +  G    G
Sbjct  87   LYDTFLFNTIIRAYAQINNLKTNSIECY-NLMLEYGVSPNKFTYPFVLKACAGIGDLNLG  145

Query  17   GLLHG  3
              +HG
Sbjct  146  KSVHG  150



>ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, 
mitochondrial-like isoform X1 [Citrus sinensis]
Length=600

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 42/125 (34%), Positives = 71/125 (57%), Gaps = 3/125 (2%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCVS  195
            L+L+    +L +L Q H++++  GL N+ + +TK T   SDLNAI +A  +IF+  +   
Sbjct  27   LALLQSCNSLPKLAQIHSRILKLGLLNNPLVLTKFTATSSDLNAIDYATSVIFSPESDTL  86

Query  194  PPDLFLYNVVLRGFSQ-NNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              D FL+N ++R ++Q NN   +S+  Y +L  +  + P+ FTY FV+   +  G    G
Sbjct  87   LYDTFLFNTIIRAYAQINNLKTNSIECY-NLMLEYGVSPNKFTYPFVLKACAGIGDLNLG  145

Query  17   GLLHG  3
              +HG
Sbjct  146  KSVHG  150



>ref|XP_010467800.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Camelina sativa]
Length=534

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 35/126 (28%), Positives = 67/126 (53%), Gaps = 3/126 (2%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            N+F++L+ +  + ++  + HA +I++GL      VTK+      +  + +A  +FN    
Sbjct  11   NYFVTLLQRFKSRNEWKKIHACIIIHGLSQSSFMVTKMVDSCDKIGDMEYATRLFNQ---  67

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            VS P++FLYN ++R ++ ++   + +  Y  L  K+   PD FT+ F+    +S G    
Sbjct  68   VSNPNVFLYNSIIRAYTHHSLYCEVIRTYRQLLRKSIELPDRFTFPFMFKSCASLGSCYL  127

Query  20   GGLLHG  3
            G  +HG
Sbjct  128  GKQVHG  133



>ref|XP_002884925.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61184.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=694

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 68/126 (54%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SLI  + + +QL Q HA+L++ GL      +TKL    S    I  A+ +F+    
Sbjct  22   SFYASLIDSSTHKAQLRQIHARLLVLGLQFSGFLITKLIHASSSYGDITFARQVFDD---  78

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            +  P +F +N ++RG+S+NN   D+L MY  ++   ++ PD+FT+  ++       + + 
Sbjct  79   LPRPQVFPWNAIIRGYSRNNHFQDALLMYSKMQ-LARVSPDSFTFPHLLKACGGLSHLQM  137

Query  20   GGLLHG  3
            G  +H 
Sbjct  138  GRFVHA  143



>gb|KFK37135.1| hypothetical protein AALP_AA4G217600 [Arabis alpina]
Length=537

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = -3

Query  380  NFFLSLI-TKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFN  204
            N +L LI T    + +L Q HA LI  GL +D I  +++    S L+ I +A  +F   N
Sbjct  22   NSYLRLIDTHCTTMRELKQIHANLIKTGLISDTIVASRVLAFSSSLD-IDYAYYVFTRIN  80

Query  203  CVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEK  24
              +P   F++N ++RG+S+++ P  ++S+++ +     +KP   TY  V  G +S G   
Sbjct  81   EKNP---FVWNTIIRGYSRSSLPEMAISIFVDMLCSESVKPQRLTYPSVFKGYASLGLAL  137

Query  23   FGGLLHG  3
             G +LHG
Sbjct  138  DGKVLHG  144



>ref|XP_010274819.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Nelumbo nucifera]
Length=556

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 66/124 (53%), Gaps = 3/124 (2%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
             +S + K + + +L   +A +I N +  D  ++ +     S+L+ + +A L   AF+ V 
Sbjct  7    LISRLRKCSTVRELESIYASMIKNKVHQDCFSINQFVSACSNLDRMDYALL---AFSHVE  63

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             P++F+YN V+RG  Q +S F +L  YL +     + P +FT++ +V   +      FG 
Sbjct  64   TPNVFVYNAVIRGSVQCSSSFQALQFYLEMLKDDGVFPTSFTFSSIVKACTQVSEVGFGE  123

Query  14   LLHG  3
            ++HG
Sbjct  124  IVHG  127



>ref|XP_009379143.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Pyrus x bretschneideri]
Length=552

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 4/110 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            L L+    N  ++ Q HAQL+++GL +  +   +L Q +  ++ I HA  IF+    +S 
Sbjct  30   LVLLQMCCNFQEVRQVHAQLVVSGLLDRPLNAGRLLQSYVIVSQIHHALSIFDR---ISY  86

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS  42
            PD+F YN ++RG     SP+ SL +Y  L    +LKPDN+TY FV+   S
Sbjct  87   PDVFAYNNMIRGLILVKSPYHSLLLYNKLL-LDRLKPDNYTYTFVLKACS  135



>ref|XP_008784659.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like 
[Phoenix dactylifera]
Length=588

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 44/125 (35%), Positives = 67/125 (54%), Gaps = 11/125 (9%)
 Frame = -3

Query  392  LRDRNFFLSLITKAANLSQLNQTHAQLILNGLGND-------LIAVTKLTQRFSDLNAIA  234
            L  +N FLSL+  A   SQ+ Q HAQLI   L +D       L A  +L+   S     A
Sbjct  9    LLSQNPFLSLLQNARTASQIFQIHAQLICRALMSDSFVASRLLFAACELSNPSSIHLTAA  68

Query  233  HAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVV  54
            +A+LIF+    V  P+ F +N ++R  SQ ++P  +L  +  +R K+ +  DN+TY FV+
Sbjct  69   YAELIFSQ---VHHPNTFFWNTIIRFHSQTSNPLRALLFFSQMR-KSGIFTDNYTYPFVL  124

Query  53   SGVSS  39
               +S
Sbjct  125  KACAS  129



>emb|CDY52870.1| BnaCnng23580D [Brassica napus]
Length=210

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 69/126 (55%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SLI  + + SQL Q HA+L + GL    + +TKL    S    I  A+ +F+    
Sbjct  22   SFYASLIGSSTHKSQLRQIHARLFVLGLQLSSLLITKLIHASSSFGDIRFARKVFDD---  78

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            +  P +F +N ++ G+S+NN   D+L MY  ++   ++ PD+FT+  ++   S   + + 
Sbjct  79   LPRPQIFPWNAIITGYSRNNLFQDALLMYSKMQ-LARVSPDSFTFPHLLKACSGLPHLQM  137

Query  20   GGLLHG  3
            G L+H 
Sbjct  138  GRLVHA  143



>ref|XP_009350396.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g05240 [Pyrus x bretschneideri]
Length=645

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 37/124 (30%), Positives = 69/124 (56%), Gaps = 5/124 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAFNCV  198
            LSL+ K  ++S+L Q H  +I   + N++I +++L      S+   + + K     F  +
Sbjct  88   LSLLEKCRSMSELKQIHGLMITTSVVNNVIQLSRLIDFCTNSETRNLGYGKK--KVFQQI  145

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
            S P ++++N ++RG+S + +P +SL MY  +  +  L PDNFT+ FV+   S     ++G
Sbjct  146  SQPSVYIWNSMIRGYSNSENPVESLIMYRKMLHRGYL-PDNFTFPFVLKSCSVIADYRYG  204

Query  17   GLLH  6
              +H
Sbjct  205  KCVH  208



>ref|XP_007139556.1| hypothetical protein PHAVU_008G039700g [Phaseolus vulgaris]
 gb|ESW11550.1| hypothetical protein PHAVU_008G039700g [Phaseolus vulgaris]
Length=604

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 11/127 (9%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            LS + K  NL+ +NQ HAQ++   L +DL    KL   FS    +A A    N FN +  
Sbjct  25   LSQLHKCTNLNHVNQIHAQILKANLHHDLFVAPKLIAAFSLCRHLASA---VNVFNQLPH  81

Query  191  PDLFLYNVVLRGFSQNNS----PFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEK  24
            P++ LYN ++R  + N+S    PF++    L    K+ L PDNFTY  ++   + S    
Sbjct  82   PNVHLYNSIIRAHAHNHSHPSLPFNTFLQML----KSGLFPDNFTYPSLLKACTDSSSLP  137

Query  23   FGGLLHG  3
               ++H 
Sbjct  138  LVRMIHA  144



>ref|XP_006293749.1| hypothetical protein CARUB_v10022711mg [Capsella rubella]
 gb|EOA26647.1| hypothetical protein CARUB_v10022711mg [Capsella rubella]
Length=739

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 66/125 (53%), Gaps = 5/125 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL--TQRFSDLNAIAHAKLIFNAFNCV  198
            +SLI + +NL QL QTHA +I  G  +D  + +KL      S   ++ +A+ +F+    +
Sbjct  35   ISLIDRCSNLRQLKQTHAHMIRTGTFSDPYSASKLFAIAALSSFASLEYARKVFDE---I  91

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P+ F +N ++R ++    P  S+ ++L +  +++  P+ +T+ F+V   +       G
Sbjct  92   PQPNSFTWNTLIRAYASGPDPVRSIWIFLDMVSESQCYPNKYTFPFLVKAAAEVSSLSLG  151

Query  17   GLLHG  3
              LHG
Sbjct  152  QSLHG  156



>ref|XP_010250014.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Nelumbo nucifera]
Length=737

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 73/125 (58%), Gaps = 6/125 (5%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAFNCV  198
            LSL++K  ++  L Q H+Q+I  GL N   A++KL +    S    +++A LIF    C+
Sbjct  35   LSLLSKCRDIENLKQIHSQIIKTGLHNTQFALSKLIEFCAISPFGDLSYALLIFA---CI  91

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P++F++N ++RG S ++SP  +++ Y+ +     ++P+++T+ F++   + +   + G
Sbjct  92   EEPNVFIWNTIIRGHSLSSSPILAVAFYVRML-LAGVEPNSYTFPFLLKSCAQATATQQG  150

Query  17   GLLHG  3
              +H 
Sbjct  151  RQVHA  155



>ref|XP_006395295.1| hypothetical protein EUTSA_v10003866mg [Eutrema salsugineum]
 gb|ESQ32581.1| hypothetical protein EUTSA_v10003866mg [Eutrema salsugineum]
Length=598

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 4/122 (3%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            L  + K ANLSQ+ Q HAQ+I   L  DL    KL    + L+      L    FN V  
Sbjct  23   LQDLPKCANLSQVKQLHAQIIRRNLHQDLHIAPKL---ITALSLCRQMTLAVGVFNQVQQ  79

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            P++ L N ++R  +QN+ P+ + S++  ++ +  L  DNFTY F++   S   +     +
Sbjct  80   PNVHLCNSLIRAHAQNSQPYQAFSVFSEMQ-RIGLFADNFTYPFLLKACSGQSWLPVVKM  138

Query  11   LH  6
            +H
Sbjct  139  MH  140



>ref|XP_009794324.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300 
[Nicotiana sylvestris]
Length=538

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 67/122 (55%), Gaps = 2/122 (2%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPP  189
            SL +K  +L  L Q HA +I++G  ++  A+ +L   FS +   A        F  ++ P
Sbjct  18   SLWSKCKDLQYLKQIHALMIISGFNSNRFALRELIYAFS-VTFSASIHYAHKLFAQITQP  76

Query  188  DLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLL  9
            DLF++N +LRG +Q+  P  +LS+Y  +  K  ++PD++T+ F++   +   +   G  +
Sbjct  77   DLFMWNTMLRGSAQSLRPSLALSLYAQME-KRYIRPDSYTFPFILKACTKLSWLVSGLTI  135

Query  8    HG  3
            HG
Sbjct  136  HG  137



>ref|XP_003533068.2| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g15930-like [Glycine max]
Length=738

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 70/125 (56%), Gaps = 10/125 (8%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAH--AKLIF--NAFN  204
            +SL+ K  ++ QL Q H+  I  GL +D      L Q+       AH   K+I+    F+
Sbjct  37   ISLLEKCKSMYQLKQIHSHTIKMGLSSD-----PLFQKRVIAFCCAHESGKMIYARQVFD  91

Query  203  CVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEK  24
             +  P LF++N +++G+S+ N P + +SMYL L   + +KPD FT+ F++ G + +   +
Sbjct  92   AIPQPTLFIWNTMIKGYSRINHPQNGVSMYL-LMLASNIKPDRFTFPFLLKGFTRNMALQ  150

Query  23   FGGLL  9
            +G +L
Sbjct  151  YGKVL  155



>emb|CBI17228.3| unnamed protein product [Vitis vinifera]
Length=590

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 68/124 (55%), Gaps = 4/124 (3%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
            F+ LI  +  L QL+Q HAQ+ L+ L ++   VT+L      L ++ +A    + F C  
Sbjct  43   FIPLIHASNTLPQLHQIHAQIFLHNLFSNSRVVTQLISSSCSLKSLDYA---LSIFRCFD  99

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             P+LF++N ++RG ++N+    S+S ++ L  +  ++PD  T  FV+  V++      G 
Sbjct  100  HPNLFVFNALIRGLAENSRFEGSVSHFV-LMLRLSIRPDRLTLPFVLKSVAALVDVGLGR  158

Query  14   LLHG  3
             LHG
Sbjct  159  CLHG  162



>ref|XP_010542851.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 
isoform X1 [Tarenaya hassleriana]
Length=694

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 39/126 (31%), Positives = 66/126 (52%), Gaps = 4/126 (3%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SLI  +     L Q HA+L+L G       +TKL    S+L  + +A+ +F+ F  
Sbjct  24   SFYASLIDSSTRKGHLRQVHARLLLLGFQFSGFLITKLIHASSELGDMCYARQVFDDF--  81

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
               PD+F +N ++RG+ +N    D+L MY  +  ++ + PD FT+  V+   S     + 
Sbjct  82   -PHPDVFPWNAIIRGYCRNGFLRDALQMY-SMMLQSWVSPDAFTFPHVLKACSGLPALET  139

Query  20   GGLLHG  3
            G  +HG
Sbjct  140  GRRIHG  145



>ref|XP_002270439.2| PREDICTED: pentatricopeptide repeat-containing protein At1g04840 
[Vitis vinifera]
Length=677

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 68/124 (55%), Gaps = 4/124 (3%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
            F+ LI  +  L QL+Q HAQ+ L+ L ++   VT+L      L ++ +A    + F C  
Sbjct  43   FIPLIHASNTLPQLHQIHAQIFLHNLFSNSRVVTQLISSSCSLKSLDYA---LSIFRCFD  99

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             P+LF++N ++RG ++N+    S+S ++ L  +  ++PD  T  FV+  V++      G 
Sbjct  100  HPNLFVFNALIRGLAENSRFEGSVSHFV-LMLRLSIRPDRLTLPFVLKSVAALVDVGLGR  158

Query  14   LLHG  3
             LHG
Sbjct  159  CLHG  162



>ref|XP_007023277.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
 gb|EOY25899.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
Length=723

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 42/128 (33%), Positives = 67/128 (52%), Gaps = 11/128 (9%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL-----TQRFSDLNAIAHAKLIFNAF  207
            L LI    ++ QL Q H Q + +GL    I+  KL     T    D+N   HA  +FN  
Sbjct  21   LFLIENCKSMDQLQQIHCQTVKSGLIRKPISQNKLISFCCTNESGDMN---HALQMFNQI  77

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
            +   P  +FL+N +++G+S+ + P   +SMYL++  K  +KPD++T+ F++ G       
Sbjct  78   S--EPKSVFLWNTMIKGYSRVDCPKHGISMYLNML-KQDVKPDDYTFPFLLKGFDRDVGL  134

Query  26   KFGGLLHG  3
              G  LHG
Sbjct  135  SCGKKLHG  142



>gb|KGN52474.1| hypothetical protein Csa_5G636660 [Cucumis sativus]
Length=542

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 2/122 (2%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPP  189
            SL  K  N   L Q HA LI+NGL N   +V +     S +            F  +S P
Sbjct  18   SLWQKCTNFRSLKQLHAFLIVNGL-NSTTSVLRELIFVSAIVVSGTMDYAHQLFAQISQP  76

Query  188  DLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLL  9
            D+F++N ++RG +Q   P  ++S+Y  +  +  ++PD FT++FV+   +   + K G  +
Sbjct  77   DIFMWNTMIRGSAQTLKPATAVSLYTQMENR-GVRPDKFTFSFVLKACTKLSWVKLGFGI  135

Query  8    HG  3
            HG
Sbjct  136  HG  137



>ref|XP_010428453.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630 
isoform X2 [Camelina sativa]
Length=639

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 69/114 (61%), Gaps = 7/114 (6%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQR--FSDLNAIAHAK-LIFNAFNC  201
            LSL+T   +L  L Q H   I +G+ +D     KL  +   S  +A+ +A+ L+F    C
Sbjct  6    LSLLTSCKSLRALTQIHGFFIKSGVDSDSYFTGKLILQCAVSIPDALPYARRLLF----C  61

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSS  39
               PD F++N ++RG+S+++ P +S+++++ +  K  + PD+F++AFVV  V++
Sbjct  62   FPEPDAFMFNTLVRGYSESDDPCNSVAVFVEMIRKGLVFPDSFSFAFVVKAVAN  115



>ref|XP_010428452.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630 
isoform X1 [Camelina sativa]
Length=640

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 69/114 (61%), Gaps = 7/114 (6%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQR--FSDLNAIAHAK-LIFNAFNC  201
            LSL+T   +L  L Q H   I +G+ +D     KL  +   S  +A+ +A+ L+F    C
Sbjct  6    LSLLTSCKSLRALTQIHGFFIKSGVDSDSYFTGKLILQCAVSIPDALPYARRLLF----C  61

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSS  39
               PD F++N ++RG+S+++ P +S+++++ +  K  + PD+F++AFVV  V++
Sbjct  62   FPEPDAFMFNTLVRGYSESDDPCNSVAVFVEMIRKGLVFPDSFSFAFVVKAVAN  115



>ref|XP_006842814.1| hypothetical protein AMTR_s00081p00056740 [Amborella trichopoda]
 gb|ERN04489.1| hypothetical protein AMTR_s00081p00056740 [Amborella trichopoda]
Length=406

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 66/123 (54%), Gaps = 2/123 (2%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            L L+    ++ QL Q HAQ    GL ND  A++K+ + F  ++           F  +S 
Sbjct  37   LFLLQSCTSMKQLKQIHAQFFKTGLHNDQFALSKIIE-FCSISPFGDLDFAHLLFGTISE  95

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            P+ F++N ++RG S +++P DSLS+Y+ +   +   P+N+T+ F++   +     + G  
Sbjct  96   PNQFIWNTLIRGHSLSSTPMDSLSLYIAML-LSLTPPNNYTFPFLLKSCACELAVEEGRQ  154

Query  11   LHG  3
            +HG
Sbjct  155  IHG  157



>ref|XP_007216544.1| hypothetical protein PRUPE_ppb007734mg [Prunus persica]
 gb|EMJ17743.1| hypothetical protein PRUPE_ppb007734mg [Prunus persica]
Length=297

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 68/125 (54%), Gaps = 5/125 (4%)
 Frame = -3

Query  371  LSLITK-AANLSQLNQTHAQLILNGLGNDLIAVTK-LTQRFSDLNAIAHAKLIFNAFNCV  198
            LS++ K   N+  L + HA LI  GL +D +A ++ L    S    I +A ++F     +
Sbjct  24   LSMLEKQCTNMKDLQKIHAHLIKTGLVSDTVAASRVLAFCASPAGNINYAYMVFRN---I  80

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P+LF++N ++RGFS++ SP  ++S+++ +   + ++P   TY  V    +  G  + G
Sbjct  81   QNPNLFIWNTIIRGFSESPSPEIAISLFIDMLVTSAIEPHRLTYPSVFKAYAQLGLAQDG  140

Query  17   GLLHG  3
              LHG
Sbjct  141  AQLHG  145



>ref|XP_011044784.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic [Populus euphratica]
 ref|XP_011044785.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic [Populus euphratica]
Length=535

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 72/141 (51%), Gaps = 11/141 (8%)
 Frame = -3

Query  410  AAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL----TQRFSDLN  243
            A+ +  + D+ +   L     ++  L + HAQLI  GL  D IA +++    T    D+N
Sbjct  13   ASISKFISDQPYLSMLDKNCTSMKDLQKIHAQLIKTGLAKDPIAASRVLAFCTSPAGDIN  72

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKT-KLKPDNFTY  66
               +A L+F     +  P+LF++N ++RGFSQ+++P  ++S+++ +   +   +P   TY
Sbjct  73   ---YAYLVFTQ---IRQPNLFVWNTIIRGFSQSSTPHYAISLFIDMMFTSPTTQPQRLTY  126

Query  65   AFVVSGVSSSGYEKFGGLLHG  3
              V    +  G    G  LHG
Sbjct  127  PSVFKAYAQLGLAHEGAQLHG  147



>ref|XP_006290812.1| hypothetical protein CARUB_v10016917mg [Capsella rubella]
 gb|EOA23710.1| hypothetical protein CARUB_v10016917mg [Capsella rubella]
Length=584

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  341  SQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPPDLFLYNVVL  162
            +QL + HA ++  G       +T+L +    L  + +A+ +F+  +    P +FL+N + 
Sbjct  25   NQLKKIHAIVLRTGFSEKNSLLTQLLENLVLLGDMCYARQLFDEMH---KPRIFLWNSLF  81

Query  161  RGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLLHG  3
            +G+ +N+ PF+S+ +Y  +R    ++PD FTY FVV  +S  G+   G  LH 
Sbjct  82   KGYVKNHLPFESVLLYKKMR-DLGVRPDEFTYPFVVKAISQLGFFPCGSALHA  133



>ref|XP_008380208.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic-like [Malus domestica]
Length=533

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/141 (26%), Positives = 73/141 (52%), Gaps = 11/141 (8%)
 Frame = -3

Query  410  AAAATVLRDRNFFLSLI-TKAANLSQLNQTHAQLILNGLGNDLIAVTKL----TQRFSDL  246
            +A+ +     N  LS++  +  ++  L + HA L+  GL  D +  ++L      R  D+
Sbjct  11   SASISKFISENPHLSMLENQCTSMKDLQKIHAHLLKTGLTKDTVVASRLLAFSASRAGDI  70

Query  245  NAIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTY  66
            N   +A ++F     +  P+ F++N ++RGFS++ +P  ++S+++ +   ++++P   TY
Sbjct  71   N---YAYMVFRR---IKKPNPFIWNTIIRGFSESQNPKTAVSLFIEMLVASEIEPQRLTY  124

Query  65   AFVVSGVSSSGYEKFGGLLHG  3
              V    S  G  K G  LHG
Sbjct  125  PSVFKAYSQVGLAKDGAQLHG  145



>ref|XP_010419202.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840-like 
[Camelina sativa]
Length=588

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 69/114 (61%), Gaps = 7/114 (6%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQR--FSDLNAIAHAK-LIFNAFNC  201
            LSL+T   +L  L Q H   I +G+ +D     KL  +   S  +A+ +A+ L+F    C
Sbjct  7    LSLLTNCKSLRALTQIHGFFIKSGVDSDSYFTGKLILQCAVSIPDALPYARRLLF----C  62

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSS  39
               PD F++N ++RG+S+++ P +S+++++ +  K  + PD+F++AFVV  V++
Sbjct  63   FPEPDAFMFNTLVRGYSESDDPGNSVAVFVEMIRKGLVFPDSFSFAFVVKAVAN  116



>ref|XP_006468953.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, 
chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006468954.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, 
chloroplastic-like isoform X2 [Citrus sinensis]
 ref|XP_006468955.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26630, 
chloroplastic-like isoform X3 [Citrus sinensis]
Length=435

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            L L+ K  N  QL   HA++I +GL ND + V KL    S      HA L+F+   C   
Sbjct  34   LVLLRKCRNFGQLKLIHAKIIRHGLSNDQLLVRKLLDLCSFYGKTDHALLVFSQIQC---  90

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSG-VSSSGYEKFGG  15
            P +F +N+++R  + N S   +L +Y +L      +PD FT+ FV+   V+S   EK G 
Sbjct  91   PHVFTWNLMIRALTINGSSQQALLLY-NLMICNGFRPDKFTFPFVIKACVASLAIEK-GK  148

Query  14   LLHG  3
             +HG
Sbjct  149  EVHG  152



>ref|XP_010095598.1| hypothetical protein L484_007437 [Morus notabilis]
 gb|EXB61171.1| hypothetical protein L484_007437 [Morus notabilis]
Length=631

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 41/131 (31%), Positives = 72/131 (55%), Gaps = 10/131 (8%)
 Frame = -3

Query  386  DRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAF  207
            +R   + L+ K  ++S +  THA++I NG   D   V +L +  S+LN+I +A  IF   
Sbjct  27   NRKEVIFLLQKCKHISHVQSTHAKIIRNGQEQDPFIVFELLRLCSNLNSIDYASKIFQR-  85

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
              +  P++FLY  ++ GF  + S FD++ +Y  +   + + PDN+    VVS + + G++
Sbjct  86   --IQTPNVFLYTALIDGFVLHGSYFDAILLYCRMIDDS-IVPDNYA---VVSALKACGFQ  139

Query  26   ---KFGGLLHG  3
               K G  +HG
Sbjct  140  LALKLGREIHG  150



>gb|KHN18567.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=549

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 39/140 (28%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            ++ RA+   V+++    LSL+    ++S L Q H Q++LNGL      V KL   +    
Sbjct  3    VLVRASGKRVVQEH--LLSLLQNCNSVSTLLQIHTQVLLNGLSQKNFIVAKLLSFYIASG  60

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
             + HA  +F   +    P   ++N V+RG++++++P+ ++  Y H+   +K +PD FT++
Sbjct  61   HLQHAHHLFAKMD---NPTTTVWNHVIRGYARSHTPWKAVECYTHMV-SSKAEPDGFTHS  116

Query  62   FVVSGVSSSGYEKFGGLLHG  3
             ++S  +  G  K G  +H 
Sbjct  117  SLLSACARGGLVKEGEQVHA  136



>ref|XP_010091451.1| hypothetical protein L484_000760 [Morus notabilis]
 ref|XP_010102153.1| hypothetical protein L484_021387 [Morus notabilis]
 gb|EXB44509.1| hypothetical protein L484_000760 [Morus notabilis]
 gb|EXB92403.1| hypothetical protein L484_021387 [Morus notabilis]
Length=530

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 39/134 (29%), Positives = 70/134 (52%), Gaps = 4/134 (3%)
 Frame = -3

Query  401  ATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQR-FSDLNAIAHAK  225
            A  + D+     L  + A +S L + HA LI  GL +  IA ++L     S    I +A 
Sbjct  20   AKFISDQPHLSMLEKRCATMSDLRKIHAHLIKTGLISHTIASSRLLAFCASPAGNINYAL  79

Query  224  LIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGV  45
            ++F+    +  P+LF++N ++RGFS++++P  ++ +++ +   + L+P   TY  V    
Sbjct  80   MVFSQ---IQNPNLFIWNTIIRGFSRSSTPQTAIFLFIDMLVGSPLEPQRLTYPSVFKAY  136

Query  44   SSSGYEKFGGLLHG  3
            +  G   FG  LHG
Sbjct  137  AQLGLACFGAQLHG  150



>ref|XP_003550788.2| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Glycine max]
Length=551

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 39/140 (28%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -3

Query  422  MICRAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN  243
            ++ RA+   V+++    LSL+    ++S L Q H Q++LNGL      V KL   +    
Sbjct  5    VLVRASGKRVVQEH--LLSLLQNCNSVSTLLQIHTQVLLNGLSQKNFIVAKLLSFYIASG  62

Query  242  AIAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
             + HA  +F   +    P   ++N V+RG++++++P+ ++  Y H+   +K +PD FT++
Sbjct  63   HLQHAHHLFAKMD---NPTTTVWNHVIRGYARSHTPWKAVECYTHMV-SSKAEPDGFTHS  118

Query  62   FVVSGVSSSGYEKFGGLLHG  3
             ++S  +  G  K G  +H 
Sbjct  119  SLLSACARGGLVKEGEQVHA  138



>ref|XP_004141574.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like 
[Cucumis sativus]
Length=542

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 2/122 (2%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPP  189
            SL  K  N   L Q HA LI+NGL N   +V +     S +            F  +S P
Sbjct  18   SLWQKCTNFRSLKQLHAFLIVNGL-NSTTSVLRELIFVSAIVVSGTMDYAHQLFAQISQP  76

Query  188  DLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLL  9
            D+F++N ++RG +Q   P  ++S+Y  +  +  ++PD FT++FV+   +   + K G  +
Sbjct  77   DIFMWNTMIRGSAQTLKPATAVSLYTQMENR-GVRPDKFTFSFVLKACTKLSWVKLGFGI  135

Query  8    HG  3
            HG
Sbjct  136  HG  137



>ref|XP_009377436.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g42920, chloroplastic [Pyrus x bretschneideri]
Length=503

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/122 (29%), Positives = 63/122 (52%), Gaps = 4/122 (3%)
 Frame = -3

Query  365  LITKAANLSQLNQTHAQLILNGLGNDLIAVTK-LTQRFSDLNAIAHAKLIFNAFNCVSPP  189
            L  +  ++  L + HA L+  GL ND IA ++ L    S    I +A   +  F  +  P
Sbjct  27   LENQCTSMKDLQKIHAHLLKTGLANDTIATSRVLAFSASPPGDINYA---YTVFRHIKEP  83

Query  188  DLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLL  9
            + F++N ++RGFS++ +P  ++S++  +   ++++P   TY  V    +  G  K G  L
Sbjct  84   NPFIWNTIIRGFSESQNPKXAISLFTEMLVASEIEPQXITYPSVFKAYAQDGLAKNGAQL  143

Query  8    HG  3
            HG
Sbjct  144  HG  145



>ref|XP_011039733.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Populus euphratica]
Length=630

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 65/125 (52%), Gaps = 3/125 (2%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCVS  195
            L+L+      S+L Q H  ++ +GL N+ + +TK T   SDL  I +A   +F+  +   
Sbjct  54   LALLQACNTFSKLTQIHTHILKSGLQNNPLVLTKFTATSSDLEVINYATSFLFSPESDTR  113

Query  194  PPDLFLYNVVLRGFSQ-NNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              D FLYN + R ++Q NN    ++ +Y  +  + KL P+ FTY FV+   +  G    G
Sbjct  114  LYDTFLYNTITRAYAQTNNLKAKAIDVYKLMLERKKL-PNKFTYPFVLKACAGIGDLNLG  172

Query  17   GLLHG  3
              +HG
Sbjct  173  KSVHG  177



>ref|XP_008344823.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Malus domestica]
Length=592

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 65/125 (52%), Gaps = 5/125 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAFNCV  198
            LS I    N+ QL Q HAQ++  GL  D  + +KL      S  +++ +A+ +F+    +
Sbjct  34   LSSIDHCTNIKQLKQVHAQMLRTGLLFDPYSASKLITVCALSSFSSLDYARQVFDQ---I  90

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P+L+ +N ++R ++ +  P +S+ ++L +  +    P+ FTY FV+   S     + G
Sbjct  91   PQPNLYSWNTLIRAYASSTDPTESILVFLEMLYRCMESPNKFTYPFVIKAASELRVLELG  150

Query  17   GLLHG  3
               HG
Sbjct  151  RGFHG  155



>ref|XP_010678470.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010678471.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010678472.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010678473.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Beta vulgaris subsp. vulgaris]
Length=551

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/123 (28%), Positives = 65/123 (53%), Gaps = 4/123 (3%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
             SL+    ++ QL Q HAQ+ +NG  +    + KL   ++      +A    N FN +  
Sbjct  22   FSLLKTCNSIKQLTQIHAQIFINGFSHKSFLIAKLNSLYATYGYFQNA---CNMFNEMPN  78

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            P   ++N V+RG++ + +P  S+ +Y  +  + +L PD +T+++V+S  + S   + G  
Sbjct  79   PSTTVWNQVIRGYANSETPQKSVELYSRML-EERLVPDEYTFSYVLSACARSSMFREGEQ  137

Query  11   LHG  3
            +HG
Sbjct  138  IHG  140



>ref|XP_002276684.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g28640 [Vitis vinifera]
Length=511

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 68/124 (55%), Gaps = 5/124 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAFNCV  198
            +SL    +N+ Q    HA  I+NGL  +  A++KL      S+  ++++A LIF+    +
Sbjct  8    ISLAQSCSNMRQFKAIHALFIVNGLHLNNYAISKLISFCALSNSGSLSYASLIFSQ---I  64

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P+LF YN ++R +S++++P  +L  +  +     + PD  T+ F++S  ++S +   G
Sbjct  65   QNPNLFAYNTLIRAYSRSSTPQLALHYFQLMLDDENVGPDQHTFPFIISACTNSLWMLLG  124

Query  17   GLLH  6
              +H
Sbjct  125  KQIH  128



>gb|KDO60957.1| hypothetical protein CISIN_1g046039mg [Citrus sinensis]
Length=502

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/118 (29%), Positives = 64/118 (54%), Gaps = 10/118 (8%)
 Frame = -3

Query  344  LSQLNQTHAQLILNGLGNDLIAVTKL----TQRFSDLNAIAHAKLIFNAFNCVSPPDLFL  177
            +  L + HA LI  GL  D IA +++    T    D+N   +A L+F     +  P+LF+
Sbjct  1    MKDLKKIHAHLIKTGLAKDPIAASRILAFCTSPAGDIN---YAYLVFTQ---IKKPNLFI  54

Query  176  YNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLLHG  3
            +N ++RGFSQ+++P +++ +++ +   + ++P   TY  +    +  G  + G  LHG
Sbjct  55   WNTIIRGFSQSSTPRNAILLFIDMLVTSPIQPQRLTYPSLFKAYAQLGLARDGAQLHG  112



>ref|XP_002515531.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF46980.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=397

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 68/126 (54%), Gaps = 4/126 (3%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCVS  195
            LSL+      S+L Q H Q++  GL N+ + +TK T   S+L+AI +A   IF+  +   
Sbjct  36   LSLLQDCNTFSKLTQIHTQILKLGLSNNPLVLTKYTSTSSNLHAIDYASSFIFSPESDKR  95

Query  194  PPDLFLYNVVLRGFSQNN--SPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
              D FL+N ++R ++ +N  S   +L MY  L  +  + P+ FTY FV+   +  GY   
Sbjct  96   LYDTFLFNTIIRAYAHSNNVSKGKALCMY-KLMLEYDVLPNKFTYPFVLKACAGIGYLNL  154

Query  20   GGLLHG  3
            G  +HG
Sbjct  155  GKSVHG  160



>ref|XP_010070463.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial-like [Eucalyptus grandis]
Length=665

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 37/140 (26%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = -3

Query  413  RAAAATVLRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA--  240
            ++ AA  L DR      + + +++S+L   HAQ+I  GL ++++ + KL   F  ++   
Sbjct  32   KSVAARTLHDR------LERCSSVSELKTIHAQIIFRGLAHEILLLGKLVS-FCAVDGAG  84

Query  239  -IAHAKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYA  63
             +A+A+ +F+    +  P+ F+YN ++RG+S +  P +++ +Y  + G + + P+ FT+ 
Sbjct  85   DLAYARYLFDK---MREPNRFMYNSLIRGYSNSEDPLEAVLLYRRMIG-SGISPNEFTFP  140

Query  62   FVVSGVSSSGYEKFGGLLHG  3
            FV+   +         L+HG
Sbjct  141  FVLKACAGESLYWVSVLVHG  160



>ref|XP_006338776.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like 
[Solanum tuberosum]
Length=539

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/122 (30%), Positives = 68/122 (56%), Gaps = 2/122 (2%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPP  189
            SL +K  ++  L Q HA +I+NG  ++ IA+ +L    S +   A        F  ++ P
Sbjct  18   SLWSKCKDVQSLKQIHALMIINGFNSNRIALRELIHA-SAVTFSASIHYAHKLFAQITQP  76

Query  188  DLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLL  9
            DLF++N +LRG +Q++ P  ++S+Y  +  ++ L PD++T+ F++   +   +   G  +
Sbjct  77   DLFMWNTMLRGSAQSHRPSLAVSVYTQMEKRSIL-PDSYTFPFLLKACTKLSWLVSGLTV  135

Query  8    HG  3
            HG
Sbjct  136  HG  137



>ref|XP_004306131.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like 
[Fragaria vesca subsp. vesca]
Length=540

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 68/124 (55%), Gaps = 6/124 (5%)
 Frame = -3

Query  368  SLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL--TQRFSDLNAIAHAKLIFNAFNCVS  195
            +L  K  NL  L Q HA ++++G  ++  A+ +L      S    I +A  +F+    ++
Sbjct  18   TLFQKCTNLKALKQVHASMVIHGFNSNPSALGELIFASAMSISGTIGYAHKVFDQ---IT  74

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             P+ F++N ++RG +Q+  P +++ +Y  +  K  L+PD+FT+ FV+   +   + + G 
Sbjct  75   EPNTFMWNTMIRGSAQSLRPLNAVVLYTRME-KRGLRPDDFTFPFVLKACNKLCWVRMGM  133

Query  14   LLHG  3
             +HG
Sbjct  134  GIHG  137



>ref|XP_007208504.1| hypothetical protein PRUPE_ppa026555mg [Prunus persica]
 gb|EMJ09703.1| hypothetical protein PRUPE_ppa026555mg [Prunus persica]
Length=565

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 71/127 (56%), Gaps = 6/127 (5%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNA--IAHAKLIFNAF  207
            N  LSL+    ++S+L Q H  +I   + N++I +++L    ++  A  + +AK +F+  
Sbjct  6    NTILSLLETCKSMSELKQLHGLMITTSVFNNVIPLSRLVDFCANSEARDLVYAKSVFHQI  65

Query  206  NCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
            N    P ++++N ++RG+S + +P +SL MY  +  +  + PDNFT+ FV+   S     
Sbjct  66   N---QPRVYIWNSMIRGYSNSENPAESLIMYREMLQRGYV-PDNFTFPFVLKACSLITVY  121

Query  26   KFGGLLH  6
             +G  +H
Sbjct  122  HYGRCVH  128



>ref|XP_009762871.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic [Nicotiana sylvestris]
Length=525

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 73/135 (54%), Gaps = 11/135 (8%)
 Frame = -3

Query  392  LRDRNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL---TQRF--SDLNAIAHA  228
            + D+ +   L TK   ++ L + HAQLI  GL  D IA +++   + +F   D+N   +A
Sbjct  19   ISDQPYLYLLETKCKTITDLKKIHAQLIKTGLIKDKIASSRVLAFSAKFPTGDIN---YA  75

Query  227  KLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSG  48
             ++F     +  P+LF++N ++RGFS++++P  ++ +++ +   + ++P   TY  V   
Sbjct  76   NMVFTQ---IDNPNLFIWNTMIRGFSESSTPQYAIHLFIEMLTTSDIQPQLLTYPSVFKA  132

Query  47   VSSSGYEKFGGLLHG  3
             +  G    G  LHG
Sbjct  133  YTRLGLANSGTQLHG  147



>ref|XP_010258267.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
Length=564

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 64/124 (52%), Gaps = 4/124 (3%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVS  195
              SL+    + ++L Q HAQ+++NG       + KL         + HA+    AF  V 
Sbjct  21   LFSLLQNCKSSNELTQIHAQIVVNGFSQKNYILAKLLSFCVTSGNLIHAQ---KAFEQVR  77

Query  194  PPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGG  15
             P   ++N ++RG++ + +P +S+ +Y  +   T+ KPD FTY F+++  +   + + G 
Sbjct  78   KPSTIVWNQMIRGYACSIAPHESVKLYNKME-STETKPDTFTYLFLLNACARPSFLRVGE  136

Query  14   LLHG  3
             LHG
Sbjct  137  QLHG  140



>ref|XP_010931854.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like 
[Elaeis guineensis]
Length=588

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/134 (31%), Positives = 70/134 (52%), Gaps = 11/134 (8%)
 Frame = -3

Query  383  RNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN-------AIAHAK  225
            +N  LSL+  A   SQ+ Q HAQLI   L +DL   ++L     +L+        +A+ +
Sbjct  12   QNPLLSLLQNARTNSQILQIHAQLICRALVSDLFVASRLLFAICELSNSSSVDLTVAYVE  71

Query  224  LIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGV  45
            LIF+    +  P+ F +N ++R  S+ + P  +L  +  +R K  +  DN+TY FV+   
Sbjct  72   LIFSQ---IHQPNTFSWNTIIRFHSRTSKPLRALLFFSQMR-KNGIFTDNYTYPFVLKAC  127

Query  44   SSSGYEKFGGLLHG  3
            +S    + G ++HG
Sbjct  128  ASMPGRREGLVVHG  141



>ref|XP_008356438.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic-like [Malus domestica]
Length=481

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 65/125 (52%), Gaps = 5/125 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAFNCV  198
            LS I    N+ QL Q HAQ++  GL  D  + +KL      S  +++ +A+ +F+    +
Sbjct  34   LSSIDHCTNIKQLKQVHAQMLRTGLLFDPYSASKLITVCALSSFSSLDYARQVFDQ---I  90

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P+L+ +N ++R ++ +  P +S+ ++L +  +    P+ FTY FV+   S     + G
Sbjct  91   PQPNLYSWNTLIRAYASSTDPTESILVFLEMLYRCMESPNKFTYPFVIKAASELRVLELG  150

Query  17   GLLHG  3
               HG
Sbjct  151  RGFHG  155



>ref|XP_003552546.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like 
[Glycine max]
Length=604

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 40/109 (37%), Positives = 57/109 (52%), Gaps = 11/109 (10%)
 Frame = -3

Query  356  KAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPPDLFL  177
            K  NL  +NQ HAQ++   L  DL    KL   FS    +A A    N FN V  P++ L
Sbjct  30   KCTNLDSVNQIHAQVLKANLHQDLFVAPKLIAAFSLCRHLASA---VNVFNHVPHPNVHL  86

Query  176  YNVVLRGFSQNNS----PFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS  42
            YN ++R  + N+S    PF++   +  ++ K  L PDNFTY F++   S
Sbjct  87   YNSIIRAHAHNSSHRSLPFNA---FFQMQ-KNGLFPDNFTYPFLLKACS  131



>ref|XP_007034318.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007034319.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007034320.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007034321.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY05244.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY05245.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY05246.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY05247.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=682

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 4/127 (3%)
 Frame = -3

Query  383  RNFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFN  204
            +  F SLI  +    QL Q HAQ+    L +     T L    S L +I +A  +FN F+
Sbjct  45   KTHFASLIQSSKTTLQLRQIHAQIFRRNLSSSSNLTTLLISASSSLKSIPYAISLFNHFH  104

Query  203  CVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEK  24
              S   +FL+N ++RG + N+    S+S +L L     ++PD  TY FV+  ++  G   
Sbjct  105  HKS---IFLFNALIRGLTDNSLLESSISHFL-LMLSLGVRPDKLTYPFVLKSIAGLGLRC  160

Query  23   FGGLLHG  3
             G +LHG
Sbjct  161  LGLILHG  167



>ref|XP_010651252.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial [Vitis vinifera]
 ref|XP_010651254.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial [Vitis vinifera]
 ref|XP_010651255.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial [Vitis vinifera]
Length=686

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 16/135 (12%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLT-----QRFSDLNAIAHAKLIF  216
            N FLSL+ K  ++SQL Q  +Q++L GL  D  A ++L        + DL+   +  ++F
Sbjct  51   NPFLSLLEKCKSISQLKQIQSQMVLTGLIEDGFASSRLIAFCAISEWRDLDYCTN--ILF  108

Query  215  NAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS--  42
            N  N    P+ F +NV +RGF  + +P +++ +Y  +      KPDN+TY  +    +  
Sbjct  109  NTRN----PNTFSWNVAIRGFLDSENPREAVVLYKRVLQCDGTKPDNYTYPLLFKACARL  164

Query  41   ---SSGYEKFGGLLH  6
                 G E  G +LH
Sbjct  165  SLIRMGSEILGHVLH  179



>ref|XP_011075783.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic [Sesamum indicum]
 ref|XP_011075784.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, 
chloroplastic [Sesamum indicum]
Length=734

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 69/125 (55%), Gaps = 5/125 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL--TQRFSDLNAIAHAKLIFNAFNCV  198
            + LI + +N   L Q HAQ++  GL  D  + +KL  +  F+D +++ +A  +F+    +
Sbjct  30   VQLIDRCSNAHHLKQIHAQMLRAGLFFDPFSASKLIHSSLFTDFSSLHYAHKVFDQ---I  86

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P+L+ +N+++R ++ +  P   +SM++ L  + + KP+ FTY  V+   +     + G
Sbjct  87   PHPNLYSWNLLIRAYASSLQPIHCISMFIRLLHEGREKPNKFTYPSVIKASAKLADLQLG  146

Query  17   GLLHG  3
              +HG
Sbjct  147  KGVHG  151



>ref|XP_010489024.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Camelina sativa]
Length=534

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/126 (28%), Positives = 64/126 (51%), Gaps = 3/126 (2%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            N+F+ L+ +  +  +  + HA +I++GL      VTK+      +  + +A  +FN    
Sbjct  11   NYFVPLLQRFKSRKEWKKIHACIIIHGLSQSSFMVTKMVDSCDKIGDMEYATRLFNQ---  67

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            VS P++FLYN ++R ++ ++   + +  Y  L  K    PD FT+ F+    +S G    
Sbjct  68   VSSPNVFLYNSIIRAYTHHSLYCEVIRTYRQLLRKCIELPDRFTFPFMFKSCASLGSCYL  127

Query  20   GGLLHG  3
            G  +HG
Sbjct  128  GKQVHG  133



>gb|KFK23272.1| hypothetical protein AALP_AAs55729U000100 [Arabis alpina]
Length=739

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/123 (27%), Positives = 63/123 (51%), Gaps = 1/123 (1%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            +SLI + A+L QL Q HA ++  GL ND  + +KL    + L+  A        F+ +  
Sbjct  35   ISLIDRCADLRQLKQIHAHMVRTGLFNDPYSASKLFA-IAALSPFASLDYACKVFDQIPQ  93

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGL  12
            P+ F +N ++R ++    P  S+ ++L +  +++  P+ +T+ F++   +       G  
Sbjct  94   PNSFSWNTLIRAYASGPDPLRSIWVFLDMVSESQSYPNKYTFPFLIKAAAEVSSLSLGQS  153

Query  11   LHG  3
            LHG
Sbjct  154  LHG  156



>ref|XP_009117485.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 
[Brassica rapa]
Length=538

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/126 (28%), Positives = 62/126 (49%), Gaps = 3/126 (2%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            N+F  L+ +    S+  Q HA +  +GL      +TK+      +  + +A  +FN    
Sbjct  13   NYFAPLLHRFKTRSEWKQIHASITTHGLSQSSFILTKMVDLCDKIGDMEYATRLFNH---  69

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            VS P++FLYN ++R ++ N+    ++ +Y  +   +   PD FT+ FV    +S G    
Sbjct  70   VSNPNVFLYNSIIRAYTHNSLYPSAIRIYKQMLANSLEFPDRFTFPFVFKSCASLGSCYL  129

Query  20   GGLLHG  3
            G  +HG
Sbjct  130  GKQVHG  135



>ref|XP_010255448.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like 
[Nelumbo nucifera]
Length=564

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSP  192
            +S + +    +QL Q HA +    L  D+   TK  +R ++   + +++L+F+  + + P
Sbjct  9    ISNLLQKCTFTQLKQIHALITTTSLNRDIRISTKTLRRSTEFGGMDYSELLFSQMDEIFP  68

Query  191  PDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSG  33
             DL L+N ++RG++  N P+D      H   +  LKP+N+TY ++++  +  G
Sbjct  69   ADLLLWNAMIRGYA-FNGPYDKCISMHHQMIQRGLKPNNYTYPYLLNSCAQIG  120



>ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina]
 gb|ESR63698.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina]
Length=629

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/122 (34%), Positives = 68/122 (56%), Gaps = 3/122 (2%)
 Frame = -3

Query  362  ITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHA-KLIFNAFNCVSPPD  186
            I +   L +L Q H++++  GL N+ + +TK T   SDLNAI +A  +IF+  +     D
Sbjct  59   ILRCVGLPKLAQIHSRILKLGLLNNPLVLTKFTATSSDLNAIDYATSVIFSPESDTLLYD  118

Query  185  LFLYNVVLRGFSQ-NNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLL  9
             FL+N ++R ++Q NN   +S+  Y +L  +  + P+ FTY FV+   +  G    G  +
Sbjct  119  TFLFNTIIRAYAQINNLKTNSIECY-NLMLEYGVSPNKFTYPFVLKACAGIGDLNLGKSV  177

Query  8    HG  3
            HG
Sbjct  178  HG  179



>gb|EMT31807.1| hypothetical protein F775_12997 [Aegilops tauschii]
Length=1042

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = -3

Query  344  LSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLN---AIAHAKLIFNAFNCVSPPDLFLY  174
            +  + + H  LI++GL N   A++K+ + ++ L     +AH       +  +  P  +L 
Sbjct  478  METIKKLHGHLIVSGLHNCQYAMSKILRFYAILQPDLVLAH-----KVYGQIEAPTTYLR  532

Query  173  NVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLLH  6
            N++LRG +Q+++P D+++ Y   RGK  ++PDN T+ FVV   +  G  K G  +H
Sbjct  533  NIILRGLAQSDAPEDAIAFYKKARGKC-MEPDNLTFPFVVKACARIGALKEGKQMH  587



>emb|CBI35029.3| unnamed protein product [Vitis vinifera]
Length=1596

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 68/124 (55%), Gaps = 5/124 (4%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIFNAFNCV  198
            +SL    +N+ Q    HA  I+NGL  +  A++KL      S+  ++++A LIF+    +
Sbjct  8    ISLAQSCSNMRQFKAIHALFIVNGLHLNNYAISKLISFCALSNSGSLSYASLIFSQ---I  64

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
              P+LF YN ++R +S++++P  +L  +  +     + PD  T+ F++S  ++S +   G
Sbjct  65   QNPNLFAYNTLIRAYSRSSTPQLALHYFQLMLDDENVGPDQHTFPFIISACTNSLWMLLG  124

Query  17   GLLH  6
              +H
Sbjct  125  KQIH  128



>ref|XP_006408981.1| hypothetical protein EUTSA_v10001958mg [Eutrema salsugineum]
 gb|ESQ50434.1| hypothetical protein EUTSA_v10001958mg [Eutrema salsugineum]
Length=531

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/126 (28%), Positives = 63/126 (50%), Gaps = 3/126 (2%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            N+F+  + +  +L +  + HA +I++GL      VTK+      +  +  A  +F     
Sbjct  11   NYFVPFLQRFKSLGEWKKIHASIIVHGLSQSSFMVTKMVDVCDKIGDMECATRLFKQ---  67

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKF  21
            V+ P++FLYN ++R ++ N+   D + +Y  L  K+   PD FT+ F+    +S G    
Sbjct  68   VANPNVFLYNSIIRAYAHNSLYRDVIRIYRQLLRKSLDLPDRFTFPFMFKSCASIGSYYL  127

Query  20   GGLLHG  3
            G   HG
Sbjct  128  GKQAHG  133



>emb|CDY08404.1| BnaA05g26400D [Brassica napus]
Length=694

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 8/128 (6%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +F+ SLI  + + SQL Q HA+L + GL      +TKL    S    I  A+ +F+    
Sbjct  22   SFYASLIGSSTHKSQLRQIHARLFVLGLQLSSFLITKLIHASSSFGDICFARKVFDG---  78

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMY--LHLRGKTKLKPDNFTYAFVVSGVSSSGYE  27
            +  P +F +N ++ G+S+NN   D+L MY  + L G   + PD+FT+  ++   S     
Sbjct  79   LPLPQIFPWNAIITGYSKNNLFQDALLMYSKMQLAG---VSPDSFTFPHLLKACSGLPNL  135

Query  26   KFGGLLHG  3
            + G L+H 
Sbjct  136  QMGRLVHA  143



>gb|KDP31247.1| hypothetical protein JCGZ_11623 [Jatropha curcas]
Length=643

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 36/126 (29%), Positives = 69/126 (55%), Gaps = 9/126 (7%)
 Frame = -3

Query  371  LSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKL----TQRFSDLNAIAHAKLIFNAFN  204
            +SL+    +L+ L Q HA ++ NGL  D     KL    T   SD  ++ +A  +F    
Sbjct  9    VSLLNSCKSLTSLKQIHANVLKNGLDTDPFVAGKLLLHCTISLSD--SLDYACSLFRH--  64

Query  203  CVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEK  24
                PD+F+YN ++RG ++++ P +S+  ++ +R ++   PD+F++AF++   ++    +
Sbjct  65   -TPNPDVFMYNTLIRGLAESDKPQNSIFTFVEMRRESLFTPDSFSFAFILKAAANLRSLR  123

Query  23   FGGLLH  6
             G  LH
Sbjct  124  TGVQLH  129



>ref|XP_003551738.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like 
[Glycine max]
 gb|KHN13601.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=518

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 37/120 (31%), Positives = 66/120 (55%), Gaps = 6/120 (5%)
 Frame = -3

Query  347  NLSQLNQTHAQLILNGLGNDLIAVTKL--TQRFSDLNAIAHAKLI---FNAFNCVSPPDL  183
            N+  L Q HA +I+NGL +++  + KL  T   S +   A + +I      F  +  PD 
Sbjct  13   NVGTLKQIHALMIVNGLTSNVGFLRKLVLTTAMSMVGPNATSAVIRYALQMFAQIPQPDT  72

Query  182  FLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLLHG  3
            F++N  +RG SQ++ P  ++++Y  +  ++ +KPDNFT+ FV+   +   +   G  +HG
Sbjct  73   FMWNTYIRGSSQSHDPVHAVALYAQMDQRS-VKPDNFTFPFVLKACTKLFWVNTGSAVHG  131



>ref|XP_007132588.1| hypothetical protein PHAVU_011G107600g [Phaseolus vulgaris]
 gb|ESW04582.1| hypothetical protein PHAVU_011G107600g [Phaseolus vulgaris]
Length=700

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 39/125 (31%), Positives = 67/125 (54%), Gaps = 5/125 (4%)
 Frame = -3

Query  374  FLSLITKAANLSQLNQTHAQLILNG-LGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCV  198
             L  ++ + +L+Q  Q HAQ+   G L ++    TKL   ++    + HA+LIF+    +
Sbjct  27   LLQSLSNSKSLTQAQQLHAQVTTGGTLRHNTYLATKLAACYAACGHMLHAQLIFDQ---I  83

Query  197  SPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFG  18
               + FL+N ++RG++ N+SP  SL +Y  +  +   KPDNFTY FV+       + + G
Sbjct  84   VLKNSFLWNSMIRGYACNHSPTKSLVLYRDML-RFGQKPDNFTYPFVLKACGDLLFRRIG  142

Query  17   GLLHG  3
              +H 
Sbjct  143  RKVHA  147



>ref|XP_007133846.1| hypothetical protein PHAVU_011G213900g [Phaseolus vulgaris]
 gb|ESW05840.1| hypothetical protein PHAVU_011G213900g [Phaseolus vulgaris]
Length=690

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/101 (30%), Positives = 56/101 (55%), Gaps = 3/101 (3%)
 Frame = -3

Query  344  LSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPPDLFLYNVV  165
            L ++ Q H +L+  GL +D   +  L +   +L A  +A ++F        P++FLYN +
Sbjct  30   LQEVKQCHCRLLRLGLHHDTFLINTLLRSSLNLRATQYATVVFAQ---TPNPNIFLYNTL  86

Query  164  LRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS  42
            +RG   N +  +++S+Y  +R ++   PDNFT+ FV+   +
Sbjct  87   IRGLVSNEAFHEAVSLYASMRQRSAFAPDNFTFPFVLKACA  127



>ref|XP_006411565.1| hypothetical protein EUTSA_v10017572mg [Eutrema salsugineum]
 gb|ESQ53018.1| hypothetical protein EUTSA_v10017572mg [Eutrema salsugineum]
Length=546

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 74/136 (54%), Gaps = 5/136 (4%)
 Frame = -3

Query  404  AATVLRDRNFFLSLI-TKAANLSQLNQTHAQLILNGLGNDLIAVTK-LTQRFSDLNAIAH  231
            ++T+    N  + LI T+ + + +L Q HA LI  GL +D IA ++ L    +  + +++
Sbjct  17   SSTISVSGNSHIRLIDTQCSTMRELKQIHANLIKTGLISDTIAASRVLAFCCTSPSDMSY  76

Query  230  AKLIFNAFNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVS  51
            A L+F   N  +P   F++N ++RGFS+++ P  S+++++ +      KP   TY  V  
Sbjct  77   AYLLFTRINHKNP---FVWNTIIRGFSRSSFPEMSITIFIDMFSSASAKPQRLTYPSVFK  133

Query  50   GVSSSGYEKFGGLLHG  3
              +S G  + G  LHG
Sbjct  134  AYASLGKARDGMQLHG  149



>ref|XP_003530418.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like 
[Glycine max]
Length=604

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 45/125 (36%), Positives = 63/125 (50%), Gaps = 16/125 (13%)
 Frame = -3

Query  356  KAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNCVSPPDLFL  177
            K +NL  +NQ HAQ++   L  DL    KL   FS    +A A    N FN V  P++ L
Sbjct  30   KCSNLDSVNQIHAQVLKANLHQDLFVAPKLIAAFSLCRHLASA---VNVFNHVPHPNVHL  86

Query  176  YNVVLRGFSQNNS-PFDSLSMYLHLRGKTKLKPDNFTYAFVV---SGVSS--------SG  33
            YN ++R  + N S P    + +  ++ K  L PDNFTY F++   +G SS        + 
Sbjct  87   YNSIIRAHAHNTSHPSLPFNAFFQMQ-KNGLFPDNFTYPFLLKACTGPSSLPLVRMIHAH  145

Query  32   YEKFG  18
             EKFG
Sbjct  146  VEKFG  150



>ref|XP_010257292.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, 
mitochondrial [Nelumbo nucifera]
Length=719

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 38/133 (29%), Positives = 73/133 (55%), Gaps = 12/133 (9%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQ--RFSDLNAIAHAKLIF-NA  210
            N  LSL+ +  +++QL Q  AQ+IL GL +D +A+++L      S+  ++ +  +I  N 
Sbjct  53   NPLLSLLERCKSMNQLKQIQAQMILTGLISDRLALSRLIAFCAISESGSLDYCNMILANT  112

Query  209  FNCVSPPDLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVS----  42
             N    P++F +N+ +RG S++++P ++  +Y+ +       PDN+TY F+    +    
Sbjct  113  EN----PNVFSWNIAIRGHSESDNPKEAFLLYMQMLRNGGSCPDNYTYPFLFKACARLSL  168

Query  41   -SSGYEKFGGLLH  6
               G   FG ++H
Sbjct  169  IGIGCAIFGHVMH  181



>ref|XP_006395538.1| hypothetical protein EUTSA_v10004197mg [Eutrema salsugineum]
 gb|ESQ32824.1| hypothetical protein EUTSA_v10004197mg [Eutrema salsugineum]
Length=453

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 68/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  380  NFFLSLITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQRFSDLNAIAHAKLIFNAFNC  201
            +FFL      +N SQL Q HA++I   L ND + V +L    S L    +A L+F+    
Sbjct  24   SFFLR---NCSNFSQLKQIHAKIIRYNLTNDQLLVRQLISVSSSLGETRYASLVFSQ---  77

Query  200  VSPPDLFLYNVVLRGFSQNNSPFDSLSMY-LHLRGKTKLKPDNFTYAFVVSGVSSSGYEK  24
            +  P  F +N+++R  S N+ P ++L ++ L L  +++L  D FT+ FV+    +S   +
Sbjct  78   LQSPSTFTWNLMIRSLSVNDKPREALLLFILMLSHQSQL--DKFTFPFVIKACLASSSLR  135

Query  23   FGGLLHG  3
             G  +HG
Sbjct  136  LGTQVHG  142



>ref|XP_008365629.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g29760, chloroplastic-like [Malus domestica]
Length=773

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/122 (28%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -3

Query  362  ITKAANLSQLNQTHAQLILNGLGNDLIAVTKLTQR--FSDLNAIAHAKLIFNAFNCVSPP  189
            I +  N++QL Q HAQ++  GL  D  + +KL      S  ++I +A+ +F+    +  P
Sbjct  72   IEQCTNIAQLKQVHAQMLRTGLFFDPYSTSKLISACALSSFSSIDYARQMFDQ---IPQP  128

Query  188  DLFLYNVVLRGFSQNNSPFDSLSMYLHLRGKTKLKPDNFTYAFVVSGVSSSGYEKFGGLL  9
            +L+ +N ++R ++ +  P +S+ ++L +       P+ +TY FV+   S       GG +
Sbjct  129  NLYTWNTLIRAYASSADPVESILVFLDMLYGCSECPNKYTYPFVIKAASELRALHTGGAV  188

Query  8    HG  3
            HG
Sbjct  189  HG  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511272866440