BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c44999_g1_i1 len=212 path=[1:0-211]

Length=212
                                                                      Score     E

dbj|BAA21726.1|  S-adenosylmethionine synthase                          138   7e-40   Nicotiana tabacum [American tobacco]
ref|XP_002519480.1|  s-adenosylmethionine synthetase, putative          144   2e-39   Ricinus communis
ref|XP_010312254.1|  PREDICTED: S-adenosylmethionine synthase 3-like    142   7e-39   
gb|AAL33587.1|  methionine adenosyltransferase                          138   2e-38   Zea mays [maize]
sp|P50302.1|METK2_ACTCH  RecName: Full=S-adenosylmethionine synth...    141   3e-38   Actinidia chinensis
ref|XP_009796999.1|  PREDICTED: S-adenosylmethionine synthase 2-like    140   4e-38   
gb|ADC80653.1|  S-adenosylmethionine synthase-like protein              135   4e-38   Eperua falcata
ref|XP_010098790.1|  S-adenosylmethionine synthase 2                    140   4e-38   
sp|Q96553.1|METK3_CATRO  RecName: Full=S-adenosylmethionine synth...    140   4e-38   Catharanthus roseus [chatas]
ref|XP_011094598.1|  PREDICTED: S-adenosylmethionine synthase 3         140   5e-38   
gb|AGF95107.1|  S-adenosylmethionine synthetase                         136   6e-38   
ref|XP_003632745.1|  PREDICTED: S-adenosylmethionine synthase 3         140   6e-38   
gb|ABO27088.1|  S-adenosylmethionine synthetase                         135   6e-38   
ref|XP_007162776.1|  hypothetical protein PHAVU_001G179500g             140   7e-38   
gb|AGV22116.1|  S-adenosylmethionine synthetase 3                       140   7e-38   
sp|Q6SYB9.1|METK2_TOBAC  RecName: Full=S-adenosylmethionine synth...    140   7e-38   Nicotiana tabacum [American tobacco]
ref|XP_009596067.1|  PREDICTED: S-adenosylmethionine synthase 2         140   8e-38   
ref|XP_011077317.1|  PREDICTED: S-adenosylmethionine synthase 3         140   8e-38   
emb|CBI30144.3|  unnamed protein product                                140   9e-38   
ref|XP_009795880.1|  PREDICTED: S-adenosylmethionine synthase 2         139   1e-37   
ref|XP_010558180.1|  PREDICTED: S-adenosylmethionine synthase 4         139   1e-37   
ref|XP_006339084.1|  PREDICTED: S-adenosylmethionine synthase 3-like    139   1e-37   
gb|ADC80645.1|  S-adenosylmethionine synthase-like protein              134   1e-37   Phanera guianensis
ref|XP_007027434.1|  Methionine adenosyltransferase 3                   139   1e-37   
gb|ADC80652.1|  S-adenosylmethionine synthase-like protein              134   1e-37   Eperua falcata
ref|XP_009609870.1|  PREDICTED: S-adenosylmethionine synthase 3         139   2e-37   
gb|ACF17673.1|  putative S-adenosylmethionine synthetase                139   2e-37   Capsicum annuum
ref|XP_009610332.1|  PREDICTED: S-adenosylmethionine synthase 2-like    139   2e-37   
sp|Q9M7K8.1|METK1_TOBAC  RecName: Full=S-adenosylmethionine synth...    139   2e-37   Nicotiana tabacum [American tobacco]
gb|ABI95859.1|  S-adenosyl-L-methionine synthase                        139   2e-37   Nicotiana suaveolens
gb|KDO72159.1|  hypothetical protein CISIN_1g045358mg                   134   2e-37   
ref|XP_009760627.1|  PREDICTED: S-adenosylmethionine synthase 1         139   2e-37   
ref|XP_006418333.1|  hypothetical protein EUTSA_v10007845mg             139   2e-37   
ref|XP_006305011.1|  hypothetical protein CARUB_v10009376mg             139   2e-37   
gb|ADC80644.1|  S-adenosylmethionine synthase-like protein              133   2e-37   Phanera guianensis
gb|KHG12690.1|  S-adenosylmethionine synthase                           139   2e-37   
gb|ADC80654.1|  S-adenosylmethionine synthase-like protein              133   3e-37   Eperua falcata
gb|KDO36066.1|  hypothetical protein CISIN_1g044843mg                   134   3e-37   
ref|XP_011018770.1|  PREDICTED: S-adenosylmethionine synthase 4         138   3e-37   
ref|XP_006381397.1|  S-adenosylmethionine synthetase family protein     138   4e-37   
ref|XP_010921340.1|  PREDICTED: S-adenosylmethionine synthase           138   4e-37   
ref|XP_008369552.1|  PREDICTED: S-adenosylmethionine synthase 3         138   4e-37   
ref|XP_007154449.1|  hypothetical protein PHAVU_003G1202001g            131   4e-37   
gb|AGF95106.1|  S-adenosylmethionine synthetase                         135   5e-37   
gb|EYU29879.1|  hypothetical protein MIMGU_mgv1a006187mg                138   5e-37   
gb|ADC80651.1|  S-adenosylmethionine synthase-like protein              132   6e-37   Bauhinia purpurea
gb|ADC80649.1|  S-adenosylmethionine synthase-like protein              132   6e-37   Bauhinia purpurea
ref|XP_003521408.1|  PREDICTED: S-adenosylmethionine synthase 3-l...    137   6e-37   
gb|ADC80648.1|  S-adenosylmethionine synthase-like protein              132   6e-37   Bauhinia purpurea
gb|KHN09527.1|  S-adenosylmethionine synthase 2                         137   6e-37   
ref|XP_002273336.1|  PREDICTED: S-adenosylmethionine synthase 1 i...    137   6e-37   Vitis vinifera
emb|CDP06782.1|  unnamed protein product                                137   7e-37   
ref|XP_007035965.1|  S-adenosylmethionine synthetase 2                  138   7e-37   
sp|P48498.1|METK1_PETHY  RecName: Full=S-adenosylmethionine synth...    137   7e-37   Petunia x hybrida [garden petunia]
gb|ACJ84588.1|  unknown                                                 131   7e-37   Medicago truncatula
emb|CAN72082.1|  hypothetical protein VITISV_033661                     137   7e-37   Vitis vinifera
ref|XP_010651779.1|  PREDICTED: S-adenosylmethionine synthase 1 i...    137   7e-37   
ref|XP_009377021.1|  PREDICTED: S-adenosylmethionine synthase 4         137   8e-37   
ref|XP_002966239.1|  hypothetical protein SELMODRAFT_168213             137   8e-37   
ref|XP_002982311.1|  hypothetical protein SELMODRAFT_155092             137   9e-37   
ref|XP_008462483.1|  PREDICTED: S-adenosylmethionine synthase 4         137   9e-37   
ref|NP_001234004.1|  S-adenosylmethionine synthase 3                    137   9e-37   
gb|AHB32111.1|  S-adenosylmethionine synthase                           137   9e-37   
sp|P50301.1|METK1_ACTCH  RecName: Full=S-adenosylmethionine synth...    137   9e-37   Actinidia chinensis
ref|XP_004143274.1|  PREDICTED: S-adenosylmethionine synthase 2-like    137   1e-36   
ref|XP_009365469.1|  PREDICTED: S-adenosylmethionine synthase 2-like    137   1e-36   
ref|XP_009335533.1|  PREDICTED: S-adenosylmethionine synthase 2-like    137   1e-36   
gb|ACJ83268.1|  unknown                                                 133   1e-36   Medicago truncatula
ref|XP_010556675.1|  PREDICTED: S-adenosylmethionine synthase           136   1e-36   
ref|XP_010267208.1|  PREDICTED: S-adenosylmethionine synthase 1         136   1e-36   
gb|KDP43982.1|  hypothetical protein JCGZ_05449                         136   1e-36   
ref|XP_008241399.1|  PREDICTED: S-adenosylmethionine synthase 3         136   1e-36   
ref|XP_010457229.1|  PREDICTED: S-adenosylmethionine synthase 1-like    136   1e-36   
dbj|BAI66450.1|  S-adenosylmethionine synthase                          133   1e-36   Malus domestica [apple tree]
ref|XP_007219282.1|  hypothetical protein PRUPE_ppa018473mg             131   1e-36   
sp|A9NUH8.1|METK1_PICSI  RecName: Full=S-adenosylmethionine synth...    136   1e-36   Picea sitchensis
emb|CCC55422.1|  S-adenosylmethionine synthase 1                        136   1e-36   
ref|XP_004288343.1|  PREDICTED: S-adenosylmethionine synthase 2-l...    136   1e-36   
ref|XP_007202118.1|  hypothetical protein PRUPE_ppa006915mg             136   1e-36   
ref|XP_008793316.1|  PREDICTED: S-adenosylmethionine synthase 4         136   2e-36   
ref|XP_002523705.1|  s-adenosylmethionine synthetase, putative          136   2e-36   Ricinus communis
ref|XP_010031402.1|  PREDICTED: S-adenosylmethionine synthase 1         136   2e-36   
ref|XP_010544939.1|  PREDICTED: S-adenosylmethionine synthase 1-like    136   2e-36   
sp|Q944U4.1|METK_DENCR  RecName: Full=S-adenosylmethionine syntha...    136   2e-36   Dendrobium crumenatum
ref|XP_010523888.1|  PREDICTED: S-adenosylmethionine synthase 1-like    136   2e-36   
ref|XP_008781205.1|  PREDICTED: S-adenosylmethionine synthase           136   3e-36   
gb|AFK42420.1|  unknown                                                 135   3e-36   
emb|CBI37018.3|  unnamed protein product                                132   3e-36   
gb|AFK48536.1|  unknown                                                 132   3e-36   
ref|XP_008387540.1|  PREDICTED: S-adenosylmethionine synthase 4         135   3e-36   
ref|XP_006294369.1|  hypothetical protein CARUB_v10023387mg             135   3e-36   
ref|XP_006379697.1|  S-adenosylmethionine synthase family protein       135   3e-36   
sp|P47916.1|METK_POPDE  RecName: Full=S-adenosylmethionine syntha...    135   3e-36   Populus deltoides
gb|AEY85025.1|  S-adenosylmethionine synthetase                         135   3e-36   
gb|AFK33626.1|  unknown                                                 132   3e-36   
ref|XP_010507932.1|  PREDICTED: S-adenosylmethionine synthase 2         135   3e-36   
gb|AFI38954.1|  S-adenosyl-L-methionine synthetase                      135   3e-36   
ref|XP_010518399.1|  PREDICTED: S-adenosylmethionine synthase 2-like    135   3e-36   
gb|ADC80650.1|  S-adenosylmethionine synthase-like protein              130   3e-36   Bauhinia purpurea
ref|XP_009408430.1|  PREDICTED: S-adenosylmethionine synthase 5-like    135   3e-36   
ref|XP_004288342.1|  PREDICTED: S-adenosylmethionine synthase 2-l...    135   3e-36   
sp|A7L2Z6.1|METK_GOSHI  RecName: Full=S-adenosylmethionine syntha...    135   3e-36   Gossypium hirsutum [American cotton]
gb|ACD92982.1|  S-adenosylmethionine synthetase                         134   3e-36   Panax ginseng [Chinese ginseng]
ref|XP_010506734.1|  PREDICTED: S-adenosylmethionine synthase 2-like    135   3e-36   
dbj|BAF63499.1|  S-adenosyl-L-methionine synthetase                     130   3e-36   Potamogeton distinctus
ref|XP_002312296.2|  hypothetical protein POPTR_0008s09870g             135   4e-36   Populus trichocarpa [western balsam poplar]
ref|XP_002314993.1|  S-adenosylmethionine synthase family protein       135   4e-36   Populus trichocarpa [western balsam poplar]
gb|AIU34471.1|  putative S-adenosyl-L-methionine synthetase             135   4e-36   
gb|ACK37352.1|  S-adenosyl-L-methionine synthetase                      135   4e-36   Glebionis coronaria [crown daisy]
ref|XP_011019063.1|  PREDICTED: S-adenosylmethionine synthase 3         135   4e-36   
ref|XP_006397900.1|  hypothetical protein EUTSA_v10001487mg             135   4e-36   
ref|XP_003546550.1|  PREDICTED: S-adenosylmethionine synthase-lik...    135   4e-36   
ref|NP_001269246.1|  S-adenosylmethionine synthase-like                 135   4e-36   
ref|XP_008388436.1|  PREDICTED: S-adenosylmethionine synthase 2-like    135   4e-36   
ref|XP_011011515.1|  PREDICTED: S-adenosylmethionine synthase 3         135   4e-36   
gb|AGF95110.1|  S-adenosylmethionine synthetase                         132   4e-36   
gb|ACF57862.1|  S-adenosyl-L-methionine synthetase                      135   4e-36   
sp|Q9SBQ5.1|METK2_PETHY  RecName: Full=S-adenosylmethionine synth...    135   4e-36   Petunia x hybrida [garden petunia]
ref|XP_010543435.1|  PREDICTED: S-adenosylmethionine synthase 3-like    135   5e-36   
ref|XP_004304467.1|  PREDICTED: S-adenosylmethionine synthase 2-like    135   5e-36   
ref|XP_007163224.1|  hypothetical protein PHAVU_001G2166001g            129   5e-36   
gb|KCW46784.1|  hypothetical protein EUGRSUZ_K00588                     134   5e-36   
ref|XP_008246300.1|  PREDICTED: S-adenosylmethionine synthase 2-like    135   5e-36   
ref|XP_010276540.1|  PREDICTED: S-adenosylmethionine synthase 2         135   5e-36   
ref|XP_007207334.1|  hypothetical protein PRUPE_ppa006916mg             135   5e-36   
sp|Q96551.1|METK1_CATRO  RecName: Full=S-adenosylmethionine synth...    135   6e-36   Catharanthus roseus [chatas]
dbj|BAP47513.1|  S-adenosylmethionine synthetase                        135   6e-36   
ref|XP_010559172.1|  PREDICTED: S-adenosylmethionine synthase 1-like    135   6e-36   
gb|KDP28322.1|  hypothetical protein JCGZ_14093                         135   6e-36   
gb|EYU38563.1|  hypothetical protein MIMGU_mgv1a007936mg                134   7e-36   
sp|Q9AT56.1|METK1_ELAUM  RecName: Full=S-adenosylmethionine synth...    134   7e-36   Elaeagnus umbellata [aki-gumi]
ref|XP_002515204.1|  s-adenosylmethionine synthetase, putative          134   7e-36   Ricinus communis
gb|ADC80647.1|  S-adenosylmethionine synthase-like protein              129   7e-36   Phanera guianensis
ref|XP_004302338.1|  PREDICTED: S-adenosylmethionine synthase 1-like    135   8e-36   
gb|KDO86834.1|  hypothetical protein CISIN_1g015873mg                   134   8e-36   
gb|AIT39705.1|  S-adenosylmethionine synthetase                         134   8e-36   
gb|AES81900.2|  S-adenosylmethionine synthase-like protein              134   9e-36   
gb|KDO86832.1|  hypothetical protein CISIN_1g015873mg                   134   9e-36   
gb|ACU21288.1|  unknown                                                 134   9e-36   Glycine max [soybeans]
gb|AGE15419.1|  S-adenosyl-L-methionine synthetase                      134   9e-36   
ref|XP_008461384.1|  PREDICTED: S-adenosylmethionine synthase 2-like    134   9e-36   
gb|KHN28175.1|  S-adenosylmethionine synthase                           134   1e-35   
ref|XP_006583980.1|  PREDICTED: S-adenosylmethionine synthase-like      134   1e-35   
ref|XP_003550804.1|  PREDICTED: S-adenosylmethionine synthase-lik...    134   1e-35   
ref|XP_006444593.1|  hypothetical protein CICLE_v10020504mg             134   1e-35   
ref|XP_004153700.1|  PREDICTED: S-adenosylmethionine synthase 1-l...    134   1e-35   
ref|XP_004135945.1|  PREDICTED: S-adenosylmethionine synthase 1-like    134   1e-35   
ref|XP_004168042.1|  PREDICTED: S-adenosylmethionine synthase 1-l...    134   1e-35   
ref|XP_003557087.1|  PREDICTED: S-adenosylmethionine synthase-like      134   1e-35   
ref|XP_006492396.1|  PREDICTED: S-adenosylmethionine synthase 1-like    134   1e-35   
ref|XP_003550837.1|  PREDICTED: S-adenosylmethionine synthase-lik...    134   1e-35   
gb|ACU24485.1|  unknown                                                 134   1e-35   Glycine max [soybeans]
gb|EEE54451.1|  hypothetical protein OsJ_01540                          133   1e-35   Oryza sativa Japonica Group [Japonica rice]
sp|Q9FPL6.1|METK2_SUASA  RecName: Full=S-adenosylmethionine synth...    134   1e-35   Suaeda salsa
ref|XP_011087536.1|  PREDICTED: S-adenosylmethionine synthase 1         134   1e-35   
gb|ABC24692.1|  S-adenosyl-L-methionine synthetase                      130   1e-35   Annona cherimola [cherimoya]
gb|KCW46783.1|  hypothetical protein EUGRSUZ_K00588                     134   1e-35   
ref|XP_004153699.1|  PREDICTED: S-adenosylmethionine synthase 1-l...    134   1e-35   
gb|KDO86833.1|  hypothetical protein CISIN_1g015873mg                   134   1e-35   
ref|XP_009363082.1|  PREDICTED: S-adenosylmethionine synthase 1         134   1e-35   
sp|A4ULF8.1|METK_MEDSF  RecName: Full=S-adenosylmethionine syntha...    134   1e-35   Medicago falcata [sickle alfalfa]
ref|XP_004168041.1|  PREDICTED: S-adenosylmethionine synthase 1-l...    134   1e-35   
ref|XP_010035406.1|  PREDICTED: S-adenosylmethionine synthase 1         134   1e-35   
ref|XP_008343205.1|  PREDICTED: S-adenosylmethionine synthase 1         134   1e-35   
ref|XP_010093299.1|  S-adenosylmethionine synthase 1                    134   1e-35   
sp|P49613.1|METK2_PEA  RecName: Full=S-adenosylmethionine synthas...    133   1e-35   Pisum sativum [garden pea]
sp|P93438.1|METK2_ORYSJ  RecName: Full=S-adenosylmethionine synth...    134   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003625682.1|  S-adenosylmethionine synthetase                    135   1e-35   
ref|XP_006419259.1|  hypothetical protein CICLE_v10005146mg             134   2e-35   
gb|EYU19403.1|  hypothetical protein MIMGU_mgv1a007849mg                134   2e-35   
ref|XP_007144340.1|  hypothetical protein PHAVU_007G148000g             134   2e-35   
ref|XP_009402630.1|  PREDICTED: S-adenosylmethionine synthase 3         134   2e-35   
ref|XP_006488750.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    134   2e-35   
ref|XP_009400237.1|  PREDICTED: S-adenosylmethionine synthase 5-like    134   2e-35   
sp|Q38JH8.1|METK2_SOLTU  RecName: Full=S-adenosylmethionine synth...    134   2e-35   Solanum tuberosum [potatoes]
ref|XP_010938162.1|  PREDICTED: S-adenosylmethionine synthase           134   2e-35   
ref|XP_006354373.1|  PREDICTED: S-adenosylmethionine synthase 2-l...    133   2e-35   
gb|AEN14510.1|  S-adenosylmethionine synthetase                         133   2e-35   
ref|XP_007144342.1|  hypothetical protein PHAVU_007G148100g             133   2e-35   
ref|XP_006424470.1|  hypothetical protein CICLE_v10028614mg             133   2e-35   
sp|Q9AT55.1|METK2_ELAUM  RecName: Full=S-adenosylmethionine synth...    133   2e-35   Elaeagnus umbellata [aki-gumi]
ref|XP_010941482.1|  PREDICTED: S-adenosylmethionine synthase-like      133   2e-35   
ref|XP_010524596.1|  PREDICTED: S-adenosylmethionine synthase           133   2e-35   
emb|CDX91837.1|  BnaC03g31390D                                          133   2e-35   
ref|XP_008800644.1|  PREDICTED: S-adenosylmethionine synthase 1         133   2e-35   
ref|XP_009412154.1|  PREDICTED: S-adenosylmethionine synthase           133   2e-35   
ref|XP_010270953.1|  PREDICTED: S-adenosylmethionine synthase 5         133   2e-35   
sp|O22338.1|METK_MUSAC  RecName: Full=S-adenosylmethionine syntha...    133   2e-35   Musa acuminata [banana]
ref|XP_009366042.1|  PREDICTED: S-adenosylmethionine synthase 5-like    133   2e-35   
sp|Q84MM2.1|METK_LITCN  RecName: Full=S-adenosylmethionine syntha...    133   2e-35   Litchi chinensis [litchi]
ref|XP_009124482.1|  PREDICTED: S-adenosylmethionine synthase 2         133   2e-35   
gb|ADN96174.1|  S-adenosylmethionine synthetase                         133   2e-35   
gb|AGW99248.1|  S-adenosylmethionine synthetase                         133   2e-35   
emb|CDY37784.1|  BnaC04g00410D                                          133   2e-35   
sp|Q4LB21.1|METK4_HORVU  RecName: Full=S-adenosylmethionine synth...    133   2e-35   Hordeum vulgare [barley]
gb|AHA80147.1|  S-adenosylmethionine synthetase                         133   2e-35   
gb|KDO60254.1|  hypothetical protein CISIN_1g045474mg                   133   2e-35   
ref|XP_010914756.1|  PREDICTED: S-adenosylmethionine synthase-like      133   2e-35   
ref|XP_003541415.1|  PREDICTED: S-adenosylmethionine synthase 3-like    133   2e-35   
ref|XP_006488022.1|  PREDICTED: S-adenosylmethionine synthase 3-like    133   2e-35   
ref|XP_002266358.1|  PREDICTED: S-adenosylmethionine synthase 2         133   2e-35   Vitis vinifera
emb|CAN75334.1|  hypothetical protein VITISV_002362                     133   2e-35   Vitis vinifera
ref|XP_008778582.1|  PREDICTED: S-adenosylmethionine synthase-like      133   2e-35   
emb|CAN75687.1|  hypothetical protein VITISV_034977                     133   2e-35   Vitis vinifera
ref|XP_002512570.1|  s-adenosylmethionine synthetase, putative          133   3e-35   Ricinus communis
ref|XP_009391996.1|  PREDICTED: S-adenosylmethionine synthase           133   3e-35   
sp|B0LXM0.1|METK_WHEAT  RecName: Full=S-adenosylmethionine syntha...    133   3e-35   Triticum aestivum [Canadian hard winter wheat]
gb|KEH37748.1|  S-adenosylmethionine synthase-like protein              133   3e-35   
gb|EMS52834.1|  S-adenosylmethionine synthase 4                         134   3e-35   
ref|XP_008447451.1|  PREDICTED: S-adenosylmethionine synthase 2         133   3e-35   
ref|XP_004967601.1|  PREDICTED: S-adenosylmethionine synthase 3-l...    133   3e-35   
ref|XP_010241791.1|  PREDICTED: S-adenosylmethionine synthase 1-like    133   3e-35   
ref|XP_006388227.1|  hypothetical protein POPTR_0274s002001g            132   3e-35   
gb|AAA32868.1|  S-adenosylmethionine synthetase                         133   3e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDX74394.1|  BnaA03g26530D                                          132   3e-35   
gb|EMT13885.1|  S-adenosylmethionine synthetase                         133   3e-35   
ref|XP_007031241.1|  S-adenosylmethionine synthetase 1                  133   3e-35   
emb|CDY72092.1|  BnaCnng75920D                                          132   3e-35   
ref|NP_171751.1|  S-adenosylmethionine synthetase 1                     133   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002457705.1|  hypothetical protein SORBIDRAFT_03g011930          133   3e-35   Sorghum bicolor [broomcorn]
ref|XP_004967602.1|  PREDICTED: S-adenosylmethionine synthase 3-l...    133   3e-35   
gb|AAP87282.1|  putative S-adenosylmethionine synthetase                132   3e-35   Brassica oleracea var. capitata
ref|XP_009353412.1|  PREDICTED: S-adenosylmethionine synthase 2-like    133   3e-35   
ref|XP_003567567.1|  PREDICTED: S-adenosylmethionine synthase 4         133   3e-35   
gb|AAT40304.1|  S-adenosylmethionine synthase                           133   3e-35   Medicago sativa [alfalfa]
sp|Q96552.1|METK2_CATRO  RecName: Full=S-adenosylmethionine synth...    133   3e-35   Catharanthus roseus [chatas]
ref|XP_008390498.1|  PREDICTED: S-adenosylmethionine synthase 2         133   3e-35   
gb|KHG12602.1|  S-adenosylmethionine synthase 2                         133   3e-35   
ref|XP_010422683.1|  PREDICTED: S-adenosylmethionine synthase           132   3e-35   
ref|XP_009359772.1|  PREDICTED: S-adenosylmethionine synthase 2-like    132   3e-35   
ref|XP_010024863.1|  PREDICTED: S-adenosylmethionine synthase 2         132   4e-35   
ref|XP_006287904.1|  hypothetical protein CARUB_v10001138mg             132   4e-35   
gb|AAS83521.1|  S-adenosylmethionine synthetase 2                       128   4e-35   Camellia sinensis var. sinensis
ref|XP_006855322.1|  hypothetical protein AMTR_s00057p00083760          132   4e-35   
ref|XP_010528006.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    132   4e-35   
ref|XP_010659744.1|  PREDICTED: S-adenosylmethionine synthase 4         132   4e-35   
gb|KHG08721.1|  S-adenosylmethionine synthase 1                         132   4e-35   
ref|XP_004494065.1|  PREDICTED: S-adenosylmethionine synthase 3-like    132   4e-35   
sp|Q8W3Y4.1|METK_PHALU  RecName: Full=S-adenosylmethionine syntha...    132   4e-35   Phaseolus lunatus
ref|XP_008390375.1|  PREDICTED: S-adenosylmethionine synthase 2-like    132   4e-35   
ref|XP_011003147.1|  PREDICTED: S-adenosylmethionine synthase 1         132   4e-35   
ref|XP_009134472.1|  PREDICTED: S-adenosylmethionine synthase           132   4e-35   
emb|CDO98704.1|  unnamed protein product                                132   4e-35   
ref|NP_001042349.1|  Os01g0207300                                       127   4e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004252944.1|  PREDICTED: S-adenosylmethionine synthase 2         132   4e-35   
ref|XP_011014828.1|  PREDICTED: S-adenosylmethionine synthase 1         132   4e-35   
ref|NP_001148708.1|  S-adenosylmethionine synthetase 1                  132   4e-35   Zea mays [maize]
ref|XP_006349861.1|  PREDICTED: S-adenosylmethionine synthase 2-like    132   4e-35   
ref|XP_002301543.1|  hypothetical protein POPTR_0002s19000g             132   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_008654959.1|  PREDICTED: S-adenosylmethionine synthetase 1...    132   4e-35   
ref|XP_009111338.1|  PREDICTED: S-adenosylmethionine synthase-like      132   4e-35   
gb|AGV22115.1|  S-adenosylmethionine synthetase 2                       132   4e-35   
gb|AHA84275.1|  S-adenosylmethionine synthase                           132   4e-35   
sp|Q5DNB1.1|METK_BRARP  RecName: Full=S-adenosylmethionine syntha...    132   4e-35   Brassica rapa subsp. pekinensis [bai cai]
gb|AHY28818.1|  s-adenosylmethionine synthetase 1                       127   4e-35   
ref|XP_006396376.1|  hypothetical protein EUTSA_v10028715mg             132   4e-35   
gb|AHY28817.1|  s-adenosylmethionine synthetase 1                       127   5e-35   
sp|Q94FA6.1|METK3_BRAJU  RecName: Full=S-adenosylmethionine synth...    132   5e-35   Brassica juncea [brown mustard]
ref|XP_010456120.1|  PREDICTED: S-adenosylmethionine synthase-like      132   5e-35   
gb|AHY28816.1|  s-adenosylmethionine synthetase 1                       126   5e-35   
ref|XP_002320949.1|  S-adenosylmethionine synthetase 1 family pro...    132   5e-35   Populus trichocarpa [western balsam poplar]
sp|P49611.1|METK1_BRAJU  RecName: Full=S-adenosylmethionine synth...    132   5e-35   Brassica juncea [brown mustard]
ref|NP_001132867.2|  uncharacterized protein LOC100194360               132   5e-35   Zea mays [maize]
ref|XP_010428836.1|  PREDICTED: S-adenosylmethionine synthase-like      132   5e-35   
ref|XP_009367157.1|  PREDICTED: S-adenosylmethionine synthase 1-like    132   5e-35   
gb|AAV34107.1|  S-adenosyl methionine synthetase 1                      126   5e-35   Pinus taeda
sp|A9PHE9.1|METK5_POPTR  RecName: Full=S-adenosylmethionine synth...    132   5e-35   Populus trichocarpa [western balsam poplar]
gb|KHN14160.1|  S-adenosylmethionine synthase 1                         132   5e-35   
ref|XP_004515907.1|  PREDICTED: S-adenosylmethionine synthase 2-like    132   6e-35   
ref|XP_011092195.1|  PREDICTED: S-adenosylmethionine synthase 1-like    132   6e-35   
ref|XP_007154447.1|  hypothetical protein PHAVU_003G120000g             132   6e-35   
ref|XP_011071333.1|  PREDICTED: S-adenosylmethionine synthase 2         132   6e-35   
ref|XP_003626035.1|  S-adenosylmethionine synthetase                    132   6e-35   
ref|XP_002280106.1|  PREDICTED: S-adenosylmethionine synthase 5         132   6e-35   Vitis vinifera
ref|XP_002872873.1|  S-adenosylmethionine synthetase                    132   7e-35   
sp|Q4H1G3.1|METK2_BETVU  RecName: Full=S-adenosylmethionine synth...    132   7e-35   Beta vulgaris [beet]
sp|P50303.1|METK3_ACTCH  RecName: Full=S-adenosylmethionine synth...    131   7e-35   Actinidia chinensis
gb|ABP35525.1|  S-adenosyl-L-methionine synthetase                      132   7e-35   Ipomoea batatas [batate]
gb|KDP27996.1|  hypothetical protein JCGZ_19076                         132   7e-35   
ref|XP_010679475.1|  PREDICTED: S-adenosylmethionine synthase 2         132   7e-35   
ref|XP_003521610.1|  PREDICTED: S-adenosylmethionine synthase 1-l...    132   7e-35   
gb|ACU24454.1|  unknown                                                 132   7e-35   
ref|NP_192094.1|  S-adenosylmethionine synthase 2                       132   7e-35   
ref|XP_004494460.1|  PREDICTED: S-adenosylmethionine synthase-like      132   7e-35   
ref|XP_004968660.1|  PREDICTED: S-adenosylmethionine synthase 1-like    132   7e-35   
ref|XP_003554569.1|  PREDICTED: S-adenosylmethionine synthase 1-l...    132   8e-35   
gb|KCW61378.1|  hypothetical protein EUGRSUZ_H04112                     132   8e-35   
gb|ABY25855.1|  S-adenosylmethionine synthetase                         132   8e-35   
gb|ABU94038.1|  S-adenosylmethionine synthetase                         126   9e-35   
gb|KHG10268.1|  S-adenosylmethionine synthase 4                         132   9e-35   
ref|XP_004297092.1|  PREDICTED: S-adenosylmethionine synthase 3-l...    130   9e-35   
ref|XP_009114068.1|  PREDICTED: S-adenosylmethionine synthase 2         132   9e-35   
ref|XP_008372935.1|  PREDICTED: S-adenosylmethionine synthase 4-like    129   9e-35   
gb|ADC80655.1|  S-adenosylmethionine synthase-like protein              126   9e-35   
ref|XP_010911974.1|  PREDICTED: S-adenosylmethionine synthase 3         131   9e-35   
gb|AFK36950.1|  unknown                                                 131   9e-35   
ref|XP_008223483.1|  PREDICTED: S-adenosylmethionine synthase 5         131   9e-35   
sp|Q9FUZ1.1|METK2_BRAJU  RecName: Full=S-adenosylmethionine synth...    131   9e-35   
ref|XP_007223013.1|  hypothetical protein PRUPE_ppa006841mg             131   9e-35   
gb|EMT05684.1|  S-adenosylmethionine synthetase 2                       131   1e-34   
gb|EMS47328.1|  S-adenosylmethionine synthase 1                         131   1e-34   
ref|XP_003609861.1|  S-adenosylmethionine synthetase                    132   1e-34   
gb|ADM18304.1|  SAM synthetase 1                                        131   1e-34   
emb|CDY48693.1|  BnaCnng16700D                                          131   1e-34   
gb|ABU94049.1|  S-adenosylmethionine synthetase                         126   1e-34   
ref|XP_010091412.1|  S-adenosylmethionine synthase 2                    131   1e-34   
ref|XP_006645787.1|  PREDICTED: S-adenosylmethionine synthase 3-like    131   1e-34   
sp|Q9LDQ7.1|METK_CAMSI  RecName: Full=S-adenosylmethionine syntha...    131   1e-34   
ref|XP_006840308.1|  hypothetical protein AMTR_s00045p00073480          131   1e-34   
ref|XP_002961973.1|  hypothetical protein SELMODRAFT_164791             131   1e-34   
ref|XP_009385101.1|  PREDICTED: S-adenosylmethionine synthase 3-like    132   2e-34   
emb|CAJ45523.1|  S-adenosylmethionine synthetase                        131   2e-34   
ref|WP_039310884.1|  S-adenosylmethionine synthetase                    131   2e-34   
ref|XP_004297091.1|  PREDICTED: S-adenosylmethionine synthase 3-l...    130   2e-34   
ref|XP_001769033.1|  predicted protein                                  125   2e-34   
sp|P50299.1|METK1_HORVU  RecName: Full=S-adenosylmethionine synth...    131   2e-34   
emb|CAJ01702.1|  putative AdoMet synthase 1                             131   2e-34   
sp|Q4LB23.1|METK2_HORVU  RecName: Full=S-adenosylmethionine synth...    131   2e-34   
sp|Q56TU3.1|METK2_DAUCA  RecName: Full=S-adenosylmethionine synth...    131   2e-34   
ref|XP_004297088.1|  PREDICTED: S-adenosylmethionine synthase 3-l...    131   2e-34   
ref|XP_004960412.1|  PREDICTED: S-adenosylmethionine synthase 1-like    131   2e-34   
ref|XP_004297087.1|  PREDICTED: S-adenosylmethionine synthase 3-l...    130   2e-34   
gb|AFW97626.1|  putative S-adenosylmethionine synthetase                130   2e-34   
emb|CDX82370.1|  BnaA03g34510D                                          130   2e-34   
gb|ADC45377.1|  S-adenosylmethionine synthetase                         130   2e-34   
ref|XP_009389524.1|  PREDICTED: S-adenosylmethionine synthase 5         130   2e-34   
ref|XP_006406736.1|  hypothetical protein EUTSA_v10020887mg             130   2e-34   
gb|AFV79319.1|  s-adenosyl methionine synthetase                        126   2e-34   
gb|AFV79415.1|  s-adenosyl methionine synthetase                        125   2e-34   
dbj|BAF01944.1|  s-adenosylmethionine synthetase like protein           130   2e-34   
sp|P49612.2|METK1_PEA  RecName: Full=S-adenosylmethionine synthas...    130   2e-34   
gb|EPS69795.1|  s-adenosylmethionine synthase                           130   2e-34   
gb|AAA58772.1|  S-adenosylmethionine synthase                           130   2e-34   
ref|NP_188365.1|  S-adenosylmethionine synthase 4                       130   2e-34   
ref|XP_006297742.1|  hypothetical protein CARUB_v10013777mg             130   3e-34   
ref|XP_009617578.1|  PREDICTED: S-adenosylmethionine synthase 2-like    130   3e-34   
gb|ABU94067.1|  S-adenosylmethionine synthetase                         125   3e-34   
ref|XP_008785826.1|  PREDICTED: S-adenosylmethionine synthase 3         130   3e-34   
ref|XP_009589856.1|  PREDICTED: S-adenosylmethionine synthase 1         130   3e-34   
ref|NP_001042794.1|  Os01g0293000                                       130   3e-34   
ref|XP_010465788.1|  PREDICTED: S-adenosylmethionine synthase 4         130   3e-34   
gb|EPS65878.1|  s-adenosylmethionine synthase 1                         127   3e-34   
ref|XP_010505371.1|  PREDICTED: S-adenosylmethionine synthase 4-like    130   3e-34   
ref|XP_009391529.1|  PREDICTED: S-adenosylmethionine synthase-like      130   4e-34   
sp|Q8GTL5.1|METK_CARPA  RecName: Full=S-adenosylmethionine syntha...    130   4e-34   
gb|ADM64331.1|  S-adenosyl-L-methionine synthase                        130   4e-34   
emb|CDX75914.1|  BnaC03g39970D                                          130   4e-34   
ref|XP_009772911.1|  PREDICTED: S-adenosylmethionine synthase 2         130   4e-34   
ref|XP_009609235.1|  PREDICTED: S-adenosylmethionine synthase 2         130   4e-34   
ref|XP_002439235.1|  hypothetical protein SORBIDRAFT_09g002840          130   4e-34   
gb|KDP23344.1|  hypothetical protein JCGZ_23177                         130   4e-34   
dbj|BAP19030.1|  S-adenosyl-L-methionine synthase like protein          130   4e-34   
gb|AHX42567.1|  S-adenosylmethionine synthetase                         130   5e-34   
ref|XP_009401660.1|  PREDICTED: S-adenosylmethionine synthase 1-like    130   5e-34   
ref|XP_007163226.1|  hypothetical protein PHAVU_001G216700g             129   5e-34   
ref|NP_001054575.1|  Os05g0135700                                       129   5e-34   
emb|CAJ45511.1|  S-adenosylmethionine synthetase                        129   5e-34   
ref|XP_003536989.1|  PREDICTED: S-adenosylmethionine synthase 1-like    129   5e-34   
emb|CAC82203.1|  S-adenosylmethionine synthetase                        129   5e-34   
ref|XP_006654018.1|  PREDICTED: S-adenosylmethionine synthase 1-like    129   5e-34   
emb|CAJ45548.1|  S-adenosylmethionine synthetase                        129   5e-34   
emb|CAJ45536.1|  S-adenosylmethionine synthetase                        129   5e-34   
emb|CAJ45501.1|  S-adenosylmethionine synthetas                         129   5e-34   
emb|CAJ45486.1|  S-adenosylmethionine synthetase                        129   5e-34   
gb|AGV54237.1|  S-adenosylmethionine synthase 1-like isoform 1          129   5e-34   
emb|CAJ45528.1|  S-adenosylmethionine synthetase                        129   5e-34   
emb|CAJ45530.1|  S-adenosylmethionine synthetase                        129   5e-34   
ref|XP_006428268.1|  hypothetical protein CICLE_v10011912mg             129   5e-34   
emb|CAJ45497.1|  S-adenosylmethionine synthetas                         129   5e-34   
emb|CAJ45492.1|  S-adenosylmethionine synthetas                         129   5e-34   
emb|CAJ45561.1|  S-adenosylmethionine synthetase                        129   5e-34   
gb|AFC88125.1|  S-adenosylmethionine synthetase                         129   5e-34   
emb|CAJ45487.1|  S-adenosylmethionine synthetase                        129   6e-34   
emb|CAJ45488.1|  S-adenosylmethionine synthetase                        129   6e-34   
emb|CAJ45521.1|  S-adenosylmethionine synthetase                        129   6e-34   
ref|XP_007145110.1|  hypothetical protein PHAVU_007G210700g             129   6e-34   
gb|AFN54653.1|  S-adenosylmethionine synthetase                         129   6e-34   
emb|CAJ45544.1|  S-adenosylmethionine synthetase                        129   6e-34   
gb|AGE46016.1|  s-adenosylmethionine synthetase                         129   7e-34   
gb|ACG42196.1|  S-adenosylmethionine synthetase 1                       129   7e-34   
sp|Q9SBQ7.1|METK3_PETHY  RecName: Full=S-adenosylmethionine synth...    129   7e-34   
ref|XP_008370347.1|  PREDICTED: S-adenosylmethionine synthase 5-like    129   7e-34   
ref|NP_001146249.1|  uncharacterized protein LOC100279822               129   8e-34   
gb|ACF79074.1|  unknown                                                 129   8e-34   
ref|XP_006644126.1|  PREDICTED: S-adenosylmethionine synthase 2-like    129   8e-34   
emb|CAJ45532.1|  S-adenosylmethionine synthetase                        129   8e-34   
gb|AHH25131.1|  S-adenosylmethionine synthetase-1                       129   8e-34   
emb|CAJ45535.1|  S-adenosylmethionine synthetase                        129   8e-34   
ref|XP_007163296.1|  hypothetical protein PHAVU_001G222800g             129   8e-34   
gb|EEE67155.1|  hypothetical protein OsJ_24224                          129   8e-34   
gb|ACN40813.1|  unknown                                                 127   8e-34   
emb|CAJ45533.1|  S-adenosylmethionine synthetase                        129   8e-34   
ref|XP_007154451.1|  hypothetical protein PHAVU_003G120300g             129   8e-34   
gb|ADC80657.1|  S-adenosylmethionine synthase-like protein              124   9e-34   
ref|XP_009135526.1|  PREDICTED: S-adenosylmethionine synthase 2-like    129   9e-34   
ref|XP_001778739.1|  predicted protein                                  129   1e-33   
ref|XP_007221573.1|  hypothetical protein PRUPE_ppa025497mg             128   1e-33   
gb|ABK94600.1|  unknown                                                 129   1e-33   
ref|XP_008227796.1|  PREDICTED: S-adenosylmethionine synthase 1         129   1e-33   
sp|Q6F3F0.1|METK3_ATRNU  RecName: Full=S-adenosylmethionine synth...    129   1e-33   
ref|XP_002319463.1|  S-adenosylmethionine synthetase-2 family pro...    129   1e-33   
ref|XP_011023857.1|  PREDICTED: S-adenosylmethionine synthase 2         129   1e-33   
gb|AFW82691.1|  methionine adenosyltransferase                          129   1e-33   
ref|NP_001234425.1|  S-adenosylmethionine synthase 1                    129   1e-33   
ref|XP_003567630.1|  PREDICTED: S-adenosylmethionine synthase 3-like    129   1e-33   
gb|KEH42171.1|  S-adenosylmethionine synthase-like protein              128   1e-33   
ref|XP_009793311.1|  PREDICTED: S-adenosylmethionine synthase 1-like    128   1e-33   
gb|AGF95108.1|  S-adenosylmethionine synthetase                         128   1e-33   
ref|XP_007051250.1|  S-adenosylmethionine synthetase 2 isoform 1        128   1e-33   
gb|AGV22114.1|  S-adenosylmethionine synthetase 1                       128   1e-33   
sp|Q56TU4.1|METK1_DAUCA  RecName: Full=S-adenosylmethionine synth...    129   1e-33   
sp|Q6GV10.1|METK_SOLPL  RecName: Full=S-adenosylmethionine syntha...    128   1e-33   
ref|NP_001275609.1|  S-adenosylmethionine synthase 1                    128   2e-33   
gb|KEH42170.1|  S-adenosylmethionine synthase-like protein              128   2e-33   
emb|CAJ45555.1|  S-adenosylmethionine synthetase                        128   2e-33   
gb|ABB29941.1|  S-adenosyl methionine synthase-like                     127   2e-33   
emb|CAJ45556.1|  S-adenosylmethionine synthetase                        128   2e-33   
emb|CDX79695.1|  BnaC03g20310D                                          127   2e-33   
ref|XP_010230849.1|  PREDICTED: S-adenosylmethionine synthase 1         127   3e-33   
dbj|BAP47512.1|  S-adenosylmethionine synthetase                        127   3e-33   
emb|CDM83018.1|  unnamed protein product                                127   3e-33   
sp|A6XMY9.1|METK1_TRIMO  RecName: Full=S-adenosylmethionine synth...    127   3e-33   
emb|CDY46742.1|  BnaA03g16860D                                          127   3e-33   
ref|XP_011040531.1|  PREDICTED: S-adenosylmethionine synthase 1-like    127   3e-33   
gb|EMS55466.1|  S-adenosylmethionine synthase 1                         127   3e-33   
emb|CDY33203.1|  BnaC04g08360D                                          127   3e-33   
gb|AGE09560.1|  SAM2-like protein                                       127   3e-33   
emb|CDX75007.1|  BnaA05g07530D                                          127   3e-33   
gb|ADC80656.1|  S-adenosylmethionine synthase-like protein              122   3e-33   
gb|AGF69113.1|  S-adenosylmethionine synthetase                         127   4e-33   
ref|XP_010099707.1|  S-adenosylmethionine synthase 2                    127   4e-33   
ref|NP_001130734.1|  uncharacterized protein LOC100191838               127   4e-33   
gb|ABR18346.1|  unknown                                                 127   4e-33   
ref|XP_009133101.1|  PREDICTED: S-adenosylmethionine synthase 3         127   4e-33   
ref|XP_006410860.1|  hypothetical protein EUTSA_v10016774mg             127   5e-33   
ref|XP_002881476.1|  hypothetical protein ARALYDRAFT_902809             127   5e-33   
sp|Q94FA5.1|METK4_BRAJU  RecName: Full=S-adenosylmethionine synth...    127   5e-33   
ref|XP_002519309.1|  s-adenosylmethionine synthetase, putative          127   5e-33   
sp|Q9FVG7.1|METK2_PINCO  RecName: Full=S-adenosylmethionine synth...    127   5e-33   
ref|NP_181225.1|  S-adenosylmethionine synthase 3                       127   5e-33   
sp|A9P2P4.1|METK3_PICSI  RecName: Full=S-adenosylmethionine synth...    127   6e-33   
ref|XP_009141614.1|  PREDICTED: S-adenosylmethionine synthase 3-like    126   7e-33   
sp|P50300.1|METK_PINBN  RecName: Full=S-adenosylmethionine syntha...    126   7e-33   
gb|AER27715.1|  S-adenosyl-L-methionine synthase                        125   7e-33   
ref|XP_003536032.1|  PREDICTED: S-adenosylmethionine synthase 1-l...    126   8e-33   
sp|A9NYY0.1|METK2_PICSI  RecName: Full=S-adenosylmethionine synth...    126   9e-33   
ref|XP_001778741.1|  predicted protein                                  126   1e-32   
sp|Q6F3F1.1|METK4_ATRNU  RecName: Full=S-adenosylmethionine synth...    126   1e-32   
sp|Q7XZR1.2|METK1_ATRNU  RecName: Full=S-adenosylmethionine synth...    126   1e-32   
gb|AHH25132.1|  S-adenosylmethionine synthetase-2                       124   1e-32   
ref|XP_010045729.1|  PREDICTED: S-adenosylmethionine synthase 5         125   1e-32   
sp|Q6F3F3.1|METK2_ATRNU  RecName: Full=S-adenosylmethionine synth...    125   2e-32   
sp|P24260.1|METK2_DIACA  RecName: Full=S-adenosylmethionine synth...    125   2e-32   
emb|CAJ45565.1|  S-adenosylmethionine synthetase                        125   2e-32   
ref|XP_009403767.1|  PREDICTED: S-adenosylmethionine synthase 1         125   2e-32   
gb|EMT15540.1|  S-adenosylmethionine synthetase 1                       124   3e-32   
ref|XP_010509423.1|  PREDICTED: S-adenosylmethionine synthase 3-like    125   3e-32   
ref|XP_009795613.1|  PREDICTED: S-adenosylmethionine synthase 3-like    124   3e-32   
ref|XP_010674512.1|  PREDICTED: S-adenosylmethionine synthase 1         124   5e-32   
sp|Q4H1G4.1|METK1_BETVU  RecName: Full=S-adenosylmethionine synth...    124   6e-32   
ref|XP_005652163.1|  methionine adenosyltransferase                     124   8e-32   
gb|ABA01149.1|  S-adenosyl-L-methionine synthetase                      121   8e-32   
gb|EMT05685.1|  S-adenosylmethionine synthetase 3                       122   9e-32   
sp|P93254.1|METK_MESCR  RecName: Full=S-adenosylmethionine syntha...    123   9e-32   
ref|XP_009626028.1|  PREDICTED: S-adenosylmethionine synthase 3-like    123   1e-31   
sp|Q4LB22.1|METK3_HORVU  RecName: Full=S-adenosylmethionine synth...    122   2e-31   
gb|ADI46913.1|  METM1m                                                  122   3e-31   
ref|XP_001696661.1|  S-Adenosylmethionine synthetase                    122   3e-31   
gb|KFM24334.1|  S-adenosylmethionine synthase 2                         120   1e-30   
ref|XP_005848049.1|  S-adenosyl-L-methionine synthetase                 120   1e-30   
gb|ADI46846.1|  METM1f                                                  119   4e-30   
gb|KDD76402.1|  S-adenosylmethionine synthetase                         118   9e-30   
gb|AFH58668.1|  S-adenosylmethionine synthetase                         113   3e-29   
gb|AFH58667.1|  S-adenosylmethionine synthetase                         113   3e-29   
ref|XP_011089950.1|  PREDICTED: S-adenosylmethionine synthase 3-like    114   2e-28   
ref|XP_003083240.1|  S-adenosylmethionine synthetase (ISS)              112   8e-28   
gb|AGR66194.1|  methionine adenosyltransferase                          110   1e-27   
gb|KCW46782.1|  hypothetical protein EUGRSUZ_K00588                     109   1e-26   
ref|XP_001421225.1|  predicted protein                                  107   4e-26   
ref|XP_003061327.1|  predicted protein                                  106   1e-25   
ref|XP_002506656.1|  predicted protein                                  105   3e-25   
gb|AGG11669.1|  hypothetical protein                                    104   5e-25   
gb|AGT02663.1|  methionine adenosyltransferase                          104   7e-25   
ref|XP_761166.1|  hypothetical protein UM05019.1                        103   1e-24   
emb|CDI57118.1|  probable SAM2-S-adenosylmethionine synthetase 2        103   1e-24   
emb|CCF50180.1|  probable SAM2-S-adenosylmethionine synthetase 2        103   1e-24   
dbj|GAC92847.1|  S-adenosylmethionine synthetase                        103   1e-24   
emb|CCD12926.1|  unnamed protein product                              99.0    2e-24   
gb|EST09127.1|  S-adenosylmethionine synthetase                         103   2e-24   
sp|O43938.2|METK_LEIIN  RecName: Full=S-adenosylmethionine syntha...    102   3e-24   
ref|XP_003863067.1|  S-adenosylmethionine synthetase                    102   3e-24   
ref|XP_003392704.1|  S-adenosylmethionine synthetase                    102   3e-24   
gb|ETS65397.1|  hypothetical protein PaG_00131                          102   4e-24   
dbj|GAC71506.1|  20S proteasome, regulatory subunit beta type PSM...    102   4e-24   
dbj|BAC81655.1|  S-adenosylmethionine synthetase-2                      102   4e-24   
ref|XP_007880508.1|  hypothetical protein PFL1_04789                    102   4e-24   
ref|XP_007514977.1|  predicted protein                                  102   4e-24   
emb|CBQ69436.1|  probable SAM2-S-adenosylmethionine synthetase 2        102   4e-24   
ref|WP_012671903.1|  S-adenosylmethionine synthetase                    102   5e-24   
ref|WP_014488673.1|  S-adenosylmethionine synthetase                    102   5e-24   



>dbj|BAA21726.1| S-adenosylmethionine synthase [Nicotiana tabacum]
Length=113

 Score =   138 bits (347),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_002519480.1| s-adenosylmethionine synthetase, putative [Ricinus communis]
 gb|EEF42894.1| s-adenosylmethionine synthetase, putative [Ricinus communis]
Length=390

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/70 (97%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010312254.1| PREDICTED: S-adenosylmethionine synthase 3-like [Solanum lycopersicum]
Length=390

 Score =   142 bits (359),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/70 (96%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDAD+CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|AAL33587.1| methionine adenosyltransferase [Zea mays]
Length=253

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  23   EQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADNCKV  82

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  83   LVNIEQQSPD  92



>sp|P50302.1|METK2_ACTCH RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Actinidia chinensis]
 gb|AAA81377.1| S-adenosylmethionine synthetase [Actinidia chinensis]
Length=390

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKV+YEKIVRDTCRGIGFTSPDVGLDAD+CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFTSPDVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_009796999.1| PREDICTED: S-adenosylmethionine synthase 2-like [Nicotiana sylvestris]
 ref|XP_009797000.1| PREDICTED: S-adenosylmethionine synthase 2-like [Nicotiana sylvestris]
Length=390

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTSPDVGLDADNCKVL
Sbjct  34   QDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>gb|ADC80653.1| S-adenosylmethionine synthase-like protein [Eperua falcata]
Length=167

 Score =   135 bits (340),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  2    EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFVSDDVGLDADNCKV  61

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  62   LVNIEQQSPD  71



>ref|XP_010098790.1| S-adenosylmethionine synthase 2 [Morus notabilis]
 gb|EXB75878.1| S-adenosylmethionine synthase 2 [Morus notabilis]
Length=390

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KT+MVMVFGEITTKA+VDYEKIVRDTCRGIGFTSPDVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTSMVMVFGEITTKAEVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>sp|Q96553.1|METK3_CATRO RecName: Full=S-adenosylmethionine synthase 3; Short=AdoMet synthase 
3; AltName: Full=Methionine adenosyltransferase 3; Short=MAT 
3 [Catharanthus roseus]
 emb|CAA95858.1| S-adenosyl-L-methionine synthetase 3 [Catharanthus roseus]
Length=390

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA V+YEKIVRDTCRGIGFTSPDVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVNYEKIVRDTCRGIGFTSPDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_011094598.1| PREDICTED: S-adenosylmethionine synthase 3 [Sesamum indicum]
Length=390

 Score =   140 bits (353),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA ++YEKIVRDTCRGIGFTSPDVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKANINYEKIVRDTCRGIGFTSPDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|AGF95107.1| S-adenosylmethionine synthetase, partial [Prunus persica]
Length=232

 Score =   136 bits (343),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITT+AKVDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTQAKVDYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSP+
Sbjct  93   LVNIEKQSPE  102



>ref|XP_003632745.1| PREDICTED: S-adenosylmethionine synthase 3 [Vitis vinifera]
 ref|XP_010653984.1| PREDICTED: S-adenosylmethionine synthase 3 [Vitis vinifera]
 sp|A7QJG1.1|METK3_VITVI RecName: Full=S-adenosylmethionine synthase 3; Short=AdoMet synthase 
3; AltName: Full=Methionine adenosyltransferase 3; Short=MAT 
3 [Vitis vinifera]
Length=389

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/70 (96%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|ABO27088.1| S-adenosylmethionine synthetase [Dendrobium hybrid cultivar]
Length=207

 Score =   135 bits (341),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETCSKTNMVM+FGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  36   EQDPDSKVACETCSKTNMVMIFGEITTKANVDYEKIVRDTCRAIGFVSDDVGLDADNCKV  95

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  96   LVNIEQQSPD  105



>ref|XP_007162776.1| hypothetical protein PHAVU_001G179500g [Phaseolus vulgaris]
 gb|ESW34770.1| hypothetical protein PHAVU_001G179500g [Phaseolus vulgaris]
Length=390

 Score =   140 bits (352),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA V+YEKIVRDTCRGIGF SPDVGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFVSPDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|AGV22116.1| S-adenosylmethionine synthetase 3 [Betula luminifera]
Length=390

 Score =   140 bits (352),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKV+YEK+VRDTCRGIGF SPDVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKLVRDTCRGIGFVSPDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>sp|Q6SYB9.1|METK2_TOBAC RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Nicotiana tabacum]
 gb|AAR15895.1| S-adenosyl-L-methionine synthetase [Nicotiana tabacum]
Length=390

 Score =   140 bits (352),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTS DVGLDAD+CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSADVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_009596067.1| PREDICTED: S-adenosylmethionine synthase 2 [Nicotiana tomentosiformis]
 gb|AAQ14854.1|AF321140_1 S-adenosylmethionine synthase [Nicotiana tabacum]
Length=390

 Score =   140 bits (352),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTS DVGLDAD+CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSADVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_011077317.1| PREDICTED: S-adenosylmethionine synthase 3 [Sesamum indicum]
Length=390

 Score =   140 bits (352),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA ++YEKIVRDTCRGIGFTSPDVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKANLNYEKIVRDTCRGIGFTSPDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>emb|CBI30144.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   140 bits (353),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/70 (96%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  125  EQDPESKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFVSADVGLDADNCKV  184

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  185  LVNIEQQSPD  194



>ref|XP_009795880.1| PREDICTED: S-adenosylmethionine synthase 2 [Nicotiana sylvestris]
 ref|XP_009795882.1| PREDICTED: S-adenosylmethionine synthase 2 [Nicotiana sylvestris]
 gb|AGT40327.1| SAM synthetase [Nicotiana attenuata]
Length=390

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTS DVGLDAD+CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSADVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010558180.1| PREDICTED: S-adenosylmethionine synthase 4 [Tarenaya hassleriana]
Length=390

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA+VDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAQVDYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_006339084.1| PREDICTED: S-adenosylmethionine synthase 3-like [Solanum tuberosum]
Length=390

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTS DVGLDAD+CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSADVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|ADC80645.1| S-adenosylmethionine synthase-like protein [Bauhinia guianensis]
Length=167

 Score =   134 bits (336),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD+CKV
Sbjct  2    EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADHCKV  61

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  62   LVNIEQQSPD  71



>ref|XP_007027434.1| Methionine adenosyltransferase 3 [Theobroma cacao]
 gb|EOY07936.1| Methionine adenosyltransferase 3 [Theobroma cacao]
Length=390

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKV+YEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|ADC80652.1| S-adenosylmethionine synthase-like protein [Eperua falcata]
Length=167

 Score =   134 bits (336),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVR+TCR IGF S DVGLDADNCKV
Sbjct  2    EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRETCRNIGFVSDDVGLDADNCKV  61

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  62   LVNIEQQSPD  71



>ref|XP_009609870.1| PREDICTED: S-adenosylmethionine synthase 3 [Nicotiana tomentosiformis]
 ref|XP_009609871.1| PREDICTED: S-adenosylmethionine synthase 3 [Nicotiana tomentosiformis]
Length=390

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|ACF17673.1| putative S-adenosylmethionine synthetase [Capsicum annuum]
Length=390

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_009610332.1| PREDICTED: S-adenosylmethionine synthase 2-like [Nicotiana tomentosiformis]
 ref|XP_009610333.1| PREDICTED: S-adenosylmethionine synthase 2-like [Nicotiana tomentosiformis]
Length=390

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDP+SKVACETC+KTNMVMVFGEITTKA VDYE+IVRDTCRGIGFTSPDVGLDADNCKVL
Sbjct  34   QDPESKVACETCTKTNMVMVFGEITTKANVDYEEIVRDTCRGIGFTSPDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>sp|Q9M7K8.1|METK1_TOBAC RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Nicotiana tabacum]
 gb|AAF42974.1|AF127243_1 S-adenosyl-L-methionine synthetase [Nicotiana tabacum]
Length=390

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|ABI95859.1| S-adenosyl-L-methionine synthase [Nicotiana suaveolens]
Length=390

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|KDO72159.1| hypothetical protein CISIN_1g045358mg, partial [Citrus sinensis]
Length=200

 Score =   134 bits (338),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDAD+CKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_009760627.1| PREDICTED: S-adenosylmethionine synthase 1 [Nicotiana sylvestris]
Length=390

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_006418333.1| hypothetical protein EUTSA_v10007845mg [Eutrema salsugineum]
 gb|ESQ36686.1| hypothetical protein EUTSA_v10007845mg [Eutrema salsugineum]
Length=393

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/70 (96%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRAIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_006305011.1| hypothetical protein CARUB_v10009376mg [Capsella rubella]
 gb|EOA37909.1| hypothetical protein CARUB_v10009376mg [Capsella rubella]
Length=393

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/70 (96%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRAIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|ADC80644.1| S-adenosylmethionine synthase-like protein [Bauhinia guianensis]
 gb|ADC80646.1| S-adenosylmethionine synthase-like protein [Bauhinia guianensis]
Length=167

 Score =   133 bits (335),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD+CKV
Sbjct  2    EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRKIGFVSDDVGLDADHCKV  61

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  62   LVNIEQQSPD  71



>gb|KHG12690.1| S-adenosylmethionine synthase [Gossypium arboreum]
Length=495

 Score =   139 bits (351),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 65/68 (96%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  8    DPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVLV  187
            DP+SKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCKVLV
Sbjct  137  DPESKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFTSDDVGLDADNCKVLV  196

Query  188  NIEQQSPD  211
            NIEQQSPD
Sbjct  197  NIEQQSPD  204



>gb|ADC80654.1| S-adenosylmethionine synthase-like protein [Eperua falcata]
Length=167

 Score =   133 bits (334),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  2    EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFVSDDVGLDADNCKV  61

Query  182  LVNIEQQSPD  211
            LV+IEQQSPD
Sbjct  62   LVDIEQQSPD  71



>gb|KDO36066.1| hypothetical protein CISIN_1g044843mg, partial [Citrus sinensis]
Length=200

 Score =   134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDAD+CKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSDDVGLDADHCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_011018770.1| PREDICTED: S-adenosylmethionine synthase 4 [Populus euphratica]
 ref|XP_011018771.1| PREDICTED: S-adenosylmethionine synthase 4 [Populus euphratica]
Length=390

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDP+SKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCKVL
Sbjct  34   QDPESKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFTSADVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_006381397.1| S-adenosylmethionine synthetase family protein [Populus trichocarpa]
 sp|A9PHC5.1|METK4_POPTR RecName: Full=S-adenosylmethionine synthase 4; Short=AdoMet synthase 
4; AltName: Full=Methionine adenosyltransferase 4; Short=MAT 
4 [Populus trichocarpa]
 gb|ABK95778.1| unknown [Populus trichocarpa]
 gb|ERP59194.1| S-adenosylmethionine synthetase family protein [Populus trichocarpa]
Length=390

 Score =   138 bits (347),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDP+SKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCKVL
Sbjct  34   QDPESKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFTSADVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_010921340.1| PREDICTED: S-adenosylmethionine synthase [Elaeis guineensis]
Length=396

 Score =   138 bits (347),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDAD+CKV
Sbjct  36   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFTSDDVGLDADHCKV  95

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  96   LVNIEQQSPD  105



>ref|XP_008369552.1| PREDICTED: S-adenosylmethionine synthase 3 [Malus domestica]
 ref|XP_008369553.1| PREDICTED: S-adenosylmethionine synthase 3 [Malus domestica]
Length=390

 Score =   138 bits (347),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSP+
Sbjct  93   LVNIEKQSPE  102



>ref|XP_007154449.1| hypothetical protein PHAVU_003G1202001g, partial [Phaseolus vulgaris]
 gb|ESW26443.1| hypothetical protein PHAVU_003G1202001g, partial [Phaseolus vulgaris]
Length=126

 Score =   131 bits (330),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTN+VMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  34   EQDPESKVACETCTKTNLVMVFGEITTKADVDYEKIVRDTCRNIGFISNDVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>gb|AGF95106.1| S-adenosylmethionine synthetase, partial [Prunus persica]
Length=257

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S  VGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRTIGFVSDHVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|EYU29879.1| hypothetical protein MIMGU_mgv1a006187mg [Erythranthe guttata]
Length=454

 Score =   138 bits (348),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVR TCRGIGF SPDVGLDADNCKV
Sbjct  97   EQDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRSTCRGIGFISPDVGLDADNCKV  156

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  157  LVNIEQQSPD  166



>gb|ADC80651.1| S-adenosylmethionine synthase-like protein [Bauhinia purpurea]
Length=167

 Score =   132 bits (332),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  2    EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFVSDDVGLDADKCKV  61

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  62   LVNIEQQSPD  71



>gb|ADC80649.1| S-adenosylmethionine synthase-like protein [Bauhinia purpurea]
Length=167

 Score =   132 bits (332),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  2    EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFVSDDVGLDADKCKV  61

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  62   LVNIEQQSPD  71



>ref|XP_003521408.1| PREDICTED: S-adenosylmethionine synthase 3-like isoform 1 [Glycine 
max]
Length=390

 Score =   137 bits (346),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA V+YEKIVRDTC+GIGF SPDVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKASVNYEKIVRDTCKGIGFVSPDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|ADC80648.1| S-adenosylmethionine synthase-like protein [Bauhinia purpurea]
Length=167

 Score =   132 bits (332),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  2    EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFVSDDVGLDADKCKV  61

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  62   LVNIEQQSPD  71



>gb|KHN09527.1| S-adenosylmethionine synthase 2 [Glycine soja]
Length=390

 Score =   137 bits (345),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA V+YEKIVRDTC+GIGF SPDVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKASVNYEKIVRDTCKGIGFVSPDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_002273336.1| PREDICTED: S-adenosylmethionine synthase 1 isoform X1 [Vitis 
vinifera]
Length=394

 Score =   137 bits (346),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKV+YEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  36   EQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFVSADVGLDADNCKV  95

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  96   LVNIEQQSPD  105



>emb|CDP06782.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   137 bits (345),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA V+YEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVNYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_007035965.1| S-adenosylmethionine synthetase 2 [Theobroma cacao]
 gb|EOY06891.1| S-adenosylmethionine synthetase 2 [Theobroma cacao]
Length=498

 Score =   138 bits (348),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVM+FGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCKVL
Sbjct  139  QDPDSKVACETCTKTNMVMIFGEITTKANVDYEKIVRDTCRGIGFTSDDVGLDADNCKVL  198

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  199  VNIEQQSPD  207



>sp|P48498.1|METK1_PETHY RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Petunia x hybrida]
 emb|CAA57696.1| methionine adenosyltransferase [Petunia x hybrida]
Length=390

 Score =   137 bits (345),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDAD+CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|ACJ84588.1| unknown [Medicago truncatula]
Length=136

 Score =   131 bits (329),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  34   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFISDDVGLDADKCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>emb|CAN72082.1| hypothetical protein VITISV_033661 [Vitis vinifera]
Length=391

 Score =   137 bits (345),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKV+YEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010651779.1| PREDICTED: S-adenosylmethionine synthase 1 isoform X2 [Vitis 
vinifera]
 ref|XP_010651780.1| PREDICTED: S-adenosylmethionine synthase 1 isoform X2 [Vitis 
vinifera]
 sp|A7PQS0.1|METK1_VITVI RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Vitis vinifera]
Length=391

 Score =   137 bits (345),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKV+YEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_009377021.1| PREDICTED: S-adenosylmethionine synthase 4 [Pyrus x bretschneideri]
Length=390

 Score =   137 bits (345),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTS DVGLDADNC+V
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSADVGLDADNCRV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSP+
Sbjct  93   LVNIEKQSPE  102



>ref|XP_002966239.1| hypothetical protein SELMODRAFT_168213 [Selaginella moellendorffii]
 gb|EFJ32266.1| hypothetical protein SELMODRAFT_168213 [Selaginella moellendorffii]
Length=393

 Score =   137 bits (345),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVM+FGEITTKA VDYEKIVRDTCRGIGFTS DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMIFGEITTKANVDYEKIVRDTCRGIGFTSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_002982311.1| hypothetical protein SELMODRAFT_155092 [Selaginella moellendorffii]
 gb|EFJ16556.1| hypothetical protein SELMODRAFT_155092 [Selaginella moellendorffii]
Length=393

 Score =   137 bits (345),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVM+FGEITTKA VDYEKIVRDTCRGIGFTS DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMIFGEITTKANVDYEKIVRDTCRGIGFTSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_008462483.1| PREDICTED: S-adenosylmethionine synthase 4 [Cucumis melo]
Length=390

 Score =   137 bits (344),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETCSKTNMVMVFGEITTKA V+YEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCSKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|NP_001234004.1| S-adenosylmethionine synthase 3 [Solanum lycopersicum]
 ref|XP_010325712.1| PREDICTED: S-adenosylmethionine synthase 3 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010325713.1| PREDICTED: S-adenosylmethionine synthase 3 isoform X1 [Solanum 
lycopersicum]
 sp|P43282.1|METK3_SOLLC RecName: Full=S-adenosylmethionine synthase 3; Short=AdoMet synthase 
3; AltName: Full=Methionine adenosyltransferase 3; Short=MAT 
3 [Solanum lycopersicum]
 emb|CAA80867.1| S-adenosyl-L-methionine synthetase [Solanum lycopersicum]
Length=390

 Score =   137 bits (344),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|AHB32111.1| S-adenosylmethionine synthase [Camellia sinensis]
Length=393

 Score =   137 bits (344),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDP+SKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCKVL
Sbjct  34   QDPESKVACETCSKTNMVMVFGEITTKADVDYEKIVRDTCRGIGFTSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>sp|P50301.1|METK1_ACTCH RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Actinidia chinensis]
 gb|AAA81378.1| S-adenosylmethionine synthetase [Actinidia chinensis]
Length=390

 Score =   137 bits (344),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            +QDP+SKVACE+C+KTNMVMVFGEITTKA+V+YEKIVRDTCRGIGFTSPDVGLDAD+CKV
Sbjct  33   KQDPESKVACESCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_004143274.1| PREDICTED: S-adenosylmethionine synthase 2-like [Cucumis sativus]
 ref|XP_004156276.1| PREDICTED: S-adenosylmethionine synthase 2-like [Cucumis sativus]
 gb|KGN48191.1| hypothetical protein Csa_6G446510 [Cucumis sativus]
Length=390

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETCSKTNMVMVFGEITTKA V+YEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCSKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_009365469.1| PREDICTED: S-adenosylmethionine synthase 2-like [Pyrus x bretschneideri]
Length=391

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRTIGFVSDDVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>ref|XP_009335533.1| PREDICTED: S-adenosylmethionine synthase 2-like [Pyrus x bretschneideri]
Length=391

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRTIGFVSDDVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>gb|ACJ83268.1| unknown [Medicago truncatula]
Length=211

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVR TCR IGF S DVGLDADNCKV
Sbjct  35   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRKTCRNIGFVSDDVGLDADNCKV  94

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  95   LVNIEQQSPD  104



>ref|XP_010556675.1| PREDICTED: S-adenosylmethionine synthase [Tarenaya hassleriana]
Length=393

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFISDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010267208.1| PREDICTED: S-adenosylmethionine synthase 1 [Nelumbo nucifera]
Length=391

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKV+YEKIVRDTCRGIGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFVSADVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|KDP43982.1| hypothetical protein JCGZ_05449 [Jatropha curcas]
Length=391

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGE+TT AKVDYEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEVTTSAKVDYEKIVRDTCRGIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_008241399.1| PREDICTED: S-adenosylmethionine synthase 3 [Prunus mume]
 ref|XP_008241400.1| PREDICTED: S-adenosylmethionine synthase 3 [Prunus mume]
Length=390

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITT+AKVDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTQAKVDYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSP+
Sbjct  93   LVNIEKQSPE  102



>ref|XP_010457229.1| PREDICTED: S-adenosylmethionine synthase 1-like [Camelina sativa]
Length=393

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRAIGFVSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>dbj|BAI66450.1| S-adenosylmethionine synthase [Malus domestica]
Length=222

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_007219282.1| hypothetical protein PRUPE_ppa018473mg, partial [Prunus persica]
 gb|EMJ20481.1| hypothetical protein PRUPE_ppa018473mg, partial [Prunus persica]
Length=157

 Score =   131 bits (329),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF    VGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRTIGFVPDHVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIE QSPD
Sbjct  94   LVNIEHQSPD  103



>sp|A9NUH8.1|METK1_PICSI RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Picea sitchensis]
 gb|ABK24289.1| unknown [Picea sitchensis]
Length=393

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVM+FGEITTKA +DYEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMIFGEITTKANIDYEKIVRDTCRGIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>emb|CCC55422.1| S-adenosylmethionine synthase 1 [Pinus pinaster]
Length=391

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVM+FGEITTKA +DYEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMIFGEITTKANIDYEKIVRDTCRGIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_004288343.1| PREDICTED: S-adenosylmethionine synthase 2-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=358

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_007202118.1| hypothetical protein PRUPE_ppa006915mg [Prunus persica]
 gb|EMJ03317.1| hypothetical protein PRUPE_ppa006915mg [Prunus persica]
Length=390

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITT+AKVDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTQAKVDYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSP+
Sbjct  93   LVNIEKQSPE  102



>ref|XP_008793316.1| PREDICTED: S-adenosylmethionine synthase 4 [Phoenix dactylifera]
Length=396

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDAD+CKVL
Sbjct  37   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFTSDDVGLDADHCKVL  96

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  97   VNIEQQSPD  105



>ref|XP_002523705.1| s-adenosylmethionine synthetase, putative [Ricinus communis]
 gb|EEF38645.1| s-adenosylmethionine synthetase, putative [Ricinus communis]
Length=391

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCRGIGF S DVGLDAD CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFVSADVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010031402.1| PREDICTED: S-adenosylmethionine synthase 1 [Eucalyptus grandis]
 gb|KCW50682.1| hypothetical protein EUGRSUZ_J00368 [Eucalyptus grandis]
Length=391

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP SKVACETC+KTNMVMVFGEITTKAKV+YEKIVRDTCRGIGFTS DVGLDAD CKV
Sbjct  33   EQDPQSKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFTSADVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010544939.1| PREDICTED: S-adenosylmethionine synthase 1-like [Tarenaya hassleriana]
Length=393

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRNIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSPD
Sbjct  93   LVNIEEQSPD  102



>sp|Q944U4.1|METK_DENCR RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Dendrobium crumenatum]
 gb|AAL16064.1|AF420238_1 S-adenosyl-L-methionine synthetase [Dendrobium crumenatum]
Length=395

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETCSKTNMVM+FGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  36   EQDPDSKVACETCSKTNMVMIFGEITTKANVDYEKIVRDTCRAIGFVSDDVGLDADNCKV  95

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  96   LVNIEQQSPD  105



>ref|XP_010523888.1| PREDICTED: S-adenosylmethionine synthase 1-like [Tarenaya hassleriana]
Length=393

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRNIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSPD
Sbjct  93   LVNIEEQSPD  102



>ref|XP_008781205.1| PREDICTED: S-adenosylmethionine synthase [Phoenix dactylifera]
Length=396

 Score =   136 bits (342),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDAD+CKV
Sbjct  36   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFTSDDVGLDADHCKV  95

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  96   LVNIEQQSPD  105



>gb|AFK42420.1| unknown [Lotus japonicus]
Length=390

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA V+YEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>emb|CBI37018.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA +DYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  65   QDPDSKVACETCTKTNMVMVFGEITTKADIDYEKIVRDTCRTIGFVSDDVGLDADNCKVL  124

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  125  VNIEQQSPD  133



>gb|AFK48536.1| unknown [Medicago truncatula]
Length=247

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVR TCR IGF S DVGLDADNCKV
Sbjct  35   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRKTCRNIGFVSDDVGLDADNCKV  94

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  95   LVNIEQQSPD  104



>ref|XP_008387540.1| PREDICTED: S-adenosylmethionine synthase 4 [Malus domestica]
Length=390

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMV GEITTKAKVDYEKIVRDTCRGIGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVLGEITTKAKVDYEKIVRDTCRGIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSP+
Sbjct  93   LVNIEKQSPE  102



>ref|XP_006294369.1| hypothetical protein CARUB_v10023387mg [Capsella rubella]
 gb|EOA27267.1| hypothetical protein CARUB_v10023387mg [Capsella rubella]
Length=391

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRAIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSPD
Sbjct  93   LVNIEEQSPD  102



>ref|XP_006379697.1| S-adenosylmethionine synthase family protein [Populus trichocarpa]
 sp|A9PEK8.1|METK3_POPTR RecName: Full=S-adenosylmethionine synthase 3; Short=AdoMet synthase 
3; AltName: Full=Methionine adenosyltransferase 3; Short=MAT 
3 [Populus trichocarpa]
 gb|ABK94811.1| unknown [Populus trichocarpa]
 gb|ERP57494.1| S-adenosylmethionine synthase family protein [Populus trichocarpa]
Length=395

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDADNCKVL
Sbjct  35   QDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRNIGFTSADVGLDADNCKVL  94

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  95   VNIEQQSPD  103



>sp|P47916.1|METK_POPDE RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Populus deltoides]
 gb|AAA20112.1| S-adenosyl methionine synthetase [Populus trichocarpa x Populus 
deltoides]
Length=395

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDADNCKVL
Sbjct  35   QDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRNIGFTSADVGLDADNCKVL  94

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  95   VNIEQQSPD  103



>gb|AEY85025.1| S-adenosylmethionine synthetase [Cajanus cajan]
Length=394

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  35   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADNCKV  94

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  95   LVNIEQQSPD  104



>gb|AFK33626.1| unknown [Lotus japonicus]
Length=249

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTK  VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  34   EQDPDSKVACETCTKTNMVMVFGEITTKTNVDYEKIVRDTCRTIGFVSDDVGLDADKCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>ref|XP_010507932.1| PREDICTED: S-adenosylmethionine synthase 2 [Camelina sativa]
Length=391

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRAIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSPD
Sbjct  93   LVNIEEQSPD  102



>gb|AFI38954.1| S-adenosyl-L-methionine synthetase [Fragaria x ananassa]
Length=393

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010518399.1| PREDICTED: S-adenosylmethionine synthase 2-like [Camelina sativa]
Length=391

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRAIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSPD
Sbjct  93   LVNIEEQSPD  102



>gb|ADC80650.1| S-adenosylmethionine synthase-like protein [Bauhinia purpurea]
Length=167

 Score =   130 bits (327),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGE TTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  2    EQDPDSKVACETCTKTNMVMVFGETTTKANVDYEKIVRDTCRTIGFVSDDVGLDADKCKV  61

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  62   LVNIEQQSPD  71



>ref|XP_009408430.1| PREDICTED: S-adenosylmethionine synthase 5-like [Musa acuminata 
subsp. malaccensis]
Length=396

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDAD CKV
Sbjct  36   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSDDVGLDADRCKV  95

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  96   LVNIEQQSPD  105



>ref|XP_004288342.1| PREDICTED: S-adenosylmethionine synthase 2-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=393

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>sp|A7L2Z6.1|METK_GOSHI RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Gossypium hirsutum]
 gb|ABS52575.1| S-adenosylmethionine synthetase [Gossypium hirsutum]
Length=393

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDP+SKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDADNCK L
Sbjct  34   QDPESKVACETCSKTNMVMVFGEITTKADVDYEKIVRDTCRGIGFTSDDVGLDADNCKAL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>gb|ACD92982.1| S-adenosylmethionine synthetase [Panax ginseng]
Length=307

 Score =   134 bits (336),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_010506734.1| PREDICTED: S-adenosylmethionine synthase 2-like [Camelina sativa]
Length=391

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRAIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSPD
Sbjct  93   LVNIEEQSPD  102



>dbj|BAF63499.1| S-adenosyl-L-methionine synthetase [Potamogeton distinctus]
Length=182

 Score =   130 bits (328),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA +DYEKIVRDTCR IGF S DVGLDA+NCKVL
Sbjct  57   QDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRTIGFVSDDVGLDAENCKVL  116

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  117  VNIEQQSPD  125



>ref|XP_002312296.2| hypothetical protein POPTR_0008s09870g [Populus trichocarpa]
 gb|EEE89663.2| hypothetical protein POPTR_0008s09870g [Populus trichocarpa]
Length=408

 Score =   135 bits (341),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDADNCKVL
Sbjct  48   QDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRNIGFTSADVGLDADNCKVL  107

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  108  VNIEQQSPD  116



>ref|XP_002314993.1| S-adenosylmethionine synthase family protein [Populus trichocarpa]
 gb|EEF01164.1| S-adenosylmethionine synthase family protein [Populus trichocarpa]
Length=395

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDADNCKVL
Sbjct  35   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFTSDDVGLDADNCKVL  94

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  95   VNIEQQSPD  103



>gb|AIU34471.1| putative S-adenosyl-L-methionine synthetase, partial [Taraxacum 
brevicorniculatum]
Length=390

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCREIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|ACK37352.1| S-adenosyl-L-methionine synthetase [Glebionis coronaria]
Length=390

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCREIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_011019063.1| PREDICTED: S-adenosylmethionine synthase 3 [Populus euphratica]
Length=395

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDADNCKVL
Sbjct  35   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFTSDDVGLDADNCKVL  94

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  95   VNIEQQSPD  103



>ref|XP_006397900.1| hypothetical protein EUTSA_v10001487mg [Eutrema salsugineum]
 gb|ESQ39353.1| hypothetical protein EUTSA_v10001487mg [Eutrema salsugineum]
Length=391

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRAIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSPD
Sbjct  93   LVNIEEQSPD  102



>ref|XP_003546550.1| PREDICTED: S-adenosylmethionine synthase-like isoform 1 [Glycine 
max]
 ref|XP_003546552.1| PREDICTED: S-adenosylmethionine synthase-like isoform 3 [Glycine 
max]
 gb|KHN09889.1| S-adenosylmethionine synthase [Glycine soja]
Length=395

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  35   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADNCKV  94

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  95   LVNIEQQSPD  104



>ref|NP_001269246.1| S-adenosylmethionine synthase-like [Cicer arietinum]
 gb|ACL14491.1| S-adenosylmethionine synthetase [Cicer arietinum]
 gb|ACL14492.1| S-adenosylmethionine synthetase [Cicer arietinum]
Length=396

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  35   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADNCKV  94

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  95   LVNIEQQSPD  104



>ref|XP_008388436.1| PREDICTED: S-adenosylmethionine synthase 2-like [Malus domestica]
Length=391

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S +VGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRTIGFVSDNVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>ref|XP_011011515.1| PREDICTED: S-adenosylmethionine synthase 3 [Populus euphratica]
Length=395

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDADNCKVL
Sbjct  35   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFTSDDVGLDADNCKVL  94

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  95   VNIEQQSPD  103



>gb|AGF95110.1| S-adenosylmethionine synthetase, partial [Prunus persica]
Length=232

 Score =   132 bits (331),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>gb|ACF57862.1| S-adenosyl-L-methionine synthetase [Malus baccata var. xiaojinensis]
Length=391

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S +VGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRTIGFVSDNVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>sp|Q9SBQ5.1|METK2_PETHY RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Petunia x hybrida]
 gb|AAD56396.1|AF183891_1 S-adenosyl-L-methionine synthetase [Petunia x hybrida]
Length=390

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KT+MVMVFGEITTKA VDYEKIVRDTCRGIGFTS DVGLDAD+CKV
Sbjct  33   EQDPESKVACETCTKTSMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010543435.1| PREDICTED: S-adenosylmethionine synthase 3-like [Tarenaya hassleriana]
 ref|XP_010543436.1| PREDICTED: S-adenosylmethionine synthase 3-like [Tarenaya hassleriana]
Length=390

 Score =   135 bits (339),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITT AKVDYEKIVRDTCR IGF SP+VGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTTAKVDYEKIVRDTCREIGFISPEVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_004304467.1| PREDICTED: S-adenosylmethionine synthase 2-like [Fragaria vesca 
subsp. vesca]
Length=390

 Score =   135 bits (339),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVR+TCRGIGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRETCRGIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSP+
Sbjct  93   LVNIEEQSPE  102



>ref|XP_007163224.1| hypothetical protein PHAVU_001G2166001g, partial [Phaseolus vulgaris]
 gb|ESW35218.1| hypothetical protein PHAVU_001G2166001g, partial [Phaseolus vulgaris]
Length=144

 Score =   129 bits (324),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA+VDYEKIVR+TCR IGF S DVGLDAD CKVL
Sbjct  36   QDPDSKVACETCTKTNMVMVFGEITTKAEVDYEKIVRETCRSIGFISDDVGLDADKCKVL  95

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  96   VNIEQQSPD  104



>gb|KCW46784.1| hypothetical protein EUGRSUZ_K00588 [Eucalyptus grandis]
Length=327

 Score =   134 bits (336),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD+CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFVSDDVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_008246300.1| PREDICTED: S-adenosylmethionine synthase 2-like [Prunus mume]
Length=390

 Score =   135 bits (339),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S  VGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRTIGFVSDHVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010276540.1| PREDICTED: S-adenosylmethionine synthase 2 [Nelumbo nucifera]
Length=393

 Score =   135 bits (339),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_007207334.1| hypothetical protein PRUPE_ppa006916mg [Prunus persica]
 gb|EMJ08533.1| hypothetical protein PRUPE_ppa006916mg [Prunus persica]
Length=390

 Score =   135 bits (339),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S  VGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRTIGFVSDHVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>sp|Q96551.1|METK1_CATRO RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Catharanthus roseus]
 emb|CAA95856.1| S-adenosyl-L-methionine synthetase 1 [Catharanthus roseus]
Length=393

 Score =   135 bits (339),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>dbj|BAP47513.1| S-adenosylmethionine synthetase [Gentiana triflora]
Length=391

 Score =   135 bits (339),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA+VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKAQVDYEKIVRDTCRKIGFISDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010559172.1| PREDICTED: S-adenosylmethionine synthase 1-like [Tarenaya hassleriana]
Length=393

 Score =   135 bits (339),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNC V
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRNIGFVSADVGLDADNCNV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSPD
Sbjct  93   LVNIEEQSPD  102



>gb|KDP28322.1| hypothetical protein JCGZ_14093 [Jatropha curcas]
Length=392

 Score =   135 bits (339),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVR TCRGIGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRQTCRGIGFISDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|EYU38563.1| hypothetical protein MIMGU_mgv1a007936mg [Erythranthe guttata]
Length=390

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA V+YEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAIVNYEKIVRDTCRGIGFISADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>sp|Q9AT56.1|METK1_ELAUM RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Elaeagnus umbellata]
 gb|AAK29409.1|AF346305_1 S-adenosyl-L-methionine synthetase [Elaeagnus umbellata]
Length=393

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_002515204.1| s-adenosylmethionine synthetase, putative [Ricinus communis]
 gb|EEF47188.1| s-adenosylmethionine synthetase, putative [Ricinus communis]
Length=393

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRNIGFVSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|ADC80647.1| S-adenosylmethionine synthase-like protein [Bauhinia guianensis]
Length=167

 Score =   129 bits (325),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVR+TCR IGF S DVGLDAD CKV
Sbjct  2    EQDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRNTCRTIGFVSDDVGLDADKCKV  61

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  62   LVNIEQQSPD  71



>ref|XP_004302338.1| PREDICTED: S-adenosylmethionine synthase 1-like [Fragaria vesca 
subsp. vesca]
Length=409

 Score =   135 bits (339),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S  VGLDADNCKV
Sbjct  56   EQDPDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDAVGLDADNCKV  115

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  116  LVNIEQQSPD  125



>gb|KDO86834.1| hypothetical protein CISIN_1g015873mg [Citrus sinensis]
 gb|KDO86835.1| hypothetical protein CISIN_1g015873mg [Citrus sinensis]
Length=381

 Score =   134 bits (337),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDAD+CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|AIT39705.1| S-adenosylmethionine synthetase [Robinia pseudoacacia]
Length=392

 Score =   134 bits (338),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTN+VMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRKIGFVSADVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>gb|AES81900.2| S-adenosylmethionine synthase-like protein [Medicago truncatula]
Length=390

 Score =   134 bits (338),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            +QDP+SKVACETC+KTNMVMVFGEITTKA V+YEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  33   QQDPESKVACETCTKTNMVMVFGEITTKATVNYEKIVRDTCRGIGFVSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|KDO86832.1| hypothetical protein CISIN_1g015873mg [Citrus sinensis]
Length=387

 Score =   134 bits (337),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDAD+CKV
Sbjct  39   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKV  98

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  99   LVNIEQQSPD  108



>gb|ACU21288.1| unknown [Glycine max]
Length=392

 Score =   134 bits (338),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTN+VMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRNIGFVSNDVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>gb|AGE15419.1| S-adenosyl-L-methionine synthetase [Hosta ventricosa]
Length=396

 Score =   134 bits (338),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  37   QDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRHIGFVSDDVGLDADNCKVL  96

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  97   VNIEQQSPD  105



>ref|XP_008461384.1| PREDICTED: S-adenosylmethionine synthase 2-like [Cucumis melo]
Length=393

 Score =   134 bits (337),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>gb|KHN28175.1| S-adenosylmethionine synthase [Glycine soja]
Length=392

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTN+VMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRNIGFVSNDVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>ref|XP_006583980.1| PREDICTED: S-adenosylmethionine synthase-like [Glycine max]
Length=392

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTN+VMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRNIGFVSNDVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>ref|XP_003550804.1| PREDICTED: S-adenosylmethionine synthase-like isoform 1 [Glycine 
max]
Length=392

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTN+VMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRNIGFVSNDVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>ref|XP_006444593.1| hypothetical protein CICLE_v10020504mg [Citrus clementina]
 gb|ESR57833.1| hypothetical protein CICLE_v10020504mg [Citrus clementina]
 gb|KDO86836.1| hypothetical protein CISIN_1g015873mg [Citrus sinensis]
 gb|KDO86837.1| hypothetical protein CISIN_1g015873mg [Citrus sinensis]
Length=393

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDAD+CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_004153700.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004153701.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004168954.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 4 [Cucumis 
sativus]
 ref|XP_004168955.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 5 [Cucumis 
sativus]
 gb|KGN45065.1| hypothetical protein Csa_7G419610 [Cucumis sativus]
 gb|KGN45069.1| hypothetical protein Csa_7G419650 [Cucumis sativus]
Length=393

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFISDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_004135945.1| PREDICTED: S-adenosylmethionine synthase 1-like [Cucumis sativus]
 ref|XP_004135964.1| PREDICTED: S-adenosylmethionine synthase 1-like [Cucumis sativus]
Length=393

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFISDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_004168042.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004168043.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004168044.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 4 [Cucumis 
sativus]
Length=393

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFISDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_003557087.1| PREDICTED: S-adenosylmethionine synthase-like [Glycine max]
 gb|KHN28174.1| S-adenosylmethionine synthase [Glycine soja]
Length=392

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTN+VMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRSIGFISNDVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>ref|XP_006492396.1| PREDICTED: S-adenosylmethionine synthase 1-like [Citrus sinensis]
Length=393

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDAD+CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_003550837.1| PREDICTED: S-adenosylmethionine synthase-like isoform 1 [Glycine 
max]
Length=392

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTN+VMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRNIGFVSNDVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>gb|ACU24485.1| unknown [Glycine max]
Length=392

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTN+VMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  34   EQDPDSKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRNIGFVSNDVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>gb|EEE54451.1| hypothetical protein OsJ_01540 [Oryza sativa Japonica Group]
Length=353

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDAD CKVL
Sbjct  36   QDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFVSDDVGLDADRCKVL  95

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  96   VNIEQQSPD  104



>sp|Q9FPL6.1|METK2_SUASA RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Suaeda salsa]
 gb|AAG42490.1| S-adenosylmethionine synthetase 2 [Suaeda salsa]
Length=395

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA +DYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSADVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_011087536.1| PREDICTED: S-adenosylmethionine synthase 1 [Sesamum indicum]
Length=393

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA +DYEKIVRDTCR IGFTS DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRNIGFTSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|ABC24692.1| S-adenosyl-L-methionine synthetase [Annona cherimola]
Length=238

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIV+DTCR IGF S DVGLDADNCKVL
Sbjct  28   QDPDSKVACETCTKTNMVMVFGEITTKAIVDYEKIVKDTCRNIGFISDDVGLDADNCKVL  87

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  88   VNIEQQSPD  96



>gb|KCW46783.1| hypothetical protein EUGRSUZ_K00588 [Eucalyptus grandis]
Length=383

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD+CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFVSDDVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_004153699.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004168951.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004168952.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004168953.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 3 [Cucumis 
sativus]
Length=401

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  42   QDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFISDDVGLDADNCKVL  101

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  102  VNIEQQSPD  110



>gb|KDO86833.1| hypothetical protein CISIN_1g015873mg [Citrus sinensis]
Length=399

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDAD+CKV
Sbjct  39   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKV  98

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  99   LVNIEQQSPD  108



>ref|XP_009363082.1| PREDICTED: S-adenosylmethionine synthase 1 [Pyrus x bretschneideri]
Length=393

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>sp|A4ULF8.1|METK_MEDSF RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Medicago falcata]
 gb|ABO77438.1| S-adenosyl-L-methionine synthetase [Medicago falcata]
Length=396

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVR+TCR IGF S DVGLDADNCKV
Sbjct  35   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRNTCRNIGFVSDDVGLDADNCKV  94

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  95   LVNIEQQSPD  104



>ref|XP_004168041.1| PREDICTED: S-adenosylmethionine synthase 1-like isoform 1 [Cucumis 
sativus]
Length=401

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  42   QDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFISDDVGLDADNCKVL  101

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  102  VNIEQQSPD  110



>ref|XP_010035406.1| PREDICTED: S-adenosylmethionine synthase 1 [Eucalyptus grandis]
Length=393

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD+CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFVSDDVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_008343205.1| PREDICTED: S-adenosylmethionine synthase 1 [Malus domestica]
 ref|XP_008343210.1| PREDICTED: S-adenosylmethionine synthase 1 [Malus domestica]
 ref|XP_008362558.1| PREDICTED: S-adenosylmethionine synthase 1 [Malus domestica]
Length=393

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_010093299.1| S-adenosylmethionine synthase 1 [Morus notabilis]
 gb|EXB53832.1| S-adenosylmethionine synthase 1 [Morus notabilis]
Length=393

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETCSKTNMVMVFGEITTKAKV+YEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCSKTNMVMVFGEITTKAKVEYEKIVRDTCRSIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LV IEQQSPD
Sbjct  93   LVYIEQQSPD  102



>sp|P49613.1|METK2_PEA RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Pisum sativum]
 emb|CAA57581.1| methionine adenosyltransferase [Pisum sativum]
 gb|AAA58773.1| S-adenosylmethionine synthase [Pisum sativum]
Length=374

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  35   EQDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADNCKV  94

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  95   LVNIEQQSPD  104



>sp|P93438.1|METK2_ORYSJ RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Oryza sativa Japonica Group]
 gb|AAC05590.1| S-adenosyl-L-methionine synthetase [Oryza sativa]
 dbj|BAC65881.1| putative methionine adenosyltransferase [Oryza sativa Japonica 
Group]
Length=394

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDAD CKVL
Sbjct  36   QDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFVSDDVGLDADRCKVL  95

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  96   VNIEQQSPD  104



>ref|XP_003625682.1| S-adenosylmethionine synthetase [Medicago truncatula]
Length=598

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            +QDP+SKVACETC+KTNMVMVFGEITTKA V+YEKIVRDTCRGIGF S DVGLDADNCKV
Sbjct  241  QQDPESKVACETCTKTNMVMVFGEITTKATVNYEKIVRDTCRGIGFVSADVGLDADNCKV  300

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  301  LVNIEQQSPD  310



>ref|XP_006419259.1| hypothetical protein CICLE_v10005146mg [Citrus clementina]
 gb|ESR32499.1| hypothetical protein CICLE_v10005146mg [Citrus clementina]
Length=387

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDAD+CKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSDDVGLDADHCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>gb|EYU19403.1| hypothetical protein MIMGU_mgv1a007849mg [Erythranthe guttata]
 gb|EYU19404.1| hypothetical protein MIMGU_mgv1a007849mg [Erythranthe guttata]
Length=393

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA +DYEKIVRDTCR IGFTS DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRNIGFTSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_007144340.1| hypothetical protein PHAVU_007G148000g [Phaseolus vulgaris]
 ref|XP_007144341.1| hypothetical protein PHAVU_007G148000g [Phaseolus vulgaris]
 gb|ESW16334.1| hypothetical protein PHAVU_007G148000g [Phaseolus vulgaris]
 gb|ESW16335.1| hypothetical protein PHAVU_007G148000g [Phaseolus vulgaris]
Length=390

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKV+YEKIVRDTCRGIGF S DVGLDAD C V
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFVSADVGLDADKCNV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_009402630.1| PREDICTED: S-adenosylmethionine synthase 3 [Musa acuminata subsp. 
malaccensis]
Length=401

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKV+YEKIVRDTCRGIGF S DVGLDAD CKV
Sbjct  43   EQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFVSADVGLDADRCKV  102

Query  182  LVNIEQQSPD  211
            LVNIE+QSPD
Sbjct  103  LVNIEEQSPD  112



>ref|XP_006488750.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine synthase-like 
[Citrus sinensis]
Length=393

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDAD+CKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSDDVGLDADHCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_009400237.1| PREDICTED: S-adenosylmethionine synthase 5-like [Musa acuminata 
subsp. malaccensis]
Length=394

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTK  +DYEKIVRDTCR IGFTS DVGLDAD+CKV
Sbjct  34   EQDPDSKVACETCTKTNMVMVFGEITTKGSIDYEKIVRDTCRSIGFTSDDVGLDADHCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>sp|Q38JH8.1|METK2_SOLTU RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Solanum tuberosum]
 gb|ABB02634.1| S-adenosyl-L-methionine synthetase-like [Solanum tuberosum]
Length=390

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCREIGFISADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010938162.1| PREDICTED: S-adenosylmethionine synthase [Elaeis guineensis]
Length=396

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD+CKV
Sbjct  36   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFISNDVGLDADHCKV  95

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  96   LVNIEQQSPD  105



>ref|XP_006354373.1| PREDICTED: S-adenosylmethionine synthase 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006354374.1| PREDICTED: S-adenosylmethionine synthase 2-like isoform X2 [Solanum 
tuberosum]
Length=390

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCREIGFISADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|AEN14510.1| S-adenosylmethionine synthetase [Helianthus annuus]
Length=390

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQD DSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDADNCKV
Sbjct  33   EQDVDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCREIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_007144342.1| hypothetical protein PHAVU_007G148100g [Phaseolus vulgaris]
 gb|ESW16336.1| hypothetical protein PHAVU_007G148100g [Phaseolus vulgaris]
Length=390

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKV+YEKIVRDTCRGIGF S DVGLDAD C V
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFVSADVGLDADKCNV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_006424470.1| hypothetical protein CICLE_v10028614mg [Citrus clementina]
 gb|ESR37710.1| hypothetical protein CICLE_v10028614mg [Citrus clementina]
Length=392

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEK+VRDTCRGIGF S DVGLDAD CKV
Sbjct  34   EQDPESKVACETCAKTNMVMVFGEITTKAKVDYEKVVRDTCRGIGFVSADVGLDADKCKV  93

Query  182  LVNIEQQSPD  211
            LVNIE+QSP+
Sbjct  94   LVNIEEQSPE  103



>sp|Q9AT55.1|METK2_ELAUM RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Elaeagnus umbellata]
 gb|AAK29410.1|AF346306_1 S-adenosyl-L-methionine synthetase [Elaeagnus umbellata]
Length=393

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETCSKTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_010941482.1| PREDICTED: S-adenosylmethionine synthase-like [Elaeis guineensis]
Length=394

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDAD CKVL
Sbjct  35   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFTSDDVGLDADGCKVL  94

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  95   VNIEQQSPD  103



>ref|XP_010524596.1| PREDICTED: S-adenosylmethionine synthase [Tarenaya hassleriana]
 ref|XP_010524597.1| PREDICTED: S-adenosylmethionine synthase [Tarenaya hassleriana]
Length=390

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITT+A VDYEKIVRDTCR IGFTS DVGLDADNC+V
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTQANVDYEKIVRDTCRAIGFTSDDVGLDADNCQV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>emb|CDX91837.1| BnaC03g31390D [Brassica napus]
Length=364

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_008800644.1| PREDICTED: S-adenosylmethionine synthase 1 [Phoenix dactylifera]
Length=394

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDAD CKVL
Sbjct  35   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFTSDDVGLDADRCKVL  94

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  95   VNIEQQSPD  103



>ref|XP_009412154.1| PREDICTED: S-adenosylmethionine synthase [Musa acuminata subsp. 
malaccensis]
Length=393

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTK  +DYEKIVRDTCR IGFTS DVGLDAD+CKV
Sbjct  34   EQDPDSKVACETCTKTNMVMVFGEITTKGNIDYEKIVRDTCRDIGFTSEDVGLDADHCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>ref|XP_010270953.1| PREDICTED: S-adenosylmethionine synthase 5 [Nelumbo nucifera]
 ref|XP_010270954.1| PREDICTED: S-adenosylmethionine synthase 5 [Nelumbo nucifera]
Length=393

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>sp|O22338.1|METK_MUSAC RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Musa acuminata]
 gb|AAB71138.1| S-adenosyl-L-methionine synthetase homolog [Musa acuminata AAA 
Group]
Length=393

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTK  +DYEKIVRDTCR IGFTS DVGLDAD+CKV
Sbjct  34   EQDPDSKVACETCTKTNMVMVFGEITTKGNIDYEKIVRDTCRDIGFTSEDVGLDADHCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>ref|XP_009366042.1| PREDICTED: S-adenosylmethionine synthase 5-like [Pyrus x bretschneideri]
Length=394

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACE+C+KTNMVM+FGEITTKAKVDYEKIVRDTCR IGF S  VGLDADNCKV
Sbjct  37   EQDPDSKVACESCTKTNMVMIFGEITTKAKVDYEKIVRDTCRTIGFVSDSVGLDADNCKV  96

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  97   LVNIEQQSPD  106



>sp|Q84MM2.1|METK_LITCN RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Litchi chinensis]
 gb|AAP13994.1| S-adenosylmethionine synthetase [Litchi chinensis]
Length=393

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC++TNMVMVFGEITTKA VDYE+IVRDTCR IGFTS DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTRTNMVMVFGEITTKANVDYEQIVRDTCRSIGFTSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_009124482.1| PREDICTED: S-adenosylmethionine synthase 2 [Brassica rapa]
 ref|XP_009124483.1| PREDICTED: S-adenosylmethionine synthase 2 [Brassica rapa]
 emb|CDX80079.1| BnaA05g00770D [Brassica napus]
Length=391

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRAIGFVSADVGLDADTCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSPD
Sbjct  93   LVNIEEQSPD  102



>gb|ADN96174.1| S-adenosylmethionine synthetase [Gossypium hirsutum]
Length=393

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>gb|AGW99248.1| S-adenosylmethionine synthetase [Helianthus annuus]
Length=390

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQD DSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDADNCKV
Sbjct  33   EQDVDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCREIGFTSADVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>emb|CDY37784.1| BnaC04g00410D [Brassica napus]
Length=391

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRAIGFVSADVGLDADTCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSPD
Sbjct  93   LVNIEEQSPD  102



>sp|Q4LB21.1|METK4_HORVU RecName: Full=S-adenosylmethionine synthase 4; Short=AdoMet synthase 
4; AltName: Full=Methionine adenosyltransferase 4; Short=MAT 
4 [Hordeum vulgare]
 emb|CAJ01705.1| putative AdoMet synthase 4 [Hordeum vulgare subsp. vulgare]
Length=396

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            +DPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDAD+CKVL
Sbjct  37   EDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDADHCKVL  96

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  97   VNIEQQSPD  105



>gb|AHA80147.1| S-adenosylmethionine synthetase [Gossypium hirsutum]
Length=393

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>gb|KDO60254.1| hypothetical protein CISIN_1g045474mg [Citrus sinensis]
Length=391

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEK+VRDTCRGIGF S DVGLDAD CKV
Sbjct  33   EQDPESKVACETCAKTNMVMVFGEITTKAKVDYEKVVRDTCRGIGFVSADVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIE+QSP+
Sbjct  93   LVNIEEQSPE  102



>ref|XP_010914756.1| PREDICTED: S-adenosylmethionine synthase-like [Elaeis guineensis]
Length=394

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDAD CKVL
Sbjct  35   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFTSDDVGLDADRCKVL  94

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  95   VNIEQQSPD  103



>ref|XP_003541415.1| PREDICTED: S-adenosylmethionine synthase 3-like [Glycine max]
 gb|KHN48281.1| S-adenosylmethionine synthase 2 [Glycine soja]
Length=390

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKV+YEKIVRDTCRGIGF S DVGLDAD C V
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFVSADVGLDADKCNV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_006488022.1| PREDICTED: S-adenosylmethionine synthase 3-like [Citrus sinensis]
Length=392

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEK+VRDTCRGIGF S DVGLDAD CKV
Sbjct  34   EQDPESKVACETCAKTNMVMVFGEITTKAKVDYEKVVRDTCRGIGFVSADVGLDADKCKV  93

Query  182  LVNIEQQSPD  211
            LVNIE+QSP+
Sbjct  94   LVNIEEQSPE  103



>ref|XP_002266358.1| PREDICTED: S-adenosylmethionine synthase 2 [Vitis vinifera]
 sp|A7NVX9.1|METK2_VITVI RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Vitis vinifera]
Length=393

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            +QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   QQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCREIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>emb|CAN75334.1| hypothetical protein VITISV_002362 [Vitis vinifera]
Length=393

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            +QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   QQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCREIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_008778582.1| PREDICTED: S-adenosylmethionine synthase-like [Phoenix dactylifera]
Length=394

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDAD CKVL
Sbjct  35   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFTSDDVGLDADGCKVL  94

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  95   VNIEQQSPD  103



>emb|CAN75687.1| hypothetical protein VITISV_034977 [Vitis vinifera]
Length=393

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            +QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   QQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCREIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_002512570.1| s-adenosylmethionine synthetase, putative [Ricinus communis]
 gb|EEF50022.1| s-adenosylmethionine synthetase, putative [Ricinus communis]
Length=403

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  43   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFVSDDVGLDADKCKV  102

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  103  LVNIEQQSPD  112



>ref|XP_009391996.1| PREDICTED: S-adenosylmethionine synthase [Musa acuminata subsp. 
malaccensis]
Length=394

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTK  +DYEKIVRDTCR IGFTS DVGLDAD CKV
Sbjct  34   EQDPDSKVACETCTKTNMVMVFGEITTKGNIDYEKIVRDTCRAIGFTSDDVGLDADRCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>sp|B0LXM0.1|METK_WHEAT RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Triticum aestivum]
 gb|ABY85789.1| S-adenosylmethionine synthetase [Triticum aestivum]
Length=396

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            +DPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDAD+CKVL
Sbjct  37   EDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDADHCKVL  96

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  97   VNIEQQSPD  105



>gb|KEH37748.1| S-adenosylmethionine synthase-like protein [Medicago truncatula]
Length=396

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVR TCR IGF S DVGLDADNCKV
Sbjct  35   EQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRKTCRNIGFVSDDVGLDADNCKV  94

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  95   LVNIEQQSPD  104



>gb|EMS52834.1| S-adenosylmethionine synthase 4 [Triticum urartu]
Length=479

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            +DPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDAD+CKVL
Sbjct  120  EDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDADHCKVL  179

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  180  VNIEQQSPD  188



>ref|XP_008447451.1| PREDICTED: S-adenosylmethionine synthase 2 [Cucumis melo]
Length=393

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFISDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_004967601.1| PREDICTED: S-adenosylmethionine synthase 3-like isoform X1 [Setaria 
italica]
Length=409

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            +DPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDAD+CKVL
Sbjct  50   EDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDADHCKVL  109

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  110  VNIEQQSPD  118



>ref|XP_010241791.1| PREDICTED: S-adenosylmethionine synthase 1-like [Nelumbo nucifera]
Length=391

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKA V+YEKIVRDTCRGIGF S DVGLDAD CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKATVNYEKIVRDTCRGIGFVSSDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_006388227.1| hypothetical protein POPTR_0274s002001g, partial [Populus trichocarpa]
 gb|ERP47141.1| hypothetical protein POPTR_0274s002001g, partial [Populus trichocarpa]
Length=359

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTK K+DYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKGKIDYEKIVRDTCRNIGFVSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|AAA32868.1| S-adenosylmethionine synthetase [Arabidopsis thaliana]
Length=393

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRAIGFVSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>emb|CDX74394.1| BnaA03g26530D [Brassica napus]
Length=365

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|EMT13885.1| S-adenosylmethionine synthetase [Aegilops tauschii]
Length=425

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  8    DPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVLV  187
            DPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDAD+CKVLV
Sbjct  38   DPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDADHCKVLV  97

Query  188  NIEQQSPD  211
            NIEQQSPD
Sbjct  98   NIEQQSPD  105



>ref|XP_007031241.1| S-adenosylmethionine synthetase 1 [Theobroma cacao]
 gb|EOY11743.1| S-adenosylmethionine synthetase 1 [Theobroma cacao]
Length=393

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRNIGFVSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>emb|CDY72092.1| BnaCnng75920D [Brassica napus]
 emb|CDY22010.1| BnaA09g00390D [Brassica napus]
Length=365

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|NP_171751.1| S-adenosylmethionine synthetase 1 [Arabidopsis thaliana]
 ref|NP_849577.1| S-adenosylmethionine synthetase 1 [Arabidopsis thaliana]
 sp|P23686.2|METK1_ARATH RecName: Full=S-adenosylmethionine synthase 1; Short=AdoMet synthase 
1; AltName: Full=Methionine adenosyltransferase 1; Short=MAT 
1 [Arabidopsis thaliana]
 gb|AAG10639.1|AC022521_17 S-adenosylmethionine synthetase [Arabidopsis thaliana]
 gb|AAG40413.1|AF325061_1 At1g02500 [Arabidopsis thaliana]
 gb|AAL16209.1|AF428440_1 At1g02500/T14P4_22 [Arabidopsis thaliana]
 gb|AAM12954.1| S-adenosylmethionine synthetase [Arabidopsis thaliana]
 gb|AAM65240.1| s-adenosylmethionine synthetase [Arabidopsis thaliana]
 gb|AEE27437.1| S-adenosylmethionine synthetase 1 [Arabidopsis thaliana]
 gb|AEE27438.1| S-adenosylmethionine synthetase 1 [Arabidopsis thaliana]
Length=393

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRAIGFVSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_002457705.1| hypothetical protein SORBIDRAFT_03g011930 [Sorghum bicolor]
 gb|EES02825.1| hypothetical protein SORBIDRAFT_03g011930 [Sorghum bicolor]
Length=396

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            +DPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDAD+CKVL
Sbjct  37   EDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDADHCKVL  96

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  97   VNIEQQSPD  105



>ref|XP_004967602.1| PREDICTED: S-adenosylmethionine synthase 3-like isoform X2 [Setaria 
italica]
Length=396

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            +DPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDAD+CKVL
Sbjct  37   EDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDADHCKVL  96

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  97   VNIEQQSPD  105



>gb|AAP87282.1| putative S-adenosylmethionine synthetase, partial [Brassica oleracea 
var. capitata]
Length=366

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  6    EQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKV  65

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  66   LVNIEQQSPD  75



>ref|XP_009353412.1| PREDICTED: S-adenosylmethionine synthase 2-like [Pyrus x bretschneideri]
Length=395

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_003567567.1| PREDICTED: S-adenosylmethionine synthase 4 [Brachypodium distachyon]
Length=396

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            +DPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDAD+CKVL
Sbjct  37   EDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDADHCKVL  96

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  97   VNIEQQSPD  105



>gb|AAT40304.1| S-adenosylmethionine synthase [Medicago sativa]
Length=391

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQD DSKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  33   EQDVDSKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRKIGFVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>sp|Q96552.1|METK2_CATRO RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Catharanthus roseus]
 emb|CAA95857.1| S-adenosyl-L-methionine synthetase 2 [Catharanthus roseus]
Length=393

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDP+SKVACETC+KTNMVMVFGEITTKA+VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPESKVACETCTKTNMVMVFGEITTKAQVDYEKIVRDTCRAIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_008390498.1| PREDICTED: S-adenosylmethionine synthase 2 [Malus domestica]
 ref|XP_008351153.1| PREDICTED: S-adenosylmethionine synthase 2 [Malus domestica]
Length=393

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>gb|KHG12602.1| S-adenosylmethionine synthase 2 [Gossypium arboreum]
Length=446

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  87   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFVSDDVGLDADNCKVL  146

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  147  VNIEQQSPD  155



>ref|XP_010422683.1| PREDICTED: S-adenosylmethionine synthase [Camelina sativa]
Length=393

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRAIGFISDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_009359772.1| PREDICTED: S-adenosylmethionine synthase 2-like [Pyrus x bretschneideri]
 ref|XP_009359773.1| PREDICTED: S-adenosylmethionine synthase 2-like [Pyrus x bretschneideri]
Length=393

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_010024863.1| PREDICTED: S-adenosylmethionine synthase 2 [Eucalyptus grandis]
Length=393

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QD DSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCRGIGF S DVGLDADNCKVL
Sbjct  34   QDADSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_006287904.1| hypothetical protein CARUB_v10001138mg [Capsella rubella]
 gb|EOA20802.1| hypothetical protein CARUB_v10001138mg [Capsella rubella]
Length=393

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRAIGFISDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|AAS83521.1| S-adenosylmethionine synthetase 2 [Camellia sinensis var. sinensis]
Length=178

 Score =   128 bits (321),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQD DSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR +G  S DVGLDADNCKV
Sbjct  33   EQDQDSKVACETCTKTNMVMVFGEITTKAAVDYEKIVRDTCRTMGLVSDDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_006855322.1| hypothetical protein AMTR_s00057p00083760 [Amborella trichopoda]
 gb|ERN16789.1| hypothetical protein AMTR_s00057p00083760 [Amborella trichopoda]
Length=392

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            +QDP+SKVACETC+KTNMVMVFGEITTKAKVDYEKIVRDTCR IGFTS DVGLDAD C V
Sbjct  33   KQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRAIGFTSADVGLDADRCNV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010528006.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine synthase 
3 [Tarenaya hassleriana]
Length=391

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITT AKVDYEKIVRDTCR IGFTS DVGLDAD C V
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTSAKVDYEKIVRDTCRAIGFTSADVGLDADKCNV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_010659744.1| PREDICTED: S-adenosylmethionine synthase 4 [Vitis vinifera]
 sp|A7PRJ6.1|METK4_VITVI RecName: Full=S-adenosylmethionine synthase 4; Short=AdoMet synthase 
4; AltName: Full=Methionine adenosyltransferase 4; Short=MAT 
4 [Vitis vinifera]
Length=393

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTN+VM+FGEITTKA +DYEKIVRDTCR +GF S DVGLDADNCKV
Sbjct  33   EQDPDSKVACETCTKTNLVMIFGEITTKANLDYEKIVRDTCRAVGFVSEDVGLDADNCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>gb|KHG08721.1| S-adenosylmethionine synthase 1 [Gossypium arboreum]
Length=393

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETCSKTNMVMVFGEITTKA VDYEKIVR+TCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRETCRNIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_004494065.1| PREDICTED: S-adenosylmethionine synthase 3-like [Cicer arietinum]
Length=390

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTNMVMVFGEITT+A V+YEKIVRDTCRGIGF S DVGLDAD+CKV
Sbjct  33   EQDPESKVACETCTKTNMVMVFGEITTQANVNYEKIVRDTCRGIGFVSADVGLDADHCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>sp|Q8W3Y4.1|METK_PHALU RecName: Full=S-adenosylmethionine synthase; Short=AdoMet synthase; 
AltName: Full=Methionine adenosyltransferase; Short=MAT 
[Phaseolus lunatus]
 dbj|BAB83761.1| S-adenosylmethionine synthetase [Phaseolus lunatus]
Length=392

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDP+SKVACETC+KTN+VMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKV
Sbjct  34   EQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRNIGFISNDVGLDADNCKV  93

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  94   LVNIEQQSPD  103



>ref|XP_008390375.1| PREDICTED: S-adenosylmethionine synthase 2-like [Malus domestica]
Length=393

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_011003147.1| PREDICTED: S-adenosylmethionine synthase 1 [Populus euphratica]
 ref|XP_011005938.1| PREDICTED: S-adenosylmethionine synthase 1-like [Populus euphratica]
Length=392

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTK K+DYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKGKIDYEKIVRDTCRNIGFVSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_009134472.1| PREDICTED: S-adenosylmethionine synthase [Brassica rapa]
Length=393

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>emb|CDO98704.1| unnamed protein product [Coffea canephora]
Length=393

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDP+SKVACETC+KTNMVMVFGEITTKA+VDYEKIVRDTCR IGF S DVGLDADNCKVL
Sbjct  34   QDPESKVACETCTKTNMVMVFGEITTKAQVDYEKIVRDTCRAIGFVSDDVGLDADNCKVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|NP_001042349.1| Os01g0207300 [Oryza sativa Japonica Group]
 dbj|BAB92156.1| putative S-adenosyl methionine synthetase [Oryza sativa Japonica 
Group]
 dbj|BAF04263.1| Os01g0207300 [Oryza sativa Japonica Group]
 gb|EAZ10976.1| hypothetical protein OsJ_00819 [Oryza sativa Japonica Group]
Length=164

 Score =   127 bits (319),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDP+ KVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGF S D+GLDAD CKVL
Sbjct  36   QDPEGKVACETCTKTNMVMVFGEITTKASVDYEKIVRDTCRNIGFVSDDIGLDADRCKVL  95

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  96   VNIEQQSPD  104



>ref|XP_004252944.1| PREDICTED: S-adenosylmethionine synthase 2 [Solanum lycopersicum]
 sp|P43281.1|METK2_SOLLC RecName: Full=S-adenosylmethionine synthase 2; Short=AdoMet synthase 
2; AltName: Full=Methionine adenosyltransferase 2; Short=MAT 
2 [Solanum lycopersicum]
 emb|CAA80866.1| S-adenosyl-L-methionine synthetase [Solanum lycopersicum]
Length=393

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDP+SKVACETC+KTN+VMVFGEITTKA +DYEKIVRDTCR IGF SPDVGLDADNC+VL
Sbjct  34   QDPESKVACETCTKTNLVMVFGEITTKANIDYEKIVRDTCREIGFVSPDVGLDADNCRVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_011014828.1| PREDICTED: S-adenosylmethionine synthase 1 [Populus euphratica]
 ref|XP_011014829.1| PREDICTED: S-adenosylmethionine synthase 1 [Populus euphratica]
Length=392

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTK K+DYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKGKIDYEKIVRDTCRNIGFVSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|NP_001148708.1| S-adenosylmethionine synthetase 1 [Zea mays]
 gb|ACG32614.1| S-adenosylmethionine synthetase 1 [Zea mays]
Length=392

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDAD CKVL
Sbjct  36   QDPDSKVACETCTKTNMVMVFGEITTKASVDYEKIVRDTCREIGFTSDDVGLDADRCKVL  95

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  96   VNIEQQSPD  104



>ref|XP_006349861.1| PREDICTED: S-adenosylmethionine synthase 2-like [Solanum tuberosum]
Length=393

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDP+SKVACETC+KTN+VMVFGEITTKA +DYEKIVRDTCR IGF SPDVGLDADNC+VL
Sbjct  34   QDPESKVACETCTKTNLVMVFGEITTKANIDYEKIVRDTCREIGFVSPDVGLDADNCRVL  93

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  94   VNIEQQSPD  102



>ref|XP_002301543.1| hypothetical protein POPTR_0002s19000g [Populus trichocarpa]
 ref|XP_006386694.1| S-adenosylmethionine synthetase 1 family protein [Populus trichocarpa]
 gb|EEE80816.1| hypothetical protein POPTR_0002s19000g [Populus trichocarpa]
 gb|ERP64491.1| S-adenosylmethionine synthetase 1 family protein [Populus trichocarpa]
Length=392

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    EQDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKV  181
            EQDPDSKVACETC+KTNMVMVFGEITTK K+DYEKIVRDTCR IGF S DVGLDAD CKV
Sbjct  33   EQDPDSKVACETCTKTNMVMVFGEITTKGKIDYEKIVRDTCRNIGFVSDDVGLDADKCKV  92

Query  182  LVNIEQQSPD  211
            LVNIEQQSPD
Sbjct  93   LVNIEQQSPD  102



>ref|XP_008654959.1| PREDICTED: S-adenosylmethionine synthetase 1 isoform X1 [Zea 
mays]
 ref|XP_008654960.1| PREDICTED: S-adenosylmethionine synthetase 1 isoform X1 [Zea 
mays]
 gb|AFW80645.1| S-adenosylmethionine synthase isoform 1 [Zea mays]
 gb|AFW80646.1| S-adenosylmethionine synthase isoform 2 [Zea mays]
 gb|AFW80647.1| S-adenosylmethionine synthase isoform 3 [Zea mays]
 gb|AFW80648.1| S-adenosylmethionine synthase isoform 4 [Zea mays]
 gb|AFW80649.1| S-adenosylmethionine synthase isoform 5 [Zea mays]
Length=392

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    QDPDSKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVL  184
            QDPDSKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR IGFTS DVGLDAD CKVL
Sbjct  36   QDPDSKVACETCTKTNMVMVFGEITTKASVDYEKIVRDTCREIGFTSDDVGLDADRCKVL  95

Query  185  VNIEQQSPD  211
            VNIEQQSPD
Sbjct  96   VNIEQQSPD  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512687374752