BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c44888_g1_i1 len=260 path=[238:0-259]

Length=260
                                                                      Score     E

gb|AHG95117.1|  2-3 ethylene-responsive transcription factor 1B       97.8    7e-24   
gb|AHG95104.1|  2-3 ethylene-responsive transcription factor 1B       97.4    1e-23   
gb|AHG95118.1|  2-3 ethylene-responsive transcription factor 1B       97.4    1e-23   
gb|AHG95100.1|  2-3 ethylene-responsive transcription factor 1B       97.4    1e-23   
ref|XP_009619700.1|  PREDICTED: ethylene-responsive transcription...    100   1e-23   
gb|AHG95102.1|  2-3 ethylene-responsive transcription factor 1B       97.1    1e-23   
ref|XP_004495318.1|  PREDICTED: ethylene-responsive transcription...  99.4    2e-23   
gb|AHG95101.1|  2-3 ethylene-responsive transcription factor 1B       95.9    5e-23   
ref|XP_009799481.1|  PREDICTED: ethylene-responsive transcription...  98.6    8e-23   
gb|AHG95099.1|  2-3 ethylene-responsive transcription factor 1B       94.7    1e-22   
gb|AGZ87835.1|  transcription factor ERF10                            96.7    2e-22   
gb|EYU45759.1|  hypothetical protein MIMGU_mgv1a024948mg              95.1    3e-22   
ref|XP_006298479.1|  hypothetical protein CARUB_v10014553mg           96.7    3e-22   
ref|XP_008224366.1|  PREDICTED: ethylene-responsive transcription...  95.9    6e-22   
ref|XP_006852536.1|  hypothetical protein AMTR_s00021p00184450        95.5    9e-22   
emb|CAN61702.1|  hypothetical protein VITISV_015644                   93.2    1e-21   Vitis vinifera
ref|XP_006354500.1|  PREDICTED: ethylene-responsive transcription...  94.7    2e-21   
ref|XP_009339611.1|  PREDICTED: ethylene-responsive transcription...  94.4    2e-21   
ref|XP_008447432.1|  PREDICTED: ethylene-responsive transcription...  94.4    2e-21   
ref|XP_010532635.1|  PREDICTED: ethylene-responsive transcription...  94.4    2e-21   
ref|XP_004247350.1|  PREDICTED: ethylene-responsive transcription...  93.6    2e-21   
ref|XP_004150983.1|  PREDICTED: ethylene-responsive transcription...  94.0    2e-21   
ref|XP_009764685.1|  PREDICTED: ethylene-responsive transcription...  93.2    2e-21   
gb|KDP23702.1|  hypothetical protein JCGZ_23535                       93.6    2e-21   
ref|XP_009804882.1|  PREDICTED: ethylene-responsive transcription...  93.2    2e-21   
ref|NP_001234695.1|  ethylene responsive element binding protein      94.4    3e-21   
gb|KDP26542.1|  hypothetical protein JCGZ_17700                       93.6    3e-21   
ref|XP_009386590.1|  PREDICTED: ethylene-responsive transcription...  92.8    3e-21   
ref|XP_002521963.1|  Ethylene-responsive transcription factor 1B,...  93.6    3e-21   Ricinus communis
ref|XP_010488373.1|  PREDICTED: ethylene-responsive transcription...  93.6    3e-21   
ref|XP_006420203.1|  hypothetical protein CICLE_v10005820mg           93.6    3e-21   
ref|XP_006406062.1|  hypothetical protein EUTSA_v10022374mg           93.6    3e-21   
ref|XP_002532362.1|  Ethylene-responsive transcription factor 1B,...  93.6    3e-21   Ricinus communis
ref|XP_010527399.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  93.6    4e-21   
ref|XP_002306843.1|  hypothetical protein POPTR_0005s24470g           93.6    4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010512204.1|  PREDICTED: ethylene-responsive transcription...  93.2    4e-21   
ref|XP_004151982.1|  PREDICTED: ethylene-responsive transcription...  93.2    4e-21   
ref|XP_006442707.1|  hypothetical protein CICLE_v10024142mg           93.6    4e-21   
ref|XP_009624600.1|  PREDICTED: ethylene-responsive transcription...  92.4    5e-21   
ref|XP_010037983.1|  PREDICTED: ethylene-responsive transcription...  93.2    5e-21   
ref|XP_009625479.1|  PREDICTED: ethylene-responsive transcription...  93.2    5e-21   
ref|NP_001234818.1|  transcription factor TSRF1                       93.2    5e-21   
ref|XP_006487868.1|  PREDICTED: ethylene-responsive transcription...  93.2    5e-21   
ref|XP_009804881.1|  PREDICTED: ethylene-responsive transcription...  92.0    5e-21   
ref|XP_010650070.1|  PREDICTED: ethylene-responsive transcription...  92.8    5e-21   
ref|XP_009108096.1|  PREDICTED: ethylene-responsive transcription...  92.8    6e-21   
ref|XP_011025993.1|  PREDICTED: ethylene-responsive transcription...  93.2    6e-21   
emb|CDY35518.1|  BnaA01g23940D                                        92.8    6e-21   
ref|XP_011091214.1|  PREDICTED: ethylene-responsive transcription...  93.2    6e-21   
ref|XP_009796372.1|  PREDICTED: ethylene-responsive transcription...  93.2    7e-21   
gb|AFK41204.1|  unknown                                               92.0    8e-21   
ref|XP_004302079.1|  PREDICTED: ethylene-responsive transcription...  92.8    8e-21   
ref|XP_007224758.1|  hypothetical protein PRUPE_ppa024173mg           92.8    8e-21   
ref|XP_010093429.1|  Ethylene-responsive transcription factor 1B      92.4    8e-21   
gb|KEH42734.1|  ethylene-responsive transcription factor 1B           92.4    8e-21   
ref|XP_007035093.1|  Ethylene-responsive transcription factor 1B      92.0    1e-20   
ref|XP_008341120.1|  PREDICTED: ethylene-responsive transcription...  92.4    1e-20   
ref|XP_006341690.1|  PREDICTED: ethylene-responsive transcription...  92.0    1e-20   
ref|XP_002264656.1|  PREDICTED: ethylene-responsive transcription...  92.0    1e-20   Vitis vinifera
dbj|BAG50053.1|  transcription factor AP2-EREBP                       92.0    1e-20   Lotus japonicus
ref|XP_006356112.1|  PREDICTED: ethylene-responsive transcription...  92.0    1e-20   
gb|EPS58568.1|  hypothetical protein M569_16245                       90.9    1e-20   
emb|CAN78568.1|  hypothetical protein VITISV_012060                   92.0    1e-20   Vitis vinifera
ref|XP_007030462.1|  Ethylene-responsive transcription factor         92.8    1e-20   
ref|XP_002264523.1|  PREDICTED: ethylene-responsive transcription...  92.0    1e-20   Vitis vinifera
gb|KHN03875.1|  Ethylene-responsive transcription factor 1B           91.7    1e-20   
ref|XP_009384005.1|  PREDICTED: ethylene-responsive transcription...  91.7    1e-20   
ref|XP_007030461.1|  Ethylene-responsive transcription factor         91.7    2e-20   
ref|XP_009606435.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  92.4    2e-20   
gb|AAB38748.1|  S25-XP1 DNA binding protein                           92.4    2e-20   Nicotiana tabacum [American tobacco]
ref|XP_010542739.1|  PREDICTED: ethylene-responsive transcription...  91.7    2e-20   
gb|EYU32546.1|  hypothetical protein MIMGU_mgv1a014195mg              91.3    2e-20   
ref|XP_010940609.1|  PREDICTED: ethylene-responsive transcription...  90.9    2e-20   
ref|XP_010671217.1|  PREDICTED: ethylene-responsive transcription...  92.0    2e-20   
gb|AAM63284.1|  ethylene response factor ERF1                         91.3    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011073519.1|  PREDICTED: ethylene-responsive transcription...  91.7    2e-20   
ref|XP_011085906.1|  PREDICTED: ethylene-responsive transcription...  90.1    2e-20   
ref|XP_007144910.1|  hypothetical protein PHAVU_007G193700g           91.3    2e-20   
ref|NP_188965.1|  ethylene-responsive transcription factor 1B         91.3    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234841.1|  ethylene-responsive factor 1                     91.3    3e-20   
ref|XP_004234236.1|  PREDICTED: ethylene-responsive transcription...  90.9    3e-20   
ref|XP_010679245.1|  PREDICTED: ethylene-responsive transcription...  91.7    3e-20   
ref|XP_009615714.1|  PREDICTED: ethylene-responsive transcription...  90.9    3e-20   
emb|CBI37105.3|  unnamed protein product                              92.0    3e-20   
ref|XP_002883413.1|  ATERF1/ERF1                                      90.9    3e-20   
ref|XP_006352404.1|  PREDICTED: ethylene-responsive transcription...  89.7    3e-20   
ref|XP_010466640.1|  PREDICTED: ethylene-responsive transcription...  90.9    3e-20   
emb|CDP01663.1|  unnamed protein product                              90.5    3e-20   
ref|XP_008460636.1|  PREDICTED: ethylene-responsive transcription...  90.9    3e-20   
gb|ADJ67439.1|  ethylene response factor 10                           90.9    3e-20   
gb|AGS80335.1|  ethylene response factor                              90.5    3e-20   
ref|XP_009775978.1|  PREDICTED: ethylene-responsive transcription...  90.5    4e-20   
gb|AAP44742.1|  putative DNA binding protein                          89.7    4e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007050314.1|  Ethylene response factor 1                       91.3    4e-20   
ref|XP_002531539.1|  Ethylene-responsive transcription factor 1B,...  90.5    4e-20   Ricinus communis
ref|XP_004289932.1|  PREDICTED: ethylene-responsive transcription...  91.3    4e-20   
ref|XP_011038525.1|  PREDICTED: ethylene-responsive transcription...  90.5    4e-20   
ref|XP_009624601.1|  PREDICTED: ethylene-responsive transcription...  89.4    5e-20   
gb|KFK39613.1|  hypothetical protein AALP_AA3G266600                  90.1    5e-20   
gb|AFK41308.1|  unknown                                               90.5    5e-20   
ref|XP_003593690.1|  Ethylene-responsive transcription factor         89.0    5e-20   
ref|XP_006346761.1|  PREDICTED: ethylene-responsive transcription...  90.9    5e-20   
ref|XP_009402075.1|  PREDICTED: ethylene-responsive transcription...  90.5    5e-20   
gb|EYU45762.1|  hypothetical protein MIMGU_mgv1a021881mg              89.0    6e-20   
ref|XP_002315707.1|  ETHYLENE RESPONSE FACTOR 1 family protein        90.1    6e-20   Populus trichocarpa [western balsam poplar]
ref|XP_009396591.1|  PREDICTED: ethylene-responsive transcription...  89.0    6e-20   
ref|XP_011045877.1|  PREDICTED: pathogenesis-related genes transc...  89.4    6e-20   
ref|XP_002319099.2|  hypothetical protein POPTR_0013s04240g           90.1    6e-20   Populus trichocarpa [western balsam poplar]
gb|EYU46463.1|  hypothetical protein MIMGU_mgv1a026963mg              90.5    6e-20   
ref|XP_003536939.1|  PREDICTED: ethylene-responsive transcription...  90.1    7e-20   
ref|XP_003536244.1|  PREDICTED: ethylene-responsive transcription...  90.1    7e-20   
ref|XP_009354935.1|  PREDICTED: ethylene-responsive transcription...  90.5    7e-20   
ref|XP_003590048.1|  Ethylene-responsive transcription factor         89.7    7e-20   
ref|XP_004236685.1|  PREDICTED: ethylene-responsive transcription...  90.1    7e-20   
ref|XP_009384570.1|  PREDICTED: ethylene-responsive transcription...  90.1    7e-20   
emb|CDY10178.1|  BnaC05g04210D                                        89.7    8e-20   
emb|CDY47720.1|  BnaA10g04090D                                        89.4    8e-20   
ref|XP_011025994.1|  PREDICTED: ethylene-responsive transcription...  89.7    8e-20   
ref|XP_009372140.1|  PREDICTED: ethylene-responsive transcription...  90.1    9e-20   
ref|XP_003541351.1|  PREDICTED: ethylene-responsive transcription...  89.7    9e-20   
ref|XP_009373990.1|  PREDICTED: ethylene-responsive transcription...  90.1    9e-20   
ref|XP_006379895.1|  hypothetical protein POPTR_0008s16610g           90.1    9e-20   
ref|XP_007050311.1|  Ethylene response factor 1, putative             89.7    9e-20   
ref|XP_007223771.1|  hypothetical protein PRUPE_ppa013137mg           87.8    9e-20   
ref|XP_011029834.1|  PREDICTED: ethylene-responsive transcription...  89.7    1e-19   
ref|XP_008364034.1|  PREDICTED: ethylene-responsive transcription...  89.7    1e-19   
ref|XP_004134941.1|  PREDICTED: pathogenesis-related genes transc...  88.6    1e-19   
ref|XP_004155637.1|  PREDICTED: pathogenesis-related genes transc...  88.6    1e-19   
gb|KHN44967.1|  Ethylene-responsive transcription factor 1B           89.4    1e-19   
gb|EEC76584.1|  hypothetical protein OsI_14431                        89.4    1e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001051973.1|  Os03g0860100                                     89.4    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010660112.1|  PREDICTED: ethylene-responsive transcription...  89.4    1e-19   
ref|XP_004497839.1|  PREDICTED: ethylene-responsive transcription...  89.4    1e-19   
gb|KCW74464.1|  hypothetical protein EUGRSUZ_E03167                   89.7    1e-19   
ref|XP_009777388.1|  PREDICTED: ethylene-responsive transcription...  89.0    1e-19   
gb|ADY38793.1|  ethylene-responsive transcription factor              89.4    1e-19   
ref|XP_009378995.1|  PREDICTED: ethylene-responsive transcription...  89.4    1e-19   
ref|XP_009777387.1|  PREDICTED: ethylene-responsive transcription...  89.4    1e-19   
ref|XP_007200770.1|  hypothetical protein PRUPE_ppa023839mg           89.7    1e-19   
ref|XP_009609579.1|  PREDICTED: ethylene-responsive transcription...  89.4    1e-19   
ref|XP_006360378.1|  PREDICTED: ethylene-responsive transcription...  89.4    1e-19   
gb|KCW74023.1|  hypothetical protein EUGRSUZ_E02652                   89.4    2e-19   
ref|XP_007050316.1|  Integrase-type DNA-binding superfamily prote...  87.4    2e-19   
dbj|BAN45686.1|  ethylene response factor                             89.4    2e-19   
ref|XP_010058963.1|  PREDICTED: ethylene-responsive transcription...  90.1    2e-19   
gb|AFG46740.1|  hypothetical protein 0_3648_01                        87.4    2e-19   
ref|XP_011030512.1|  PREDICTED: ethylene-responsive transcription...  89.0    2e-19   
ref|XP_004959050.1|  PREDICTED: ethylene-responsive transcription...  89.7    2e-19   
ref|XP_011077236.1|  PREDICTED: ethylene-responsive transcription...  88.6    2e-19   
ref|XP_008235690.1|  PREDICTED: ethylene-responsive transcription...  89.4    2e-19   
ref|XP_006351652.1|  PREDICTED: ethylene-responsive transcription...  88.6    2e-19   
ref|XP_010102245.1|  Ethylene-responsive transcription factor 1B      89.7    2e-19   
ref|XP_003593691.1|  Ethylene responsive transcription factor 1b      89.4    2e-19   
ref|XP_010671053.1|  PREDICTED: ethylene-responsive transcription...  87.0    2e-19   
ref|XP_010039189.1|  PREDICTED: ethylene-responsive transcription...  89.0    2e-19   
gb|EPS59543.1|  hypothetical protein M569_15262                       87.4    2e-19   
ref|XP_010023969.1|  PREDICTED: ethylene-responsive transcription...  89.0    2e-19   
gb|KCW61533.1|  hypothetical protein EUGRSUZ_H04254                   88.6    2e-19   
emb|CDO99222.1|  unnamed protein product                              89.4    2e-19   
ref|XP_007147223.1|  hypothetical protein PHAVU_006G106100g           88.2    2e-19   
ref|XP_003556353.1|  PREDICTED: ethylene-responsive transcription...  88.6    2e-19   
emb|CDP03737.1|  unnamed protein product                              89.4    2e-19   
ref|XP_009391058.1|  PREDICTED: ethylene-responsive transcription...  86.7    2e-19   
ref|XP_009119086.1|  PREDICTED: ethylene-responsive transcription...  89.0    2e-19   
ref|XP_006827480.1|  hypothetical protein AMTR_s00009p00143340        89.0    2e-19   
ref|XP_007025492.1|  Ethylene responsive element binding factor 1     87.8    2e-19   
ref|XP_003535804.1|  PREDICTED: ethylene-responsive transcription...  87.4    2e-19   
gb|EAZ29383.1|  hypothetical protein OsJ_13455                        87.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004296361.1|  PREDICTED: ethylene-responsive transcription...  89.0    2e-19   
ref|XP_009802785.1|  PREDICTED: ethylene-responsive transcription...  87.4    3e-19   
ref|NP_001170395.1|  putative AP2/EREBP transcription factor supe...  89.0    3e-19   Zea mays [maize]
ref|XP_009398626.1|  PREDICTED: ethylene-responsive transcription...  88.6    3e-19   
gb|AFG46732.1|  hypothetical protein 0_3648_01                        86.7    3e-19   
ref|XP_007025491.1|  AP2/ERF domain-containing transcription fact...  89.0    3e-19   
ref|XP_008806912.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  88.2    3e-19   
gb|AHA93904.1|  ethylene response factor 13                           87.8    3e-19   
ref|XP_010059232.1|  PREDICTED: uncharacterized protein LOC104447159  90.5    3e-19   
emb|CBJ55931.1|  ethylene response factor 1                           88.2    3e-19   
ref|XP_008349063.1|  PREDICTED: ethylene-responsive transcription...  88.6    3e-19   
ref|XP_011085905.1|  PREDICTED: ethylene-responsive transcription...  86.7    3e-19   
ref|XP_002306842.1|  hypothetical protein POPTR_0005s24460g           88.2    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010024972.1|  PREDICTED: ethylene-responsive transcription...  88.6    3e-19   
ref|XP_011085907.1|  PREDICTED: ethylene-responsive transcription...  89.0    3e-19   
ref|XP_010557112.1|  PREDICTED: ethylene-responsive transcription...  88.2    3e-19   
ref|XP_010111930.1|  Ethylene-responsive transcription factor         89.7    3e-19   
gb|AGE97366.1|  ethylene response factor 11                           88.2    4e-19   
ref|NP_001233987.1|  pathogenesis-related genes transcriptional a...  87.0    4e-19   
ref|XP_008438534.1|  PREDICTED: ethylene-responsive transcription...  88.2    4e-19   
gb|KHN02512.1|  Ethylene-responsive transcription factor 1B           86.7    4e-19   
ref|XP_009610278.1|  PREDICTED: ethylene-responsive transcription...  87.0    4e-19   
ref|XP_009590609.1|  PREDICTED: ethylene-responsive transcription...  88.2    4e-19   
gb|ABZ89186.1|  putative protein                                      88.2    4e-19   Coffea canephora [robusta coffee]
ref|XP_004959051.1|  PREDICTED: ethylene-responsive transcription...  88.6    4e-19   
ref|XP_002529292.1|  Ethylene-responsive transcription factor, pu...  86.3    4e-19   Ricinus communis
ref|XP_009609581.1|  PREDICTED: ethylene-responsive transcription...  87.4    4e-19   
gb|ADZ55304.1|  ethylene-responsive transcription factor              88.2    4e-19   
ref|XP_003519719.1|  PREDICTED: ethylene-responsive transcription...  87.8    4e-19   
ref|XP_008224368.1|  PREDICTED: ethylene-responsive transcription...  86.3    4e-19   
ref|XP_003541350.1|  PREDICTED: ethylene-responsive transcription...  87.8    4e-19   
ref|XP_006443850.1|  hypothetical protein CICLE_v10021622mg           88.6    4e-19   
ref|XP_007144090.1|  hypothetical protein PHAVU_007G127800g           87.8    4e-19   
gb|AID61741.1|  pathogenesis-related gene transcriptional activator   87.0    4e-19   
ref|XP_004134068.1|  PREDICTED: ethylene-responsive transcription...  87.8    4e-19   
gb|EYU18348.1|  hypothetical protein MIMGU_mgv1a022864mg              88.2    5e-19   
ref|XP_006367196.1|  PREDICTED: pathogenesis-related genes transc...  87.0    5e-19   
ref|XP_008391192.1|  PREDICTED: ethylene-responsive transcription...  87.8    5e-19   
ref|XP_004250546.1|  PREDICTED: ethylene-responsive transcription...  87.0    5e-19   
ref|XP_008439787.1|  PREDICTED: pathogenesis-related genes transc...  87.0    5e-19   
ref|XP_003553495.1|  PREDICTED: ethylene-responsive transcription...  88.2    5e-19   
ref|XP_010274789.1|  PREDICTED: ethylene-responsive transcription...  86.3    5e-19   
ref|XP_007145844.1|  hypothetical protein PHAVU_007G273000g           87.4    5e-19   
ref|XP_011028796.1|  PREDICTED: ethylene-responsive transcription...  87.8    5e-19   
gb|ADE41122.1|  AP2 domain class transcription factor                 87.8    5e-19   
ref|XP_009396175.1|  PREDICTED: ethylene-responsive transcription...  87.4    5e-19   
gb|EMT04957.1|  Ethylene-responsive transcription factor 15           88.2    5e-19   
gb|AHB33336.1|  ERF                                                   88.2    5e-19   
ref|XP_010918804.1|  PREDICTED: ethylene-responsive transcription...  87.8    5e-19   
ref|XP_008349214.1|  PREDICTED: ethylene-responsive transcription...  88.2    5e-19   
gb|EMT29515.1|  Ethylene-responsive transcription factor 1B           88.2    6e-19   
ref|XP_009776178.1|  PREDICTED: pathogenesis-related genes transc...  87.0    6e-19   
ref|XP_009769380.1|  PREDICTED: ethylene-responsive transcription...  87.8    6e-19   
gb|KDO68455.1|  hypothetical protein CISIN_1g042174mg                 87.8    6e-19   
gb|KFK31718.1|  hypothetical protein AALP_AA6G149900                  85.5    6e-19   
gb|KEH42539.1|  ethylene-responsive transcription factor 1B           87.4    6e-19   
ref|XP_002522517.1|  Ethylene-responsive transcription factor, pu...  86.7    6e-19   Ricinus communis
ref|XP_003553765.1|  PREDICTED: ethylene-responsive transcription...  87.0    7e-19   
ref|XP_002459869.1|  hypothetical protein SORBIDRAFT_02g012630        88.2    7e-19   Sorghum bicolor [broomcorn]
ref|XP_009621762.1|  PREDICTED: ethylene-responsive transcription...  85.5    7e-19   
ref|XP_006468209.1|  PREDICTED: ethylene-responsive transcription...  87.8    7e-19   
gb|KDP40318.1|  hypothetical protein JCGZ_02316                       87.4    7e-19   
ref|XP_008371436.1|  PREDICTED: ethylene-responsive transcription...  87.0    7e-19   
ref|XP_002461637.1|  hypothetical protein SORBIDRAFT_02g005810        88.2    7e-19   Sorghum bicolor [broomcorn]
emb|CBI35159.3|  unnamed protein product                              86.7    8e-19   
ref|XP_008653717.1|  PREDICTED: ethylene-responsive transcription...  87.4    8e-19   
ref|XP_008371435.1|  PREDICTED: ethylene-responsive transcription...  87.4    8e-19   
gb|AID51424.1|  ethylene response factor 19                           86.7    8e-19   
ref|XP_008784708.1|  PREDICTED: ethylene-responsive transcription...  87.0    8e-19   
emb|CAN73126.1|  hypothetical protein VITISV_004212                   87.0    8e-19   Vitis vinifera
ref|XP_009346221.1|  PREDICTED: ethylene-responsive transcription...  87.4    8e-19   
ref|XP_010262305.1|  PREDICTED: ethylene-responsive transcription...  87.0    8e-19   
ref|XP_007148087.1|  hypothetical protein PHAVU_006G179700g           87.4    8e-19   
ref|XP_010904582.1|  PREDICTED: ethylene-responsive transcription...  87.0    9e-19   
emb|CDY23951.1|  BnaC03g17400D                                        87.0    9e-19   
ref|XP_002264611.1|  PREDICTED: ethylene-responsive transcription...  87.0    9e-19   Vitis vinifera
ref|XP_009369492.1|  PREDICTED: ethylene-responsive transcription...  87.4    9e-19   
ref|NP_001130815.1|  putative AP2/EREBP transcription factor supe...  87.4    9e-19   Zea mays [maize]
ref|XP_004292208.1|  PREDICTED: ethylene-responsive transcription...  85.5    1e-18   
gb|KDP21037.1|  hypothetical protein JCGZ_21508                       87.4    1e-18   
ref|XP_003553493.1|  PREDICTED: ethylene-responsive transcription...  86.7    1e-18   
gb|ACU19106.1|  unknown                                               87.0    1e-18   Glycine max [soybeans]
gb|AEW07522.1|  hypothetical protein 0_3648_01                        84.7    1e-18   
ref|XP_003555692.1|  PREDICTED: ethylene-responsive transcription...  87.0    1e-18   
gb|ACH88384.1|  ethylene-responsive factor                            85.5    1e-18   Brassica oleracea var. gemmifera
gb|KHN31935.1|  Ethylene-responsive transcription factor 5            87.0    1e-18   
ref|XP_010475344.1|  PREDICTED: ethylene-responsive transcription...  87.0    1e-18   
ref|XP_007206287.1|  hypothetical protein PRUPE_ppa016384mg           87.0    1e-18   
ref|XP_003547160.1|  PREDICTED: ethylene-responsive transcription...  87.0    1e-18   
gb|KHN18938.1|  Ethylene-responsive transcription factor ERF091       87.0    1e-18   
ref|XP_009141142.1|  PREDICTED: ethylene-responsive transcription...  87.0    1e-18   
ref|XP_010457737.1|  PREDICTED: ethylene-responsive transcription...  86.7    1e-18   
ref|XP_010485642.1|  PREDICTED: ethylene-responsive transcription...  86.7    1e-18   
ref|XP_007050315.1|  Integrase-type DNA-binding superfamily prote...  84.7    1e-18   
ref|XP_006410255.1|  hypothetical protein EUTSA_v10017149mg           86.7    1e-18   
ref|XP_008451254.1|  PREDICTED: ethylene-responsive transcription...  86.7    1e-18   
gb|EYU19880.1|  hypothetical protein MIMGU_mgv1a023259mg              86.7    1e-18   
ref|XP_009619682.1|  PREDICTED: pathogenesis-related genes transc...  85.9    1e-18   
ref|XP_009132775.1|  PREDICTED: ethylene-responsive transcription...  86.7    1e-18   
emb|CDY72380.1|  BnaAnng40920D                                        86.7    2e-18   
ref|XP_010260390.1|  PREDICTED: pathogenesis-related genes transc...  86.3    2e-18   
emb|CDY15417.1|  BnaC04g42060D                                        86.7    2e-18   
ref|XP_003541352.1|  PREDICTED: ethylene-responsive transcription...  85.9    2e-18   
ref|XP_009339609.1|  PREDICTED: ethylene-responsive transcription...  84.7    2e-18   
ref|XP_008382907.1|  PREDICTED: uncharacterized protein LOC103445672  88.2    2e-18   
ref|XP_009785394.1|  PREDICTED: ethylene-responsive transcription...  84.3    2e-18   
ref|XP_007148088.1|  hypothetical protein PHAVU_006G179800g           85.5    2e-18   
ref|XP_009352826.1|  PREDICTED: ethylene-responsive transcription...  86.7    2e-18   
ref|XP_004959165.1|  PREDICTED: ethylene-responsive transcription...  86.3    2e-18   
ref|XP_002863652.1|  hypothetical protein ARALYDRAFT_917307           84.3    2e-18   
ref|XP_008225440.1|  PREDICTED: ethylene-responsive transcription...  86.7    2e-18   
ref|XP_008787547.1|  PREDICTED: ethylene-responsive transcription...  84.0    2e-18   
ref|XP_008218311.1|  PREDICTED: ethylene-responsive transcription...  86.3    2e-18   
ref|XP_006351651.1|  PREDICTED: ethylene-responsive transcription...  84.7    2e-18   
ref|XP_011091224.1|  PREDICTED: ethylene-responsive transcription...  84.3    2e-18   
gb|EMT26497.1|  Ethylene-responsive transcription factor ERF096       84.0    2e-18   
ref|XP_002889501.1|  hypothetical protein ARALYDRAFT_887599           84.3    2e-18   
ref|XP_009364454.1|  PREDICTED: ethylene-responsive transcription...  86.3    2e-18   
gb|ABY68420.1|  At1g04370-like protein                                84.0    2e-18   
ref|XP_006352403.1|  PREDICTED: ethylene-responsive transcription...  85.1    2e-18   
ref|XP_003541718.1|  PREDICTED: ethylene-responsive transcription...  86.3    2e-18   
ref|XP_010488369.1|  PREDICTED: ethylene-responsive transcription...  84.0    2e-18   
gb|ABY68378.1|  At1g04370                                             84.0    2e-18   
ref|XP_004166883.1|  PREDICTED: ethylene-responsive transcription...  85.9    2e-18   
ref|XP_006449445.1|  hypothetical protein CICLE_v10018130mg           86.3    2e-18   
ref|XP_010274790.1|  PREDICTED: ethylene-responsive transcription...  84.7    2e-18   
ref|NP_188963.2|  ethylene-responsive transcription factor ERF095     84.3    2e-18   
gb|EPS69850.1|  hypothetical protein M569_04913                       84.7    3e-18   
ref|XP_004247349.1|  PREDICTED: ethylene-responsive transcription...  84.7    3e-18   
ref|XP_010111912.1|  Ethylene-responsive transcription factor 15      85.9    3e-18   
ref|XP_010274787.1|  PREDICTED: ethylene-responsive transcription...  85.9    3e-18   
ref|XP_011029836.1|  PREDICTED: ethylene-responsive transcription...  84.7    3e-18   
gb|AFB36193.1|  ERF7                                                  85.5    3e-18   
ref|NP_171932.1|  ethylene-responsive transcription factor 14         84.0    3e-18   
ref|XP_009764919.1|  PREDICTED: ethylene-responsive transcription...  85.1    3e-18   
ref|XP_004148976.1|  PREDICTED: ethylene-responsive transcription...  85.9    3e-18   
ref|XP_004250457.1|  PREDICTED: ethylene-responsive transcription...  85.5    3e-18   
ref|XP_003520600.1|  PREDICTED: ethylene-responsive transcription...  85.9    3e-18   
gb|ABY68376.1|  At1g04370                                             84.0    3e-18   
ref|XP_010522157.1|  PREDICTED: ethylene-responsive transcription...  85.5    3e-18   
gb|ABY68377.1|  At1g04370                                             84.0    3e-18   
ref|XP_006403243.1|  hypothetical protein EUTSA_v10003355mg           84.0    3e-18   
ref|XP_002459509.1|  hypothetical protein SORBIDRAFT_02g005840        86.3    3e-18   
ref|XP_004250229.1|  PREDICTED: ethylene-responsive transcription...  84.7    3e-18   
gb|ACX71873.1|  ethylene response factor                              83.6    3e-18   
ref|XP_011028795.1|  PREDICTED: ethylene-responsive transcription...  85.5    3e-18   
emb|CAN84147.1|  hypothetical protein VITISV_020435                   85.9    3e-18   
ref|XP_002883412.1|  hypothetical protein ARALYDRAFT_479836           83.6    3e-18   
ref|XP_007212945.1|  hypothetical protein PRUPE_ppa022010mg           85.9    3e-18   
gb|AFG26327.1|  ethylene response factor ERF2                         85.1    3e-18   
ref|XP_010260392.1|  PREDICTED: ethylene-responsive transcription...  85.9    3e-18   
ref|XP_011027742.1|  PREDICTED: pathogenesis-related genes transc...  84.7    3e-18   
ref|XP_010551691.1|  PREDICTED: ethylene-responsive transcription...  84.0    3e-18   
gb|KEH42541.1|  ethylene-responsive transcription factor 1B           85.5    3e-18   
ref|XP_002264524.1|  PREDICTED: ethylene-responsive transcription...  85.5    3e-18   
ref|XP_006351650.1|  PREDICTED: ethylene-responsive transcription...  84.0    3e-18   
ref|NP_001235019.1|  uncharacterized protein LOC100527364             85.1    3e-18   
ref|XP_002302049.1|  hypothetical protein POPTR_0002s04020g           85.5    3e-18   
ref|XP_006377448.1|  hypothetical protein POPTR_0011s06010g           85.9    3e-18   
ref|XP_002522518.1|  Ethylene-responsive transcription factor, pu...  85.5    3e-18   
ref|XP_009352827.1|  PREDICTED: pathogenesis-related genes transc...  85.1    3e-18   
gb|EMT02052.1|  hypothetical protein F775_52314                       85.1    3e-18   
ref|XP_008806913.1|  PREDICTED: ethylene-responsive transcription...  83.6    4e-18   
ref|XP_008349213.1|  PREDICTED: pathogenesis-related genes transc...  85.1    4e-18   
gb|KDP40317.1|  hypothetical protein JCGZ_02315                       84.0    4e-18   
ref|XP_010279206.1|  PREDICTED: pathogenesis-related genes transc...  84.3    4e-18   
ref|XP_010652366.1|  PREDICTED: ethylene-responsive transcription...  84.0    4e-18   
ref|XP_002273121.1|  PREDICTED: ethylene-responsive transcription...  85.9    4e-18   
gb|AGG35475.1|  ethylene-responsive transcription factor              83.2    4e-18   
ref|XP_009113987.1|  PREDICTED: ethylene-responsive transcription...  83.6    4e-18   
ref|XP_007144911.1|  hypothetical protein PHAVU_007G193800g           85.1    4e-18   
ref|XP_011029077.1|  PREDICTED: ethylene-responsive transcription...  84.0    4e-18   
ref|XP_011045878.1|  PREDICTED: ethylene-responsive transcription...  85.5    4e-18   
ref|XP_007145468.1|  hypothetical protein PHAVU_007G241600g           85.5    4e-18   
ref|XP_002264562.2|  PREDICTED: ethylene-responsive transcription...  85.1    4e-18   
emb|CAN61410.1|  hypothetical protein VITISV_029562                   84.0    4e-18   
ref|XP_003559098.1|  PREDICTED: ethylene-responsive transcription...  85.5    5e-18   
emb|CDY50478.1|  BnaC09g17590D                                        83.2    5e-18   
ref|XP_009406409.1|  PREDICTED: ethylene-responsive transcription...  82.8    5e-18   
ref|XP_004495104.1|  PREDICTED: ethylene-responsive transcription...  85.5    5e-18   
emb|CDP03736.1|  unnamed protein product                              84.0    5e-18   
gb|KFK31234.1|  hypothetical protein AALP_AA6G085900                  85.1    5e-18   
emb|CDY09984.1|  BnaC08g44670D                                        85.1    5e-18   
ref|XP_006661578.1|  PREDICTED: ethylene-responsive transcription...  85.1    5e-18   
ref|XP_003541719.1|  PREDICTED: pathogenesis-related genes transc...  85.1    5e-18   
ref|NP_199154.1|  ethylene-responsive transcription factor ERF096     83.2    5e-18   
emb|CBI37103.3|  unnamed protein product                              85.1    5e-18   
emb|CDP01664.1|  unnamed protein product                              84.7    6e-18   
gb|ABK28740.1|  unknown                                               83.2    6e-18   
ref|XP_007035091.1|  Integrase-type DNA-binding superfamily prote...  83.2    6e-18   
ref|XP_010935747.1|  PREDICTED: ethylene-responsive transcription...  83.2    6e-18   
ref|XP_011096448.1|  PREDICTED: ethylene-responsive transcription...  85.1    6e-18   
gb|AFA36063.1|  AP2-ERF transcription factor                          84.3    6e-18   
gb|AGE97361.1|  ethylene response factor 6                            84.0    6e-18   
gb|AAT44931.1|  putative AP2/EREBP transcription factor               82.8    6e-18   
ref|XP_006351032.1|  PREDICTED: ethylene-responsive transcription...  84.3    6e-18   
ref|XP_007162539.1|  hypothetical protein PHAVU_001G160500g           84.7    7e-18   
dbj|BAD46614.1|  putative ethylene response factor ERF1               84.7    7e-18   
ref|XP_002314634.1|  hypothetical protein POPTR_0010s08310g           83.2    7e-18   
ref|XP_006417952.1|  hypothetical protein EUTSA_v10008518mg           85.1    7e-18   
ref|NP_001175998.1|  Os09g0572000                                     84.7    7e-18   
ref|XP_008653664.1|  PREDICTED: ethylene-responsive transcription...  85.5    7e-18   
emb|CDY24746.1|  BnaC04g13510D                                        84.7    7e-18   
ref|XP_002302048.1|  hypothetical protein POPTR_0002s04010g           84.7    7e-18   
ref|XP_009144241.1|  PREDICTED: ethylene-responsive transcription...  84.7    7e-18   
ref|XP_008388707.1|  PREDICTED: ethylene-responsive transcription...  84.7    7e-18   
ref|XP_006303295.1|  hypothetical protein CARUB_v10010105mg           84.7    7e-18   
ref|XP_002305766.2|  hypothetical protein POPTR_0004s05100g           84.7    7e-18   
ref|XP_009776179.1|  PREDICTED: ethylene-responsive transcription...  84.7    7e-18   
ref|XP_006406064.1|  hypothetical protein EUTSA_v10022200mg           82.8    7e-18   
ref|XP_006282000.1|  hypothetical protein CARUB_v10028227mg           82.8    7e-18   
ref|XP_010111911.1|  Ethylene-responsive transcription factor         83.6    8e-18   
emb|CDY10783.1|  BnaA05g11530D                                        84.3    8e-18   
ref|XP_004485859.1|  PREDICTED: pathogenesis-related genes transc...  83.6    8e-18   
ref|XP_004134940.1|  PREDICTED: ethylene-responsive transcription...  84.7    8e-18   
ref|XP_008652442.1|  PREDICTED: ethylene-responsive transcription...  82.8    8e-18   
ref|XP_002889588.1|  hypothetical protein ARALYDRAFT_470633           84.3    8e-18   
gb|EAZ10163.1|  hypothetical protein OsI_32480                        84.3    8e-18   
ref|XP_010229204.1|  PREDICTED: ethylene-responsive transcription...  82.8    8e-18   
ref|XP_002532365.1|  Ethylene-responsive transcription factor, pu...  82.0    8e-18   
gb|AAT44914.1|  putative AP2/EREBP transcription factor               82.4    9e-18   
gb|KHN02510.1|  Ethylene-responsive transcription factor 15           82.8    9e-18   
tpg|DAA59931.1|  TPA: putative AP2/EREBP transcription factor sup...  85.5    9e-18   
ref|XP_006388776.1|  hypothetical protein POPTR_0102s00200g           83.2    9e-18   
gb|KDO57619.1|  hypothetical protein CISIN_1g047241mg                 82.8    9e-18   
ref|XP_006296079.1|  hypothetical protein CARUB_v10025229mg           84.3    9e-18   
ref|XP_010542934.1|  PREDICTED: ethylene-responsive transcription...  82.8    9e-18   
ref|XP_011096383.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...  83.2    9e-18   
ref|XP_006420201.1|  hypothetical protein CICLE_v10007133mg           82.8    9e-18   
emb|CDX85070.1|  BnaC07g08360D                                        82.8    9e-18   
gb|ADC94860.1|  ERF3 transcription factor                             83.6    1e-17   
gb|EAZ45750.1|  hypothetical protein OsJ_30432                        84.0    1e-17   
ref|XP_002881165.1|  hypothetical protein ARALYDRAFT_482050           84.3    1e-17   
gb|EYU45761.1|  hypothetical protein MIMGU_mgv1a021671mg              83.2    1e-17   
ref|XP_002450986.1|  hypothetical protein SORBIDRAFT_05g022110        84.7    1e-17   
ref|XP_010469744.1|  PREDICTED: ethylene-responsive transcription...  84.3    1e-17   
ref|XP_010414162.1|  PREDICTED: ethylene-responsive transcription...  84.3    1e-17   
gb|AAD20668.1|  ethylene reponse factor-like AP2 domain transcrip...  84.3    1e-17   
emb|CAN73823.1|  hypothetical protein VITISV_032915                   82.4    1e-17   
gb|ABU62817.1|  pathogen-inducible ethylene-responsive element-bi...  84.3    1e-17   
ref|NP_850162.1|  ethylene-responsive transcription factor 15         84.3    1e-17   
ref|XP_006489769.1|  PREDICTED: ethylene-responsive transcription...  82.4    1e-17   
ref|XP_010655476.1|  PREDICTED: pathogenesis-related genes transc...  82.8    1e-17   
ref|NP_001241014.1|  uncharacterized protein LOC100784784             84.3    1e-17   
ref|XP_002284760.2|  PREDICTED: ethylene-responsive transcription...  82.0    1e-17   
ref|XP_001751961.1|  predicted protein                                80.5    1e-17   
ref|XP_003535939.1|  PREDICTED: ethylene-responsive transcription...  84.3    1e-17   
gb|KHN31934.1|  Ethylene-responsive transcription factor ERF106       84.0    1e-17   
ref|XP_007145470.1|  hypothetical protein PHAVU_007G241800g           84.0    1e-17   
gb|KEH42537.1|  ethylene-responsive transcription factor 1B           84.0    1e-17   
gb|KEH30939.1|  ethylene response factor                              82.0    1e-17   
ref|XP_009621246.1|  PREDICTED: ethylene-responsive transcription...  82.4    1e-17   
ref|XP_008371434.1|  PREDICTED: pathogenesis-related genes transc...  83.6    1e-17   
gb|KDP21036.1|  hypothetical protein JCGZ_21507                       83.2    1e-17   
emb|CDY18225.1|  BnaC05g02480D                                        82.4    1e-17   
ref|XP_003537003.1|  PREDICTED: ethylene-responsive transcription...  84.3    1e-17   
ref|XP_008439786.1|  PREDICTED: ethylene-responsive transcription...  84.3    1e-17   
ref|XP_007144904.1|  hypothetical protein PHAVU_007G193300g           84.3    1e-17   
ref|XP_003576892.1|  PREDICTED: ethylene-responsive transcription...  82.0    1e-17   
ref|XP_010057052.1|  PREDICTED: pathogenesis-related genes transc...  83.2    1e-17   
ref|XP_002305098.1|  hypothetical protein POPTR_0004s05110g           84.3    1e-17   
ref|XP_010023972.1|  PREDICTED: ethylene-responsive transcription...  82.4    1e-17   
ref|NP_001235847.1|  uncharacterized protein LOC100305726             83.6    1e-17   
ref|XP_009119309.1|  PREDICTED: ethylene-responsive transcription...  82.0    1e-17   
gb|AFK36254.1|  unknown                                               82.0    1e-17   
emb|CDO96721.1|  unnamed protein product                              84.3    1e-17   
ref|XP_008225442.1|  PREDICTED: pathogenesis-related genes transc...  83.2    1e-17   
ref|XP_010057324.1|  PREDICTED: pathogenesis-related genes transc...  83.2    1e-17   
gb|EMT25962.1|  Ethylene-responsive transcription factor 1B           85.9    1e-17   
ref|XP_004956267.1|  PREDICTED: ethylene-responsive transcription...  82.0    1e-17   
ref|XP_010442022.1|  PREDICTED: ethylene-responsive transcription...  82.0    1e-17   
ref|XP_007212119.1|  hypothetical protein PRUPE_ppa012014mg           83.2    1e-17   
ref|XP_010494326.1|  PREDICTED: ethylene-responsive transcription...  82.0    1e-17   
gb|EEE63914.1|  hypothetical protein OsJ_18739                        84.3    1e-17   
ref|NP_172106.1|  ethylene-responsive transcription factor ERF094     84.0    1e-17   
gb|KDP40316.1|  hypothetical protein JCGZ_02314                       82.0    1e-17   
gb|KEH42532.1|  AP2 domain class transcription factor                 84.0    1e-17   
ref|NP_001235286.1|  uncharacterized protein LOC100500502             83.6    1e-17   
dbj|BAD46612.1|  putative transcription factor Pti5                   82.0    1e-17   
gb|KHN30258.1|  Ethylene-responsive transcription factor ERF106       83.6    1e-17   
ref|XP_006440235.1|  hypothetical protein CICLE_v10021285mg           84.3    1e-17   
ref|XP_006298771.1|  hypothetical protein CARUB_v10014873mg           82.0    1e-17   
gb|KFK42943.1|  hypothetical protein AALP_AA1G058800                  84.0    1e-17   
ref|XP_006827482.1|  hypothetical protein AMTR_s00009p00147970        82.0    2e-17   
ref|XP_002302050.2|  hypothetical protein POPTR_0002s04040g           82.4    2e-17   
ref|XP_009396176.1|  PREDICTED: ethylene-responsive transcription...  81.6    2e-17   
ref|XP_010039174.1|  PREDICTED: ethylene-responsive transcription...  82.4    2e-17   
ref|XP_010918803.1|  PREDICTED: ethylene-responsive transcription...  81.6    2e-17   
ref|XP_004309329.1|  PREDICTED: ethylene-responsive transcription...  84.0    2e-17   
ref|XP_009102649.1|  PREDICTED: ethylene-responsive transcription...  82.0    2e-17   
ref|XP_006360394.1|  PREDICTED: ethylene-responsive transcription...  82.8    2e-17   
ref|XP_006479551.1|  PREDICTED: ethylene-responsive transcription...  82.0    2e-17   
ref|XP_010262303.1|  PREDICTED: ethylene-responsive transcription...  82.0    2e-17   
ref|XP_008811549.1|  PREDICTED: ethylene-responsive transcription...  83.2    2e-17   
ref|XP_004295564.1|  PREDICTED: uncharacterized protein LOC101305925  85.9    2e-17   
ref|XP_004956268.1|  PREDICTED: ethylene-responsive transcription...  84.0    2e-17   
ref|XP_009589439.1|  PREDICTED: ethylene-responsive transcription...  82.8    2e-17   
gb|AFO70115.1|  ethylene-responsive factor 1                          83.6    2e-17   
ref|XP_011036279.1|  PREDICTED: ethylene-responsive transcription...  83.6    2e-17   
ref|XP_006661577.1|  PREDICTED: ethylene-responsive transcription...  81.6    2e-17   
ref|XP_007035092.1|  Integrase-type DNA-binding superfamily protein   83.6    2e-17   
ref|XP_010481863.1|  PREDICTED: ethylene-responsive transcription...  81.6    2e-17   
ref|XP_003553492.1|  PREDICTED: ethylene-responsive transcription...  81.3    2e-17   
gb|AFK48855.1|  unknown                                               83.2    2e-17   
gb|ADW09319.1|  ethylene-responsive element binding factor 6          84.0    2e-17   
ref|XP_002325325.1|  hypothetical protein POPTR_0019s03170g           83.2    2e-17   
ref|XP_006354270.1|  PREDICTED: ethylene-responsive transcription...  82.4    2e-17   
ref|XP_010686479.1|  PREDICTED: pathogenesis-related genes transc...  82.0    2e-17   
ref|XP_010023971.1|  PREDICTED: ethylene-responsive transcription...  81.6    2e-17   
ref|XP_006477126.1|  PREDICTED: ethylene-responsive transcription...  84.7    2e-17   
ref|XP_006443853.1|  hypothetical protein CICLE_v10023546mg           82.0    2e-17   
gb|EMT05789.1|  Ethylene-responsive transcription factor ERF091       83.6    2e-17   
ref|XP_001759702.1|  predicted protein                                79.7    2e-17   
ref|XP_009625586.1|  PREDICTED: ethylene-responsive transcription...  83.6    2e-17   
emb|CDY06202.1|  BnaA09g50010D                                        83.2    2e-17   
ref|XP_009118552.1|  PREDICTED: ethylene-responsive transcription...  83.2    2e-17   
ref|XP_006467696.1|  PREDICTED: pathogenesis-related genes transc...  82.0    2e-17   
ref|XP_006449444.1|  hypothetical protein CICLE_v10016995mg           82.0    2e-17   
ref|XP_001751773.1|  predicted protein                                79.7    2e-17   
gb|KDO40615.1|  hypothetical protein CISIN_1g023209mg                 83.6    2e-17   
gb|EYU25975.1|  hypothetical protein MIMGU_mgv1a022127mg              81.3    3e-17   
ref|XP_010918971.1|  PREDICTED: ethylene-responsive transcription...  83.6    3e-17   
ref|XP_008780729.1|  PREDICTED: ethylene-responsive transcription...  81.3    3e-17   
gb|KDP22468.1|  hypothetical protein JCGZ_26299                       83.2    3e-17   
ref|XP_009609421.1|  PREDICTED: ethylene-responsive transcription...  83.6    3e-17   
ref|XP_010510221.1|  PREDICTED: ethylene-responsive transcription...  83.2    3e-17   
ref|XP_007144912.1|  hypothetical protein PHAVU_007G193900g           81.3    3e-17   
gb|AIA57937.1|  ethylene responsive element binding factor            83.2    3e-17   
ref|XP_011030514.1|  PREDICTED: ethylene-responsive transcription...  81.3    3e-17   
ref|XP_011091225.1|  PREDICTED: ethylene-responsive transcription...  81.3    3e-17   
ref|XP_004513203.1|  PREDICTED: ethylene-responsive transcription...  83.2    3e-17   
ref|XP_003536845.1|  PREDICTED: ethylene-responsive transcription...  81.3    3e-17   



>gb|AHG95117.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo subsp. uncinata]
Length=115

 Score = 97.8 bits (242),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 2/88 (2%)
 Frame = +3

Query  3    QLSRSSAMEFSSDDN--KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaee  176
            Q +R+ A+  + ++    L VEKRYRGVRKRPWG+YAAEIRDS R+GARVWLGTFDTAEE
Sbjct  8    QEARAEALAGAKEEKGKSLAVEKRYRGVRKRPWGKYAAEIRDSNRHGARVWLGTFDTAEE  67

Query  177  aalaydqaalSMRGKSAFLNFPTEKVQE  260
            AA+AYDQAA +MRG  A LNFP E V+E
Sbjct  68   AAMAYDQAAFAMRGSRAMLNFPLEVVRE  95



>gb|AHG95104.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo]
Length=115

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   LRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAF  230
            L VEKRYRGVRKRPWG+YAAEIRDS R+GARVWLGTFDTAEEAA+AYDQAA +MRG  A 
Sbjct  26   LAVEKRYRGVRKRPWGKYAAEIRDSNRHGARVWLGTFDTAEEAAMAYDQAAFAMRGSRAM  85

Query  231  LNFPTEKVQE  260
            LNFP E V+E
Sbjct  86   LNFPLEVVRE  95



>gb|AHG95118.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo subsp. uncinata]
Length=115

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   LRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAF  230
            L VEKRYRGVRKRPWG+YAAEIRDS R+GARVWLGTFDTAEEAA+AYDQAA +MRG  A 
Sbjct  26   LAVEKRYRGVRKRPWGKYAAEIRDSNRHGARVWLGTFDTAEEAAMAYDQAAFAMRGSRAM  85

Query  231  LNFPTEKVQE  260
            LNFP E V+E
Sbjct  86   LNFPLEVVRE  95



>gb|AHG95100.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo]
 gb|AHG95103.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo]
 gb|AHG95105.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo]
 gb|AHG95106.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo]
 gb|AHG95107.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo]
 gb|AHG95108.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo]
 gb|AHG95110.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
sylvestris]
 gb|AHG95111.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
sylvestris]
 gb|AHG95112.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
sylvestris]
 gb|AHG95114.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
sylvestris]
 gb|AHG95115.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo subsp. x rotundata]
Length=115

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   LRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAF  230
            L VEKRYRGVRKRPWG+YAAEIRDS R+GARVWLGTFDTAEEAA+AYDQAA +MRG  A 
Sbjct  26   LAVEKRYRGVRKRPWGKYAAEIRDSNRHGARVWLGTFDTAEEAAMAYDQAAFAMRGSRAM  85

Query  231  LNFPTEKVQE  260
            LNFP E V+E
Sbjct  86   LNFPLEVVRE  95



>ref|XP_009619700.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
tomentosiformis]
Length=262

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK Y GVRKRPWG+YAAEIRDSTRNG RVWLGTFDTAEEAALAYDQAA SMRG  AFLNF
Sbjct  134  EKHYIGVRKRPWGKYAAEIRDSTRNGIRVWLGTFDTAEEAALAYDQAAFSMRGPLAFLNF  193

Query  240  PTEKVQE  260
            P EKVQE
Sbjct  194  PMEKVQE  200



>gb|AHG95102.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo]
 gb|AHG95109.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo]
 gb|AHG95116.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo subsp. x rotundata]
Length=115

 Score = 97.1 bits (240),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   LRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAF  230
            L VEKRYRGVRKRPWG+YAAEIRDS R+GARVWLGTFDTAEEAA+AYDQAA +MRG  A 
Sbjct  26   LAVEKRYRGVRKRPWGKYAAEIRDSNRHGARVWLGTFDTAEEAAMAYDQAAFAMRGSRAM  85

Query  231  LNFPTEKVQE  260
            LNFP E V+E
Sbjct  86   LNFPLEVVRE  95



>ref|XP_004495318.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Cicer 
arietinum]
Length=206

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  27   EFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaal  206
            E SS++N+ R EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA 
Sbjct  56   EVSSEENEPRKEKSYRGVRRRPWGKFAAEIRDSTRNGMRVWLGTFDSAEAAALAYDQAAF  115

Query  207  SMRGKSAFLNFPTEKVQE  260
            SMRG SA LNFP E V+E
Sbjct  116  SMRGSSAILNFPVEIVRE  133



>gb|AHG95101.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo]
Length=115

 Score = 95.9 bits (237),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   LRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAF  230
            L V+KRYRGVRKRPWG+YAAEIRDS R+GARVWLGTFDTAEEAA+AYDQAA +MRG  A 
Sbjct  26   LAVDKRYRGVRKRPWGKYAAEIRDSNRHGARVWLGTFDTAEEAAMAYDQAAFAMRGSRAM  85

Query  231  LNFPTEKVQE  260
            LNFP E V+E
Sbjct  86   LNFPLEVVRE  95



>ref|XP_009799481.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
sylvestris]
Length=261

 Score = 98.6 bits (244),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK Y GVRKRPWG+YAAEIRDSTRNG RVWLGTFDT EEAALAYDQAA SMRG  AFLNF
Sbjct  133  EKHYIGVRKRPWGKYAAEIRDSTRNGIRVWLGTFDTVEEAALAYDQAAFSMRGPLAFLNF  192

Query  240  PTEKVQE  260
            P EKV+E
Sbjct  193  PMEKVKE  199



>gb|AHG95099.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
mugo]
 gb|AHG95113.1| 2-3 ethylene-responsive transcription factor 1B, partial [Pinus 
sylvestris]
Length=115

 Score = 94.7 bits (234),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   LRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAF  230
            L VEKRYRGVRKRPWG+YAAEIRDS R+GARVWLGTFDTAEEAA+AYDQAA + RG  A 
Sbjct  26   LAVEKRYRGVRKRPWGKYAAEIRDSNRHGARVWLGTFDTAEEAAMAYDQAAFATRGSRAM  85

Query  231  LNFPTEKVQE  260
            LNFP E V+E
Sbjct  86   LNFPLEVVRE  95



>gb|AGZ87835.1| transcription factor ERF10 [Gossypium hirsutum]
Length=225

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  27   EFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaal  206
            E +SD N  + EK YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFD+AE AA+AYDQAA 
Sbjct  72   EVTSDANHPKKEKSYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDSAEAAAIAYDQAAF  131

Query  207  SMRGKSAFLNFPTEKVQE  260
            SM+G  A LNFP E V+E
Sbjct  132  SMKGSLATLNFPVEVVRE  149



>gb|EYU45759.1| hypothetical protein MIMGU_mgv1a024948mg, partial [Erythranthe 
guttata]
Length=168

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EKRY GVRKRPWG+YAAEIRDSTRNGARVWLGTF+T EEAALAYDQAA +MRG S  LNF
Sbjct  33   EKRYIGVRKRPWGKYAAEIRDSTRNGARVWLGTFNTEEEAALAYDQAAFAMRGPSTPLNF  92

Query  240  PTEKVQE  260
            P EKV E
Sbjct  93   PLEKVVE  99



>ref|XP_006298479.1| hypothetical protein CARUB_v10014553mg [Capsella rubella]
 gb|EOA31377.1| hypothetical protein CARUB_v10014553mg [Capsella rubella]
Length=228

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            + EK YRGVR+RPWG+YAAEIRDSTRNG RVWLGTF++AEEAALAYDQAA SMRG SA L
Sbjct  87   KSEKSYRGVRRRPWGKYAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAIL  146

Query  234  NFPTEKVQE  260
            NFP E+VQE
Sbjct  147  NFPAERVQE  155



>ref|XP_008224366.1| PREDICTED: ethylene-responsive transcription factor 1B [Prunus 
mume]
Length=232

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  33   SSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSM  212
            +SD   L+ EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SM
Sbjct  81   TSDSENLKREKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSM  140

Query  213  RGKSAFLNFPTEKVQE  260
            RG +A LNFP E+V+E
Sbjct  141  RGSAAILNFPVERVRE  156



>ref|XP_006852536.1| hypothetical protein AMTR_s00021p00184450 [Amborella trichopoda]
 gb|ERN14003.1| hypothetical protein AMTR_s00021p00184450 [Amborella trichopoda]
Length=263

 Score = 95.5 bits (236),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   VEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLN  236
             E+RYRGVRKRPWG+YAAEIRDSTR+GARVWLGTFDTAEEAA+AYD+AALSMRG   FLN
Sbjct  121  AERRYRGVRKRPWGKYAAEIRDSTRHGARVWLGTFDTAEEAAMAYDKAALSMRGPRTFLN  180

Query  237  FPTEKVQE  260
            FP E V +
Sbjct  181  FPLEMVHQ  188



>emb|CAN61702.1| hypothetical protein VITISV_015644 [Vitis vinifera]
Length=170

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +3

Query  6    LSRSSAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaal  185
            L+R    E +S +N  + EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AAL
Sbjct  20   LNRVKEEEVTSQENPEK-EKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAAL  78

Query  186  aydqaalSMRGKSAFLNFPTEKVQE  260
            AYDQAA +MRG +A LNFP E+V+E
Sbjct  79   AYDQAAFAMRGPAAVLNFPVERVKE  103



>ref|XP_006354500.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Solanum 
tuberosum]
Length=241

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE+AALAYDQAA SMRG SA LNF
Sbjct  87   EKSYRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDSAEDAALAYDQAAFSMRGTSAILNF  146

Query  240  PTEKVQE  260
            P E V+E
Sbjct  147  PVETVRE  153



>ref|XP_009339611.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Pyrus 
x bretschneideri]
Length=229

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  39   DDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRG  218
            ++  L+ EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG
Sbjct  80   EEENLKEEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDSAEAAALAYDQAAFSMRG  139

Query  219  KSAFLNFPTEKVQE  260
             +A LNFP E+V+E
Sbjct  140  STAILNFPVERVRE  153



>ref|XP_008447432.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Cucumis 
melo]
Length=222

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  18   SAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydq  197
            ++++F  +  +   EK YRGVR+RPWG+YAAEIRDSTR+G RVWLGTFD+AE AALAYDQ
Sbjct  68   NSIDFKEEKQRKTTEKNYRGVRRRPWGKYAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQ  127

Query  198  aalSMRGKSAFLNFPTEKVQE  260
            AA SMRG  A LNFP E V+E
Sbjct  128  AAFSMRGTMAVLNFPVEMVRE  148



>ref|XP_010532635.1| PREDICTED: ethylene-responsive transcription factor 1B isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010532636.1| PREDICTED: ethylene-responsive transcription factor 1B isoform 
X2 [Tarenaya hassleriana]
Length=228

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD AE+AA+AYDQAA +MRG SA LNF
Sbjct  93   EKSYRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDNAEDAAMAYDQAAFAMRGSSAILNF  152

Query  240  PTEKVQE  260
            P E+VQE
Sbjct  153  PAERVQE  159



>ref|XP_004247350.1| PREDICTED: ethylene-responsive transcription factor 1B [Solanum 
lycopersicum]
Length=193

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            R +K YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFD AEEAALAYDQAA +MRG  A L
Sbjct  61   RKDKNYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDNAEEAALAYDQAAFAMRGSMAIL  120

Query  234  NFPTEKVQE  260
            NFP E V+E
Sbjct  121  NFPVEIVKE  129



>ref|XP_004150983.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Cucumis 
sativus]
 ref|XP_004174007.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Cucumis 
sativus]
 gb|KGN61609.1| hypothetical protein Csa_2G177210 [Cucumis sativus]
Length=228

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG +A LNFP
Sbjct  87   KSYRGVRRRPWGKYAAEIRDSTRNGVRVWLGTFDSAEAAALAYDQAAFSMRGSAAVLNFP  146

Query  243  TEKVQE  260
             E+VQE
Sbjct  147  VERVQE  152



>ref|XP_009764685.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
sylvestris]
Length=188

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  Y GVRKRPWG++AAEIRDSTRNG RVWLGTFDTAEEAALAYDQAALSMRG S  LNF
Sbjct  59   ENHYIGVRKRPWGKFAAEIRDSTRNGIRVWLGTFDTAEEAALAYDQAALSMRGPSTCLNF  118

Query  240  PTEKVQE  260
            P E VQE
Sbjct  119  PVEIVQE  125



>gb|KDP23702.1| hypothetical protein JCGZ_23535 [Jatropha curcas]
Length=214

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFD AE+AALAYDQAAL+MRG +A LNF
Sbjct  79   EIAYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDKAEDAALAYDQAALAMRGSTAILNF  138

Query  240  PTEKVQE  260
            P EKV E
Sbjct  139  PIEKVYE  145



>ref|XP_009804882.1| PREDICTED: ethylene-responsive transcription factor 15-like [Nicotiana 
sylvestris]
Length=191

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            ++Y GVRKRPWG+YAAEIRDSTRNG RVWLGTFDTAEEAA+AYDQAA SMRG    LNFP
Sbjct  55   QKYIGVRKRPWGKYAAEIRDSTRNGIRVWLGTFDTAEEAAMAYDQAAFSMRGAQTCLNFP  114

Query  243  TEKVQE  260
             EKV+E
Sbjct  115  VEKVRE  120



>ref|NP_001234695.1| ethylene responsive element binding protein [Solanum lycopersicum]
 gb|AAN77067.1| ethylene responsive element binding protein [Solanum lycopersicum]
Length=245

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE+AALAYDQAA SMRG SA LNF
Sbjct  88   EKSYRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDSAEDAALAYDQAAFSMRGNSAILNF  147

Query  240  PTEKVQE  260
            P E V++
Sbjct  148  PVETVRD  154



>gb|KDP26542.1| hypothetical protein JCGZ_17700 [Jatropha curcas]
Length=225

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            R EK YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG  A L
Sbjct  81   RKEKSYRGVRKRPWGKYAAEIRDSTRNGIRVWLGTFDSAEAAALAYDQAAFSMRGSMAIL  140

Query  234  NFPTEKVQE  260
            NFP E V+E
Sbjct  141  NFPVEVVRE  149



>ref|XP_009386590.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Musa 
acuminata subsp. malaccensis]
Length=190

 Score = 92.8 bits (229),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVRKRPWG++AAEIRDSTR GARVWLGTFDTAE AALAYDQAA SMRG+ A LNF
Sbjct  57   EPCYRGVRKRPWGKFAAEIRDSTRGGARVWLGTFDTAEAAALAYDQAAFSMRGRLAVLNF  116

Query  240  PTEKVQE  260
            P E+VQE
Sbjct  117  PVEQVQE  123



>ref|XP_002521963.1| Ethylene-responsive transcription factor 1B, putative [Ricinus 
communis]
 gb|EEF40367.1| Ethylene-responsive transcription factor 1B, putative [Ricinus 
communis]
Length=224

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFDTAE AALAYDQAA +MRG  A LNF
Sbjct  89   EIAYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAAFAMRGSMAILNF  148

Query  240  PTEKVQE  260
            P EKV E
Sbjct  149  PMEKVYE  155



>ref|XP_010488373.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Camelina 
sativa]
Length=222

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            + EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTF++AEEAALAYDQAA SMRG SA L
Sbjct  80   KTEKSYRGVRRRPWGKFAAEIRDSTRSGIRVWLGTFESAEEAALAYDQAAYSMRGSSAIL  139

Query  234  NFPTEKVQE  260
            NFP E+VQE
Sbjct  140  NFPAERVQE  148



>ref|XP_006420203.1| hypothetical protein CICLE_v10005820mg [Citrus clementina]
 ref|XP_006489744.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Citrus 
sinensis]
 gb|ESR33443.1| hypothetical protein CICLE_v10005820mg [Citrus clementina]
 gb|KDO57617.1| hypothetical protein CISIN_1g039409mg [Citrus sinensis]
Length=224

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG SA LNF
Sbjct  82   EKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGSSAILNF  141

Query  240  PTEKVQE  260
            P E+VQE
Sbjct  142  PVERVQE  148



>ref|XP_006406062.1| hypothetical protein EUTSA_v10022374mg [Eutrema salsugineum]
 gb|ESQ47515.1| hypothetical protein EUTSA_v10022374mg [Eutrema salsugineum]
Length=219

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            + EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTF++AEEAALAYDQAA SMRG SA L
Sbjct  78   KSEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGTSAIL  137

Query  234  NFPTEKVQE  260
            NFP E+V+E
Sbjct  138  NFPAERVKE  146



>ref|XP_002532362.1| Ethylene-responsive transcription factor 1B, putative [Ricinus 
communis]
 gb|EEF30005.1| Ethylene-responsive transcription factor 1B, putative [Ricinus 
communis]
Length=225

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG  A LNF
Sbjct  94   EKSYRGVRKRPWGKYAAEIRDSTRNGIRVWLGTFDSAEAAALAYDQAAFSMRGSMAILNF  153

Query  240  PTEKVQE  260
            P E V+E
Sbjct  154  PVEMVRE  160



>ref|XP_010527399.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor 1B-like [Tarenaya hassleriana]
Length=222

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE+AALAYDQAA S RG SA LNF
Sbjct  82   EKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDSAEDAALAYDQAAFSTRGSSAILNF  141

Query  240  PTEKVQE  260
            P E+VQE
Sbjct  142  PVERVQE  148



>ref|XP_002306843.1| hypothetical protein POPTR_0005s24470g [Populus trichocarpa]
 gb|EEE93839.1| hypothetical protein POPTR_0005s24470g [Populus trichocarpa]
Length=241

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    QLSRSSAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaa  182
            ++    A   ++++N  R EK YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFDT E AA
Sbjct  86   EIKEKEAAPNATEENPGR-EKTYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDTGETAA  144

Query  183  laydqaalSMRGKSAFLNFPTEKV  254
            LAYDQAALS+ G  A LNFP EKV
Sbjct  145  LAYDQAALSLHGSKAVLNFPIEKV  168



>ref|XP_010512204.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Camelina 
sativa]
Length=221

 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            + EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTF++AEEAALAYDQAA S RG SA L
Sbjct  80   KTEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAYSTRGSSAIL  139

Query  234  NFPTEKVQE  260
            NFP E+VQE
Sbjct  140  NFPAERVQE  148



>ref|XP_004151982.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Cucumis 
sativus]
 ref|XP_004170778.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Cucumis 
sativus]
 gb|KGN57915.1| hypothetical protein Csa_3G389850 [Cucumis sativus]
Length=224

 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  18   SAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydq  197
            ++++F  +  +   EK YRGVR+RPWG+YAAEIRDSTR+G RVWLGTFD+AE AALAYDQ
Sbjct  68   NSIDFKEEKQRKTTEKSYRGVRRRPWGKYAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQ  127

Query  198  aalSMRGKSAFLNFPTEKVQE  260
            AA SMRG  A LNFP E V+E
Sbjct  128  AAFSMRGTMAVLNFPVEMVRE  148



>ref|XP_006442707.1| hypothetical protein CICLE_v10024142mg [Citrus clementina]
 gb|ESR55947.1| hypothetical protein CICLE_v10024142mg [Citrus clementina]
 gb|KDO49999.1| hypothetical protein CISIN_1g047387mg [Citrus sinensis]
Length=239

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVR+RPWG+YAAEIRDSTRNG RVW+GTFDTAE AALAYDQAA +MRG +A LNF
Sbjct  106  EVSYRGVRRRPWGKYAAEIRDSTRNGVRVWIGTFDTAEAAALAYDQAAFAMRGTTAVLNF  165

Query  240  PTEKVQE  260
            P EKV E
Sbjct  166  PVEKVYE  172



>ref|XP_009624600.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
tomentosiformis]
Length=186

 Score = 92.4 bits (228),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK Y GVRKRPW +YAAEIRDSTRNG RVWLGTFDTAEEAA+AYDQAA SMRG    LNF
Sbjct  59   EKHYIGVRKRPWRKYAAEIRDSTRNGIRVWLGTFDTAEEAAMAYDQAAFSMRGAQTCLNF  118

Query  240  PTEKVQE  260
            P E+VQE
Sbjct  119  PVERVQE  125



>ref|XP_010037983.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Eucalyptus 
grandis]
 gb|KCW49775.1| hypothetical protein EUGRSUZ_K03266 [Eucalyptus grandis]
Length=240

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +3

Query  36   SDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMR  215
            ++ N    EK YRGVRKRPWG+YAAEIRDSTR+G RVWLGTFD+ E AA+AYDQAA SMR
Sbjct  86   ANANHQEKEKSYRGVRKRPWGKYAAEIRDSTRHGIRVWLGTFDSPEAAAMAYDQAAFSMR  145

Query  216  GKSAFLNFPTEKVQE  260
            G  A LNFP E+V+E
Sbjct  146  GSMAVLNFPVERVRE  160



>ref|XP_009625479.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
tomentosiformis]
Length=231

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK Y GVRKRPWG+YAAEIRDSTRNG RVWLGTF+TAEEAALAYDQAALSMRG  A LNF
Sbjct  96   EKHYIGVRKRPWGKYAAEIRDSTRNGMRVWLGTFNTAEEAALAYDQAALSMRGPLALLNF  155

Query  240  PTEKVQE  260
            P +KV+E
Sbjct  156  PMDKVRE  162



>ref|NP_001234818.1| transcription factor TSRF1 [Solanum lycopersicum]
 gb|AAN32899.1|AF494201_1 transcription factor TSRF1 [Solanum lycopersicum]
Length=240

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE+AALAYDQAA SMRG SA LNF
Sbjct  88   EKSYRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDSAEDAALAYDQAAFSMRGNSAILNF  147

Query  240  PTEKVQE  260
            P E V++
Sbjct  148  PVETVRD  154



>ref|XP_006487868.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Citrus 
sinensis]
Length=239

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVR+RPWG+YAAEIRDSTRNG RVW+GTFDTAE AALAYDQAA +MRG +A LNF
Sbjct  106  EVSYRGVRRRPWGKYAAEIRDSTRNGVRVWIGTFDTAEAAALAYDQAAFAMRGTTAVLNF  165

Query  240  PTEKVQE  260
            P EKV E
Sbjct  166  PVEKVYE  172



>ref|XP_009804881.1| PREDICTED: ethylene-responsive transcription factor 15-like [Nicotiana 
sylvestris]
Length=169

 Score = 92.0 bits (227),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  21   AMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqa  200
            ++   ++D+  + EK Y GVRKRPWG++AAEIRDSTRNG RVWLGTFDTAEEAA+ YDQA
Sbjct  20   SLSLETNDSISKEEKHYIGVRKRPWGKFAAEIRDSTRNGRRVWLGTFDTAEEAAMTYDQA  79

Query  201  alSMRGKSAFLNFPTEKVQE  260
            A  MRG S  LNF  EKV+E
Sbjct  80   AFCMRGPSTCLNFSVEKVRE  99



>ref|XP_010650070.1| PREDICTED: ethylene-responsive transcription factor 1B [Vitis 
vinifera]
Length=208

 Score = 92.8 bits (229),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +3

Query  6    LSRSSAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaal  185
            L+R    E +S +N  + EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AAL
Sbjct  58   LNRVKEEEVTSQENPEK-EKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAAL  116

Query  186  aydqaalSMRGKSAFLNFPTEKVQE  260
            AYDQAA +MRG +A LNFP E+V+E
Sbjct  117  AYDQAAFAMRGPAAVLNFPVERVKE  141



>ref|XP_009108096.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Brassica 
rapa]
 ref|XP_009108108.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Brassica 
rapa]
Length=210

 Score = 92.8 bits (229),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            + EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTF++AEEAALAYDQAA SMRG SA L
Sbjct  69   KPEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAIL  128

Query  234  NFPTEKVQE  260
            NFP E+V+E
Sbjct  129  NFPAERVKE  137



>ref|XP_011025993.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Populus 
euphratica]
Length=242

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFDT E AALAYDQAALS+ G  A LNF
Sbjct  105  EKTYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDTGETAALAYDQAALSLHGSKAVLNF  164

Query  240  PTEKV  254
            P EKV
Sbjct  165  PIEKV  169



>emb|CDY35518.1| BnaA01g23940D [Brassica napus]
Length=210

 Score = 92.8 bits (229),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            + EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTF++AEEAALAYDQAA SMRG SA L
Sbjct  69   KPEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAIL  128

Query  234  NFPTEKVQE  260
            NFP E+V+E
Sbjct  129  NFPAERVKE  137



>ref|XP_011091214.1| PREDICTED: ethylene-responsive transcription factor 1B [Sesamum 
indicum]
Length=236

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK +RGVRKRPWG++AAEIRDSTRNG RVWLGTFDTAE AA+AYDQAA +MRG +A LNF
Sbjct  97   EKSFRGVRKRPWGKFAAEIRDSTRNGVRVWLGTFDTAEAAAMAYDQAAFAMRGPAAILNF  156

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  157  PAERVRE  163



>ref|XP_009796372.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
sylvestris]
Length=274

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK Y GVRKRPWG+YAAEIRDSTRNG RVWLGTF+TAEEAALAYDQAALSMRG  A LNF
Sbjct  145  EKHYIGVRKRPWGKYAAEIRDSTRNGMRVWLGTFNTAEEAALAYDQAALSMRGPLALLNF  204

Query  240  PTEKVQE  260
            P +KV+E
Sbjct  205  PMDKVRE  211



>gb|AFK41204.1| unknown [Medicago truncatula]
Length=205

 Score = 92.0 bits (227),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            R EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG SA L
Sbjct  68   RKEKSYRGVRRRPWGKFAAEIRDSTRNGMRVWLGTFDSAEAAALAYDQAAFSMRGSSAIL  127

Query  234  NFPTEKVQE  260
            NFP E V+E
Sbjct  128  NFPVEIVRE  136



>ref|XP_004302079.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Fragaria 
vesca subsp. vesca]
Length=243

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QLSRSSAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaa  182
            +++ ++AME   +D  ++ E  YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFDTAEEAA
Sbjct  88   EVNSNAAME---EDESMKDEVAYRGVRRRPWGKYAAEIRDSTRNGVRVWLGTFDTAEEAA  144

Query  183  laydqaalSMRGKSAFLNFPTEKV  254
            LAYDQAA +MRG  A LNFP + V
Sbjct  145  LAYDQAAFAMRGTLAVLNFPADIV  168



>ref|XP_007224758.1| hypothetical protein PRUPE_ppa024173mg [Prunus persica]
 gb|EMJ25957.1| hypothetical protein PRUPE_ppa024173mg [Prunus persica]
Length=232

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  33   SSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSM  212
            +SD    + EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SM
Sbjct  81   TSDSENPKREKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSM  140

Query  213  RGKSAFLNFPTEKVQE  260
            RG +A LNFP E+V+E
Sbjct  141  RGSAAILNFPVERVRE  156



>ref|XP_010093429.1| Ethylene-responsive transcription factor 1B [Morus notabilis]
 gb|EXB54035.1| Ethylene-responsive transcription factor 1B [Morus notabilis]
Length=216

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AEEAALAYDQAA SMRG+SA LNF
Sbjct  87   ERSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEEAALAYDQAAFSMRGQSAILNF  146

Query  240  PTEKVQE  260
            P E V+E
Sbjct  147  PVETVEE  153



>gb|KEH42734.1| ethylene-responsive transcription factor 1B [Medicago truncatula]
Length=213

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            R EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG SA L
Sbjct  68   RKEKSYRGVRRRPWGKFAAEIRDSTRNGMRVWLGTFDSAEAAALAYDQAAFSMRGSSAIL  127

Query  234  NFPTEKVQE  260
            NFP E V+E
Sbjct  128  NFPVEIVRE  136



>ref|XP_007035093.1| Ethylene-responsive transcription factor 1B [Theobroma cacao]
 gb|EOY06019.1| Ethylene-responsive transcription factor 1B [Theobroma cacao]
Length=214

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA +MRG +A LNF
Sbjct  80   EKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFAMRGSAAILNF  139

Query  240  PTEKVQE  260
            P E+VQE
Sbjct  140  PVERVQE  146



>ref|XP_008341120.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Malus 
domestica]
Length=229

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  33   SSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSM  212
            + ++  L+ EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SM
Sbjct  78   ACEEENLKKEKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSM  137

Query  213  RGKSAFLNFPTEKVQE  260
            RG  A LNFP E+V+E
Sbjct  138  RGSXAILNFPVERVRE  153



>ref|XP_006341690.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Solanum 
tuberosum]
Length=205

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE+AALAYDQAA SMRG SA LNF
Sbjct  61   EKNYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDSAEDAALAYDQAAFSMRGTSAILNF  120

Query  240  PTEKVQE  260
              E+V E
Sbjct  121  SVERVVE  127



>ref|XP_002264656.1| PREDICTED: ethylene-responsive transcription factor 1B [Vitis 
vinifera]
Length=226

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  45   NKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKS  224
            NK   EK YRGVRKRPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG  
Sbjct  90   NKKEKEKTYRGVRKRPWGKFAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQAAFSMRGTM  149

Query  225  AFLNFPTEKVQE  260
            A LNFP E+V E
Sbjct  150  AVLNFPVERVVE  161



>dbj|BAG50053.1| transcription factor AP2-EREBP [Lotus japonicus]
Length=227

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 4/82 (5%)
 Frame = +3

Query  27   EFSSDDNKL----RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalayd  194
            E SS++N      R EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYD
Sbjct  69   EVSSEENGCGSSPRKEKSYRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDSAEAAALAYD  128

Query  195  qaalSMRGKSAFLNFPTEKVQE  260
            QAA +MRG SA LNFP + V+E
Sbjct  129  QAAFAMRGSSAILNFPVDVVRE  150



>ref|XP_006356112.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Solanum 
tuberosum]
Length=221

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE+AALAYDQAA SMRG SA LNF
Sbjct  63   EKNYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDSAEDAALAYDQAAFSMRGTSAILNF  122

Query  240  PTEKVQE  260
              E+V E
Sbjct  123  SVERVVE  129



>gb|EPS58568.1| hypothetical protein M569_16245, partial [Genlisea aurea]
Length=165

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  18   SAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydq  197
            S +E S        EK +RGVR+RPWG++AAEIRDSTR+G RVWLGTFDTAE AALAYDQ
Sbjct  20   SVLEQSPTSGYTSSEKSWRGVRRRPWGKFAAEIRDSTRHGERVWLGTFDTAEAAALAYDQ  79

Query  198  aalSMRGKSAFLNFPTEKVQE  260
            AA +MRG +A LNFP EKV+E
Sbjct  80   AAFAMRGTAAILNFPVEKVKE  100



>emb|CAN78568.1| hypothetical protein VITISV_012060 [Vitis vinifera]
Length=226

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  45   NKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKS  224
            NK   EK YRGVRKRPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG  
Sbjct  90   NKKEKEKTYRGVRKRPWGKFAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQAAFSMRGTM  149

Query  225  AFLNFPTEKVQE  260
            A LNFP E+V E
Sbjct  150  AVLNFPVERVVE  161



>ref|XP_007030462.1| Ethylene-responsive transcription factor [Theobroma cacao]
 gb|EOY10964.1| Ethylene-responsive transcription factor [Theobroma cacao]
Length=314

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFDTAE AALAYDQAAL+MRG  A LNF
Sbjct  90   EISYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAALAMRGPMAILNF  149

Query  240  PTEKVQE  260
            P +KV E
Sbjct  150  PMDKVYE  156



>ref|XP_002264523.1| PREDICTED: ethylene-responsive transcription factor 1B [Vitis 
vinifera]
Length=223

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  45   NKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKS  224
            NK   EK YRGVRKRPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG  
Sbjct  90   NKKEKEKTYRGVRKRPWGKFAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQAAFSMRGTM  149

Query  225  AFLNFPTEKVQE  260
            A LNFP E+V E
Sbjct  150  AVLNFPVERVVE  161



>gb|KHN03875.1| Ethylene-responsive transcription factor 1B [Glycine soja]
Length=211

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ Y GVRKRPWG++AAEIRD+TRNG RVWLGTFDTAE AALAYDQAA SMRG+SA LNF
Sbjct  69   ERSYIGVRKRPWGKFAAEIRDTTRNGTRVWLGTFDTAEAAALAYDQAAFSMRGQSAVLNF  128

Query  240  PTEKVQE  260
            P ++V+E
Sbjct  129  PVKRVKE  135



>ref|XP_009384005.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Musa 
acuminata subsp. malaccensis]
Length=210

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVRKRPWG++AAEIRDSTRNG RVWLGTFDTAE AALAYDQAALSMRG+ A LNFP E
Sbjct  79   YRGVRKRPWGKFAAEIRDSTRNGIRVWLGTFDTAEAAALAYDQAALSMRGQLAVLNFPVE  138

Query  249  KVQ  257
            +VQ
Sbjct  139  RVQ  141



>ref|XP_007030461.1| Ethylene-responsive transcription factor [Theobroma cacao]
 gb|EOY10963.1| Ethylene-responsive transcription factor [Theobroma cacao]
Length=225

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFDTAE AALAYDQAAL+MRG  A LNF
Sbjct  89   EISYRGVRRRPWGKYAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAALAMRGSLAILNF  148

Query  240  PTEKVQE  260
            P EKV E
Sbjct  149  PMEKVYE  155



>ref|XP_009606435.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor 1B-like [Nicotiana tomentosiformis]
Length=276

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK +RGVR+RPWG++AAEIRDSTRNG RVWLGTFD+ E AALAYDQAA  MRG SA LNF
Sbjct  89   EKSFRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDSPEAAALAYDQAAFLMRGTSAILNF  148

Query  240  PTEKVQE  260
            P E VQE
Sbjct  149  PVETVQE  155



>gb|AAB38748.1| S25-XP1 DNA binding protein [Nicotiana tabacum]
Length=277

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK +RGVR+RPWG++AAEIRDSTRNG RVWLGTFD+ E AALAYDQAA  MRG SA LNF
Sbjct  89   EKSFRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDSPEAAALAYDQAAFLMRGTSAILNF  148

Query  240  PTEKVQE  260
            P E VQE
Sbjct  149  PVETVQE  155



>ref|XP_010542739.1| PREDICTED: ethylene-responsive transcription factor 15-like [Tarenaya 
hassleriana]
Length=230

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFDTAEEAALAYDQAA +++G SA LNF
Sbjct  79   EKAYRGVRRRPWGKYAAEIRDSTRNGIRVWLGTFDTAEEAALAYDQAAFALKGVSAILNF  138

Query  240  PTEKVQE  260
            P E V+E
Sbjct  139  PVEVVRE  145



>gb|EYU32546.1| hypothetical protein MIMGU_mgv1a014195mg [Erythranthe guttata]
Length=198

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K YRGVR+RPWG++AAEIRDSTRNG RVWLGTFDTAE AALAYDQAA +MRG++A LNFP
Sbjct  68   KSYRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAAFAMRGQAAVLNFP  127

Query  243  TEKVQE  260
             E+V+E
Sbjct  128  VERVRE  133



>ref|XP_010940609.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Elaeis 
guineensis]
Length=188

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +3

Query  27   EFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaal  206
            E  S D +   EK YRGVR+RPWG++AAEIRDSTR G RVWLGTFD+AE AALAYDQAAL
Sbjct  73   ESKSGDEQRSKEKSYRGVRRRPWGKFAAEIRDSTRRGIRVWLGTFDSAEAAALAYDQAAL  132

Query  207  SMRGKSAFLNFPTEKVQE  260
            SMRG  A LNFP E+VQE
Sbjct  133  SMRGSMAVLNFPVERVQE  150



>ref|XP_010671217.1| PREDICTED: ethylene-responsive transcription factor 1B [Beta 
vulgaris subsp. vulgaris]
Length=243

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFDT E AALAYDQAA+S RG  A LNF
Sbjct  87   EKSYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDTPEAAALAYDQAAISTRGSMAVLNF  146

Query  240  PTEKVQE  260
            P E V+E
Sbjct  147  PEEVVKE  153



>gb|AAM63284.1| ethylene response factor ERF1 [Arabidopsis thaliana]
Length=218

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTF++AEEAALAYDQAA SMRG SA LNF
Sbjct  79   EKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAILNF  138

Query  240  PTEKVQE  260
              E+VQE
Sbjct  139  SAERVQE  145



>ref|XP_011073519.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Sesamum 
indicum]
Length=234

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFDTAE AALAYDQAALS RG++A LNF
Sbjct  96   EKAYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDTAEAAALAYDQAALSTRGQAAVLNF  155

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  156  PVERVRE  162



>ref|XP_011085906.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Sesamum 
indicum]
Length=166

 Score = 90.1 bits (222),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 62/82 (76%), Gaps = 5/82 (6%)
 Frame = +3

Query  30   FSSDDN-----KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalayd  194
            FSS+ N      L   K Y GVRKRPWG+YAAEIRDSTRNG RVWLGTF+T EEAALAYD
Sbjct  18   FSSNSNAKESDHLAHNKHYIGVRKRPWGKYAAEIRDSTRNGRRVWLGTFNTEEEAALAYD  77

Query  195  qaalSMRGKSAFLNFPTEKVQE  260
            QAA +MRG S  LNFP EKV E
Sbjct  78   QAAFAMRGPSVPLNFPLEKVVE  99



>ref|XP_007144910.1| hypothetical protein PHAVU_007G193700g [Phaseolus vulgaris]
 gb|ESW16904.1| hypothetical protein PHAVU_007G193700g [Phaseolus vulgaris]
Length=211

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ Y+GVRKRPWG+YAAEIRD+TRNG RVWLGTFD+AE AALAYDQAA SMRG +A LNF
Sbjct  68   ERSYKGVRKRPWGKYAAEIRDTTRNGTRVWLGTFDSAEAAALAYDQAAFSMRGHNAVLNF  127

Query  240  PTEKVQE  260
            P ++V+E
Sbjct  128  PVKRVKE  134



>ref|NP_188965.1| ethylene-responsive transcription factor 1B [Arabidopsis thaliana]
 sp|Q8LDC8.2|ERF92_ARATH RecName: Full=Ethylene-responsive transcription factor 1B; Short=AtERF1B; 
AltName: Full=Ethylene-responsive element-binding 
factor 1B; Short=EREBP-1B [Arabidopsis thaliana]
 gb|AAL16158.1|AF428390_1 AT3g23240/K14B15_13 [Arabidopsis thaliana]
 gb|AAD03544.1| ethylene response factor 1 [Arabidopsis thaliana]
 gb|AAD03545.1| ethylene response factor 1 [Arabidopsis thaliana]
 dbj|BAA95737.1| ethylene response DNA binding protein-like [Arabidopsis thaliana]
 gb|AAM91459.1| AT3g23240/K14B15_13 [Arabidopsis thaliana]
 gb|AEE76738.1| ethylene-responsive transcription factor 1B [Arabidopsis thaliana]
Length=218

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            + EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTF++AEEAALAYDQAA SMRG SA L
Sbjct  77   KSEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAIL  136

Query  234  NFPTEKVQE  260
            NF  E+VQE
Sbjct  137  NFSAERVQE  145



>ref|NP_001234841.1| ethylene-responsive factor 1 [Solanum lycopersicum]
 gb|AAK95688.1| ethylene-responsive factor 1 [Solanum lycopersicum]
 gb|ABY86902.1| ethylene response factor [Solanum lycopersicum]
Length=224

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK Y GVRKRPWG+YA+EIRDSTRNG RVWLGTFDTAEEAALAYDQAALSMRG  + LNF
Sbjct  94   EKHYIGVRKRPWGKYASEIRDSTRNGIRVWLGTFDTAEEAALAYDQAALSMRGPWSLLNF  153

Query  240  PTEKVQ  257
            P E V+
Sbjct  154  PMEHVK  159



>ref|XP_004234236.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Solanum 
lycopersicum]
Length=211

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE+AALAYDQAA SMRG SA LNF
Sbjct  60   EKNYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDSAEDAALAYDQAAFSMRGTSAILNF  119

Query  240  PTEKVQE  260
              E+V E
Sbjct  120  SVERVVE  126



>ref|XP_010679245.1| PREDICTED: ethylene-responsive transcription factor 1B [Beta 
vulgaris subsp. vulgaris]
Length=267

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +3

Query  60   EKR-YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLN  236
            EKR YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFD+AEEAA+AYDQAA SMRG  A LN
Sbjct  122  EKRAYRGVRRRPWGKYAAEIRDSTRNGVRVWLGTFDSAEEAAMAYDQAAFSMRGTMAVLN  181

Query  237  FPTEKVQE  260
            FP E V+E
Sbjct  182  FPVEVVRE  189



>ref|XP_009615714.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
tomentosiformis]
Length=222

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVRKRPWG++AAEIRDSTRNG RVW+GTFD+AE AALAYDQAA +MRG  A LNF
Sbjct  86   EKNYRGVRKRPWGKFAAEIRDSTRNGVRVWIGTFDSAEAAALAYDQAAFAMRGSLAILNF  145

Query  240  PTEKVQE  260
            P E V+E
Sbjct  146  PVEIVKE  152



>emb|CBI37105.3| unnamed protein product [Vitis vinifera]
Length=336

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  45   NKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKS  224
            NK   EK YRGVRKRPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG  
Sbjct  130  NKKEKEKTYRGVRKRPWGKFAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQAAFSMRGTM  189

Query  225  AFLNFPTEKVQE  260
            A LNFP E+V E
Sbjct  190  AVLNFPVERVVE  201



>ref|XP_002883413.1| ATERF1/ERF1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59672.1| ATERF1/ERF1 [Arabidopsis lyrata subsp. lyrata]
Length=218

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTF++AEEAALAYDQAA SMRG SA LNF
Sbjct  79   EKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAILNF  138

Query  240  PTEKVQE  260
              E+VQE
Sbjct  139  SPERVQE  145



>ref|XP_006352404.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Solanum 
tuberosum]
Length=170

 Score = 89.7 bits (221),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +3

Query  66   RYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPT  245
            ++ GVRKRPWG+YAAEIRDSTRNG RVWLGTFDTAEEAALAYDQAA  MRG S  LNFP 
Sbjct  41   KFIGVRKRPWGKYAAEIRDSTRNGIRVWLGTFDTAEEAALAYDQAAFCMRGPSICLNFPV  100

Query  246  EKVQE  260
            EKV++
Sbjct  101  EKVRD  105



>ref|XP_010466640.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Camelina 
sativa]
Length=221

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  45   NKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKS  224
            N  + EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTF++AEEAALAYDQAA S RG S
Sbjct  77   NSRKSEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAYSTRGSS  136

Query  225  AFLNFPTEKVQE  260
            A LNFP  +VQE
Sbjct  137  AILNFPAARVQE  148



>emb|CDP01663.1| unnamed protein product [Coffea canephora]
Length=194

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            R EK+Y GVRKRPWG+YAAEIRDSTRNG RVWLGTFD+ E+AALAYDQAA SMRG  A L
Sbjct  52   RREKQYIGVRKRPWGKYAAEIRDSTRNGIRVWLGTFDSPEQAALAYDQAAFSMRGTLASL  111

Query  234  NFPTEKVQE  260
            NFP ++VQ+
Sbjct  112  NFPMDRVQK  120



>ref|XP_008460636.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Cucumis 
melo]
Length=228

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG +A LNFP
Sbjct  87   KSYRGVRRRPWGKFAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQAAFSMRGSAAVLNFP  146

Query  243  TEKVQE  260
             E+VQE
Sbjct  147  VERVQE  152



>gb|ADJ67439.1| ethylene response factor 10 [Actinidia deliciosa]
Length=216

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  42   DNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGK  221
            D K   EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AEEAALAYDQAA S+RG 
Sbjct  81   DQKPIKEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDSAEEAALAYDQAAFSVRGS  140

Query  222  SAFLNFPTEKVQE  260
             A LNFP E+V++
Sbjct  141  MAVLNFPVERVKD  153



>gb|AGS80335.1| ethylene response factor [Actinidia eriantha]
Length=216

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  42   DNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGK  221
            D K   EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AEEAALAYDQAA S+RG 
Sbjct  81   DQKPIKEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDSAEEAALAYDQAAFSVRGS  140

Query  222  SAFLNFPTEKVQE  260
             A LNFP E+V++
Sbjct  141  MAVLNFPVERVKD  153



>ref|XP_009775978.1| PREDICTED: ethylene-responsive transcription factor 1B [Nicotiana 
sylvestris]
Length=220

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVRKRPWG++AAEIRDSTRNG RVW+GTFD+AE AALAYDQAA +MRG  A LNF
Sbjct  86   EKNYRGVRKRPWGKFAAEIRDSTRNGVRVWIGTFDSAEAAALAYDQAAFAMRGSLAILNF  145

Query  240  PTEKVQE  260
            P E V+E
Sbjct  146  PVEIVKE  152



>gb|AAP44742.1| putative DNA binding protein [Oryza sativa Japonica Group]
Length=166

 Score = 89.7 bits (221),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  48   KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSA  227
            +++ ++ +RGVRKRPWG++AAEIRDSTRNG RVWLGTFD+AEEAALAYDQAA +MRG +A
Sbjct  14   QVQQQQAFRGVRKRPWGKFAAEIRDSTRNGVRVWLGTFDSAEEAALAYDQAAFAMRGSAA  73

Query  228  FLNFPTEKV  254
             LNFP E+V
Sbjct  74   VLNFPMEQV  82



>ref|XP_007050314.1| Ethylene response factor 1 [Theobroma cacao]
 gb|EOX94471.1| Ethylene response factor 1 [Theobroma cacao]
Length=279

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            +K YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG  A LNF
Sbjct  143  DKTYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDSAEAAALAYDQAAFSMRGSLATLNF  202

Query  240  PTEKVQE  260
            P E V+E
Sbjct  203  PIEVVRE  209



>ref|XP_002531539.1| Ethylene-responsive transcription factor 1B, putative [Ricinus 
communis]
 gb|EEF30858.1| Ethylene-responsive transcription factor 1B, putative [Ricinus 
communis]
Length=224

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG +A LNF
Sbjct  82   EKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGPNAILNF  141

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  142  PAERVKE  148



>ref|XP_004289932.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Fragaria 
vesca subsp. vesca]
Length=266

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  15   SSAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalayd  194
            S ++ F   + K R EK YRGVR+RPWG+YAAEIRDSTR+G RVWLGTFD+ E AALAYD
Sbjct  91   SDSITFEGFEEKPRKEKSYRGVRRRPWGKYAAEIRDSTRHGVRVWLGTFDSPEAAALAYD  150

Query  195  qaalSMRGKSAFLNFPTEKVQE  260
            QAA ++RG  A LNFP E V+E
Sbjct  151  QAAFALRGPLAVLNFPVEVVRE  172



>ref|XP_011038525.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Populus 
euphratica]
Length=225

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFDTAE AALAYDQAA +MRG  A LNF
Sbjct  89   EISYRGVRRRPWGKYAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAAFAMRGSMAVLNF  148

Query  240  PTEKVQE  260
            P +KV E
Sbjct  149  PAQKVYE  155



>ref|XP_009624601.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
tomentosiformis]
Length=168

 Score = 89.4 bits (220),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  21   AMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqa  200
            ++   ++D+  + EK Y GVRKRPWG++AAEIRDST NG RVWLGTFDTAEEAA+ YDQA
Sbjct  20   SLSLETNDSISKEEKHYIGVRKRPWGKFAAEIRDSTSNGRRVWLGTFDTAEEAAMTYDQA  79

Query  201  alSMRGKSAFLNFPTEKVQE  260
            A  MRG S  LNF  EKV+E
Sbjct  80   AFCMRGPSTCLNFSVEKVRE  99



>gb|KFK39613.1| hypothetical protein AALP_AA3G266600 [Arabis alpina]
Length=212

 Score = 90.1 bits (222),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   VEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLN  236
             EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTF+ AEEAALAYDQAA SMRG SA LN
Sbjct  81   TEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFERAEEAALAYDQAAFSMRGSSAILN  140

Query  237  FPTEKVQE  260
            FP E V+E
Sbjct  141  FPAEIVKE  148



>gb|AFK41308.1| unknown [Lotus japonicus]
Length=227

 Score = 90.5 bits (223),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 4/82 (5%)
 Frame = +3

Query  27   EFSSDDNKL----RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalayd  194
            E SS++N      R EK YRGVR+RPWG+++AEIRDSTRNG RVWLGTFD+AE AALAYD
Sbjct  69   EVSSEENGCGGSPRKEKSYRGVRRRPWGKFSAEIRDSTRNGLRVWLGTFDSAEAAALAYD  128

Query  195  qaalSMRGKSAFLNFPTEKVQE  260
            QAA +MRG SA LNFP + V+E
Sbjct  129  QAAFAMRGSSAILNFPVDVVRE  150



>ref|XP_003593690.1| Ethylene-responsive transcription factor [Medicago truncatula]
 gb|AES63941.1| ethylene response factor [Medicago truncatula]
Length=157

 Score = 89.0 bits (219),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  21   AMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqa  200
            AM    +  K   +K YRGVR+RPWG+YAAEIRDS R+GARVWLGTF TAEEAA+AYD+A
Sbjct  47   AMLSCLEPTKTIAKKHYRGVRRRPWGKYAAEIRDSARHGARVWLGTFQTAEEAAMAYDRA  106

Query  201  alSMRGKSAFLNFPTEKV  254
            A  MRG  A LNFP E V
Sbjct  107  AFKMRGSKALLNFPAETV  124



>ref|XP_006346761.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Solanum 
tuberosum]
Length=279

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  33   SSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSM  212
            +++  KL  +K Y GVRKRPWG+YAAEIRDSTRNG RVWLGTF+T EEAALAYDQAAL+M
Sbjct  143  NNNSTKLEEKKHYIGVRKRPWGKYAAEIRDSTRNGIRVWLGTFNTGEEAALAYDQAALTM  202

Query  213  RGKSAFLNFPTEKVQE  260
            RG  A LNFP +KV+E
Sbjct  203  RGPLALLNFPMDKVRE  218



>ref|XP_009402075.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Musa 
acuminata subsp. malaccensis]
Length=233

 Score = 90.5 bits (223),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 3/75 (4%)
 Frame = +3

Query  36   SDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMR  215
            +DD K+   K YRGVRKRPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMR
Sbjct  85   ADDPKV---KSYRGVRKRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMR  141

Query  216  GKSAFLNFPTEKVQE  260
            G +A LNFP ++V+E
Sbjct  142  GSTAVLNFPVDRVRE  156



>gb|EYU45762.1| hypothetical protein MIMGU_mgv1a021881mg, partial [Erythranthe 
guttata]
Length=164

 Score = 89.0 bits (219),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            +RY GVRKRPWG+YAAEIRDSTR+GARVWLGTF T EEAALAYDQAA +MRG S  LNFP
Sbjct  31   RRYIGVRKRPWGKYAAEIRDSTRHGARVWLGTFHTEEEAALAYDQAAFAMRGPSIPLNFP  90

Query  243  TEKVQE  260
             EKV E
Sbjct  91   LEKVVE  96



>ref|XP_002315707.1| ETHYLENE RESPONSE FACTOR 1 family protein [Populus trichocarpa]
 gb|EEF01878.1| ETHYLENE RESPONSE FACTOR 1 family protein [Populus trichocarpa]
Length=221

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG    LNF
Sbjct  84   EKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDSAEAAALAYDQAAFSMRGPGTILNF  143

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  144  PVERVRE  150



>ref|XP_009396591.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Musa 
acuminata subsp. malaccensis]
Length=161

 Score = 89.0 bits (219),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K YRGVR+RPWG++AAEIRDSTR G RVWLGTFD+AE AALAYDQAALSMRG +A LNFP
Sbjct  32   KSYRGVRRRPWGKFAAEIRDSTRQGVRVWLGTFDSAEAAALAYDQAALSMRGATAVLNFP  91

Query  243  TEKVQE  260
             E+V+E
Sbjct  92   AERVRE  97



>ref|XP_011045877.1| PREDICTED: pathogenesis-related genes transcriptional activator 
PTI5-like [Populus euphratica]
Length=183

 Score = 89.4 bits (220),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            +K YRGVR+RPWG+YAAEIRDSTR+GAR+WLGTF+TAE AALAYD+AA SMRG  A LNF
Sbjct  60   KKHYRGVRRRPWGKYAAEIRDSTRHGARIWLGTFETAEAAALAYDRAAFSMRGSKALLNF  119

Query  240  PTEKV  254
            P E V
Sbjct  120  PAEVV  124



>ref|XP_002319099.2| hypothetical protein POPTR_0013s04240g [Populus trichocarpa]
 gb|EEE95022.2| hypothetical protein POPTR_0013s04240g [Populus trichocarpa]
Length=225

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFDTAE AALAYDQAA +MRG  A LNF
Sbjct  89   EISYRGVRRRPWGKYAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAAFAMRGSMAVLNF  148

Query  240  PTEKVQE  260
            P +KV E
Sbjct  149  PAQKVYE  155



>gb|EYU46463.1| hypothetical protein MIMGU_mgv1a026963mg [Erythranthe guttata]
Length=250

 Score = 90.5 bits (223),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 69/82 (84%), Gaps = 3/82 (4%)
 Frame = +3

Query  15   SSAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalayd  194
            SSA + ++++ +   EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYD
Sbjct  92   SSAAKMAAEEKR---EKPYRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDSAEAAALAYD  148

Query  195  qaalSMRGKSAFLNFPTEKVQE  260
            QAA +MRG +A LNFP E+V+E
Sbjct  149  QAAFAMRGCAAVLNFPVERVRE  170



>ref|XP_003536939.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Glycine 
max]
Length=220

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            ++ Y GVRKRPWG++AAEIRD+TRNG RVWLGTFDTAE AALAYDQAA SMRG+SA LNF
Sbjct  78   QRSYIGVRKRPWGKFAAEIRDTTRNGTRVWLGTFDTAEAAALAYDQAAFSMRGQSAVLNF  137

Query  240  PTEKVQE  260
            P ++V+E
Sbjct  138  PVKRVKE  144



>ref|XP_003536244.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Glycine 
max]
Length=219

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            R EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG +A L
Sbjct  69   RKEKSYRGVRRRPWGKFAAEIRDSTRHGMRVWLGTFDSAEAAALAYDQAAFSMRGSAAIL  128

Query  234  NFPTEKVQE  260
            NFP E V+E
Sbjct  129  NFPAEIVRE  137



>ref|XP_009354935.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Pyrus 
x bretschneideri]
Length=253

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFD+ E AALAYDQAA ++RG  A LNF
Sbjct  104  EKAYRGVRRRPWGKYAAEIRDSTRNGIRVWLGTFDSPEAAALAYDQAAFALRGSLAVLNF  163

Query  240  PTEKVQE  260
            P + VQE
Sbjct  164  PAQVVQE  170



>ref|XP_003590048.1| Ethylene-responsive transcription factor [Medicago truncatula]
 gb|AES60299.1| ethylene-responsive transcription factor 1B [Medicago truncatula]
Length=218

 Score = 89.7 bits (221),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +3

Query  6    LSRSSAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaal  185
            LS++S  E ++  NK +  K YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AAL
Sbjct  62   LSKTSN-EKTTKSNKDKNNKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAAL  120

Query  186  aydqaalSMRGKSAFLNFPTEKVQE  260
            AYDQAA SMRG SA LNF  EKV+E
Sbjct  121  AYDQAAFSMRGSSATLNFSVEKVKE  145



>ref|XP_004236685.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Solanum 
lycopersicum]
Length=233

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K Y GVRKRPWG+YAAEIRDSTRNG RVWLGTF+T EEAALAYDQAAL+MRG  A LNFP
Sbjct  108  KHYIGVRKRPWGKYAAEIRDSTRNGIRVWLGTFNTCEEAALAYDQAALTMRGPLALLNFP  167

Query  243  TEKVQE  260
             +KV+E
Sbjct  168  MDKVRE  173



>ref|XP_009384570.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Musa 
acuminata subsp. malaccensis]
Length=234

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVRKRPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG  A LNF
Sbjct  93   EKSYRGVRKRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGSMAVLNF  152

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  153  PVERVRE  159



>emb|CDY10178.1| BnaC05g04210D [Brassica napus]
Length=223

 Score = 89.7 bits (221),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  45   NKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKS  224
            NK   E+ YRGVRKRPWG+YAAEIRDSTR G RVWLGTFDTAEEAALAYDQAA +++G  
Sbjct  72   NKQEEERSYRGVRKRPWGKYAAEIRDSTRKGIRVWLGTFDTAEEAALAYDQAAFALKGDL  131

Query  225  AFLNFPTEKVQE  260
            A LNFP E V+E
Sbjct  132  AVLNFPVEVVKE  143



>emb|CDY47720.1| BnaA10g04090D [Brassica napus]
Length=197

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  45   NKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKS  224
            NK   E+ YRGVRKRPWG+YAAEIRDS+R G RVWLGTFDTAEEAALAYDQAA +++G  
Sbjct  71   NKQEEERSYRGVRKRPWGKYAAEIRDSSRKGIRVWLGTFDTAEEAALAYDQAAFALKGHL  130

Query  225  AFLNFPTEKVQE  260
            A LNFP E V+E
Sbjct  131  AVLNFPVEVVKE  142



>ref|XP_011025994.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Populus 
euphratica]
Length=228

 Score = 89.7 bits (221),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG +A LNFP E
Sbjct  94   YRGVRRRPWGKYAAEIRDSTRNGIRVWLGTFDSAEAAALAYDQAAFSMRGSTAVLNFPVE  153

Query  249  KVQE  260
             V+E
Sbjct  154  MVRE  157



>ref|XP_009372140.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Pyrus 
x bretschneideri]
Length=249

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVR+RPWG++AAEIRDSTRNG RVWLGTFDTAE AALAYDQAALSMRG SA LNFP +
Sbjct  109  YRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAALSMRGSSAVLNFPAD  168

Query  249  KVQE  260
             V +
Sbjct  169  VVHQ  172



>ref|XP_003541351.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Glycine 
max]
Length=216

 Score = 89.7 bits (221),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ Y GVRKRPWG+YAAEIRD+TRNG RVWLGTFDTAE AALAYDQAA SMRG +A LNF
Sbjct  73   ERSYTGVRKRPWGKYAAEIRDTTRNGTRVWLGTFDTAEAAALAYDQAAFSMRGHNAVLNF  132

Query  240  PTEKVQE  260
            P ++V++
Sbjct  133  PIKRVKD  139



>ref|XP_009373990.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Pyrus 
x bretschneideri]
Length=249

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVR+RPWG++AAEIRDSTRNG RVWLGTFDTAE AALAYDQAALSMRG SA LNFP +
Sbjct  109  YRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAALSMRGSSAVLNFPAD  168

Query  249  KVQE  260
             V +
Sbjct  169  VVHQ  172



>ref|XP_006379895.1| hypothetical protein POPTR_0008s16610g [Populus trichocarpa]
 gb|ERP57692.1| hypothetical protein POPTR_0008s16610g [Populus trichocarpa]
Length=258

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 62/74 (84%), Gaps = 3/74 (4%)
 Frame = +3

Query  39   DDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRG  218
            D NK   EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG
Sbjct  118  DPNK---EKSYRGVRRRPWGKFAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQAAFSMRG  174

Query  219  KSAFLNFPTEKVQE  260
              A LNFP E+V+E
Sbjct  175  TGATLNFPVERVRE  188



>ref|XP_007050311.1| Ethylene response factor 1, putative [Theobroma cacao]
 gb|EOX94468.1| Ethylene response factor 1, putative [Theobroma cacao]
Length=235

 Score = 89.7 bits (221),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVRKRPWG+YAAEIRDSTR+G RVWLGTFD+AE AALAYDQAALS +G  A LNF
Sbjct  101  EKSYRGVRKRPWGKYAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAALSTQGPKAVLNF  160

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  161  PVERVRE  167



>ref|XP_007223771.1| hypothetical protein PRUPE_ppa013137mg [Prunus persica]
 gb|EMJ24970.1| hypothetical protein PRUPE_ppa013137mg [Prunus persica]
Length=138

 Score = 87.8 bits (216),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E RYRGVRKRPWG+YAAEIRDS R+GARVWLGTF+TAEEAA AYDQAA +MRG  A LNF
Sbjct  15   EVRYRGVRKRPWGKYAAEIRDSNRHGARVWLGTFNTAEEAARAYDQAAYAMRGGLAILNF  74

Query  240  PTE  248
            PTE
Sbjct  75   PTE  77



>ref|XP_011029834.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Populus 
euphratica]
Length=220

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 62/74 (84%), Gaps = 3/74 (4%)
 Frame = +3

Query  39   DDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRG  218
            D NK   EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG
Sbjct  80   DPNK---EKSYRGVRRRPWGKFAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQAAFSMRG  136

Query  219  KSAFLNFPTEKVQE  260
              A LNFP E+V+E
Sbjct  137  TGATLNFPVERVRE  150



>ref|XP_008364034.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Malus 
domestica]
Length=248

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVR+RPWG++AAEIRDSTRNG RVWLGTFDTAE AALAYDQAALSMRG SA LNFP +
Sbjct  108  YRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAALSMRGSSAVLNFPAD  167

Query  249  KVQE  260
             V +
Sbjct  168  VVHQ  171



>ref|XP_004134941.1| PREDICTED: pathogenesis-related genes transcriptional activator 
PTI5-like [Cucumis sativus]
Length=175

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  57   VEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLN  236
             +K YRGVR+RPWG+YAAEIRDSTR+GARVWLGTF TAEEAALAYD AA +MRG  A LN
Sbjct  64   AKKHYRGVRQRPWGKYAAEIRDSTRHGARVWLGTFATAEEAALAYDTAAFTMRGSKALLN  123

Query  237  FPTEKV  254
            FP E V
Sbjct  124  FPPEVV  129



>ref|XP_004155637.1| PREDICTED: pathogenesis-related genes transcriptional activator 
PTI5-like [Cucumis sativus]
 gb|KGN49274.1| hypothetical protein Csa_6G518290 [Cucumis sativus]
Length=177

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  57   VEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLN  236
             +K YRGVR+RPWG+YAAEIRDSTR+GARVWLGTF TAEEAALAYD AA +MRG  A LN
Sbjct  66   AKKHYRGVRQRPWGKYAAEIRDSTRHGARVWLGTFATAEEAALAYDTAAFTMRGSKALLN  125

Query  237  FPTEKV  254
            FP E V
Sbjct  126  FPPEVV  131



>gb|KHN44967.1| Ethylene-responsive transcription factor 1B [Glycine soja]
Length=216

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ Y GVRKRPWG+YAAEIRD+TRNG RVWLGTFDTAE AALAYDQAA SMRG +A LNF
Sbjct  73   ERSYTGVRKRPWGKYAAEIRDTTRNGTRVWLGTFDTAEAAALAYDQAAFSMRGHNAVLNF  132

Query  240  PTEKVQE  260
            P ++V++
Sbjct  133  PIKRVKD  139



>gb|EEC76584.1| hypothetical protein OsI_14431 [Oryza sativa Indica Group]
Length=221

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  48   KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSA  227
            +++ ++ +RGVRKRPWG++AAEIRDSTRNG RVWLGTFD+AEEAALAYDQAA +MRG +A
Sbjct  69   QVQQQQAFRGVRKRPWGKFAAEIRDSTRNGVRVWLGTFDSAEEAALAYDQAAFAMRGSAA  128

Query  228  FLNFPTEKV  254
             LNFP E+V
Sbjct  129  VLNFPMEQV  137



>ref|NP_001051973.1| Os03g0860100 [Oryza sativa Japonica Group]
 gb|ABG00021.1| AP2 domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13887.1| Os03g0860100 [Oryza sativa Japonica Group]
 dbj|BAG98712.1| unnamed protein product [Oryza sativa Japonica Group]
Length=225

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  48   KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSA  227
            +++ ++ +RGVRKRPWG++AAEIRDSTRNG RVWLGTFD+AEEAALAYDQAA +MRG +A
Sbjct  73   QVQQQQAFRGVRKRPWGKFAAEIRDSTRNGVRVWLGTFDSAEEAALAYDQAAFAMRGSAA  132

Query  228  FLNFPTEKV  254
             LNFP E+V
Sbjct  133  VLNFPMEQV  141



>ref|XP_010660112.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Vitis 
vinifera]
Length=208

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFDTAE AALAYDQAA +MRG  A LNF
Sbjct  76   EVSYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAAFAMRGSLAVLNF  135

Query  240  PTEKVQE  260
            P + V E
Sbjct  136  PADMVYE  142



>ref|XP_004497839.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Cicer 
arietinum]
Length=213

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SM+G +A LNFP
Sbjct  73   KSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMKGSAATLNFP  132

Query  243  TEKVQE  260
             EKV+E
Sbjct  133  VEKVKE  138



>gb|KCW74464.1| hypothetical protein EUGRSUZ_E03167 [Eucalyptus grandis]
Length=250

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  15   SSAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalayd  194
             S  E +S   K  + + YRGVR+RPWG+YAAEIRDS+R GARVWLGTFDTAEEAALAYD
Sbjct  90   CSEAEVTSPAAKAVIARHYRGVRRRPWGKYAAEIRDSSRKGARVWLGTFDTAEEAALAYD  149

Query  195  qaalSMRGKSAFLNFPTEKV  254
            +AAL +RG  A+LNFP E+V
Sbjct  150  KAALRIRGPKAYLNFPIEQV  169



>ref|XP_009777388.1| PREDICTED: ethylene-responsive transcription factor 15-like [Nicotiana 
sylvestris]
Length=195

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK Y GVR RPWG+YAAEIRDSTRNG RVWLGTF++AEEAA+AYDQ ALSMRG S  LNF
Sbjct  54   EKHYIGVRTRPWGKYAAEIRDSTRNGIRVWLGTFNSAEEAAMAYDQVALSMRGPSTCLNF  113

Query  240  PTEKV  254
            P E+V
Sbjct  114  PVERV  118



>gb|ADY38793.1| ethylene-responsive transcription factor [Coffea arabica]
Length=234

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVR+RPWG+YAAEIRDSTRNG RVW+GTFDTAEEAAL YDQAA ++RG +A LNFP E
Sbjct  91   YRGVRRRPWGKYAAEIRDSTRNGVRVWIGTFDTAEEAALVYDQAAFALRGHAAVLNFPVE  150

Query  249  KVQE  260
             V E
Sbjct  151  VVYE  154



>ref|XP_009378995.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Pyrus 
x bretschneideri]
Length=229

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  51   LRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAF  230
            L+ EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG +A 
Sbjct  84   LKKEKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGSAAV  143

Query  231  LNFPTEKVQE  260
            LNFP E+V++
Sbjct  144  LNFPVERVRK  153



>ref|XP_009777387.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
sylvestris]
Length=230

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   RYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPT  245
             Y GVRKRPWG+YAAEIRDSTRNG RVWLGTFDTAEEAALAYDQAALSMRG  + LNFP 
Sbjct  102  HYIGVRKRPWGKYAAEIRDSTRNGIRVWLGTFDTAEEAALAYDQAALSMRGPWSLLNFPL  161

Query  246  EKVQ  257
            EKV+
Sbjct  162  EKVK  165



>ref|XP_007200770.1| hypothetical protein PRUPE_ppa023839mg [Prunus persica]
 gb|EMJ01969.1| hypothetical protein PRUPE_ppa023839mg [Prunus persica]
Length=250

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  42   DNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGK  221
            + K   EK YRGVR+RPWG+YAAEIRDSTR+G RVWLGTFD+AE AALAYDQAA ++RG 
Sbjct  103  EEKPTTEKSYRGVRRRPWGKYAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFALRGS  162

Query  222  SAFLNFPTEKVQE  260
             A LNFP + VQE
Sbjct  163  LAVLNFPAQVVQE  175



>ref|XP_009609579.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
tomentosiformis]
 gb|AAU81956.1| ERF transcription factor 5 [Nicotiana tabacum]
Length=234

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   RYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPT  245
             Y GVRKRPWG+YAAEIRDSTRNG RVWLGTFDTAEEAALAYDQAALSMRG  + LNFP 
Sbjct  99   HYIGVRKRPWGKYAAEIRDSTRNGIRVWLGTFDTAEEAALAYDQAALSMRGPWSLLNFPL  158

Query  246  EKVQ  257
            EKV+
Sbjct  159  EKVK  162



>ref|XP_006360378.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Solanum 
tuberosum]
Length=225

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            +K Y GVRKRPWG+YA+EIRDSTRNG RVWLGTFDTAEEAALAYDQAALSMRG  + LNF
Sbjct  95   QKHYIGVRKRPWGKYASEIRDSTRNGVRVWLGTFDTAEEAALAYDQAALSMRGPWSLLNF  154

Query  240  PTEKVQ  257
            P E V+
Sbjct  155  PIEDVK  160



>gb|KCW74023.1| hypothetical protein EUGRSUZ_E02652 [Eucalyptus grandis]
Length=250

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  15   SSAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalayd  194
             S  E +S   K  V + YRGVR+RPWG+YAAEIRDS+R GARVWLGTFDTAEEAALAYD
Sbjct  90   CSEAEVTSRGAKAVVARHYRGVRRRPWGKYAAEIRDSSRKGARVWLGTFDTAEEAALAYD  149

Query  195  qaalSMRGKSAFLNFPTEKV  254
            +AAL +RG  A+LNFP E+V
Sbjct  150  KAALRIRGPKAYLNFPIEQV  169



>ref|XP_007050316.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOX94473.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=146

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 5/77 (6%)
 Frame = +3

Query  39   DDNKLRVEK-----RYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaa  203
            + N+ +VE+     RYRGVR+RPWG+YAAEIRDSTR+GAR+WLGTF+TAEEAA AYD+AA
Sbjct  2    EQNRKKVEEGESSVRYRGVRRRPWGKYAAEIRDSTRHGARLWLGTFETAEEAARAYDRAA  61

Query  204  lSMRGKSAFLNFPTEKV  254
             SMRG  A LNFP E +
Sbjct  62   FSMRGPLAILNFPDEHI  78



>dbj|BAN45686.1| ethylene response factor [Nicotiana umbratica]
Length=238

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   RYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPT  245
             Y GVRKRPWG+YAAEIRDSTRNG RVWLGTFDTAEEAALAYDQAALSMRG  + LNFP 
Sbjct  110  HYIGVRKRPWGKYAAEIRDSTRNGIRVWLGTFDTAEEAALAYDQAALSMRGPWSLLNFPL  169

Query  246  EKVQ  257
            EKV+
Sbjct  170  EKVK  173



>ref|XP_010058963.1| PREDICTED: ethylene-responsive transcription factor ERF091-like 
[Eucalyptus grandis]
Length=355

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  15   SSAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalayd  194
             S  E +S   K  V + YRGVR+RPWG+YAAEIRDS+R GARVWLGTFDTAEEAALAYD
Sbjct  90   CSEAEVTSRGAKAVVARHYRGVRRRPWGKYAAEIRDSSRKGARVWLGTFDTAEEAALAYD  149

Query  195  qaalSMRGKSAFLNFPTEKV  254
            +AAL +RG  A+LNFP E+V
Sbjct  150  KAALRIRGPKAYLNFPIEQV  169



>gb|AFG46740.1| hypothetical protein 0_3648_01, partial [Pinus taeda]
Length=137

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +3

Query  48   KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSA  227
            K+  EKRYRGVRKRPWG+YAAEIRDS R+G RVWLGTF+T E+AA+AYDQAA +MRG +A
Sbjct  73   KVSGEKRYRGVRKRPWGKYAAEIRDSARHGVRVWLGTFETGEDAAMAYDQAAFAMRGSNA  132

Query  228  FLNFP  242
             LNFP
Sbjct  133  ILNFP  137



>ref|XP_011030512.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Populus 
euphratica]
Length=221

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG    LNF
Sbjct  84   ERSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDSAEAAALAYDQAAFSMRGPGTILNF  143

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  144  PVERVRE  150



>ref|XP_004959050.1| PREDICTED: ethylene-responsive transcription factor 1-like [Setaria 
italica]
Length=303

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  75   GVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTEKV  254
            GVRKRPWG+YAAEIRDSTRNG RVW+GTFDT E AAL+YDQAA SMRG +A LNFP E V
Sbjct  158  GVRKRPWGKYAAEIRDSTRNGERVWIGTFDTPEAAALSYDQAAYSMRGDAAVLNFPVEHV  217

Query  255  QE  260
            QE
Sbjct  218  QE  219



>ref|XP_011077236.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Sesamum 
indicum]
Length=192

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVR+RPWG+YAAEIRDSTRN  RVWLGTFDTAEEAALAYDQAA +MRG +A LNF
Sbjct  52   EVMYRGVRRRPWGKYAAEIRDSTRNSVRVWLGTFDTAEEAALAYDQAAFAMRGTAAVLNF  111

Query  240  PTEKVQE  260
            P E V E
Sbjct  112  PVEVVWE  118



>ref|XP_008235690.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Prunus 
mume]
Length=253

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  42   DNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGK  221
            + K   EK YRGVR+RPWG+YAAEIRDSTR+G RVWLGTFD+AE AALAYDQAA ++RG 
Sbjct  106  EEKPTTEKSYRGVRRRPWGKYAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFALRGS  165

Query  222  SAFLNFPTEKVQE  260
             A LNFP + VQE
Sbjct  166  LAVLNFPPQVVQE  178



>ref|XP_006351652.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Solanum 
tuberosum]
Length=197

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVRKRPWG++AAEIRDSTRNG RVWLGTFD AEEAALAYDQAA +MRG  A LNFP E
Sbjct  70   YRGVRKRPWGKFAAEIRDSTRNGVRVWLGTFDNAEEAALAYDQAAFAMRGSMAILNFPVE  129

Query  249  KVQE  260
             V+E
Sbjct  130  IVKE  133



>ref|XP_010102245.1| Ethylene-responsive transcription factor 1B [Morus notabilis]
 gb|EXB93188.1| Ethylene-responsive transcription factor 1B [Morus notabilis]
Length=289

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFDTAEEAALAYDQAA  MRG  A LNFP E
Sbjct  134  YRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDTAEEAALAYDQAAFLMRGSLAVLNFPAE  193

Query  249  KV  254
            KV
Sbjct  194  KV  195



>ref|XP_003593691.1| Ethylene responsive transcription factor 1b [Medicago truncatula]
 gb|AES63942.1| ethylene response factor [Medicago truncatula]
Length=276

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  48   KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSA  227
            K RVEK YRGVR+RPWG+YAAEIRDS++ G+RVWLGTFDTAE+AALAYD+AAL +RG  A
Sbjct  127  KKRVEKHYRGVRRRPWGKYAAEIRDSSKKGSRVWLGTFDTAEQAALAYDKAALRIRGSKA  186

Query  228  FLNFPTEKV  254
             LNFP E V
Sbjct  187  CLNFPIESV  195



>ref|XP_010671053.1| PREDICTED: ethylene-responsive transcription factor ERF096-like 
[Beta vulgaris subsp. vulgaris]
Length=129

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +3

Query  39   DDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRG  218
            DD  +  E +YRGVRKRPWG+YAAEIRDS R+GARVWLGTF+TAEEAA AYD+AA +MRG
Sbjct  3    DDKDVGGEVKYRGVRKRPWGKYAAEIRDSNRHGARVWLGTFNTAEEAARAYDRAAYNMRG  62

Query  219  KSAFLNFPTE  248
              A LNFP+E
Sbjct  63   HLAILNFPSE  72



>ref|XP_010039189.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Eucalyptus 
grandis]
Length=228

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFDTAE AALAYDQAA ++RG  A LNFP
Sbjct  92   KTYRGVRRRPWGKYAAEIRDSTRNGNRVWLGTFDTAEAAALAYDQAAFTLRGSLAVLNFP  151

Query  243  TEKVQE  260
             EKV++
Sbjct  152  LEKVRD  157



>gb|EPS59543.1| hypothetical protein M569_15262, partial [Genlisea aurea]
Length=147

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    LSRSSAMEFSSDDNKLRVEK-RYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaa  182
            L   + M+ SS  +  R EK RY GVRKRPWGRYA+EIRDSTRNG RVWLGTFDTAEEAA
Sbjct  1    LHYPNNMDSSSTTHSGRFEKTRYIGVRKRPWGRYASEIRDSTRNGIRVWLGTFDTAEEAA  60

Query  183  laydqaalSMRGKSAFLNFPTEKVQE  260
            LAYDQAA ++RG ++ LNFP ++V E
Sbjct  61   LAYDQAAFAIRGTASRLNFPLDRVVE  86



>ref|XP_010023969.1| PREDICTED: ethylene-responsive transcription factor 1B [Eucalyptus 
grandis]
 gb|KCW60373.1| hypothetical protein EUGRSUZ_H03088 [Eucalyptus grandis]
Length=229

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K YRGVRKRPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG +A LNFP
Sbjct  88   KSYRGVRKRPWGKFAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQAAYSMRGSAAVLNFP  147

Query  243  TEKVQE  260
             E V+E
Sbjct  148  AELVRE  153



>gb|KCW61533.1| hypothetical protein EUGRSUZ_H04254 [Eucalyptus grandis]
Length=214

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFDTAEEAALAYDQAA++MRG  A LNF
Sbjct  105  EASYRGVRRRPWGKYAAEIRDSTRNGVRVWLGTFDTAEEAALAYDQAAIAMRGPLAVLNF  164

Query  240  PTEK  251
            P E+
Sbjct  165  PPER  168



>emb|CDO99222.1| unnamed protein product [Coffea canephora]
Length=277

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG++A LNFP +
Sbjct  152  YRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDSAEAAALAYDQAAFSMRGQAAILNFPVD  211

Query  249  KVQE  260
            +V+E
Sbjct  212  RVRE  215



>ref|XP_007147223.1| hypothetical protein PHAVU_006G106100g [Phaseolus vulgaris]
 gb|ESW19217.1| hypothetical protein PHAVU_006G106100g [Phaseolus vulgaris]
Length=203

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFDTAE AALAYDQAA +MRG  A LNFP E
Sbjct  62   YRGVRRRPWGKYAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAAFAMRGSKAVLNFPAE  121

Query  249  KV  254
             V
Sbjct  122  IV  123



>ref|XP_003556353.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Glycine 
max]
Length=214

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +3

Query  33   SSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSM  212
            S +    R +K YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SM
Sbjct  62   SEESEAARKKKSYRGVRRRPWGKFAAEIRDSTRHGMRVWLGTFDSAEAAALAYDQAAFSM  121

Query  213  RGKSAFLNFPTEKVQE  260
            RG +A LNFP E V+E
Sbjct  122  RGSAAILNFPVEIVRE  137



>emb|CDP03737.1| unnamed protein product [Coffea canephora]
Length=274

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG+YAAEIRDSTR G RVWLGTFD+AE AALAYDQAA  MRG  A LNF
Sbjct  131  EKSYRGVRRRPWGKYAAEIRDSTRKGIRVWLGTFDSAEAAALAYDQAAFCMRGPMAVLNF  190

Query  240  PTEKVQE  260
            P + VQE
Sbjct  191  PVDVVQE  197



>ref|XP_009391058.1| PREDICTED: ethylene-responsive transcription factor 14-like [Musa 
acuminata subsp. malaccensis]
Length=121

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            + RYRGVR+RPWG+YAAEIRDST++GARVWLGTFDTAEEAA AYD+AALSMRG  A LNF
Sbjct  16   QTRYRGVRRRPWGKYAAEIRDSTQHGARVWLGTFDTAEEAARAYDRAALSMRGSLAVLNF  75

Query  240  PTE  248
            P +
Sbjct  76   PAD  78



>ref|XP_009119086.1| PREDICTED: ethylene-responsive transcription factor ERF094 [Brassica 
rapa]
Length=236

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  45   NKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKS  224
            NK   E+ YRGVRKRPWG+YAAEIRDS+R G RVWLGTFDTAEEAALAYDQAA +++G  
Sbjct  71   NKQEEERSYRGVRKRPWGKYAAEIRDSSRKGIRVWLGTFDTAEEAALAYDQAAFALKGHL  130

Query  225  AFLNFPTEKVQE  260
            A LNFP E V+E
Sbjct  131  AVLNFPVEVVKE  142



>ref|XP_006827480.1| hypothetical protein AMTR_s00009p00143340 [Amborella trichopoda]
 gb|ERM94896.1| hypothetical protein AMTR_s00009p00143340 [Amborella trichopoda]
Length=270

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG+YAAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG  A LNF
Sbjct  131  EKCYRGVRRRPWGKYAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGAMAILNF  190

Query  240  PTEKVQE  260
            P E+V++
Sbjct  191  PVERVRD  197



>ref|XP_007025492.1| Ethylene responsive element binding factor 1 [Theobroma cacao]
 gb|EOY28114.1| Ethylene responsive element binding factor 1 [Theobroma cacao]
Length=184

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  57   VEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLN  236
             +K YRGVR+RPWG+YAAEIRDSTRNGARVWLGTF TAEEAALAYD+AA  MRG  A LN
Sbjct  77   AKKHYRGVRRRPWGKYAAEIRDSTRNGARVWLGTFVTAEEAALAYDRAAFRMRGAKALLN  136

Query  237  FPTEKV  254
            FP E V
Sbjct  137  FPAEVV  142



>ref|XP_003535804.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Glycine 
max]
Length=167

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 65/85 (76%), Gaps = 3/85 (4%)
 Frame = +3

Query  15   SSAMEFSSDDNKLRVEKR---YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaal  185
            +S  E     N+ +V K+   +RGVR+RPWG++AAEIRDSTR+G RVWLGTFD AE AAL
Sbjct  26   TSCQEKKVTINQEQVNKKRSSFRGVRRRPWGKFAAEIRDSTRHGVRVWLGTFDNAEAAAL  85

Query  186  aydqaalSMRGKSAFLNFPTEKVQE  260
            AYDQAA SMRG  A LNFP EKV+E
Sbjct  86   AYDQAAFSMRGSGAVLNFPVEKVKE  110



>gb|EAZ29383.1| hypothetical protein OsJ_13455 [Oryza sativa Japonica Group]
Length=163

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            +RGVRKRPWG++AAEIRDSTRNG RVWLGTFD+AEEAALAYDQAA +MRG +A LNFP E
Sbjct  18   FRGVRKRPWGKFAAEIRDSTRNGVRVWLGTFDSAEEAALAYDQAAFAMRGSAAVLNFPME  77

Query  249  KV  254
            +V
Sbjct  78   QV  79



>ref|XP_004296361.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Fragaria 
vesca subsp. vesca]
Length=269

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            +K YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA +MRG +A LNF
Sbjct  122  DKSYRGVRRRPWGKFAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQAAFAMRGSAAVLNF  181

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  182  PVERVRE  188



>ref|XP_009802785.1| PREDICTED: ethylene-responsive transcription factor ERF098-like 
[Nicotiana sylvestris]
Length=165

 Score = 87.4 bits (215),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  33   SSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSM  212
            S++D + R E +YRG+R+RPWG+YAAEIRD TRNGAR+WLGT++TAEEAA AYD+AA S+
Sbjct  3    SNEDQRGRRENKYRGIRRRPWGKYAAEIRDPTRNGARLWLGTYETAEEAARAYDRAAFSL  62

Query  213  RGKSAFLNFPTE  248
            RG  A LNFP +
Sbjct  63   RGHQAILNFPND  74



>ref|NP_001170395.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|ACN36877.1| unknown [Zea mays]
 tpg|DAA52603.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
 gb|AIB04579.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=285

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVRKRPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA +MRG++A LNFP E
Sbjct  127  YRGVRKRPWGKFAAEIRDSTRNGVRVWLGTFDSAEAAALAYDQAAFAMRGEAAVLNFPVE  186

Query  249  KVQE  260
            +V++
Sbjct  187  RVRQ  190



>ref|XP_009398626.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Musa 
acuminata subsp. malaccensis]
Length=234

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTR G RVWLGTFD+AE AALAYDQAA SMRG +A LNF
Sbjct  98   EKPYRGVRRRPWGKFAAEIRDSTRRGIRVWLGTFDSAEAAALAYDQAAFSMRGTTAVLNF  157

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  158  PVERVRE  164



>gb|AFG46732.1| hypothetical protein 0_3648_01, partial [Pinus taeda]
 gb|AFG46733.1| hypothetical protein 0_3648_01, partial [Pinus taeda]
 gb|AFG46734.1| hypothetical protein 0_3648_01, partial [Pinus taeda]
 gb|AFG46735.1| hypothetical protein 0_3648_01, partial [Pinus taeda]
 gb|AFG46736.1| hypothetical protein 0_3648_01, partial [Pinus taeda]
 gb|AFG46737.1| hypothetical protein 0_3648_01, partial [Pinus taeda]
 gb|AFG46738.1| hypothetical protein 0_3648_01, partial [Pinus taeda]
 gb|AFG46739.1| hypothetical protein 0_3648_01, partial [Pinus taeda]
 gb|AFG46741.1| hypothetical protein 0_3648_01, partial [Pinus taeda]
Length=137

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EKRYRGVRKRPWG+YAAEIRDS R+G RVWLGTF+T E+AA+AYDQAA +MRG +A LNF
Sbjct  77   EKRYRGVRKRPWGKYAAEIRDSARHGVRVWLGTFETGEDAAMAYDQAAFAMRGSNAILNF  136

Query  240  P  242
            P
Sbjct  137  P  137



>ref|XP_007025491.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
 gb|EOY28113.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
Length=281

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 62/74 (84%), Gaps = 4/74 (5%)
 Frame = +3

Query  45   NKLRVEK----RYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSM  212
            N +RVEK     YRGVR+RPWG+YAAEIRDS+R GARVWLGTFDTAEEAALAYD+AAL +
Sbjct  111  NSVRVEKVATRHYRGVRRRPWGKYAAEIRDSSRKGARVWLGTFDTAEEAALAYDKAALRI  170

Query  213  RGKSAFLNFPTEKV  254
            RG  A+LNFP E V
Sbjct  171  RGPKAYLNFPLETV  184



>ref|XP_008806912.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor 1B-like [Phoenix dactylifera]
Length=227

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ YRGVRKRPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG  A LNF
Sbjct  93   ERSYRGVRKRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGSMAVLNF  152

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  153  PVERVRE  159



>gb|AHA93904.1| ethylene response factor 13 [Coffea arabica]
 gb|AHB33882.1| ERF transcription factor 11 [Coffea arabica]
 gb|AHB33883.1| ERF transcription factor 12 [Coffea arabica]
 emb|CDO96720.1| unnamed protein product [Coffea canephora]
Length=193

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K YRGVR+RPWG+YAAEIRDSTRNG RVWLGTF TAEEAALAYD+AA  MRG  A LNFP
Sbjct  59   KHYRGVRRRPWGKYAAEIRDSTRNGTRVWLGTFQTAEEAALAYDRAAFRMRGAKALLNFP  118

Query  243  TEKV  254
            +E V
Sbjct  119  SEIV  122



>ref|XP_010059232.1| PREDICTED: uncharacterized protein LOC104447159 [Eucalyptus grandis]
Length=452

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +3

Query  15   SSAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalayd  194
             S  E +S   K  + + YRGVR+RPWG+YAAEIRDS+R GARVWLGTFDTAEEAALAYD
Sbjct  90   CSEAEVTSPAAKAVIARHYRGVRRRPWGKYAAEIRDSSRKGARVWLGTFDTAEEAALAYD  149

Query  195  qaalSMRGKSAFLNFPTEKVQE  260
            +AAL +RG  A+LNFP E+V +
Sbjct  150  KAALRIRGPKAYLNFPIEQVVQ  171



>emb|CBJ55931.1| ethylene response factor 1 [Bupleurum kaoi]
Length=210

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD AE AA+AYDQAA SM+G  A LNF
Sbjct  76   EKAYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDDAETAAMAYDQAAFSMKGPLATLNF  135

Query  240  PTEKVQE  260
            P ++V+E
Sbjct  136  PVDRVKE  142



>ref|XP_008349063.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Malus 
domestica]
Length=252

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG+YAAEIRDSTR+G RVWLGTFD+AE AALAYDQAA ++RG  A LNF
Sbjct  103  EKAYRGVRRRPWGKYAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFALRGSLAVLNF  162

Query  240  PTEKVQE  260
            P + VQE
Sbjct  163  PAQVVQE  169



>ref|XP_011085905.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Sesamum 
indicum]
Length=146

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            KRY GVRKRPWG+YAAEIRDSTRNG RVWLGTF+T EEAALAYDQAA + RG S  LNFP
Sbjct  24   KRYIGVRKRPWGKYAAEIRDSTRNGKRVWLGTFNTEEEAALAYDQAAFATRGPSIPLNFP  83

Query  243  TEKVQE  260
             E+V E
Sbjct  84   VERVVE  89



>ref|XP_002306842.1| hypothetical protein POPTR_0005s24460g [Populus trichocarpa]
 gb|EEE93838.1| hypothetical protein POPTR_0005s24460g [Populus trichocarpa]
Length=228

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG  A LNFP E
Sbjct  94   YRGVRRRPWGKYAAEIRDSTRNGIRVWLGTFDSAEAAALAYDQAAFSMRGSMAVLNFPVE  153

Query  249  KVQE  260
             V+E
Sbjct  154  MVRE  157



>ref|XP_010024972.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Eucalyptus 
grandis]
Length=246

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFDTAEEAALAYDQAA++MRG  A LNF
Sbjct  105  EASYRGVRRRPWGKYAAEIRDSTRNGVRVWLGTFDTAEEAALAYDQAAIAMRGPLAVLNF  164

Query  240  PTE  248
            P E
Sbjct  165  PPE  167



>ref|XP_011085907.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Sesamum 
indicum]
Length=291

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 65/88 (74%), Gaps = 5/88 (6%)
 Frame = +3

Query  12   RSSAMEFSSDDN-----KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaee  176
            ++SA+E +   N       R EKRY GVR+RPWG+YAAEIRDSTRNG RVWLGTFDT EE
Sbjct  9    QTSAVEVAESSNLRNGQDPRREKRYIGVRRRPWGKYAAEIRDSTRNGKRVWLGTFDTEEE  68

Query  177  aalaydqaalSMRGKSAFLNFPTEKVQE  260
            AALAYDQAA + RG    LNFP EKV E
Sbjct  69   AALAYDQAAFATRGPLVSLNFPLEKVAE  96



>ref|XP_010557112.1| PREDICTED: ethylene-responsive transcription factor 15-like [Tarenaya 
hassleriana]
Length=235

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG+YAAEIRDSTRNG RVWLGTFD+AEEAALAYDQAA +++G  A LNF
Sbjct  88   EKSYRGVRRRPWGKYAAEIRDSTRNGIRVWLGTFDSAEEAALAYDQAAFALKGVLAVLNF  147

Query  240  PTEKVQE  260
            P E V+E
Sbjct  148  PVETVRE  154



>ref|XP_010111930.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|EXC32021.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=407

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  57   VEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLN  236
            V K YRGVR+RPWG+YAAEIRDS+RNGARVWLGTFDTAEEAALAYD+AAL +RG  A+LN
Sbjct  120  VTKHYRGVRRRPWGKYAAEIRDSSRNGARVWLGTFDTAEEAALAYDKAALRIRGPKAYLN  179

Query  237  FPTEKV  254
            FP E V
Sbjct  180  FPLETV  185



>gb|AGE97366.1| ethylene response factor 11 [Tamarix hispida]
Length=231

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ YRGVR+RPWG+YAAEIRDSTR+G RVWLGTFD AE AALAYDQAA +MRG  A LNF
Sbjct  100  ERSYRGVRRRPWGKYAAEIRDSTRHGIRVWLGTFDDAEAAALAYDQAAFAMRGPMAVLNF  159

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  160  PAERVKE  166



>ref|NP_001233987.1| pathogenesis-related genes transcriptional activator PTI5 [Solanum 
lycopersicum]
 sp|O04681.1|PTI5_SOLLC RecName: Full=Pathogenesis-related genes transcriptional activator 
PTI5; AltName: Full=PTO-interacting protein 5 [Solanum 
lycopersicum]
 gb|AAC49740.1| Pti5 [Solanum lycopersicum]
Length=161

 Score = 87.0 bits (214),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  57   VEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLN  236
            + K+YRGVR+RPWG+YAAEIRDS R+GARVWLGTF+TAEEAALAYD+AA  MRG  A LN
Sbjct  55   IGKKYRGVRRRPWGKYAAEIRDSARHGARVWLGTFETAEEAALAYDRAAFRMRGAKALLN  114

Query  237  FPTEKVQ  257
            FP+E V 
Sbjct  115  FPSEIVN  121



>ref|XP_008438534.1| PREDICTED: ethylene-responsive transcription factor 1B [Cucumis 
melo]
Length=228

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG +A LNF
Sbjct  83   ERAYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGAAAILNF  142

Query  240  PTEKVQE  260
            P ++V+E
Sbjct  143  PVDRVRE  149



>gb|KHN02512.1| Ethylene-responsive transcription factor 1B [Glycine soja]
Length=149

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            +K Y GVR+RPWGR+AAEIRD+TR G RVWLGTFD+AEEAALAYDQAA SMRG SA LNF
Sbjct  5    KKSYIGVRRRPWGRFAAEIRDTTRKGIRVWLGTFDSAEEAALAYDQAAFSMRGSSAVLNF  64

Query  240  PTEKVQE  260
            P ++V+E
Sbjct  65   PVKRVKE  71



>ref|XP_009610278.1| PREDICTED: ethylene-responsive transcription factor ERF098-like 
[Nicotiana tomentosiformis]
Length=165

 Score = 87.0 bits (214),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  33   SSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSM  212
            S++D + R E +YRG+R+RPWG+YAAEIRD TRNG+R+WLGTF+TAEEAA AYD+AA S+
Sbjct  3    SNEDQRGRRENKYRGIRRRPWGKYAAEIRDPTRNGSRLWLGTFETAEEAARAYDRAAFSL  62

Query  213  RGKSAFLNFPTE  248
            RG  A LNFP +
Sbjct  63   RGHQAILNFPND  74



>ref|XP_009590609.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
tomentosiformis]
Length=227

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA S RG  A LNF
Sbjct  72   ERTYRGVRRRPWGKFAAEIRDSTRNGLRVWLGTFDSAEAAALAYDQAAFSTRGSGAILNF  131

Query  240  PTEKVQE  260
            P E+V E
Sbjct  132  PVERVME  138



>gb|ABZ89186.1| putative protein [Coffea canephora]
 emb|CDO99976.1| unnamed protein product [Coffea canephora]
Length=234

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVR+RPWG+YAAEIRDSTRNG RVW+GTFD+AEEAAL YDQAA ++RG +A LNFP E
Sbjct  91   YRGVRRRPWGKYAAEIRDSTRNGVRVWIGTFDSAEEAALVYDQAAFALRGHAAVLNFPVE  150

Query  249  KVQE  260
             V E
Sbjct  151  VVYE  154



>ref|XP_004959051.1| PREDICTED: ethylene-responsive transcription factor 15-like [Setaria 
italica]
Length=300

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  75   GVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTEKV  254
            GVR+RPWG+YAAEIRDSTRNG RVW+GTFDT E AALAYDQAA SMRG +A LNFP E V
Sbjct  147  GVRRRPWGKYAAEIRDSTRNGERVWIGTFDTPEAAALAYDQAAYSMRGAAAVLNFPVEHV  206

Query  255  QE  260
            QE
Sbjct  207  QE  208



>ref|XP_002529292.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF33061.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=138

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 2/72 (3%)
 Frame = +3

Query  39   DDNKLRV--EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSM  212
            D++KL+V  E +YRGVR+RPWG++AAEIRDSTR GARVWLGTF+TAEEAA AYD+AA +M
Sbjct  2    DEDKLKVGGEVKYRGVRRRPWGKFAAEIRDSTRQGARVWLGTFNTAEEAARAYDRAAYTM  61

Query  213  RGKSAFLNFPTE  248
            RG  A LNFP E
Sbjct  62   RGHLAILNFPNE  73



>ref|XP_009609581.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
tomentosiformis]
Length=188

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            + EK Y GVR RPWG++AAEIRDSTRNG RVWLGTF++AEEAA+AYDQ ALSMRG S  L
Sbjct  51   KAEKHYIGVRTRPWGKFAAEIRDSTRNGIRVWLGTFNSAEEAAMAYDQVALSMRGPSTCL  110

Query  234  NFPTEKV  254
            NFP E+V
Sbjct  111  NFPVERV  117



>gb|ADZ55304.1| ethylene-responsive transcription factor [Coffea arabica]
Length=234

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVR+RPWG+YAAEIRDSTRNG RVW+GTFD+AEEAAL YDQAA ++RG +A LNFP E
Sbjct  91   YRGVRRRPWGKYAAEIRDSTRNGVRVWIGTFDSAEEAALVYDQAAFALRGHAAVLNFPVE  150

Query  249  KVQE  260
             V E
Sbjct  151  VVYE  154



>ref|XP_003519719.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Glycine 
max]
Length=203

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            +RGVR RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG +A LNFP E
Sbjct  63   FRGVRSRPWGKFAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQAAFSMRGSAAVLNFPVE  122

Query  249  KVQE  260
            KV+E
Sbjct  123  KVKE  126



>ref|XP_008224368.1| PREDICTED: ethylene-responsive transcription factor ERF095 [Prunus 
mume]
Length=138

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E RYRGVRKRPWG+YAAEIRDS R+GARVWLGTF+TAEEAA AYD+AA +MRG  A LNF
Sbjct  15   EVRYRGVRKRPWGKYAAEIRDSNRHGARVWLGTFNTAEEAARAYDRAAYAMRGGLAILNF  74

Query  240  PTE  248
            PTE
Sbjct  75   PTE  77



>ref|XP_003541350.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Glycine 
max]
Length=220

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ Y GVRKRPWG++AAEIRD+TRNGARVWLGTFD+AE AALAYDQAA +MRG +A LNF
Sbjct  75   ERSYIGVRKRPWGKFAAEIRDTTRNGARVWLGTFDSAEAAALAYDQAAFTMRGDNAVLNF  134

Query  240  PTEKVQE  260
            P + V+E
Sbjct  135  PVKTVKE  141



>ref|XP_006443850.1| hypothetical protein CICLE_v10021622mg [Citrus clementina]
 ref|XP_006479550.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Citrus 
sinensis]
 gb|ESR57090.1| hypothetical protein CICLE_v10021622mg [Citrus clementina]
Length=274

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSA  227
            K   +K YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG  A
Sbjct  111  KTSSDKSYRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDSAEAAALAYDQAAFSMRGSLA  170

Query  228  FLNFPTEKVQE  260
             LNFP + V+E
Sbjct  171  TLNFPADMVRE  181



>ref|XP_007144090.1| hypothetical protein PHAVU_007G127800g [Phaseolus vulgaris]
 gb|ESW16084.1| hypothetical protein PHAVU_007G127800g [Phaseolus vulgaris]
Length=209

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG +A LNF
Sbjct  72   EKSYRGVRRRPWGKFAAEIRDSTRHGMRVWLGTFDSAEAAALAYDQAAFSMRGSAAILNF  131

Query  240  PTEKVQE  260
            P + V+E
Sbjct  132  PVDIVRE  138



>gb|AID61741.1| pathogenesis-related gene transcriptional activator [Capsicum 
annuum]
Length=180

 Score = 87.0 bits (214),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  57   VEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLN  236
            + K+YRGVR+RPWG+YAAEIRDS R+GARVWLGTF+TAEEAALAYD+AA  MRG  A LN
Sbjct  56   IGKKYRGVRRRPWGKYAAEIRDSARHGARVWLGTFETAEEAALAYDRAAFRMRGAKALLN  115

Query  237  FPTEKV  254
            FP+E V
Sbjct  116  FPSEIV  121



>ref|XP_004134068.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Cucumis 
sativus]
 ref|XP_004169139.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Cucumis 
sativus]
 gb|KGN56864.1| Ethylene-responsive transcription factor 1B [Cucumis sativus]
Length=228

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG +A LNF
Sbjct  83   ERAYRGVRRRPWGKFAAEIRDSTRHGTRVWLGTFDSAEAAALAYDQAAFSMRGAAAILNF  142

Query  240  PTEKVQE  260
            P ++V+E
Sbjct  143  PVDRVRE  149



>gb|EYU18348.1| hypothetical protein MIMGU_mgv1a022864mg [Erythranthe guttata]
Length=249

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K +RGVR RPWG++AAEIRDSTRNG RVWLGTFDTAE AA+AYDQAA +MRG++A LN+P
Sbjct  106  KSFRGVRARPWGKFAAEIRDSTRNGVRVWLGTFDTAEAAAMAYDQAAFAMRGQAAVLNYP  165

Query  243  TEKVQE  260
             E+V+E
Sbjct  166  VERVRE  171



>ref|XP_006367196.1| PREDICTED: pathogenesis-related genes transcriptional activator 
PTI5-like [Solanum tuberosum]
Length=182

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 4/76 (5%)
 Frame = +3

Query  39   DDNKLR----VEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaal  206
            + N LR    + K+YRGVR+RPWG+YAAEIRDS R+GARVWLGTF+TAEEAALAYD+AA 
Sbjct  46   NTNNLRPSQCIGKKYRGVRRRPWGKYAAEIRDSARHGARVWLGTFETAEEAALAYDRAAF  105

Query  207  SMRGKSAFLNFPTEKV  254
             MRG  A LNFP+E V
Sbjct  106  RMRGAKALLNFPSEIV  121



>ref|XP_008391192.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Malus 
domestica]
 ref|XP_008351311.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Malus 
domestica]
Length=229

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG +A LNF
Sbjct  87   EKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGSAAVLNF  146

Query  240  PTEKVQE  260
            P E+V++
Sbjct  147  PVERVRK  153



>ref|XP_004250546.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Solanum 
lycopersicum]
Length=184

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  66   RYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPT  245
            ++ GVRKRPWG+YAAEIRDSTRNG RVWLGTFDTAEEAALAYDQAA   RG S  LNFP 
Sbjct  43   KFIGVRKRPWGKYAAEIRDSTRNGIRVWLGTFDTAEEAALAYDQAAFCTRGPSICLNFPV  102

Query  246  EKVQE  260
            EKV++
Sbjct  103  EKVRD  107



>ref|XP_008439787.1| PREDICTED: pathogenesis-related genes transcriptional activator 
PTI5-like [Cucumis melo]
Length=172

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  57   VEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLN  236
             +K YRGVR+RPWG+YAAEIRDSTR+GARVWLGTF TAEEAALAYD AA  MRG  A LN
Sbjct  61   AKKHYRGVRQRPWGKYAAEIRDSTRHGARVWLGTFATAEEAALAYDTAAFRMRGPKALLN  120

Query  237  FPTEKV  254
            FP E V
Sbjct  121  FPPEVV  126



>ref|XP_003553495.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Glycine 
max]
Length=253

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            +K YRGVRKRPWG++AAEIRDSTRNG RVW+GTFDTAE AALAYDQAA S RG  A LNF
Sbjct  115  QKMYRGVRKRPWGKFAAEIRDSTRNGVRVWIGTFDTAEAAALAYDQAAFSTRGSLAVLNF  174

Query  240  PTEKVQE  260
            P E V E
Sbjct  175  PEEVVSE  181



>ref|XP_010274789.1| PREDICTED: ethylene-responsive transcription factor ERF098-like 
[Nelumbo nucifera]
Length=155

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  54   RVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFL  233
            R E RYRGVRKRPWG++AAEIRDSTRNGAR+WLGTF TAEEAA AYD+AA ++RG SA L
Sbjct  15   RREVRYRGVRKRPWGKFAAEIRDSTRNGARLWLGTFTTAEEAARAYDRAAYAIRGPSAIL  74

Query  234  NFPTE  248
            NFPT+
Sbjct  75   NFPTQ  79



>ref|XP_007145844.1| hypothetical protein PHAVU_007G273000g [Phaseolus vulgaris]
 gb|ESW17838.1| hypothetical protein PHAVU_007G273000g [Phaseolus vulgaris]
Length=212

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K +RGVR+RPWG++AAEIRDSTR+G RVWLGTFD AE AALAYDQAA +MRG +A LNFP
Sbjct  68   KSFRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDNAEAAALAYDQAAFAMRGSAAVLNFP  127

Query  243  TEKVQE  260
             EKV+E
Sbjct  128  VEKVKE  133



>ref|XP_011028796.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Populus 
euphratica]
Length=239

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            +K YRGVR RPWG YAAEIRDSTRNGARVWLGTFDT E AALAYDQAALS++G  A LNF
Sbjct  106  KKTYRGVRNRPWGTYAAEIRDSTRNGARVWLGTFDTGEAAALAYDQAALSLQGSKAVLNF  165

Query  240  PTEKV  254
            P E+V
Sbjct  166  PIEQV  170



>gb|ADE41122.1| AP2 domain class transcription factor [Malus domestica]
Length=229

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG +A LNF
Sbjct  87   EKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGSAAVLNF  146

Query  240  PTEKVQE  260
            P E+V++
Sbjct  147  PVERVRK  153



>ref|XP_009396175.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Musa 
acuminata subsp. malaccensis]
Length=206

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVRKRPWG++AAEIRDSTR G RVWLGTFD AE AALAYDQAAL+MRG +A LNF
Sbjct  78   EKSYRGVRKRPWGKFAAEIRDSTRQGVRVWLGTFDDAEAAALAYDQAALAMRGTAAVLNF  137

Query  240  PTEKVQ  257
            P E+V+
Sbjct  138  PAERVR  143



>gb|EMT04957.1| Ethylene-responsive transcription factor 15 [Aegilops tauschii]
Length=292

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  75   GVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTEKV  254
            GVRKRPWG+YAAEIRDSTRNGARVWLGTFDT + AALAYDQAA S+RG +A LNFP + V
Sbjct  109  GVRKRPWGKYAAEIRDSTRNGARVWLGTFDTPQAAALAYDQAAFSVRGPAAVLNFPVKLV  168

Query  255  QE  260
            QE
Sbjct  169  QE  170



>gb|AHB33336.1| ERF [Citrus sinensis]
Length=271

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  48   KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSA  227
            K   +K YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG  A
Sbjct  108  KTSSDKSYRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDSAEAAALAYDQAAFSMRGSLA  167

Query  228  FLNFPTEKVQE  260
             LNFP + V+E
Sbjct  168  TLNFPADMVRE  178



>ref|XP_010918804.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Elaeis 
guineensis]
Length=228

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG  A LNF
Sbjct  94   ERSYRGVRRRPWGKFAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQAAFSMRGPMAVLNF  153

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  154  PVERVRE  160



>ref|XP_008349214.1| PREDICTED: ethylene-responsive transcription factor ERF091-like 
[Malus domestica]
Length=267

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +3

Query  48   KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSA  227
            K+ + K YRGVR+RPWG+YAAEIRDSTR GARVWLGTF+TAEEAALAYD+AAL +RG  A
Sbjct  126  KVEIAKHYRGVRRRPWGKYAAEIRDSTRKGARVWLGTFETAEEAALAYDKAALRIRGSKA  185

Query  228  FLNFPTEKV  254
             LNFP E V
Sbjct  186  HLNFPLETV  194



>gb|EMT29515.1| Ethylene-responsive transcription factor 1B [Aegilops tauschii]
Length=281

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  75   GVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTEKV  254
            GVRKRPWG+YAAEIRDSTRNGARVWLGTFDT + AALAYDQAA ++RG +A LNFP  +V
Sbjct  138  GVRKRPWGKYAAEIRDSTRNGARVWLGTFDTPQAAALAYDQAAFALRGPAAVLNFPVNRV  197

Query  255  QE  260
            QE
Sbjct  198  QE  199



>ref|XP_009776178.1| PREDICTED: pathogenesis-related genes transcriptional activator 
PTI5-like [Nicotiana sylvestris]
Length=184

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  57   VEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLN  236
            + K+YRGVR+RPWG+YAAEIRDS R+GARVWLGTF+TAEEAALAYD+AA  MRG  A LN
Sbjct  54   IGKKYRGVRRRPWGKYAAEIRDSARHGARVWLGTFETAEEAALAYDRAAFRMRGAKALLN  113

Query  237  FPTEKV  254
            FP+E V
Sbjct  114  FPSEVV  119



>ref|XP_009769380.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nicotiana 
sylvestris]
Length=232

 Score = 87.8 bits (216),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA S RG  A LNF
Sbjct  73   ERTYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFDSAEAAALAYDQAAFSTRGSGAILNF  132

Query  240  PTEKVQE  260
            P E+V E
Sbjct  133  PVERVVE  139



>gb|KDO68455.1| hypothetical protein CISIN_1g042174mg [Citrus sinensis]
Length=254

 Score = 87.8 bits (216),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AE AALAYDQAA SMRG  A LNFP
Sbjct  96   KSYRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDSAEAAALAYDQAAFSMRGSLATLNFP  155

Query  243  TEKVQE  260
             + V+E
Sbjct  156  ADMVRE  161



>gb|KFK31718.1| hypothetical protein AALP_AA6G149900 [Arabis alpina]
Length=133

 Score = 85.5 bits (210),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  66   RYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPT  245
            +YRGVR+RPWG+YAAEIRDS ++G RVWLGTFDTAEEAA AYDQAA SMRG+SA LNFP 
Sbjct  15   KYRGVRRRPWGKYAAEIRDSRKHGERVWLGTFDTAEEAARAYDQAAYSMRGQSAILNFPQ  74

Query  246  E  248
            E
Sbjct  75   E  75



>gb|KEH42539.1| ethylene-responsive transcription factor 1B [Medicago truncatula]
Length=225

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +3

Query  9    SRSSAMEFSSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaala  188
            S S A E   ++NK+  +    GVRKRPWG+YAAEIRD+TR G RVWLGTFD+AE+AALA
Sbjct  64   SSSEAKEVLQNNNKMNQKSSLIGVRKRPWGKYAAEIRDTTRGGKRVWLGTFDSAEDAALA  123

Query  189  ydqaalSMRGKSAFLNFPTEKVQE  260
            YDQAA SMRG +A LNF  ++V+E
Sbjct  124  YDQAAFSMRGNNAVLNFSVQRVKE  147



>ref|XP_002522517.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF39817.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=173

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +3

Query  48   KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSA  227
            K+  +K YRGVR+RPWG+YAAEIRDS R+GARVWLGTF+TAEEAALAYD+AA  MRG  A
Sbjct  53   KVIAKKHYRGVRRRPWGKYAAEIRDSARHGARVWLGTFETAEEAALAYDRAAFRMRGAKA  112

Query  228  FLNFPTEKV  254
             LNFP E V
Sbjct  113  LLNFPAEVV  121



>ref|XP_003553765.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Glycine 
max]
 gb|KHN43154.1| Ethylene-responsive transcription factor 1B [Glycine soja]
Length=197

 Score = 87.0 bits (214),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +3

Query  57   VEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLN  236
            V   YRGVR+RPWG++AAEIRDSTRNG RVWLGTFDTAE AALAYDQAAL MRG  A LN
Sbjct  63   VSVSYRGVRRRPWGKFAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAALVMRGSMAVLN  122

Query  237  FPTEKVQE  260
            FP E V++
Sbjct  123  FPAEIVRQ  130



>ref|XP_002459869.1| hypothetical protein SORBIDRAFT_02g012630 [Sorghum bicolor]
 gb|EER96390.1| hypothetical protein SORBIDRAFT_02g012630 [Sorghum bicolor]
Length=329

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 4/80 (5%)
 Frame = +3

Query  33   SSDDN----KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqa  200
            +SDDN    K + ++ + GVRKRPWG++AAEIRDSTR GARVWLGTFD+ E AA+AYDQA
Sbjct  158  TSDDNNKCSKKQQQQPFIGVRKRPWGKFAAEIRDSTRKGARVWLGTFDSPEAAAMAYDQA  217

Query  201  alSMRGKSAFLNFPTEKVQE  260
            A S+RG +A LNFP E+VQE
Sbjct  218  AFSVRGAAAVLNFPVERVQE  237



>ref|XP_009621762.1| PREDICTED: ethylene-responsive transcription factor ERF098-like 
[Nicotiana tomentosiformis]
Length=128

 Score = 85.5 bits (210),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  33   SSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSM  212
            S+D+ + R E RYRGVRKRPWG+YAAEIRD+ +NG RVWLGT+ TAEEAA AYD+AA  M
Sbjct  7    SNDNKESREEVRYRGVRKRPWGKYAAEIRDTNKNGVRVWLGTYATAEEAARAYDKAAFEM  66

Query  213  RGKSAFLNFPTE  248
            RG+ A LNFP E
Sbjct  67   RGRFAVLNFPHE  78



>ref|XP_006468209.1| PREDICTED: ethylene-responsive transcription factor ERF091-like 
[Citrus sinensis]
 gb|KDO77755.1| hypothetical protein CISIN_1g037347mg [Citrus sinensis]
Length=295

 Score = 87.8 bits (216),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 6/76 (8%)
 Frame = +3

Query  45   NKLRVEK------RYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaal  206
            N +RVEK       YRGVR+RPWG+YAAEIRDS+R GARVWLGTFDTAEEAALAYD+AAL
Sbjct  124  NAMRVEKVATPTRHYRGVRRRPWGKYAAEIRDSSRKGARVWLGTFDTAEEAALAYDKAAL  183

Query  207  SMRGKSAFLNFPTEKV  254
             +RG  A LNFP E+V
Sbjct  184  RIRGPKAHLNFPLEEV  199



>gb|KDP40318.1| hypothetical protein JCGZ_02316 [Jatropha curcas]
Length=219

 Score = 87.4 bits (215),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  45   NKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKS  224
            N  +  K +RGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG  
Sbjct  80   NTKKESKSFRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGAG  139

Query  225  AFLNFPTEKVQE  260
            A LNFP E+V+E
Sbjct  140  AVLNFPVERVKE  151



>ref|XP_008371436.1| PREDICTED: ethylene-responsive transcription factor ERF091 isoform 
X2 [Malus domestica]
Length=216

 Score = 87.0 bits (214),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +3

Query  48   KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSA  227
            K+ + K YRGVR+RPWG+YAAEIRDSTR GARVWLGTF+TAE+AALAYD+AAL +RG  A
Sbjct  72   KVEITKHYRGVRRRPWGKYAAEIRDSTRKGARVWLGTFETAEDAALAYDKAALRIRGSKA  131

Query  228  FLNFPTEKV  254
             LNFP E V
Sbjct  132  HLNFPLETV  140



>ref|XP_002461637.1| hypothetical protein SORBIDRAFT_02g005810 [Sorghum bicolor]
 gb|EER98158.1| hypothetical protein SORBIDRAFT_02g005810 [Sorghum bicolor]
Length=340

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  75   GVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTEKV  254
            GVRKRPWG++AAEIRDSTRNG RVW+GTFDT E AALAYDQAA SMRG +A LNFP E V
Sbjct  192  GVRKRPWGKFAAEIRDSTRNGERVWIGTFDTPEAAALAYDQAAYSMRGPAAVLNFPVEHV  251

Query  255  QE  260
            QE
Sbjct  252  QE  253



>emb|CBI35159.3| unnamed protein product [Vitis vinifera]
Length=184

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E  YRGVRKRPWG+YAAEIRDSTRNG RVWLGTFDTAE AALAYDQAA +MRG  A LNF
Sbjct  76   EVSYRGVRKRPWGKYAAEIRDSTRNGVRVWLGTFDTAEAAALAYDQAAFAMRGSLAVLNF  135

Query  240  PTE  248
            P +
Sbjct  136  PAD  138



>ref|XP_008653717.1| PREDICTED: ethylene-responsive transcription factor 15-like [Zea 
mays]
 tpg|DAA60352.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
 gb|AIB05193.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=262

 Score = 87.4 bits (215),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            + GVR+RPWGR+AAEIRDSTRNGARVWLGTFD+AE AA+AYDQAALS RG +A LNFP E
Sbjct  98   FIGVRRRPWGRFAAEIRDSTRNGARVWLGTFDSAEAAAMAYDQAALSARGSAAALNFPVE  157

Query  249  KVQE  260
            +VQE
Sbjct  158  RVQE  161



>ref|XP_008371435.1| PREDICTED: ethylene-responsive transcription factor ERF091 isoform 
X1 [Malus domestica]
Length=263

 Score = 87.4 bits (215),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +3

Query  48   KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSA  227
            K+ + K YRGVR+RPWG+YAAEIRDSTR GARVWLGTF+TAE+AALAYD+AAL +RG  A
Sbjct  119  KVEITKHYRGVRRRPWGKYAAEIRDSTRKGARVWLGTFETAEDAALAYDKAALRIRGSKA  178

Query  228  FLNFPTEKV  254
             LNFP E V
Sbjct  179  HLNFPLETV  187



>gb|AID51424.1| ethylene response factor 19 [Diospyros kaki]
Length=205

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            YRGVR+RPWG++AAEIRDSTRNG RVWLGTFD+AEEAA+AYDQAAL+MRG  A LNFP E
Sbjct  75   YRGVRRRPWGKFAAEIRDSTRNGMRVWLGTFDSAEEAAMAYDQAALAMRGTRAVLNFPAE  134

Query  249  KVQE  260
            +V E
Sbjct  135  RVVE  138



>ref|XP_008784708.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Phoenix 
dactylifera]
Length=227

 Score = 87.0 bits (214),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG  A LNF
Sbjct  93   EQSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGSMAVLNF  152

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  153  PVERVRE  159



>emb|CAN73126.1| hypothetical protein VITISV_004212 [Vitis vinifera]
Length=218

 Score = 87.0 bits (214),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDS R+G RVWLGTFDTAE+AALAYD+AA  MRG  A LNF
Sbjct  85   EKSYRGVRRRPWGKFAAEIRDSNRHGRRVWLGTFDTAEDAALAYDRAAYLMRGSMAILNF  144

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  145  PVERVKE  151



>ref|XP_009346221.1| PREDICTED: ethylene-responsive transcription factor ERF091-like 
[Pyrus x bretschneideri]
Length=263

 Score = 87.4 bits (215),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +3

Query  48   KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSA  227
            K+   K YRGVR+RPWG+YAAEIRDSTR GARVWLGTFDTAE+AALAYD+AAL +RG  A
Sbjct  119  KVEFTKHYRGVRRRPWGKYAAEIRDSTRKGARVWLGTFDTAEDAALAYDKAALRIRGSKA  178

Query  228  FLNFPTEKV  254
             LNFP E V
Sbjct  179  HLNFPLETV  187



>ref|XP_010262305.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Nelumbo 
nucifera]
Length=230

 Score = 87.0 bits (214),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG  A LNF
Sbjct  96   EKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGSMAVLNF  155

Query  240  PTEKVQE  260
            P E V++
Sbjct  156  PVEHVRQ  162



>ref|XP_007148087.1| hypothetical protein PHAVU_006G179700g [Phaseolus vulgaris]
 gb|ESW20081.1| hypothetical protein PHAVU_006G179700g [Phaseolus vulgaris]
Length=263

 Score = 87.4 bits (215),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 72/100 (72%), Gaps = 17/100 (17%)
 Frame = +3

Query  6    LSRSSAMEFSSDDN-------------KLRVEK----RYRGVRKRPWGRYAAEIRDSTRN  134
            L  +S  E+SS++N              +R+EK     YRGVR+RPWG+YAAEIRDS++ 
Sbjct  84   LPNTSNTEYSSNNNMESGGECDSKVEDAVRIEKEVTKHYRGVRRRPWGKYAAEIRDSSKK  143

Query  135  GARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTEKV  254
            GARVWLGTFDTAEEAALAYD+AAL +RG  A+LNFP E+V
Sbjct  144  GARVWLGTFDTAEEAALAYDKAALRIRGPKAYLNFPLERV  183



>ref|XP_010904582.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Elaeis 
guineensis]
Length=223

 Score = 87.0 bits (214),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            E+ YRGVR+RPWG++AAEIRDSTR+G RVWLGTFD+AE AALAYDQAA SMRG  A LNF
Sbjct  89   EQSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFSMRGSMAVLNF  148

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  149  PVERVRE  155



>emb|CDY23951.1| BnaC03g17400D [Brassica napus]
Length=233

 Score = 87.0 bits (214),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVRKRPWG++AAEIRDSTRNG RVWLGTFD AEEAALAYDQAA + +G  A LNF
Sbjct  72   EKSYRGVRKRPWGKFAAEIRDSTRNGIRVWLGTFDKAEEAALAYDQAAYATKGSLAVLNF  131

Query  240  PTEKVQE  260
            P E V+E
Sbjct  132  PVEVVKE  138



>ref|XP_002264611.1| PREDICTED: ethylene-responsive transcription factor 1B [Vitis 
vinifera]
Length=218

 Score = 87.0 bits (214),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG++AAEIRDS R+G RVWLGTFDT+E+AALAYD+AA  MRG  A LNF
Sbjct  85   EKSYRGVRRRPWGKFAAEIRDSNRHGRRVWLGTFDTSEDAALAYDRAAYLMRGSMAILNF  144

Query  240  PTEKVQE  260
            P E+V+E
Sbjct  145  PVERVKE  151



>ref|XP_009369492.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Pyrus 
x bretschneideri]
Length=251

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  60   EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNF  239
            EK YRGVR+RPWG+YAAEIRDSTR+G RVWLGTFD+AE AALAYDQAA ++RG  A LNF
Sbjct  103  EKAYRGVRRRPWGKYAAEIRDSTRHGIRVWLGTFDSAEAAALAYDQAAFALRGSLAVLNF  162

Query  240  PTEKVQE  260
            P + VQ+
Sbjct  163  PAQVVQD  169



>ref|NP_001130815.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|ACF79179.1| unknown [Zea mays]
 gb|AFU81613.1| AP2-EREBP-type transcription factor, partial [Zea mays subsp. 
mays]
 tpg|DAA60670.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
Length=257

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  69   YRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFPTE  248
            Y GVRKRPWG++AAEIRDSTR GARVWLGTFD+ E AA+AYDQAA S+RG +A LNFP E
Sbjct  108  YIGVRKRPWGKFAAEIRDSTRKGARVWLGTFDSPEAAAMAYDQAAFSVRGAAAVLNFPVE  167

Query  249  KVQE  260
            +VQE
Sbjct  168  RVQE  171



>ref|XP_004292208.1| PREDICTED: ethylene-responsive transcription factor ERF098-like 
[Fragaria vesca subsp. vesca]
Length=149

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 60/79 (76%), Gaps = 4/79 (5%)
 Frame = +3

Query  24   MEFSSDDN----KLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalay  191
            ME   +DN    ++R   RYRG R+RPWGRYAAEIRD TRNGAR+WLGTFDTAE+AA AY
Sbjct  1    MEGKREDNQNQARVRDPTRYRGTRRRPWGRYAAEIRDPTRNGARLWLGTFDTAEQAARAY  60

Query  192  dqaalSMRGKSAFLNFPTE  248
            D+AA  +RG  A LNFP E
Sbjct  61   DRAAFRLRGNLAILNFPNE  79



>gb|KDP21037.1| hypothetical protein JCGZ_21508 [Jatropha curcas]
Length=273

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 67/88 (76%), Gaps = 10/88 (11%)
 Frame = +3

Query  21   AMEFSSDDNK-LRV---------EKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTa  170
            +  F S DNK L+V         ++ YRGVR+RPWG+YAAEIRDSTR GARVWLGTFDTA
Sbjct  92   SCNFDSSDNKNLKVNAMKVDNVTQRHYRGVRRRPWGKYAAEIRDSTRKGARVWLGTFDTA  151

Query  171  eeaalaydqaalSMRGKSAFLNFPTEKV  254
            EEAALAYD+AAL +RG  A+LNFP + V
Sbjct  152  EEAALAYDKAALRIRGPKAYLNFPLDTV  179



>ref|XP_003553493.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Glycine 
max]
Length=212

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  63   KRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSMRGKSAFLNFP  242
            K Y GVR+RPWGR+AAEIRD+TR G RVWLGTFD+AEEAALAYDQAA SMRG SA LNFP
Sbjct  69   KSYIGVRRRPWGRFAAEIRDTTRKGIRVWLGTFDSAEEAALAYDQAAFSMRGSSAVLNFP  128

Query  243  TEKVQE  260
             ++V+E
Sbjct  129  VKRVKE  134



>gb|ACU19106.1| unknown [Glycine max]
Length=266

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  33   SSDDNKLRVEKRYRGVRKRPWGRYAAEIRDSTRNGARVWLGTFDTaeeaalaydqaalSM  212
            S + N ++  K YRGVR+RPWG+YAAEIRD  R G+RVWLGTFDTA EAA AYD+AA  M
Sbjct  106  SDETNNIKENKHYRGVRRRPWGKYAAEIRDPNRKGSRVWLGTFDTAIEAAKAYDKAAFKM  165

Query  213  RGKSAFLNFPTE  248
            RG  A LNFP E
Sbjct  166  RGSKAILNFPLE  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525010460520