BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4485_g2_i1 len=1093 path=[1365:0-1092]

Length=1093
                                                                      Score     E

ref|XP_011081918.1|  PREDICTED: boron transporter 4-like                582   0.0      
ref|XP_007013808.1|  HCO3- transporter family                           582   0.0      
ref|XP_009621374.1|  PREDICTED: probable boron transporter 7            578   0.0      
ref|XP_006364282.1|  PREDICTED: probable boron transporter 7-like       573   0.0      
ref|XP_004245187.1|  PREDICTED: probable boron transporter 7            571   0.0      
ref|XP_009799564.1|  PREDICTED: probable boron transporter 7            569   0.0      
ref|XP_010102816.1|  Boron transporter 4                                566   0.0      
ref|XP_010049957.1|  PREDICTED: boron transporter 4-like isoform X1     565   0.0      
gb|KCW82788.1|  hypothetical protein EUGRSUZ_C04162                     565   0.0      
ref|XP_011085892.1|  PREDICTED: boron transporter 4-like                564   0.0      
gb|EYU21945.1|  hypothetical protein MIMGU_mgv1a002503mg                563   0.0      
ref|XP_002299613.2|  anion exchange family protein                      563   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP33629.1|  hypothetical protein JCGZ_07200                         560   0.0      
ref|XP_007023953.1|  Boron transporter, putative                        560   0.0      
ref|XP_011035643.1|  PREDICTED: boron transporter 4-like isoform X4     555   0.0      
ref|XP_002304164.2|  anion exchange family protein                      558   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011085180.1|  PREDICTED: boron transporter 4-like                557   0.0      
ref|XP_011035641.1|  PREDICTED: boron transporter 4-like isoform X3     556   0.0      
ref|XP_011035639.1|  PREDICTED: boron transporter 4-like isoform X1     556   0.0      
ref|XP_011035640.1|  PREDICTED: boron transporter 4-like isoform X2     556   0.0      
ref|XP_010254316.1|  PREDICTED: boron transporter 4                     554   0.0      
ref|XP_002281778.2|  PREDICTED: boron transporter 4                     553   0.0      Vitis vinifera
ref|XP_011014678.1|  PREDICTED: boron transporter 4-like                551   0.0      
gb|KGN62918.1|  hypothetical protein Csa_2G379980                       551   0.0      
ref|XP_011040005.1|  PREDICTED: boron transporter 4-like                551   0.0      
ref|XP_002514365.1|  Boron transporter, putative                        551   0.0      Ricinus communis
ref|XP_002282436.1|  PREDICTED: probable boron transporter 7            551   0.0      Vitis vinifera
ref|XP_002517565.1|  Boron transporter, putative                        551   0.0      Ricinus communis
ref|XP_006356189.1|  PREDICTED: boron transporter 4-like                549   0.0      
ref|XP_007226316.1|  hypothetical protein PRUPE_ppa021289mg             548   0.0      
ref|XP_008445157.1|  PREDICTED: probable boron transporter 6 isof...    548   0.0      
ref|XP_009791278.1|  PREDICTED: boron transporter 4-like                548   0.0      
gb|EYU29240.1|  hypothetical protein MIMGU_mgv1a002537mg                548   0.0      
ref|XP_008445155.1|  PREDICTED: probable boron transporter 6 isof...    548   0.0      
ref|XP_004138738.1|  PREDICTED: probable boron transporter 6-like       548   0.0      
ref|XP_008445156.1|  PREDICTED: probable boron transporter 6 isof...    547   0.0      
ref|XP_002324278.1|  hypothetical protein POPTR_0018s01350g             547   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010049958.1|  PREDICTED: boron transporter 4-like isoform X2     543   0.0      
ref|XP_009592836.1|  PREDICTED: boron transporter 4-like isoform X1     544   0.0      
ref|XP_009592837.1|  PREDICTED: boron transporter 4-like isoform X2     544   0.0      
emb|CDX88179.1|  BnaA06g27700D                                          542   0.0      
ref|XP_009151072.1|  PREDICTED: probable boron transporter 6            542   0.0      
emb|CAN61936.1|  hypothetical protein VITISV_001012                     542   0.0      Vitis vinifera
ref|XP_009625163.1|  PREDICTED: boron transporter 4-like                541   0.0      
gb|KHG17895.1|  Putative boron transporter 5 -like protein              540   0.0      
ref|XP_010914933.1|  PREDICTED: boron transporter 4-like                541   0.0      
gb|KHG27141.1|  Putative boron transporter 5 -like protein              540   0.0      
ref|XP_008394033.1|  PREDICTED: probable boron transporter 6 isof...    540   0.0      
ref|XP_006465393.1|  PREDICTED: boron transporter 4-like                541   0.0      
ref|XP_006394797.1|  hypothetical protein EUTSA_v10003768mg             540   0.0      
emb|CDX80510.1|  BnaC07g29340D                                          540   0.0      
ref|XP_008394032.1|  PREDICTED: probable boron transporter 6 isof...    539   0.0      
ref|XP_010454873.1|  PREDICTED: probable boron transporter 6            538   0.0      
ref|XP_008219893.1|  PREDICTED: probable boron transporter 7            538   0.0      
ref|XP_006289519.1|  hypothetical protein CARUB_v10003060mg             538   0.0      
ref|XP_009334783.1|  PREDICTED: probable boron transporter 6 isof...    537   0.0      
ref|XP_010526199.1|  PREDICTED: probable boron transporter 7            538   0.0      
ref|XP_006581378.1|  PREDICTED: boron transporter 4-like isoform X1     537   0.0      
ref|XP_009389936.1|  PREDICTED: boron transporter 4-like isoform X3     538   0.0      
ref|XP_010033916.1|  PREDICTED: boron transporter 4                     536   0.0      
ref|NP_197925.4|  putative boron transporter 6                          536   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHN07101.1|  Boron transporter 4                                     535   0.0      
ref|XP_009400125.1|  PREDICTED: boron transporter 4-like                536   0.0      
gb|KHN08107.1|  Boron transporter 4                                     535   0.0      
ref|XP_010495500.1|  PREDICTED: probable boron transporter 6            535   0.0      
ref|XP_011013546.1|  PREDICTED: boron transporter 4-like isoform X3     531   0.0      
ref|XP_010421393.1|  PREDICTED: probable boron transporter 6            535   0.0      
ref|XP_002872164.1|  anion exchange protein family                      533   0.0      
ref|XP_010437902.1|  PREDICTED: probable boron transporter 7            535   0.0      
ref|XP_004501300.1|  PREDICTED: probable boron transporter 7-like       534   0.0      
ref|XP_006601135.1|  PREDICTED: probable boron transporter 6-like       534   0.0      
ref|XP_006578164.1|  PREDICTED: boron transporter 4-like                534   0.0      
ref|XP_010048993.1|  PREDICTED: probable boron transporter 7            533   0.0      
gb|AES73690.2|  boron transporter-like protein                          534   0.0      
ref|XP_010432710.1|  PREDICTED: probable boron transporter 7 isof...    533   0.0      
ref|XP_010432709.1|  PREDICTED: probable boron transporter 7 isof...    533   0.0      
ref|XP_004151241.1|  PREDICTED: boron transporter 4-like                532   0.0      
ref|XP_002309238.2|  hypothetical protein POPTR_0006s15960g             532   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006283276.1|  hypothetical protein CARUB_v10004311mg             532   0.0      
ref|XP_007013334.1|  HCO3- transporter family                           531   0.0      
ref|XP_010447377.1|  PREDICTED: probable boron transporter 7            532   0.0      
ref|XP_011013544.1|  PREDICTED: boron transporter 4-like isoform X1     531   0.0      
ref|XP_011013545.1|  PREDICTED: boron transporter 4-like isoform X2     531   0.0      
ref|XP_008394031.1|  PREDICTED: probable boron transporter 6 isof...    531   0.0      
ref|XP_002867240.1|  predicted protein                                  531   0.0      
ref|XP_009334782.1|  PREDICTED: probable boron transporter 6 isof...    531   0.0      
ref|XP_006412469.1|  hypothetical protein EUTSA_v10024599mg             531   0.0      
ref|XP_002529372.1|  Boron transporter, putative                        530   0.0      Ricinus communis
ref|XP_010519936.1|  PREDICTED: probable boron transporter 6            531   0.0      
ref|XP_006427176.1|  hypothetical protein CICLE_v10025159mg             528   0.0      
ref|XP_009786676.1|  PREDICTED: boron transporter 4-like isoform X2     530   0.0      
ref|XP_009786674.1|  PREDICTED: boron transporter 4-like isoform X1     530   0.0      
ref|XP_010249971.1|  PREDICTED: probable boron transporter 7            529   1e-180   
ref|XP_010691218.1|  PREDICTED: boron transporter 4-like                529   1e-180   
ref|XP_010088266.1|  Boron transporter 4                                528   2e-180   
ref|XP_008447479.1|  PREDICTED: boron transporter 4-like                527   7e-180   
ref|NP_194977.6|  HCO3- transporter family                              527   9e-180   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389934.1|  PREDICTED: boron transporter 4-like isoform X2     528   9e-180   
ref|XP_009389933.1|  PREDICTED: boron transporter 4-like isoform X1     528   2e-179   
ref|XP_003603439.1|  Anion exchanger family protein                     527   2e-179   
ref|XP_010691216.1|  PREDICTED: boron transporter 4-like isoform X2     525   4e-179   
ref|XP_009148940.1|  PREDICTED: boron transporter 4                     525   6e-179   
ref|XP_010691213.1|  PREDICTED: boron transporter 4-like isoform X1     524   6e-179   
ref|XP_010537968.1|  PREDICTED: boron transporter 4 isoform X1          525   9e-179   
ref|XP_010537973.1|  PREDICTED: boron transporter 4 isoform X2          524   1e-178   
emb|CDP04803.1|  unnamed protein product                                524   1e-178   
ref|XP_002308645.1|  hypothetical protein POPTR_0006s26590g             524   1e-178   Populus trichocarpa [western balsam poplar]
ref|XP_006390387.1|  hypothetical protein EUTSA_v10018222mg             524   3e-178   
emb|CDY13492.1|  BnaA03g52100D                                          522   6e-178   
ref|XP_007137052.1|  hypothetical protein PHAVU_009G095800g             521   7e-178   
ref|XP_006416903.1|  hypothetical protein EUTSA_v10007002mg             522   8e-178   
ref|XP_004486699.1|  PREDICTED: boron transporter 4-like                522   9e-178   
ref|XP_006341714.1|  PREDICTED: boron transporter 4-like                522   1e-177   
gb|KFK41918.1|  hypothetical protein AALP_AA2G189000                    522   1e-177   
gb|KDP37147.1|  hypothetical protein JCGZ_06203                         521   1e-177   
ref|XP_011019813.1|  PREDICTED: probable boron transporter 7            521   2e-177   
ref|XP_004291480.1|  PREDICTED: boron transporter 4-like                521   2e-177   
gb|KEH15890.1|  boron transporter-like protein                          520   5e-177   
emb|CDX72362.1|  BnaC07g43840D                                          519   7e-177   
dbj|BAD67809.1|  band 3 anion transport protein -like                   519   7e-177   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006595477.1|  PREDICTED: boron transporter 4-like                518   9e-177   
emb|CDY46028.1|  BnaA02g16980D                                          514   1e-176   
emb|CAA22578.1|  putative protein                                       520   1e-176   Arabidopsis thaliana [mouse-ear cress]
gb|ABD78950.1|  boron transporter                                       519   2e-176   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042174.2|  Os01g0175600                                       518   2e-176   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009138133.1|  PREDICTED: probable boron transporter 7            518   2e-176   
emb|CDY39649.1|  BnaC05g11780D                                          518   2e-176   
ref|XP_010318581.1|  PREDICTED: boron transporter 4                     518   3e-176   
ref|XP_004498650.1|  PREDICTED: probable boron transporter 7-like       518   3e-176   
ref|XP_007161235.1|  hypothetical protein PHAVU_001G053300g             517   4e-176   
gb|EEE53967.1|  hypothetical protein OsJ_00580                          518   5e-176   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006465502.1|  PREDICTED: boron transporter 4-like                518   8e-176   
ref|XP_002892869.1|  anion exchange family protein                      517   1e-175   
ref|XP_003597847.1|  Anion exchanger family protein                     519   1e-175   
ref|XP_006306092.1|  hypothetical protein CARUB_v10011515mg             517   1e-175   
ref|XP_004968394.1|  PREDICTED: boron transporter 4-like isoform X3     516   1e-175   
ref|NP_172999.1|  boron transporter 4                                   516   2e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691217.1|  PREDICTED: boron transporter 4-like                515   2e-175   
ref|XP_009348429.1|  PREDICTED: boron transporter 4-like isoform X2     516   2e-175   
emb|CDX68852.1|  BnaC01g06010D                                          516   2e-175   
ref|XP_009348427.1|  PREDICTED: boron transporter 4-like isoform X1     516   3e-175   
ref|XP_004968395.1|  PREDICTED: boron transporter 4-like isoform X4     513   4e-175   
gb|AAG51913.1|AC013258_7  putative anion exchanger; 94836-91832         515   4e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007216756.1|  hypothetical protein PRUPE_ppa024840mg             514   5e-175   
emb|CDY37274.1|  BnaCnng08280D                                          515   6e-175   
ref|XP_004968392.1|  PREDICTED: boron transporter 4-like isoform X1     514   6e-175   
ref|XP_004968393.1|  PREDICTED: boron transporter 4-like isoform X2     514   7e-175   
ref|XP_008792104.1|  PREDICTED: boron transporter 4-like isoform X2     513   7e-175   
gb|ABS83564.1|  boron transporter                                       514   8e-175   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006300811.1|  hypothetical protein CARUB_v10019898mg             514   9e-175   
emb|CDY68117.1|  BnaA02g35930D                                          514   1e-174   
ref|XP_009128063.1|  PREDICTED: boron transporter 4                     514   1e-174   
ref|XP_010691211.1|  PREDICTED: boron transporter 4-like                513   1e-174   
gb|ABX26206.1|  boron transporter 2                                     514   1e-174   Triticum aestivum [Canadian hard winter wheat]
emb|CDM81925.1|  unnamed protein product                                513   2e-174   
ref|NP_177619.2|  boron transporter 5                                   514   2e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228633.1|  PREDICTED: boron transporter 4                     513   3e-174   
ref|XP_008357258.1|  PREDICTED: boron transporter 4-like isoform X1     513   3e-174   
ref|XP_008357260.1|  PREDICTED: boron transporter 4-like isoform X2     513   3e-174   
ref|XP_008792103.1|  PREDICTED: boron transporter 4-like isoform X1     513   3e-174   
gb|ABS83562.1|  boron transporter                                       513   4e-174   Hordeum vulgare [barley]
gb|AES58965.2|  boron transporter-like protein                          512   4e-174   
ref|XP_010459081.1|  PREDICTED: boron transporter 4 isoform X3          513   5e-174   
ref|XP_007150705.1|  hypothetical protein PHAVU_005G174400g             512   9e-174   
ref|XP_011081148.1|  PREDICTED: boron transporter 4-like isoform X3     511   1e-173   
ref|XP_010476636.1|  PREDICTED: boron transporter 4-like                512   1e-173   
ref|XP_010459078.1|  PREDICTED: boron transporter 4 isoform X1          512   1e-173   
gb|EEC70033.1|  hypothetical protein OsI_00611                          513   1e-173   Oryza sativa Indica Group [Indian rice]
ref|XP_011081141.1|  PREDICTED: boron transporter 4-like isoform X2     511   1e-173   
ref|XP_010497166.1|  PREDICTED: boron transporter 4-like isoform X2     511   2e-173   
ref|XP_006643819.1|  PREDICTED: boron transporter 4-like                511   2e-173   
ref|XP_011081134.1|  PREDICTED: boron transporter 4-like isoform X1     511   2e-173   
ref|XP_010497173.1|  PREDICTED: boron transporter 4-like isoform X3     511   3e-173   
ref|XP_010497162.1|  PREDICTED: boron transporter 4-like isoform X1     511   4e-173   
ref|XP_003546177.1|  PREDICTED: boron transporter 4-like isoform X1     510   4e-173   
gb|EMS45494.1|  Boron transporter 4                                     514   4e-173   
gb|KHN22473.1|  Boron transporter 4                                     510   4e-173   
dbj|BAJ87955.1|  predicted protein                                      509   5e-173   
ref|XP_009125922.1|  PREDICTED: probable boron transporter 7 isof...    509   6e-173   
ref|XP_006854912.1|  hypothetical protein AMTR_s00052p00085150          509   6e-173   
ref|XP_009333648.1|  PREDICTED: boron transporter 4-like                509   7e-173   
gb|AHY28555.1|  boron transporter                                       509   8e-173   
gb|AHY28556.1|  boron transporter                                       508   1e-172   
ref|XP_008792146.1|  PREDICTED: boron transporter 4-like                508   2e-172   
gb|AHY28557.1|  boron transporter                                       508   2e-172   
ref|XP_009125916.1|  PREDICTED: probable boron transporter 7 isof...    508   3e-172   
ref|XP_002455089.1|  hypothetical protein SORBIDRAFT_03g004180          506   9e-172   Sorghum bicolor [broomcorn]
gb|KHN44152.1|  Boron transporter 4                                     506   9e-172   
ref|XP_008809478.1|  PREDICTED: boron transporter 4                     507   1e-171   
ref|XP_008347793.1|  PREDICTED: boron transporter 4-like                505   4e-171   
ref|XP_010428474.1|  PREDICTED: putative boron transporter 5            505   6e-171   
ref|XP_008672825.1|  PREDICTED: boron transporter-like protein 2 ...    504   6e-171   
ref|NP_001147798.1|  boron transporter-like protein 2                   504   7e-171   Zea mays [maize]
gb|EMT12936.1|  Boron transporter-like protein 2                        504   8e-171   
gb|AHY28551.1|  boron transporter                                       503   1e-170   
ref|XP_010925146.1|  PREDICTED: LOW QUALITY PROTEIN: boron transp...    504   1e-170   
gb|AHY28552.1|  boron transporter                                       502   4e-170   
emb|CDY36563.1|  BnaA06g10160D                                          526   7e-170   
gb|EMT07454.1|  Boron transporter-like protein 2                        518   9e-170   
ref|XP_010416339.1|  PREDICTED: putative boron transporter 5            502   1e-169   
ref|XP_003569518.2|  PREDICTED: boron transporter 4-like                515   2e-169   
ref|XP_010471571.1|  PREDICTED: putative boron transporter 5            501   2e-169   
ref|XP_002517531.1|  Boron transporter, putative                        497   2e-168   Ricinus communis
emb|CDX75250.1|  BnaA01g04520D                                          514   3e-168   
ref|XP_004960830.1|  PREDICTED: boron transporter 4-like isoform X3     495   1e-167   
ref|XP_002285279.1|  PREDICTED: boron transporter 4                     494   5e-167   Vitis vinifera
gb|EEE53968.1|  hypothetical protein OsJ_00581                          494   5e-167   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960829.1|  PREDICTED: boron transporter 4-like isoform X2     494   8e-167   
ref|XP_004960828.1|  PREDICTED: boron transporter 4-like isoform X1     494   9e-167   
gb|EEC70035.1|  hypothetical protein OsI_00613                          493   2e-166   Oryza sativa Indica Group [Indian rice]
ref|XP_004302934.1|  PREDICTED: boron transporter 4-like                492   5e-166   
gb|EMT25132.1|  Boron transporter-like protein 2                        485   2e-164   
gb|EPS73271.1|  hypothetical protein M569_01481                         487   2e-164   
gb|KEH35928.1|  boron transporter-like protein                          481   6e-164   
gb|KHN06659.1|  Putative boron transporter 6                            484   8e-164   
gb|ABD78951.1|  boron transporter                                       486   1e-163   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008656127.1|  PREDICTED: boron transporter 4-like                486   2e-163   
ref|XP_003568821.1|  PREDICTED: boron transporter 4-like                483   3e-162   
emb|CAN78158.1|  hypothetical protein VITISV_032799                     481   3e-162   Vitis vinifera
ref|XP_010670707.1|  PREDICTED: probable boron transporter 7            481   1e-161   
gb|EEC78613.1|  hypothetical protein OsI_18656                          477   3e-160   Oryza sativa Indica Group [Indian rice]
ref|XP_002440699.1|  hypothetical protein SORBIDRAFT_09g005350          476   4e-160   Sorghum bicolor [broomcorn]
gb|EMT10235.1|  Boron transporter-like protein 2                        472   8e-158   
ref|XP_009786677.1|  PREDICTED: boron transporter 4-like isoform X3     464   5e-157   
ref|XP_006654099.1|  PREDICTED: putative boron transporter 5-like       467   3e-156   
gb|EMS54934.1|  Boron transporter 4                                     474   2e-155   
ref|XP_003597850.1|  Anion exchanger family protein                     460   7e-153   
ref|XP_008352715.1|  PREDICTED: probable boron transporter 2            457   4e-152   
ref|XP_010679449.1|  PREDICTED: probable boron transporter 2            457   6e-152   
gb|KDO72103.1|  hypothetical protein CISIN_1g004693mg                   454   7e-152   
ref|XP_004297106.1|  PREDICTED: probable boron transporter 2-like       457   8e-152   
ref|XP_010319275.1|  PREDICTED: boron transporter 1 isoform X1          457   9e-152   
ref|XP_004229035.1|  PREDICTED: boron transporter 1 isoform X2          457   9e-152   
ref|XP_006419285.1|  hypothetical protein CICLE_v10004419mg             457   1e-151   
gb|KHG23009.1|  Putative boron transporter 5 -like protein              443   2e-151   
gb|KDO72102.1|  hypothetical protein CISIN_1g004693mg                   456   2e-151   
gb|ABR18319.1|  unknown                                                 454   2e-151   Picea sitchensis
ref|XP_009372058.1|  PREDICTED: probable boron transporter 2            455   3e-151   
ref|XP_004241498.1|  PREDICTED: probable boron transporter 2            455   4e-151   
ref|XP_006347452.1|  PREDICTED: probable boron transporter 2-like       455   5e-151   
ref|XP_008223448.1|  PREDICTED: probable boron transporter 2            454   7e-151   
ref|XP_008390404.1|  PREDICTED: probable boron transporter 2 isof...    454   8e-151   
ref|XP_009590549.1|  PREDICTED: boron transporter 1-like isoform X1     454   8e-151   
ref|XP_008390400.1|  PREDICTED: probable boron transporter 2 isof...    454   1e-150   
ref|XP_006841594.1|  hypothetical protein AMTR_s00003p00203390          454   1e-150   
ref|XP_010418569.1|  PREDICTED: probable boron transporter 2            451   2e-150   
ref|XP_010069747.1|  PREDICTED: boron transporter 1-like isoform X2     453   3e-150   
ref|XP_006337976.1|  PREDICTED: boron transporter 1-like isoform X2     452   3e-150   
ref|XP_006337975.1|  PREDICTED: boron transporter 1-like isoform X1     452   4e-150   
ref|XP_006402392.1|  hypothetical protein EUTSA_v10005815mg             452   4e-150   
ref|XP_010544945.1|  PREDICTED: boron transporter 1 isoform X1          452   4e-150   
ref|XP_010098757.1|  putative boron transporter 2                       452   4e-150   
ref|XP_009762958.1|  PREDICTED: boron transporter 1-like isoform X1     452   5e-150   
ref|XP_010069746.1|  PREDICTED: boron transporter 1-like isoform X1     452   5e-150   
ref|XP_010270898.1|  PREDICTED: probable boron transporter 2 isof...    452   5e-150   
emb|CDX93980.1|  BnaC04g21390D                                          452   6e-150   
ref|XP_010270899.1|  PREDICTED: probable boron transporter 2 isof...    452   8e-150   
ref|XP_009138732.1|  PREDICTED: probable boron transporter 2            451   1e-149   
ref|XP_002887560.1|  hypothetical protein ARALYDRAFT_316416             447   3e-149   
ref|XP_009590550.1|  PREDICTED: boron transporter 1-like isoform X2     450   3e-149   
ref|NP_191786.1|  putative boron transporter 2                          449   6e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010468972.1|  PREDICTED: probable boron transporter 2            449   7e-149   
ref|XP_006290670.1|  hypothetical protein CARUB_v10016761mg             449   7e-149   
ref|XP_009617739.1|  PREDICTED: probable boron transporter 2            449   8e-149   
ref|XP_002878446.1|  anion exchange family protein                      449   9e-149   
ref|XP_009762959.1|  PREDICTED: boron transporter 1-like isoform X2     449   2e-148   
ref|XP_009795732.1|  PREDICTED: probable boron transporter 2            448   2e-148   
gb|KFK35411.1|  hypothetical protein AALP_AA5G281100                    447   3e-148   
ref|XP_010652294.1|  PREDICTED: probable boron transporter 2            448   3e-148   
ref|XP_006349160.1|  PREDICTED: boron transporter 1-like                448   3e-148   
gb|ADF30183.1|  boron transporter                                       447   4e-148   
emb|CDY37790.1|  BnaC04g00350D                                          447   5e-148   
ref|XP_009367178.1|  PREDICTED: probable boron transporter 2            447   5e-148   
ref|XP_011079508.1|  PREDICTED: probable boron transporter 2            447   7e-148   
ref|XP_008381453.1|  PREDICTED: probable boron transporter 2            447   7e-148   
ref|XP_002989430.1|  hypothetical protein SELMODRAFT_129751             444   8e-148   
gb|AGJ84334.1|  putative boron transporter                              446   1e-147   
ref|XP_011019193.1|  PREDICTED: probable boron transporter 2            446   1e-147   
ref|XP_010546941.1|  PREDICTED: probable boron transporter 3            447   1e-147   
ref|XP_010649605.1|  PREDICTED: uncharacterized protein LOC100252...    446   1e-147   
ref|XP_010649608.1|  PREDICTED: uncharacterized protein LOC100252...    446   1e-147   
ref|XP_010649607.1|  PREDICTED: uncharacterized protein LOC100252...    446   1e-147   
emb|CDX80082.1|  BnaA05g00740D                                          446   1e-147   
ref|XP_010523900.1|  PREDICTED: probable boron transporter 2            446   1e-147   
ref|XP_010506744.1|  PREDICTED: boron transporter 1-like                446   1e-147   
ref|XP_010507922.1|  PREDICTED: boron transporter 1                     446   2e-147   
ref|XP_002962848.1|  hypothetical protein SELMODRAFT_78956              444   2e-147   
ref|XP_003533117.1|  PREDICTED: probable boron transporter 2-like...    445   2e-147   
ref|XP_004229368.1|  PREDICTED: boron transporter 1                     446   3e-147   
gb|ADF30182.1|  boron transporter                                       444   3e-147   
gb|ADF30190.1|  boron transporter                                       444   4e-147   
ref|NP_001078071.1|  boron transporter 1                                445   4e-147   
ref|NP_850469.1|  boron transporter 1                                   444   4e-147   
ref|XP_007225187.1|  hypothetical protein PRUPE_ppa002139mg             444   5e-147   
ref|XP_009363096.1|  PREDICTED: probable boron transporter 2            444   5e-147   
ref|XP_009376187.1|  PREDICTED: probable boron transporter 2            444   6e-147   
gb|KDP27981.1|  hypothetical protein JCGZ_19061                         444   6e-147   
ref|XP_009118889.1|  PREDICTED: boron transporter 1                     444   7e-147   
gb|ADC35526.1|  boron transporter                                       444   7e-147   
ref|XP_002882111.1|  hypothetical protein ARALYDRAFT_483891             444   8e-147   
gb|ADF30181.1|  boron transporter                                       444   8e-147   
gb|KDP28306.1|  hypothetical protein JCGZ_14077                         444   9e-147   
ref|XP_008227811.1|  PREDICTED: probable boron transporter 2            444   1e-146   
ref|XP_006293775.1|  hypothetical protein CARUB_v10022751mg             443   1e-146   
ref|XP_009142562.1|  PREDICTED: boron transporter 1-like                443   1e-146   
gb|ADF30180.1|  boron transporter                                       443   1e-146   
ref|XP_010518409.1|  PREDICTED: boron transporter 1                     443   1e-146   
ref|XP_010678778.1|  PREDICTED: probable boron transporter 2            444   1e-146   
ref|XP_008362547.1|  PREDICTED: boron transporter 1-like                443   2e-146   
gb|ADF30179.1|  boron transporter                                       443   2e-146   
ref|XP_009133802.1|  PREDICTED: boron transporter 1-like isoform X1     442   3e-146   
ref|XP_009133803.1|  PREDICTED: boron transporter 1-like isoform X2     442   3e-146   
ref|XP_007221557.1|  hypothetical protein PRUPE_ppa002104mg             442   4e-146   
gb|ADF30184.1|  boron transporter                                       441   7e-146   
ref|XP_006840700.1|  hypothetical protein AMTR_s00096p00091060          442   8e-146   
ref|XP_006397908.1|  hypothetical protein EUTSA_v10001337mg             441   8e-146   
ref|XP_010251206.1|  PREDICTED: probable boron transporter 2            441   8e-146   
gb|KFK37462.1|  hypothetical protein AALP_AA4G260300                    441   1e-145   
ref|XP_007147404.1|  hypothetical protein PHAVU_006G121500g             439   2e-145   
ref|XP_008447454.1|  PREDICTED: boron transporter 1                     440   3e-145   
ref|XP_010276508.1|  PREDICTED: boron transporter 1-like                440   3e-145   
ref|XP_011071873.1|  PREDICTED: probable boron transporter 2            440   3e-145   
ref|XP_010248503.1|  PREDICTED: probable boron transporter 2            440   3e-145   
ref|XP_004151220.1|  PREDICTED: probable boron transporter 2-like       440   3e-145   
ref|NP_001167745.1|  hypothetical protein                               439   4e-145   
ref|NP_001151747.1|  LOC100285382                                       439   4e-145   
ref|XP_011040663.1|  PREDICTED: boron transporter 1                     440   4e-145   
ref|XP_004288330.1|  PREDICTED: boron transporter 1-like                440   4e-145   
gb|AEJ82307.1|  BOR1-3YA                                                439   5e-145   
emb|CDY51414.1|  BnaA04g26910D                                          439   5e-145   
emb|CDY50920.1|  BnaC03g72490D                                          439   5e-145   
emb|CDX83341.1|  BnaA03g21650D                                          439   5e-145   
ref|XP_006376860.1|  hypothetical protein POPTR_0012s08340g             436   8e-145   
gb|KHG05664.1|  Boron transporter 1 -like protein                       439   8e-145   
ref|XP_006376863.1|  hypothetical protein POPTR_0012s08340g             437   8e-145   
emb|CAN70359.1|  hypothetical protein VITISV_044309                     436   9e-145   
emb|CDY27507.1|  BnaC04g51480D                                          438   1e-144   
ref|XP_003521605.1|  PREDICTED: boron transporter 1-like isoform 1      439   1e-144   
ref|XP_002519293.1|  Boron transporter, putative                        438   1e-144   
ref|XP_002311364.1|  hypothetical protein POPTR_0008s09970g             438   1e-144   
ref|XP_010024845.1|  PREDICTED: probable boron transporter 2            438   2e-144   
ref|XP_011001527.1|  PREDICTED: probable boron transporter 2 isof...    437   2e-144   
ref|XP_011028552.1|  PREDICTED: probable boron transporter 2            438   3e-144   
ref|XP_006376862.1|  hypothetical protein POPTR_0012s08340g             437   3e-144   
ref|XP_003554567.1|  PREDICTED: boron transporter 1-like                437   3e-144   
emb|CDP12423.1|  unnamed protein product                                437   5e-144   
emb|CAN71135.1|  hypothetical protein VITISV_025408                     437   5e-144   
ref|XP_010027612.1|  PREDICTED: boron transporter 1-like                437   6e-144   
ref|XP_006376859.1|  hypothetical protein POPTR_0012s08340g             437   6e-144   
tpg|DAA56999.1|  TPA: hypothetical protein ZEAMMB73_940587              434   6e-144   
ref|XP_009800123.1|  PREDICTED: probable boron transporter 2            437   6e-144   
ref|XP_002318053.2|  hypothetical protein POPTR_0012s08340g             437   6e-144   
ref|NP_001267820.1|  uncharacterized protein LOC100252933               437   8e-144   
ref|XP_011001525.1|  PREDICTED: probable boron transporter 2 isof...    436   1e-143   
ref|XP_007036237.1|  HCO3- transporter family                           436   1e-143   
ref|XP_007051221.1|  HCO3- transporter family                           436   2e-143   
ref|XP_006492382.1|  PREDICTED: boron transporter 1-like                436   2e-143   
ref|XP_009600894.1|  PREDICTED: probable boron transporter 2 isof...    434   2e-143   
ref|XP_007163214.1|  hypothetical protein PHAVU_001G215700g             436   2e-143   
ref|XP_006444569.1|  hypothetical protein CICLE_v10019073mg             435   2e-143   
gb|EYU46857.1|  hypothetical protein MIMGU_mgv1a002116mg                435   2e-143   
ref|XP_003527015.1|  PREDICTED: boron transporter 1-like isoform X1     436   2e-143   
gb|KHN44685.1|  Putative boron transporter 2                            435   2e-143   
ref|XP_006439833.1|  hypothetical protein CICLE_v10019060mg             431   3e-143   
ref|XP_006375422.1|  hypothetical protein POPTR_0014s11140g             430   3e-143   
ref|XP_011003170.1|  PREDICTED: probable boron transporter 2            435   3e-143   
ref|XP_007035926.1|  HCO3- transporter family isoform 1                 435   3e-143   
ref|XP_006407945.1|  hypothetical protein EUTSA_v10020147mg             435   3e-143   
ref|XP_008438478.1|  PREDICTED: boron transporter 1-like                435   3e-143   
ref|XP_007035927.1|  HCO3- transporter family isoform 2                 435   3e-143   
ref|XP_009600893.1|  PREDICTED: probable boron transporter 2 isof...    435   4e-143   
ref|XP_010087682.1|  putative boron transporter 2                       435   5e-143   
gb|EEC69514.1|  hypothetical protein OsI_38753                          430   6e-143   
gb|KHN14153.1|  Putative boron transporter 2                            434   8e-143   
ref|XP_006483702.1|  PREDICTED: LOW QUALITY PROTEIN: probable bor...    429   8e-143   
ref|XP_002511389.1|  Boron transporter, putative                        434   9e-143   
ref|XP_006581924.1|  PREDICTED: boron transporter 1-like isoform X2     434   1e-142   
ref|XP_004298950.1|  PREDICTED: probable boron transporter 2-like       434   2e-142   
gb|KDO69621.1|  hypothetical protein CISIN_1g0051001mg                  429   2e-142   
gb|ABG22050.1|  Boron transporter 1, putative, expressed                430   3e-142   
dbj|BAO98796.1|  boron transporter                                      432   4e-142   
ref|XP_002321602.2|  hypothetical protein POPTR_0015s08870g             432   5e-142   
ref|NP_001054793.1|  Os05g0176800                                       432   7e-142   
gb|EYU22115.1|  hypothetical protein MIMGU_mgv1a002094mg                431   8e-142   
gb|AFQ32800.1|  boron transporter                                       431   1e-141   
gb|KHN43428.1|  Putative boron transporter 2                            431   1e-141   
ref|XP_003523082.1|  PREDICTED: boron transporter 1-like isoform X1     431   1e-141   
ref|XP_002282501.1|  PREDICTED: probable boron transporter 2            431   1e-141   
ref|XP_006439834.1|  hypothetical protein CICLE_v10019060mg             431   1e-141   
ref|XP_006476787.1|  PREDICTED: probable boron transporter 2-like       431   1e-141   
ref|XP_010440377.1|  PREDICTED: probable boron transporter 3            431   2e-141   
ref|XP_004152479.1|  PREDICTED: probable boron transporter 2-like       430   2e-141   
ref|NP_001067049.1|  Os12g0566000                                       430   2e-141   
ref|XP_007138070.1|  hypothetical protein PHAVU_009G178000g             430   2e-141   
ref|XP_006664109.1|  PREDICTED: boron transporter 1-like                430   2e-141   
gb|KDO86873.1|  hypothetical protein CISIN_1g004855mg                   430   3e-141   
gb|EMS63176.1|  putative boron transporter 2                            430   3e-141   
ref|XP_010486154.1|  PREDICTED: probable boron transporter 3            430   3e-141   
dbj|BAO98798.1|  boron transporter                                      429   4e-141   
gb|AAQ02664.1|  boron transporter                                       429   4e-141   
dbj|BAO98797.1|  boron transporter                                      429   5e-141   
ref|XP_007210327.1|  hypothetical protein PRUPE_ppa002100mg             429   5e-141   
ref|XP_010921366.1|  PREDICTED: probable boron transporter 2            429   5e-141   
ref|XP_004494453.1|  PREDICTED: probable boron transporter 2-like       429   8e-141   
ref|XP_009393149.1|  PREDICTED: probable boron transporter 2            429   8e-141   
gb|KHG10152.1|  Boron transporter 1 -like protein                       429   9e-141   
ref|XP_003594631.1|  Boron transporter                                  428   1e-140   
gb|ABQ52428.1|  boron transporter                                       427   2e-140   
gb|AEZ56957.1|  boron transporter                                       428   2e-140   
ref|XP_004962742.1|  PREDICTED: probable boron transporter 2-like       427   2e-140   
ref|NP_187296.2|  putative boron transporter 3                          427   5e-140   
gb|KHG11152.1|  putative boron transporter 2 -like protein              426   5e-140   
ref|XP_006297051.1|  hypothetical protein CARUB_v10013052mg             427   6e-140   
ref|XP_003626013.1|  Boron transporter                                  426   7e-140   
ref|XP_010464218.1|  PREDICTED: probable boron transporter 3            427   7e-140   
ref|XP_008360809.1|  PREDICTED: probable boron transporter 2            425   2e-139   
ref|XP_009363008.1|  PREDICTED: probable boron transporter 2            426   2e-139   
ref|XP_007155436.1|  hypothetical protein PHAVU_003G201100g             423   3e-139   
ref|XP_009391991.1|  PREDICTED: probable boron transporter 2            425   3e-139   
ref|XP_010914678.1|  PREDICTED: probable boron transporter 2            424   4e-139   
gb|KDP31090.1|  hypothetical protein JCGZ_11466                         424   4e-139   
ref|XP_010094418.1|  putative boron transporter 2                       423   4e-139   
ref|XP_008239773.1|  PREDICTED: probable boron transporter 2            424   4e-139   
ref|XP_008811526.1|  PREDICTED: probable boron transporter 2 isof...    424   5e-139   
gb|EMT30931.1|  Putative boron transporter 2                            424   5e-139   
ref|XP_008811525.1|  PREDICTED: probable boron transporter 2 isof...    424   5e-139   
gb|AJD08843.1|  boron transporter                                       424   5e-139   
ref|XP_004501922.1|  PREDICTED: boron transporter 1-like                423   8e-139   
ref|XP_002884586.1|  anion exchange family protein                      423   2e-138   
ref|XP_002301535.1|  anion exchange family protein                      423   2e-138   
gb|KHN30916.1|  Putative boron transporter 2                            422   3e-138   
ref|XP_010533486.1|  PREDICTED: boron transporter 1-like                420   5e-138   
gb|KHG23411.1|  putative boron transporter 2 -like protein              421   5e-138   
ref|XP_003579069.1|  PREDICTED: boron transporter 1-like                421   7e-138   
ref|XP_002515224.1|  Boron transporter, putative                        420   1e-137   
dbj|BAJ97664.1|  predicted protein                                      419   6e-137   
dbj|BAK06588.1|  predicted protein                                      418   8e-137   
ref|XP_008781062.1|  PREDICTED: LOW QUALITY PROTEIN: probable bor...    418   9e-137   
gb|AAF08571.1|AC011623_4  unknown protein                               417   3e-136   
gb|KHG13958.1|  Boron transporter 1 -like protein                       416   4e-136   
ref|XP_003550734.1|  PREDICTED: probable boron transporter 2-like       413   1e-135   
ref|XP_003601253.1|  Boron transporter                                  415   2e-135   
ref|XP_009134897.1|  PREDICTED: probable boron transporter 3            416   2e-135   
gb|ADF30185.1|  boron transporter                                       416   2e-135   
emb|CDX74103.1|  BnaA03g29440D                                          415   2e-135   
ref|XP_010691191.1|  PREDICTED: boron transporter 4-like                413   4e-135   
gb|ADF30186.1|  boron transporter                                       414   5e-135   
emb|CAN66593.1|  hypothetical protein VITISV_018358                     411   6e-135   
gb|KHG12566.1|  Putative boron transporter 5 -like protein              402   9e-135   
gb|KEH16038.1|  boron transporter-like protein                          407   5e-134   
emb|CDY69873.1|  BnaAnng31830D                                          404   6e-134   
ref|XP_003525432.1|  PREDICTED: probable boron transporter 2-like       409   2e-133   
gb|KHN34321.1|  Putative boron transporter 2                            408   2e-133   
ref|XP_003588714.1|  Boron transporter-like protein                     404   1e-132   
gb|KHN18451.1|  Boron transporter 1                                     403   1e-131   
gb|ADF30193.1|  boron transporter                                       404   4e-131   
gb|AFW89730.1|  hypothetical protein ZEAMMB73_939088                    408   1e-129   
gb|KCW53789.1|  hypothetical protein EUGRSUZ_J03035                     390   1e-127   
gb|EEE62518.1|  hypothetical protein OsJ_17316                          386   2e-127   
ref|XP_001766018.1|  predicted protein                                  391   2e-127   
gb|EPS73817.1|  hypothetical protein M569_00936                         392   7e-127   
ref|XP_006581925.1|  PREDICTED: boron transporter 1-like isoform X3     389   9e-126   
ref|XP_006407944.1|  hypothetical protein EUTSA_v10020147mg             381   8e-125   
ref|XP_006376858.1|  hypothetical protein POPTR_0012s08340g             380   3e-124   
ref|XP_006578634.1|  PREDICTED: boron transporter 1-like isoform X2     384   4e-124   
ref|XP_002968573.1|  hypothetical protein SELMODRAFT_440430             380   8e-124   
ref|XP_007035928.1|  HCO3- transporter family isoform 3                 377   6e-123   
ref|XP_006427177.1|  hypothetical protein CICLE_v10027318mg             373   6e-121   
gb|KHG05351.1|  Boron transporter 1 -like protein                       378   1e-120   
ref|XP_001759676.1|  predicted protein                                  358   8e-114   
gb|KDO52911.1|  hypothetical protein CISIN_1g042620mg                   336   8e-109   
ref|XP_005644950.1|  hypothetical protein COCSUDRAFT_37744              340   2e-107   
gb|AAD26598.1|  putative anion exchange protein                         322   2e-101   
gb|KDO52914.1|  hypothetical protein CISIN_1g0066281mg                  303   3e-96    
ref|XP_006450502.1|  hypothetical protein CICLE_v10010398mg             306   8e-96    
gb|ACB98708.1|  boron transporter                                       294   2e-91    
gb|KDO61655.1|  hypothetical protein CISIN_1g038033mg                   291   1e-90    
tpg|DAA47031.1|  TPA: hypothetical protein ZEAMMB73_787140              282   1e-87    
ref|XP_006376861.1|  hypothetical protein POPTR_0012s08340g             273   3e-84    
ref|XP_011026637.1|  PREDICTED: boron transporter 4-like                265   5e-81    
pir||T02172  hypothetical protein F14M4.1 - Arabidopsis thaliana        248   2e-75 
gb|KDO52912.1|  hypothetical protein CISIN_1g037025mg                   248   7e-75    
ref|XP_005824671.1|  hypothetical protein GUITHDRAFT_41323              249   7e-74    
gb|KHG18097.1|  Putative boron transporter 5 -like protein              238   6e-72    
ref|XP_010254317.1|  PREDICTED: boron transporter 4-like                199   4e-57    
ref|XP_002975908.1|  hypothetical protein SELMODRAFT_104444             200   2e-55    
gb|KDO52913.1|  hypothetical protein CISIN_1g0066282mg                  187   5e-53    
tpg|DAA46702.1|  TPA: hypothetical protein ZEAMMB73_504549              191   4e-52    
ref|XP_005850992.1|  hypothetical protein CHLNCDRAFT_20008              176   2e-46    
gb|KFK23498.1|  hypothetical protein AALP_AAs41097U000100               160   4e-42    
ref|XP_010322680.1|  PREDICTED: boron transporter 4-like                145   1e-38    
ref|XP_009588835.1|  PREDICTED: probable boron transporter 7            147   1e-38    
ref|NP_001182855.1|  uncharacterized protein LOC100501111               141   4e-37    
ref|XP_010463627.1|  PREDICTED: probable boron transporter 2            140   2e-36    
ref|XP_004340803.1|  anion transporter, putative                        148   2e-36    
ref|XP_008392173.1|  PREDICTED: uncharacterized protein LOC103454355    151   3e-36    
gb|AFG45891.1|  hypothetical protein 0_2279_01                          138   1e-35    
gb|AFG45884.1|  hypothetical protein 0_2279_01                          137   2e-35    
gb|AEW07470.1|  hypothetical protein 0_2279_01                          137   2e-35    
ref|XP_009039499.1|  hypothetical protein AURANDRAFT_1158               138   7e-33    



>ref|XP_011081918.1| PREDICTED: boron transporter 4-like [Sesamum indicum]
 ref|XP_011081919.1| PREDICTED: boron transporter 4-like [Sesamum indicum]
 ref|XP_011081922.1| PREDICTED: boron transporter 4-like [Sesamum indicum]
 ref|XP_011081923.1| PREDICTED: boron transporter 4-like [Sesamum indicum]
Length=662

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/366 (75%), Positives = 317/366 (87%), Gaps = 2/366 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLLAVIFSFGVLLTSLRSR+ARSW YGTG+FRSFIADYGVPLMVV+WTA+
Sbjct  189   KYQFQWLYVNGLLAVIFSFGVLLTSLRSRKARSWRYGTGWFRSFIADYGVPLMVVVWTAL  248

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY +P + P+ VPRRL CPLPWE  S+YHWTV+KDM KVP  YI A FIPA MIA LYFF
Sbjct  249   SYGMPGKAPAGVPRRLFCPLPWESESLYHWTVMKDMAKVPVGYIFAAFIPAVMIAALYFF  308

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVA+Q+AQ KEFNLK P AYHYDIL+LGVMTLICGLLGLPPSNGVLPQ+PMHT+SLA 
Sbjct  309   DHSVAAQLAQQKEFNLKNPPAYHYDILLLGVMTLICGLLGLPPSNGVLPQSPMHTRSLAV  368

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK Q++R++M+ SAKEGM+ QA+ SEIYGRMHAV+VEM S+P+   +K+L NL+ AV+K+
Sbjct  369   LKRQMIREKMVKSAKEGMQEQASHSEIYGRMHAVFVEMESAPSHTTEKDLANLREAVLKH  428

Query  721   DEKD--GNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
             D++D  G  D  K ID HLPV VNEQRVSNLLQSI VGL++CA+PVI+MIPTSVLWGYFA
Sbjct  429   DDEDTNGKFDPEKCIDLHLPVRVNEQRVSNLLQSILVGLAVCAMPVIKMIPTSVLWGYFA  488

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPGNQFWER++LLFVP  RRFKV++  HA+YVESVPFKYI  FTIFQ VY LVC
Sbjct  489   YMAIDSLPGNQFWERVLLLFVPAGRRFKVIQESHASYVESVPFKYIMMFTIFQIVYFLVC  548

Query  1075  FGVTWI  1092
             FG+TWI
Sbjct  549   FGITWI  554



>ref|XP_007013808.1| HCO3- transporter family [Theobroma cacao]
 gb|EOY31427.1| HCO3- transporter family [Theobroma cacao]
Length=666

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/368 (76%), Positives = 319/368 (87%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF WLY NGLLAVIFSFGVL+++L++R+ARSW YGTG+ R FIADYGVPLMV+ WTA+
Sbjct  191   KYQFPWLYTNGLLAVIFSFGVLVSALKTRKARSWCYGTGWLRGFIADYGVPLMVLCWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYT+P +V S VPRRL CPL WEPAS++HWTVIKDMGKVP  YILA FIPA MIAGLYFF
Sbjct  251   SYTIPGKVDSGVPRRLFCPLLWEPASLHHWTVIKDMGKVPIVYILAAFIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLKKPSAYHYDIL+LGVMTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKKPSAYHYDILLLGVMTLICGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
             LK QL+RK+M+ SAKEGM  QA+ SEIYGRM AV++EM +SPA ++ DKEL NLK AVMK
Sbjct  371   LKKQLIRKKMVKSAKEGMLQQASNSEIYGRMQAVFIEMDASPALISVDKELKNLKEAVMK  430

Query  718   ND---EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              D   +  G  D  K IDA+LPV VNEQR+SNLLQS  VGLS+CA+PVI+ IPTSVLWGY
Sbjct  431   GDDGQDAKGKFDPVKHIDAYLPVRVNEQRMSNLLQSFLVGLSMCALPVIKKIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI+LLF+ P+RR+KVLEG+HA++VESVPFK I  FT+FQFVY L
Sbjct  491   FAYMAIDSLPGNQFWERILLLFITPSRRYKVLEGVHASFVESVPFKSILLFTLFQFVYFL  550

Query  1069  VCFGVTWI  1092
             VCFGVTWI
Sbjct  551   VCFGVTWI  558



>ref|XP_009621374.1| PREDICTED: probable boron transporter 7 [Nicotiana tomentosiformis]
 ref|XP_009621375.1| PREDICTED: probable boron transporter 7 [Nicotiana tomentosiformis]
Length=655

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/368 (74%), Positives = 310/368 (84%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+ FQWLY NGLLAVIFSFGVLLTSL+SR ARSW YGTG+ RSFIADYGVPLMVVLWTA+
Sbjct  191   EFHFQWLYTNGLLAVIFSFGVLLTSLKSRGARSWRYGTGWMRSFIADYGVPLMVVLWTAM  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP ++PS VPRRL CPLPWEP S+YHWTVIKDM +VP  YI + FIPA MIAGLYFF
Sbjct  251   SFGVPGKIPSEVPRRLFCPLPWEPKSLYHWTVIKDMARVPVLYIFSAFIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVA+QMAQ KEFNLK PSAYHYD+ +LGVMTLICGLLG+PPSNGVLPQ+PMHT+SLA 
Sbjct  311   DHSVAAQMAQQKEFNLKNPSAYHYDLFLLGVMTLICGLLGIPPSNGVLPQSPMHTRSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+RK+M+ SAKEG+K  ATKSEIYG+MHAV+VEM ++    ADKEL NLK AV+K+
Sbjct  371   LKRQLIRKKMVKSAKEGIKQNATKSEIYGKMHAVFVEMDATSKRTADKELENLKAAVLKH  430

Query  721   DE----KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             D+     D N D  K IDAHLPV VNEQRVSN LQS+ VG  + A+PVIR IPTSVLWGY
Sbjct  431   DDGEDGADENFDPEKHIDAHLPVRVNEQRVSNFLQSLLVGCCVFAIPVIRRIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+P  RRFKV EG+HA+YVE VPFK+I  FT  QF+Y L
Sbjct  491   FAYMAIDSLPGNQFWERVLLLFIPSGRRFKVFEGLHASYVELVPFKFIVKFTALQFLYFL  550

Query  1069  VCFGVTWI  1092
             +CFGVTWI
Sbjct  551   ICFGVTWI  558



>ref|XP_006364282.1| PREDICTED: probable boron transporter 7-like [Solanum tuberosum]
Length=656

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/368 (73%), Positives = 308/368 (84%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+ F+WLY NGLLAVIFSFGVLL SL+SR ARSW YGTG+ RSFIADYGVPLMVVLWTA+
Sbjct  191   EFHFEWLYTNGLLAVIFSFGVLLASLKSRGARSWRYGTGWMRSFIADYGVPLMVVLWTAM  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP ++PS VPRRL CPLPWE  S+YHWTV+KDM +VP  YI A FIPA MIAGLYFF
Sbjct  251   SFGVPGKIPSEVPRRLFCPLPWEAKSLYHWTVMKDMVRVPVLYIFAAFIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVA+QMAQ  EFNLK PSAYHYD+ +LGVMTLICGLLG+PPSNGVLPQ+PMHT+SLA 
Sbjct  311   DHSVAAQMAQQNEFNLKNPSAYHYDLFLLGVMTLICGLLGIPPSNGVLPQSPMHTRSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+RK+M+ SAKEG+K  ATKSEIYG+MHAV+VEM ++    ADK+L NLK AVMK+
Sbjct  371   LKRQLIRKKMVKSAKEGIKQNATKSEIYGKMHAVFVEMDATSKRTADKDLENLKAAVMKH  430

Query  721   DE----KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             D+     DG  D  K IDAHLPV VNEQRVSN LQS+ VG S+ A+PVIR IPTSVLWGY
Sbjct  431   DDGENGTDGKFDPEKHIDAHLPVRVNEQRVSNFLQSLLVGCSVFAIPVIRRIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LL +P  RRFKV EG+HA+YV SVPFKYI  FT+ QFVY L
Sbjct  491   FAYMAIDSLPGNQFWERLLLLLIPSGRRFKVFEGLHASYVASVPFKYIVKFTMLQFVYFL  550

Query  1069  VCFGVTWI  1092
             +CFGVTWI
Sbjct  551   ICFGVTWI  558



>ref|XP_004245187.1| PREDICTED: probable boron transporter 7 [Solanum lycopersicum]
Length=656

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/368 (73%), Positives = 308/368 (84%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+ F+WLY NGLLAVIFSFGVLL SL+SR ARSW YGTG+ RSFIADYGVPLMVVLWTA+
Sbjct  191   EFHFEWLYTNGLLAVIFSFGVLLASLKSRGARSWRYGTGWMRSFIADYGVPLMVVLWTAM  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP ++PS VPRRL CPLPWE  S+YHWTVIKDM +VP  YI A  IPA MIAGLYFF
Sbjct  251   SFGVPGKIPSEVPRRLFCPLPWEAKSLYHWTVIKDMVRVPVLYIFAAIIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVA+QMAQ  EFNLK PSAYHYD+ +LGVMTLICGLLG+PPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVAAQMAQQSEFNLKNPSAYHYDLFLLGVMTLICGLLGIPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+RK+M+ SAKEG+K  ATKSEIYG+MHAV+VEM ++    AD++L NLK AVMK+
Sbjct  371   LKRQLIRKKMVKSAKEGIKQNATKSEIYGKMHAVFVEMDATSKRTADRDLENLKAAVMKH  430

Query  721   DE----KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             ++     +G  DL K IDAHLPV VNEQRVSN LQS+ VG S+ A+PVIR IPTSVLWGY
Sbjct  431   EDGENGTEGKFDLEKHIDAHLPVRVNEQRVSNFLQSLLVGCSVFAIPVIRRIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+P  RRFKV EG+HA+Y+ SVPFKYI  FT+ Q VY L
Sbjct  491   FAYMAIDSLPGNQFWERLLLLFIPSGRRFKVFEGLHASYIASVPFKYIVKFTMLQLVYFL  550

Query  1069  VCFGVTWI  1092
             +CFGVTWI
Sbjct  551   ICFGVTWI  558



>ref|XP_009799564.1| PREDICTED: probable boron transporter 7 [Nicotiana sylvestris]
Length=655

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/368 (73%), Positives = 306/368 (83%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+ FQWLY NGL+AVIFSFGVLLTSL+SR ARSW YGTG+ RSF ADYGVPLMVVLWTA+
Sbjct  191   EFHFQWLYTNGLMAVIFSFGVLLTSLKSRGARSWRYGTGWMRSFTADYGVPLMVVLWTAM  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP  +PS VPRRL CPLPWE  S+YHWTVIKDM +VP  YI A FIPA MIAGLYFF
Sbjct  251   SFGVPGNIPSEVPRRLFCPLPWEAKSLYHWTVIKDMARVPVLYIFAAFIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVA+QMAQ KEFNLK PSAYHYD+ +LGVMTLICGLLG+PPSNGVLPQ+PMHT+SLA 
Sbjct  311   DHSVAAQMAQQKEFNLKNPSAYHYDLFLLGVMTLICGLLGIPPSNGVLPQSPMHTRSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+RK+M+ +AKEG+K  ATKSEIYG+MHAV+VEM ++    ADK+L NLK AV+K+
Sbjct  371   LKRQLIRKKMVKTAKEGIKQNATKSEIYGKMHAVFVEMDATSKRTADKDLENLKAAVLKH  430

Query  721   DE----KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             D+     D   D  K IDAHLPV VNEQRVSN LQS+ VG  + A+PVIR IPTSVLWGY
Sbjct  431   DDGEDGADEKFDPEKHIDAHLPVRVNEQRVSNFLQSLLVGCCVLAIPVIRRIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+P  RRFKV EG+HA+YVE VPFK+I  FT  QF+Y L
Sbjct  491   FAYMAIDSLPGNQFWERVLLLFIPSGRRFKVFEGLHASYVELVPFKFIVKFTALQFLYFL  550

Query  1069  VCFGVTWI  1092
             +CFGVTWI
Sbjct  551   ICFGVTWI  558



>ref|XP_010102816.1| Boron transporter 4 [Morus notabilis]
 gb|EXB94144.1| Boron transporter 4 [Morus notabilis]
Length=663

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/367 (73%), Positives = 312/367 (85%), Gaps = 6/367 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWL+ NGLLAVIF+FG+L T+L+SR ARSW YGTG+ R FI DYGVPLMVV+WTA+
Sbjct  191   KYQFQWLFVNGLLAVIFAFGLLFTALKSRRARSWRYGTGWLRGFITDYGVPLMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY+VP++VP  VPRRL CPLPWE AS+YHWTVIKDMGKVP  YI A FIPA  IAGLYFF
Sbjct  251   SYSVPRKVPEGVPRRLFCPLPWESASLYHWTVIKDMGKVPGLYIFAAFIPAVTIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+KPSA+HYDIL+LG+MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLQKPSAFHYDILLLGIMTLICGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ +L+RK+M+ SAKE +K QA+ +EIYG+M AV++EM +SP P   KEL NLK AVM+ 
Sbjct  371   LRRRLIRKKMVKSAKECIKQQASNTEIYGKMQAVFIEMDASPTP---KELENLKEAVMQV  427

Query  721   DE---KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D+    +G  D  K IDA+LPV VNEQR+SNLLQS+ VGLS+C V VI+MIPTSVLWGYF
Sbjct  428   DDGGPANGKFDPEKHIDAYLPVRVNEQRMSNLLQSLLVGLSMCTVSVIKMIPTSVLWGYF  487

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPG QFWERI+LL + P RR+KVLEG HA+YVESVPFKYI  FTIFQ VYLL+
Sbjct  488   AYMAIDSLPGIQFWERILLLLITPRRRYKVLEGSHASYVESVPFKYITLFTIFQLVYLLI  547

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  548   CFGVTWI  554



>ref|XP_010049957.1| PREDICTED: boron transporter 4-like isoform X1 [Eucalyptus grandis]
 gb|KCW82787.1| hypothetical protein EUGRSUZ_C04162 [Eucalyptus grandis]
Length=668

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/366 (72%), Positives = 316/366 (86%), Gaps = 3/366 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
              Y FQW Y NGLL +IF+FG++ T+L+SR ARSWPYGTG+FRSFIADYGVPLMV++W+A+
Sbjct  191   RYHFQWRYVNGLLGIIFTFGLVSTALKSRRARSWPYGTGWFRSFIADYGVPLMVLIWSAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             +++VPK VPS VPRRL  PLPWEPAS++HW+VIKDMG+VPP YI A FIPA M+AGLYFF
Sbjct  251   AFSVPKSVPSGVPRRLYSPLPWEPASLHHWSVIKDMGRVPPAYIFAAFIPAVMVAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFN+K PSAYHYD+L+LG+MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNIKNPSAYHYDVLVLGLMTLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+RK+M+ SAKE MK +A+KSEIYG+M  V+VEM S+P     KEL  LK AVM +
Sbjct  371   LKRQLIRKKMVESAKECMKQKASKSEIYGKMQQVFVEMDSTPTLSVAKELKQLKDAVMGS  430

Query  721   DEKDGNLD--LAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
             +++D N+D   AK IDAHLPV VNEQRVSNLLQS+ +G +I A+PVI+ IPTSVLWGYFA
Sbjct  431   EDED-NVDGQFAKHIDAHLPVRVNEQRVSNLLQSLLLGAAILAMPVIKQIPTSVLWGYFA  489

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPGNQFWERI+LLFV P RR+K+LEG HA++VESVPFK++A FT+FQ VYLLVC
Sbjct  490   YMAIDSLPGNQFWERILLLFVTPRRRYKILEGAHASFVESVPFKWMAAFTLFQVVYLLVC  549

Query  1075  FGVTWI  1092
             FGVTWI
Sbjct  550   FGVTWI  555



>gb|KCW82788.1| hypothetical protein EUGRSUZ_C04162 [Eucalyptus grandis]
Length=667

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/366 (72%), Positives = 316/366 (86%), Gaps = 3/366 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
              Y FQW Y NGLL +IF+FG++ T+L+SR ARSWPYGTG+FRSFIADYGVPLMV++W+A+
Sbjct  191   RYHFQWRYVNGLLGIIFTFGLVSTALKSRRARSWPYGTGWFRSFIADYGVPLMVLIWSAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             +++VPK VPS VPRRL  PLPWEPAS++HW+VIKDMG+VPP YI A FIPA M+AGLYFF
Sbjct  251   AFSVPKSVPSGVPRRLYSPLPWEPASLHHWSVIKDMGRVPPAYIFAAFIPAVMVAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFN+K PSAYHYD+L+LG+MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNIKNPSAYHYDVLVLGLMTLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+RK+M+ SAKE MK +A+KSEIYG+M  V+VEM S+P     KEL  LK AVM +
Sbjct  371   LKRQLIRKKMVESAKECMKQKASKSEIYGKMQQVFVEMDSTPTLSVAKELKQLKDAVMGS  430

Query  721   DEKDGNLD--LAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
             +++D N+D   AK IDAHLPV VNEQRVSNLLQS+ +G +I A+PVI+ IPTSVLWGYFA
Sbjct  431   EDED-NVDGQFAKHIDAHLPVRVNEQRVSNLLQSLLLGAAILAMPVIKQIPTSVLWGYFA  489

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPGNQFWERI+LLFV P RR+K+LEG HA++VESVPFK++A FT+FQ VYLLVC
Sbjct  490   YMAIDSLPGNQFWERILLLFVTPRRRYKILEGAHASFVESVPFKWMAAFTLFQVVYLLVC  549

Query  1075  FGVTWI  1092
             FGVTWI
Sbjct  550   FGVTWI  555



>ref|XP_011085892.1| PREDICTED: boron transporter 4-like [Sesamum indicum]
 ref|XP_011085938.1| PREDICTED: boron transporter 4-like [Sesamum indicum]
 ref|XP_011086017.1| PREDICTED: boron transporter 4-like [Sesamum indicum]
 ref|XP_011086102.1| PREDICTED: boron transporter 4-like [Sesamum indicum]
Length=663

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/366 (73%), Positives = 308/366 (84%), Gaps = 3/366 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             + F+WLY NGLLAVIF+ GVL+TSL+SREARSW YGTG+ RS IADYGVPLMVVLWTA+S
Sbjct  190   FHFEWLYINGLLAVIFTIGVLITSLKSREARSWRYGTGWLRSIIADYGVPLMVVLWTAIS  249

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y+VP ++PS VPRRL   LPW+ +SMYHWTV KDMGKVP  YI A  IPA MIAGLYFFD
Sbjct  250   YSVPSKIPSGVPRRLNSALPWDSSSMYHWTVAKDMGKVPAGYIFAAIIPALMIAGLYFFD  309

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ  EFNL KP+AYHYDIL+LGVMTLICGLLGLPPSNGVLPQ+PMHTKSLA L
Sbjct  310   HSVASQLAQQSEFNLTKPTAYHYDILLLGVMTLICGLLGLPPSNGVLPQSPMHTKSLAVL  369

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKND  723
             K Q++R +M+  AKEGMK Q + +EIYGRMHAV+VEM S+P+   +KEL +LK AV+K+D
Sbjct  370   KKQVIRDKMVKCAKEGMKEQVSHTEIYGRMHAVFVEMDSAPSQAVEKELADLKEAVVKHD  429

Query  724   ---EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
                E +G  D  K ID HLPV VNEQRVSN LQS+ VGLSICA+PVI+MIPTSVLWGYFA
Sbjct  430   NEGESNGKFDPEKCIDLHLPVRVNEQRVSNFLQSVAVGLSICAMPVIKMIPTSVLWGYFA  489

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YM  +SLPGNQFWER++LL VPP RRFK+LE  HA++VESVPFKYI  FT+FQ VYLLVC
Sbjct  490   YMGIESLPGNQFWERMLLLLVPPRRRFKILEESHASFVESVPFKYITSFTLFQLVYLLVC  549

Query  1075  FGVTWI  1092
             FG+TWI
Sbjct  550   FGITWI  555



>gb|EYU21945.1| hypothetical protein MIMGU_mgv1a002503mg [Erythranthe guttata]
Length=666

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/366 (75%), Positives = 319/366 (87%), Gaps = 2/366 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLLAVIFSFG+L+T+L+SR+ARSW YG+G+FRSFIADYGVP+MVV+WTA+
Sbjct  192   KYQFQWLYTNGLLAVIFSFGLLITALKSRKARSWRYGSGWFRSFIADYGVPMMVVVWTAL  251

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY++P ++P+ VPRRL CPLPWE  S+YHWTVI DMGK+P  YI A  IPA MIAGLYFF
Sbjct  252   SYSIPSQIPTGVPRRLFCPLPWESESLYHWTVINDMGKIPAGYIFAAIIPAMMIAGLYFF  311

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDI +LGVMTL+CGLLGLPPSNGVLPQ+PMHT+SLA 
Sbjct  312   DHSVASQLAQQKEFNLKNPSAYHYDIFLLGVMTLLCGLLGLPPSNGVLPQSPMHTRSLAV  371

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK Q+MRK+M+ SAKEG+K QA+ SEIYGRMHAV++EM  +P+ VADKEL NLK AV+ +
Sbjct  372   LKRQIMRKKMVKSAKEGIKEQASNSEIYGRMHAVFIEMEGAPSHVADKELANLKEAVLSH  431

Query  721   D--EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
             +  E + N D  K ID HLPV VNEQRVSNLLQSI VGLSIC +PVI+MIP+SVLWGYFA
Sbjct  432   EDGEANDNFDPEKCIDLHLPVRVNEQRVSNLLQSILVGLSICIMPVIKMIPSSVLWGYFA  491

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPGNQFWERI+LLFVPP RRFKV++G HA++VESVPFKYI  FTIFQ  YLL+C
Sbjct  492   YMAIDSLPGNQFWERILLLFVPPGRRFKVIQGFHASFVESVPFKYIFMFTIFQLAYLLMC  551

Query  1075  FGVTWI  1092
             FG+TWI
Sbjct  552   FGITWI  557



>ref|XP_002299613.2| anion exchange family protein [Populus trichocarpa]
 gb|EEE84418.2| anion exchange family protein [Populus trichocarpa]
Length=665

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/364 (72%), Positives = 308/364 (85%), Gaps = 0/364 (0%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IF+FG+L T+L+SR AR+W YGTG+FRSFIADYGVPLMVV WTA+
Sbjct  191   KYQFQWLYTNGLLGIIFTFGLLYTALKSRRARAWWYGTGWFRSFIADYGVPLMVVAWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+++P +VPS VPRRL  PLP + AS++HWTVIKDMG VPP YI A FIPA MIAGLYFF
Sbjct  251   SFSIPSKVPSGVPRRLFSPLPRDSASLHHWTVIKDMGNVPPAYIFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+ASAKE +K +A+ SEIYG M AV++EM S P     KEL +LK AVMK 
Sbjct  371   LKRQLIRRKMVASAKESIKQKASNSEIYGNMQAVFIEMDSIPINAVIKELEDLKEAVMKG  430

Query  721   DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAYM  900
             ++     D  K IDA+LPV VNEQRVSN LQS+ V  S+CA+P I++IPTSVLWGYFAYM
Sbjct  431   EDPKDTFDPEKHIDAYLPVRVNEQRVSNFLQSLLVAASVCAMPAIKLIPTSVLWGYFAYM  490

Query  901   ATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCFG  1080
             A DSLPGNQFWER++LLF+ P RR+KVLEGIHA++VES+PFKYIA FTIFQFVY LVCFG
Sbjct  491   AIDSLPGNQFWERMLLLFIAPGRRYKVLEGIHASFVESIPFKYIAIFTIFQFVYFLVCFG  550

Query  1081  VTWI  1092
             VTWI
Sbjct  551   VTWI  554



>gb|KDP33629.1| hypothetical protein JCGZ_07200 [Jatropha curcas]
Length=663

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/368 (71%), Positives = 314/368 (85%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+FQWLYANGLLA+IFS G+L T+L+SR+ARSW YGTG+FRSFIADYGVPLMV+LWT +
Sbjct  191   QYRFQWLYANGLLAIIFSLGLLGTALKSRKARSWRYGTGWFRSFIADYGVPLMVLLWTLM  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY+VP +VP+ VPRRL CPL W+ ASMYHWTV+KDMGKVP  YI A  +PA MIAGLYFF
Sbjct  251   SYSVPSKVPTGVPRRLYCPLLWDSASMYHWTVVKDMGKVPLVYIFAAIVPAIMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG +TLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLKNPSAYHYDILLLGFLTLICGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
             LK QL+RK+M+ SAKE ++ +A+  EIYG+M AV++EM ++P   + DKEL +LK AVMK
Sbjct  371   LKKQLIRKKMVKSAKECIERKASNKEIYGKMQAVFIEMDTAPPTASVDKELEDLKEAVMK  430

Query  718   NDEKDGN---LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             ND+  G     D  K IDA+LPV VNEQRVSNLLQS+ VGL+ CA+P+++ IPTSVLWGY
Sbjct  431   NDDGGGANEIFDPDKHIDAYLPVRVNEQRVSNLLQSLLVGLATCALPIVKNIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI+LLF+P  RR+K+LEG+HA++VE VPFK I  FT+FQFVYLL
Sbjct  491   FAYMAIDSLPGNQFWERILLLFIPAKRRYKLLEGVHASFVELVPFKQIVIFTLFQFVYLL  550

Query  1069  VCFGVTWI  1092
             +CFGVTWI
Sbjct  551   ICFGVTWI  558



>ref|XP_007023953.1| Boron transporter, putative [Theobroma cacao]
 gb|EOY26575.1| Boron transporter, putative [Theobroma cacao]
Length=668

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/368 (70%), Positives = 310/368 (84%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGL+ +IF+FG+L T+L+SR ARSW YGTG+FRS IADYGVPLMVVLWT +
Sbjct  191   KYQFQWLYTNGLVGIIFTFGLLYTALKSRRARSWWYGTGWFRSLIADYGVPLMVVLWTVL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VPS VPRRL  PLPWE AS+ HWTVIKDMGK+PP YI + F+PA MIAGLYFF
Sbjct  251   SFSVPSKVPSGVPRRLFSPLPWESASLEHWTVIKDMGKIPPLYIFSAFLPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLAL  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+ SAKE +K +A+ SEIYG+M AV++EM SSP     KEL +LK  VMK 
Sbjct  371   LKRQLIRRKMVKSAKESIKQKASNSEIYGKMQAVFIEMDSSPETTIVKELEDLKKVVMKG  430

Query  721   DEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             ++K  N     D  + IDA+LPV VNEQRVSNLLQS+ V  S+CA+P I++IPTSVLWGY
Sbjct  431   EKKGENEKETFDPERHIDAYLPVRVNEQRVSNLLQSLLVAASVCAIPAIKLIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P RR+KVLEG+HA++VESVP++YI  FT+FQ VYLL
Sbjct  491   FAYMAIDSLPGNQFWERMLLLFITPGRRYKVLEGVHASFVESVPYRYIVMFTLFQLVYLL  550

Query  1069  VCFGVTWI  1092
             +CFGVTWI
Sbjct  551   LCFGVTWI  558



>ref|XP_011035643.1| PREDICTED: boron transporter 4-like isoform X4 [Populus euphratica]
Length=561

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/364 (72%), Positives = 305/364 (84%), Gaps = 0/364 (0%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQ LY NGLL +IF+FG+L T+L+SR AR+W YGTG+FR+FIADYGVP MVV WTA+
Sbjct  90    KYQFQMLYTNGLLGIIFTFGLLYTALKSRRARAWWYGTGWFRNFIADYGVPFMVVAWTAL  149

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+++P +VPS VPRRL  PLP + AS++HWTVIKDMG VPP YI A FIPA MIAGLYFF
Sbjct  150   SFSIPSKVPSGVPRRLYSPLPLDSASLHHWTVIKDMGSVPPAYIFAAFIPALMIAGLYFF  209

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL GLPP NGVLPQ+PMHTKSLA 
Sbjct  210   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLTGLPPCNGVLPQSPMHTKSLAV  269

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+ASAKE +K +A+ SEIYG M AV+VEM S P     KEL +LK AVMK 
Sbjct  270   LKRQLIRRKMVASAKESIKQKASNSEIYGNMQAVFVEMDSIPINAVIKELEDLKEAVMKG  329

Query  721   DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAYM  900
             ++ +   D  K IDA+LPV VNEQRVSN LQS+ V  S+CA+P I++IPTSVLWGYFAYM
Sbjct  330   EDSEDTFDPEKHIDAYLPVRVNEQRVSNFLQSLLVAASVCAIPAIKLIPTSVLWGYFAYM  389

Query  901   ATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCFG  1080
             A DSLPGNQFWER++LLF+ P RR+KVLEGIHA++VESVPFKYIA FTIFQFVY LVCFG
Sbjct  390   AIDSLPGNQFWERMLLLFIAPGRRYKVLEGIHASFVESVPFKYIAIFTIFQFVYFLVCFG  449

Query  1081  VTWI  1092
             VTWI
Sbjct  450   VTWI  453



>ref|XP_002304164.2| anion exchange family protein [Populus trichocarpa]
 gb|EEE79143.2| anion exchange family protein [Populus trichocarpa]
Length=675

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/364 (71%), Positives = 306/364 (84%), Gaps = 0/364 (0%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IF+FG+L T+L+SR AR+W YGTG+FRSFIADYGVPLMVV+WTA+
Sbjct  191   KYQFQWLYTNGLLGIIFTFGLLYTALKSRRARAWWYGTGWFRSFIADYGVPLMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+++P +VPS VPR+L  PLPWE AS++HWTVIKDMG VPP YI A F+PA MIAGLYFF
Sbjct  251   SFSIPSKVPSGVPRKLFSPLPWESASLHHWTVIKDMGNVPPAYIFAAFVPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+L  MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDILLLSFMTLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+ SAKE +K +A+ SEIYG+M  V++EM SSP     +EL +LK AVMK 
Sbjct  371   LKRQLIRRKMVESAKESIKQKASNSEIYGKMQDVFIEMDSSPITTVVRELEDLKEAVMKG  430

Query  721   DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAYM  900
             +      D  K IDA+LPV VNEQRVSN LQS+ V  S+ AVP I++IPTSVLWGYFAYM
Sbjct  431   ENPKDTFDPEKHIDAYLPVRVNEQRVSNFLQSLLVAASVSAVPAIKLIPTSVLWGYFAYM  490

Query  901   ATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCFG  1080
             A DSLPGNQFWER++LLFV P RR+KVLEG+HA++VESVPFKYIA FTIFQFVY L C+G
Sbjct  491   AIDSLPGNQFWERMLLLFVTPGRRYKVLEGVHASFVESVPFKYIAIFTIFQFVYFLFCYG  550

Query  1081  VTWI  1092
             VTWI
Sbjct  551   VTWI  554



>ref|XP_011085180.1| PREDICTED: boron transporter 4-like [Sesamum indicum]
Length=665

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/366 (72%), Positives = 304/366 (83%), Gaps = 3/366 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             Y F+WLY NGLLAVIF+ GVL+ SL SREARSW YGTG+ RS IADYGVPLMVVLWTA+S
Sbjct  190   YHFEWLYINGLLAVIFTIGVLIMSLESREARSWRYGTGWLRSIIADYGVPLMVVLWTAIS  249

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y+VP ++PS VPRRL   LPW+ +SMYHWTV KDMGKVP  YI A  IPA MIAGLYFFD
Sbjct  250   YSVPSKIPSGVPRRLNSALPWDSSSMYHWTVAKDMGKVPAGYIFAAIIPALMIAGLYFFD  309

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ  EFNL KP+AYHYDIL+LGVMTLICGLLGLPPSNGVLPQ+PMHTKSLA L
Sbjct  310   HSVASQLAQQSEFNLTKPTAYHYDILLLGVMTLICGLLGLPPSNGVLPQSPMHTKSLAVL  369

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKND  723
             K Q++R +M+  AKEGMK Q + SEIY RMH V+VEM S+P+   +KEL +LK AV+K+D
Sbjct  370   KKQVIRDKMVKCAKEGMKEQVSHSEIYRRMHTVFVEMDSAPSQAVEKELADLKEAVVKHD  429

Query  724   ---EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
                E +G  D  K ID HLPV VNEQRVSN LQS+ VGL+ICA+PVI+MIPTSVLWGYFA
Sbjct  430   NEGESNGKFDPEKCIDLHLPVRVNEQRVSNFLQSVAVGLAICAMPVIKMIPTSVLWGYFA  489

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YM  +SLPGNQFWER++LL VPP RRFKVL+  HA++VESVPFKYI  FT+FQ VYLLVC
Sbjct  490   YMGIESLPGNQFWERMLLLLVPPRRRFKVLQESHASFVESVPFKYITSFTLFQLVYLLVC  549

Query  1075  FGVTWI  1092
             FG+TWI
Sbjct  550   FGITWI  555



>ref|XP_011035641.1| PREDICTED: boron transporter 4-like isoform X3 [Populus euphratica]
 ref|XP_011035642.1| PREDICTED: boron transporter 4-like isoform X3 [Populus euphratica]
Length=662

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/364 (72%), Positives = 305/364 (84%), Gaps = 0/364 (0%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQ LY NGLL +IF+FG+L T+L+SR AR+W YGTG+FR+FIADYGVP MVV WTA+
Sbjct  191   KYQFQMLYTNGLLGIIFTFGLLYTALKSRRARAWWYGTGWFRNFIADYGVPFMVVAWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+++P +VPS VPRRL  PLP + AS++HWTVIKDMG VPP YI A FIPA MIAGLYFF
Sbjct  251   SFSIPSKVPSGVPRRLYSPLPLDSASLHHWTVIKDMGSVPPAYIFAAFIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL GLPP NGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLTGLPPCNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+ASAKE +K +A+ SEIYG M AV+VEM S P     KEL +LK AVMK 
Sbjct  371   LKRQLIRRKMVASAKESIKQKASNSEIYGNMQAVFVEMDSIPINAVIKELEDLKEAVMKG  430

Query  721   DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAYM  900
             ++ +   D  K IDA+LPV VNEQRVSN LQS+ V  S+CA+P I++IPTSVLWGYFAYM
Sbjct  431   EDSEDTFDPEKHIDAYLPVRVNEQRVSNFLQSLLVAASVCAIPAIKLIPTSVLWGYFAYM  490

Query  901   ATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCFG  1080
             A DSLPGNQFWER++LLF+ P RR+KVLEGIHA++VESVPFKYIA FTIFQFVY LVCFG
Sbjct  491   AIDSLPGNQFWERMLLLFIAPGRRYKVLEGIHASFVESVPFKYIAIFTIFQFVYFLVCFG  550

Query  1081  VTWI  1092
             VTWI
Sbjct  551   VTWI  554



>ref|XP_011035639.1| PREDICTED: boron transporter 4-like isoform X1 [Populus euphratica]
Length=697

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/364 (72%), Positives = 305/364 (84%), Gaps = 0/364 (0%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQ LY NGLL +IF+FG+L T+L+SR AR+W YGTG+FR+FIADYGVP MVV WTA+
Sbjct  226   KYQFQMLYTNGLLGIIFTFGLLYTALKSRRARAWWYGTGWFRNFIADYGVPFMVVAWTAL  285

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+++P +VPS VPRRL  PLP + AS++HWTVIKDMG VPP YI A FIPA MIAGLYFF
Sbjct  286   SFSIPSKVPSGVPRRLYSPLPLDSASLHHWTVIKDMGSVPPAYIFAAFIPALMIAGLYFF  345

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL GLPP NGVLPQ+PMHTKSLA 
Sbjct  346   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLTGLPPCNGVLPQSPMHTKSLAV  405

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+ASAKE +K +A+ SEIYG M AV+VEM S P     KEL +LK AVMK 
Sbjct  406   LKRQLIRRKMVASAKESIKQKASNSEIYGNMQAVFVEMDSIPINAVIKELEDLKEAVMKG  465

Query  721   DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAYM  900
             ++ +   D  K IDA+LPV VNEQRVSN LQS+ V  S+CA+P I++IPTSVLWGYFAYM
Sbjct  466   EDSEDTFDPEKHIDAYLPVRVNEQRVSNFLQSLLVAASVCAIPAIKLIPTSVLWGYFAYM  525

Query  901   ATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCFG  1080
             A DSLPGNQFWER++LLF+ P RR+KVLEGIHA++VESVPFKYIA FTIFQFVY LVCFG
Sbjct  526   AIDSLPGNQFWERMLLLFIAPGRRYKVLEGIHASFVESVPFKYIAIFTIFQFVYFLVCFG  585

Query  1081  VTWI  1092
             VTWI
Sbjct  586   VTWI  589



>ref|XP_011035640.1| PREDICTED: boron transporter 4-like isoform X2 [Populus euphratica]
Length=696

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/364 (72%), Positives = 305/364 (84%), Gaps = 0/364 (0%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQ LY NGLL +IF+FG+L T+L+SR AR+W YGTG+FR+FIADYGVP MVV WTA+
Sbjct  226   KYQFQMLYTNGLLGIIFTFGLLYTALKSRRARAWWYGTGWFRNFIADYGVPFMVVAWTAL  285

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+++P +VPS VPRRL  PLP + AS++HWTVIKDMG VPP YI A FIPA MIAGLYFF
Sbjct  286   SFSIPSKVPSGVPRRLYSPLPLDSASLHHWTVIKDMGSVPPAYIFAAFIPALMIAGLYFF  345

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL GLPP NGVLPQ+PMHTKSLA 
Sbjct  346   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLTGLPPCNGVLPQSPMHTKSLAV  405

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+ASAKE +K +A+ SEIYG M AV+VEM S P     KEL +LK AVMK 
Sbjct  406   LKRQLIRRKMVASAKESIKQKASNSEIYGNMQAVFVEMDSIPINAVIKELEDLKEAVMKG  465

Query  721   DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAYM  900
             ++ +   D  K IDA+LPV VNEQRVSN LQS+ V  S+CA+P I++IPTSVLWGYFAYM
Sbjct  466   EDSEDTFDPEKHIDAYLPVRVNEQRVSNFLQSLLVAASVCAIPAIKLIPTSVLWGYFAYM  525

Query  901   ATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCFG  1080
             A DSLPGNQFWER++LLF+ P RR+KVLEGIHA++VESVPFKYIA FTIFQFVY LVCFG
Sbjct  526   AIDSLPGNQFWERMLLLFIAPGRRYKVLEGIHASFVESVPFKYIAIFTIFQFVYFLVCFG  585

Query  1081  VTWI  1092
             VTWI
Sbjct  586   VTWI  589



>ref|XP_010254316.1| PREDICTED: boron transporter 4 [Nelumbo nucifera]
Length=673

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/368 (72%), Positives = 307/368 (83%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLYANGLL +IFSFG+L T+L+SR ARSW YGTG+ RSFIADYGVPLMV++WTA+
Sbjct  191   KYQFQWLYANGLLGLIFSFGLLYTALKSRRARSWRYGTGWLRSFIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VPS VPRRL  PLPW+  S+YHWTVIKDM +VP  YI A FIPA M+AGLYFF
Sbjct  251   SFSVPSKVPSGVPRRLFSPLPWDSDSLYHWTVIKDMWRVPVVYIFAAFIPAVMVAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ K+FNLK PSAYHYDI +LGVM L+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKDFNLKNPSAYHYDIFLLGVMVLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+RK+M+ SAKE +K QA+ SEIYG+M AV++EM ++P  V  KEL  LK AVM  
Sbjct  371   LKRQLLRKKMVESAKECIKQQASNSEIYGKMQAVFIEMDAAPKTVVTKELKGLKEAVMSG  430

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             + + G++    D  K ID +LPV VNEQRVSNLLQS  VG SI A+ +IR IPTSVLWGY
Sbjct  431   ENEGGDMKRKFDPEKHIDEYLPVRVNEQRVSNLLQSALVGASIFAMSIIRTIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI+LLFV P RRFKVLEG HA++VE VPFKYIA FT+FQFVYLL
Sbjct  491   FAYMAIDSLPGNQFWERILLLFVTPGRRFKVLEGDHASFVELVPFKYIATFTLFQFVYLL  550

Query  1069  VCFGVTWI  1092
             +CFGVTWI
Sbjct  551   ICFGVTWI  558



>ref|XP_002281778.2| PREDICTED: boron transporter 4 [Vitis vinifera]
 emb|CBI28149.3| unnamed protein product [Vitis vinifera]
Length=675

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/367 (71%), Positives = 311/367 (85%), Gaps = 3/367 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY+NGLLA+IFSFG+L T+L+SR ARSW YGTG+ R FIADYGVPLMV++WTA+
Sbjct  191   KYQFQWLYSNGLLAIIFSFGLLFTALKSRRARSWSYGTGWSRGFIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VPS VPRRL  PLPWE AS+ HW VIKDMGK+PP YILA  IPA MIAGLYFF
Sbjct  251   SFSVPSKVPSGVPRRLFSPLPWESASLQHWIVIKDMGKIPPAYILAAIIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQM+Q KEFNLK PSAYHYDIL+LGVMTL+CG LGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMSQQKEFNLKNPSAYHYDILLLGVMTLLCGFLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK +L+R++M+ SAKE +K QA+ +EIY +M AV++EM  +P+ +  +EL +LK A+MK 
Sbjct  371   LKRRLIRRKMVQSAKECIKQQASNTEIYRKMQAVFIEMDMAPSLLVTEELKDLKEAIMKG  430

Query  721   DE---KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             ++    D   D  K ID +LPV VNEQRVSNLLQSI VG S+ ++P+IR IPTSVLWGYF
Sbjct  431   EDGKNADDKFDPEKHIDDYLPVRVNEQRVSNLLQSILVGASVFSMPIIRRIPTSVLWGYF  490

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWER++LLF+ P RR+KVLEG+HA++VESVPFKYI  FT+FQFVYLLV
Sbjct  491   AYMAIDSLPGNQFWERMLLLFITPARRYKVLEGVHASFVESVPFKYIFMFTLFQFVYLLV  550

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  551   CFGVTWI  557



>ref|XP_011014678.1| PREDICTED: boron transporter 4-like [Populus euphratica]
Length=665

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/364 (71%), Positives = 303/364 (83%), Gaps = 0/364 (0%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IF+FG+L T+L+SR AR+W YGTG+FRSFIADYGVPLMVV+WTA+
Sbjct  191   KYQFQWLYTNGLLGIIFTFGLLYTALKSRRARAWWYGTGWFRSFIADYGVPLMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+++P +VPS VPR+L  PLPWE AS++HWTVIKDMG VPP YI A F+PA MIAGLYFF
Sbjct  251   SFSIPSKVPSGVPRKLFSPLPWESASLHHWTVIKDMGNVPPAYIFAAFVPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+L  MTL+CG+LGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDILLLSFMTLLCGILGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+ SAKE +K +A+ SEIYG M  V++EM SS      +EL  LK AVMK 
Sbjct  371   LKRQLIRRKMVESAKESIKQKASNSEIYGMMQDVFIEMDSSRITTVVRELEALKEAVMKG  430

Query  721   DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAYM  900
             +      D  K IDA+LPV VNEQRVSN LQS+ V  S+ AVP I++IPTSVLWGYFAYM
Sbjct  431   ENPKDKFDPEKHIDAYLPVRVNEQRVSNFLQSLLVAASVSAVPAIKLIPTSVLWGYFAYM  490

Query  901   ATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCFG  1080
             A DSLPGNQFWER++LLFV P RR+KVLEG+HA++VESVPFKYIA FTIFQFVY L C+G
Sbjct  491   AIDSLPGNQFWERMLLLFVTPGRRYKVLEGVHASFVESVPFKYIAIFTIFQFVYFLFCYG  550

Query  1081  VTWI  1092
             VTWI
Sbjct  551   VTWI  554



>gb|KGN62918.1| hypothetical protein Csa_2G379980 [Cucumis sativus]
Length=660

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/366 (71%), Positives = 304/366 (83%), Gaps = 5/366 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             EY+F+WLY NGLLAVIFS G+L T+L+SR ARSW YGTG+FRSFIADYG+PLMVV WTA+
Sbjct  188   EYKFEWLYTNGLLAVIFSVGLLFTALKSRGARSWKYGTGWFRSFIADYGIPLMVVFWTAL  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP +VP  VPRRL CPLPWEPAS+YHWTV+KD+GKVP  YI A  +PA MIAGLYFF
Sbjct  248   SYGVPGKVPDGVPRRLFCPLPWEPASLYHWTVVKDLGKVPVTYIFAAALPAVMIAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+ PSAYHYD+ +LG+MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  308   DHSVASQLAQQKEFNLQNPSAYHYDVFLLGIMTLICGLLGLPPSNGVLPQSPMHTKSLAV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL RK+M+  AKE +K +A+ SEIYG+MHAV++EM ++P P   K+L  L  AVM  
Sbjct  368   LKRQLFRKKMVKRAKECIKQKASNSEIYGKMHAVFIEMDAAPVP---KDLETLTKAVMNA  424

Query  721   DEKD--GNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
             DE D  G  D  K+ID +LPV VNEQR+SNLLQS  V  SI A+PV++MIPTSVLWGYFA
Sbjct  425   DEGDQKGKFDAEKNIDPYLPVRVNEQRMSNLLQSFLVAASIFAIPVMKMIPTSVLWGYFA  484

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPGNQFWER++LLF+ P+RRFKVLEG H ++VESVPFK IA FT+ QF Y L+C
Sbjct  485   YMAIDSLPGNQFWERMLLLFITPSRRFKVLEGSHLSFVESVPFKIIASFTLLQFAYFLLC  544

Query  1075  FGVTWI  1092
             FGVTWI
Sbjct  545   FGVTWI  550



>ref|XP_011040005.1| PREDICTED: boron transporter 4-like [Populus euphratica]
Length=665

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/364 (71%), Positives = 302/364 (83%), Gaps = 0/364 (0%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
              YQFQWLY NGLL +IF+FG+L T+L+SR AR+W YGTG+FRSFIADYGVPLMVV+WTA+
Sbjct  191   RYQFQWLYTNGLLGIIFTFGLLYTALKSRRARAWWYGTGWFRSFIADYGVPLMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+++P +VPS VPR+L  PLPWE AS++HWTVIKDMG VPP YI A F+PA MIAGLYFF
Sbjct  251   SFSIPSKVPSGVPRKLFSPLPWESASLHHWTVIKDMGNVPPAYIFAAFVPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+L  MTL+CG+LGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDILLLSFMTLLCGILGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+ SAKE +K +A+ SEIYG M  V++EM SS      +EL  LK AVMK 
Sbjct  371   LKRQLIRRKMVESAKESIKQKASNSEIYGMMQDVFIEMDSSRITTVVRELEALKEAVMKG  430

Query  721   DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAYM  900
             +      D  K IDA+LPV VNEQRVSN LQS+ V  S+ AVP I++IPTSVLWGYFAYM
Sbjct  431   ENPKDKFDPEKHIDAYLPVRVNEQRVSNFLQSLLVAASVSAVPAIKLIPTSVLWGYFAYM  490

Query  901   ATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCFG  1080
             A DSLPGNQFWER++LLFV P RR+KVLEG+HA++VESVPFKYIA FTIFQFVY L C+G
Sbjct  491   AIDSLPGNQFWERMLLLFVTPGRRYKVLEGVHASFVESVPFKYIAIFTIFQFVYFLFCYG  550

Query  1081  VTWI  1092
             VTWI
Sbjct  551   VTWI  554



>ref|XP_002514365.1| Boron transporter, putative [Ricinus communis]
 gb|EEF48319.1| Boron transporter, putative [Ricinus communis]
Length=658

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/368 (73%), Positives = 311/368 (85%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLYANGLLA+IFSFG+L+T+L+SR+ARSW YGTG  RSFIADYGVPLMV+LWT +
Sbjct  188   KYQFQWLYANGLLAIIFSFGLLVTALKSRKARSWRYGTGCLRSFIADYGVPLMVLLWTLM  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY+VP +VP  VPRRL  PL W+  S+YHWTV+KDMGKVP  YI A  +PA MIAGLYFF
Sbjct  248   SYSVPSKVPIGVPRRLHSPLLWDSISLYHWTVVKDMGKVPVVYIFAAIVPAIMIAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYD+ +LG MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  308   DHSVASQMAQQKEFNLKNPSAYHYDVFLLGFMTLICGLLGLPPSNGVLPQSPMHTKSLAV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
             LK QL+RK+M+ SAKE ++ +A+ SEIYG M AV++EM ++P   + DKEL +LK AVMK
Sbjct  368   LKKQLIRKKMVQSAKECIERKASNSEIYGSMQAVFIEMDTAPPTASVDKELKDLKEAVMK  427

Query  718   -NDEKDG--NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
               DE D     D  K IDA+LPV VNEQR+SNLLQS+ VGLS  A+P I+ IPTSVLWGY
Sbjct  428   PYDEVDKREKFDPDKHIDAYLPVRVNEQRMSNLLQSLLVGLSTFALPFIKKIPTSVLWGY  487

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI+LLF+PPNRR+KVLEG+HA++VE VPFK+IA FTIFQFVYLL
Sbjct  488   FAYMAIDSLPGNQFWERILLLFIPPNRRYKVLEGVHASFVELVPFKHIAVFTIFQFVYLL  547

Query  1069  VCFGVTWI  1092
             +CFGVTWI
Sbjct  548   ICFGVTWI  555



>ref|XP_002282436.1| PREDICTED: probable boron transporter 7 [Vitis vinifera]
 emb|CBI20996.3| unnamed protein product [Vitis vinifera]
Length=669

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/368 (70%), Positives = 307/368 (83%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+FQWLY NGLL +IFSFGVL TSL+SR ARSW Y TG+ R FIADYGVPLMV+LWTA+
Sbjct  191   KYEFQWLYTNGLLGIIFSFGVLFTSLKSRRARSWRYSTGWVREFIADYGVPLMVLLWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY++PK+VPS VPRRL C  PW+  S Y W V++DMGKVP  YI A  IPA MIAGLYFF
Sbjct  251   SYSIPKKVPSGVPRRLFCRAPWDSDSNYQWAVVQDMGKVPLGYIFAALIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYD+ +LGVMTL+CGLLG PPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDLFLLGVMTLLCGLLGFPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
             LK  L+RK+M+ SAKE +K QA+ SE+YGRM AV++EM ++P  V+ DKEL +LK AVM 
Sbjct  371   LKKLLIRKKMVKSAKECIKEQASNSEMYGRMQAVFIEMDTAPNDVSVDKELKDLKEAVMN  430

Query  718   ND---EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             ++   +  G  D  K ID +LPV VNEQRV+NLLQS+ VG+S+CA+PVI+ IPTSVLWGY
Sbjct  431   SEDGGDTKGKFDPEKHIDPYLPVRVNEQRVTNLLQSLLVGISVCAIPVIKAIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI+LLF+ P RR+KVLEG+HA++VE+VPFKYIA FT+FQ VYL+
Sbjct  491   FAYMAVDSLPGNQFWERILLLFITPGRRYKVLEGVHASFVETVPFKYIATFTLFQLVYLM  550

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  551   ICFGITWI  558



>ref|XP_002517565.1| Boron transporter, putative [Ricinus communis]
 gb|EEF44729.1| Boron transporter, putative [Ricinus communis]
Length=670

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/368 (70%), Positives = 306/368 (83%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IF+FG+L T L+SR+ARSW YGTG+FRSFIADYGVPLMVV+WTA+
Sbjct  191   KYQFQWLYINGLLGIIFTFGLLYTGLKSRKARSWWYGTGWFRSFIADYGVPLMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+++P +VPS VPRRL  PLPWE AS+ HWTVIKDMG VP  YI A  IPA MIAGLYFF
Sbjct  251   SFSIPSKVPSGVPRRLFSPLPWESASLGHWTVIKDMGNVPTAYIFAAIIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+ SAKE +K +A+ +EIYG+M A+++E+ SSP     KEL +LK A+MK 
Sbjct  371   LKRQLIRRKMVESAKESIKQKASNTEIYGKMQAIFIEIDSSPVTTVAKELKDLKEAIMKG  430

Query  721   DEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +    N     D  K IDA+LPV VNEQRVSNLLQS+ V  S+CA+P I++IPTSVLWGY
Sbjct  431   ENNGENPKDTFDPEKHIDAYLPVRVNEQRVSNLLQSLLVAASVCAMPAIKLIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI+LLF+ P+RR+KVLE +HA++VE VPFK IA FTIFQ VY L
Sbjct  491   FAYMAIDSLPGNQFWERILLLFITPSRRYKVLEAVHASFVELVPFKQIAMFTIFQLVYFL  550

Query  1069  VCFGVTWI  1092
             VCFGVTWI
Sbjct  551   VCFGVTWI  558



>ref|XP_006356189.1| PREDICTED: boron transporter 4-like [Solanum tuberosum]
Length=661

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/370 (71%), Positives = 308/370 (83%), Gaps = 6/370 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL VIFSFG+L TSL+SR+ARSW YGTG+FRSF+ADYGVPLMV++W+A+
Sbjct  188   KYQFQWLYINGLLGVIFSFGLLYTSLKSRKARSWWYGTGWFRSFVADYGVPLMVLVWSAL  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP EVPS VPRRL  PLPWE AS +HWTVIKDMGKVPP YI+A  IPA MIAGLYFF
Sbjct  248   SYGVPSEVPSGVPRRLFSPLPWESASSHHWTVIKDMGKVPPTYIVAALIPALMIAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DH+VASQMAQ  EFNLK PSAYH+DIL+LG MTL+CGL+G+PPSNGVLPQ+PMHTKSLA 
Sbjct  308   DHTVASQMAQQSEFNLKNPSAYHHDILLLGFMTLLCGLIGVPPSNGVLPQSPMHTKSLAV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+ SAKE +K +A+ SEIYG M AV +E+ SS      KEL +LK AVMK+
Sbjct  368   LKRQLIRRKMVKSAKESIKRKASNSEIYGNMQAVLIEIDSSSDTTVAKELEHLKEAVMKS  427

Query  721   DE-KDG-----NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLW  882
              E K+G       D  K ID +LPV VNEQRVSNLLQS+ V  S+ A+PVI+ IPTSVLW
Sbjct  428   TENKNGGTTEVTFDPEKHIDVYLPVRVNEQRVSNLLQSLLVAASVFAMPVIKKIPTSVLW  487

Query  883   GYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVY  1062
             GYFAYMA DSLPGNQ WER++LLF+   RRFKVLEG+HA++VESVPF+YIA FTIFQFVY
Sbjct  488   GYFAYMAIDSLPGNQLWERLLLLFITTGRRFKVLEGVHASFVESVPFRYIAIFTIFQFVY  547

Query  1063  LLVCFGVTWI  1092
             LL+CFGVTWI
Sbjct  548   LLLCFGVTWI  557



>ref|XP_007226316.1| hypothetical protein PRUPE_ppa021289mg, partial [Prunus persica]
 gb|EMJ27515.1| hypothetical protein PRUPE_ppa021289mg, partial [Prunus persica]
Length=647

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/369 (72%), Positives = 310/369 (84%), Gaps = 8/369 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLY NGLLAVIF FGV+ TSL+SR+ARSW YGTG+ RS IADYGVPLMV++WTA+
Sbjct  191   EFQFQWLYTNGLLAVIFCFGVISTSLKSRKARSWWYGTGWLRSLIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP +VP  VPRRLVCP PW+ AS+YHWTV+KDM  VP  YI A FIPA MIAGLYFF
Sbjct  251   SYVVPGKVPHGVPRRLVCPFPWDSASLYHWTVVKDMPNVPVLYIFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ K+FNL+KP AYHYD+L+LG+MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKDFNLQKPPAYHYDMLLLGIMTLICGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEM--GSSPAPVADKELNNLKVAVM  714
             L+ Q++RK+M+ SAKE +K++AT SE++GRM AV++EM  GS P P   KEL NLK AVM
Sbjct  371   LRRQVIRKKMVKSAKECIKLKATNSEMFGRMEAVFIEMDGGSPPNP---KELQNLKEAVM  427

Query  715   KNDEKD---GNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             K+D+ +   G  D  K IDAHLPV VNEQRVSNLLQS+ VG S+ A+ VI+ IPTSVLWG
Sbjct  428   KSDDGEELKGKFDPEKHIDAHLPVRVNEQRVSNLLQSLLVGGSVFAIFVIKKIPTSVLWG  487

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWERI+LLF+ P+RR+KVLEG HA++VE VPFKYI  FT+FQ VY 
Sbjct  488   YFAYMAIDSLPGNQFWERILLLFISPSRRYKVLEGSHASFVELVPFKYIVAFTLFQLVYF  547

Query  1066  LVCFGVTWI  1092
             L+CFGVTWI
Sbjct  548   LICFGVTWI  556



>ref|XP_008445157.1| PREDICTED: probable boron transporter 6 isoform X3 [Cucumis melo]
 ref|XP_008445158.1| PREDICTED: probable boron transporter 6 isoform X3 [Cucumis melo]
 ref|XP_008445159.1| PREDICTED: probable boron transporter 6 isoform X3 [Cucumis melo]
Length=660

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/366 (71%), Positives = 303/366 (83%), Gaps = 5/366 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             EY+F+WLY NGLLA+IFS G+L T+L+SR ARSW YGTG+FRSFIADYGVPLMVV WTA+
Sbjct  188   EYKFEWLYTNGLLAIIFSVGLLFTALQSRGARSWKYGTGWFRSFIADYGVPLMVVFWTAL  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP +VP  VPRRL CPLPWEPAS+YHWTV+KDMGKVP  YI A  +PA MIAGLYFF
Sbjct  248   SYGVPGKVPHGVPRRLFCPLPWEPASLYHWTVVKDMGKVPVTYIFAAALPAVMIAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+ PSAYHYD+ +LG+MTLICGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  308   DHSVASQMAQQKEFNLQNPSAYHYDVFLLGIMTLICGLIGLPPSNGVLPQSPMHTKSLAV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL RK+M+  AKE +K +A+ SEIYG+M AV++EM ++P P   K+L  L  AVM  
Sbjct  368   LKRQLFRKKMVKRAKECIKQKASNSEIYGKMQAVFIEMDAAPVP---KDLETLTKAVMNA  424

Query  721   DE--KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
             DE  + G  D  K+ID +LPV VNEQR+SNLLQS  V  SI AVP+++MIPTSVLWGYFA
Sbjct  425   DEGAQKGKFDAEKNIDPYLPVRVNEQRMSNLLQSFLVAASIFAVPIMKMIPTSVLWGYFA  484

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPGNQFWER++LLF+ P+RRFKVLEG H ++VESVPFK IA FT+ QF Y L+C
Sbjct  485   YMAIDSLPGNQFWERMLLLFITPSRRFKVLEGSHLSFVESVPFKIIASFTLLQFAYFLLC  544

Query  1075  FGVTWI  1092
             FGVTWI
Sbjct  545   FGVTWI  550



>ref|XP_009791278.1| PREDICTED: boron transporter 4-like [Nicotiana sylvestris]
Length=669

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/369 (71%), Positives = 307/369 (83%), Gaps = 7/369 (2%)
 Frame = +1

Query  7     QFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSY  186
             QF WLY NGLL +IF+FG+L T+L+SR+ARSW YGTG+ RSFIADYGVPLMV++W+A+S+
Sbjct  194   QFHWLYTNGLLGIIFTFGLLYTALKSRKARSWWYGTGWIRSFIADYGVPLMVLVWSALSF  253

Query  187   TVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDH  366
              VP +VPS VPR L  PLPWE AS+YHWTVIKDMGKVPP YI A  IPA MIAGLYFFDH
Sbjct  254   IVPNKVPSGVPRTLYSPLPWESASLYHWTVIKDMGKVPPTYIFAAIIPAVMIAGLYFFDH  313

Query  367   SVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELK  546
             SVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA LK
Sbjct  314   SVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLAILK  373

Query  547   TQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKNDE  726
              QL+RK+M+ SAKE ++ +A+ SEIYG M AV++E+ SSP     KEL +LK A+MK++ 
Sbjct  374   KQLIRKKMVESAKESIRRKASNSEIYGNMQAVFIEIDSSPVNAVAKELKHLKEAIMKHEI  433

Query  727   KDGN-------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             ++GN        D  K IDA+LPV VNEQRVSNLLQS+ V  S+ A+PVI+ IPTSVLWG
Sbjct  434   ENGNGEKSNGRFDPEKHIDAYLPVRVNEQRVSNLLQSLLVAASVGAMPVIKKIPTSVLWG  493

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQ WERI+LLF+ P RRFKVLEG+HA++VESVPF+YIA FT+FQ VYL
Sbjct  494   YFAYMAIDSLPGNQLWERILLLFITPGRRFKVLEGVHASFVESVPFRYIAIFTVFQLVYL  553

Query  1066  LVCFGVTWI  1092
             LV FGVTWI
Sbjct  554   LVVFGVTWI  562



>gb|EYU29240.1| hypothetical protein MIMGU_mgv1a002537mg [Erythranthe guttata]
Length=661

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/367 (72%), Positives = 311/367 (85%), Gaps = 3/367 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++QFQWLY NGLL++IFSFGVL+T+L+SREARSW YGTG FRSFIADYGVPLM+V+WTA+
Sbjct  189   QFQFQWLYTNGLLSIIFSFGVLITALKSREARSWRYGTGTFRSFIADYGVPLMIVVWTAL  248

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY+VP  +PS +PRRL+  LPWE  S+YHWTV+KDMGKV   YI A  IPA MIAGLYFF
Sbjct  249   SYSVPSNIPSGLPRRLISALPWESESLYHWTVVKDMGKVSVGYIFAAIIPAVMIAGLYFF  308

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGLLGLPPSNGVLPQ+PMHT+SLA 
Sbjct  309   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLLGLPPSNGVLPQSPMHTRSLAV  368

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+  AKEGMK QA+ SEIYGRMH V++EM S+P+   +KEL NLK AV+K+
Sbjct  369   LKKQLIRRKMVKRAKEGMKQQASHSEIYGRMHEVFIEMESAPSQTVEKELANLKEAVLKH  428

Query  721   D---EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D   E +G  D  + ID HLPV VNEQRVSN LQSI VGL++C +PVI+MIPT VLWGYF
Sbjct  429   DDEGEANGQFDPERCIDMHLPVRVNEQRVSNFLQSILVGLAVCTMPVIKMIPTCVLWGYF  488

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+L+FVPP RRFKV+E  HA++VE+VPFKYI  FT FQF YLL+
Sbjct  489   AYMAIDSLPGNQFWERILLIFVPPRRRFKVIEEFHASFVETVPFKYIFMFTAFQFAYLLM  548

Query  1072  CFGVTWI  1092
             CFG+TWI
Sbjct  549   CFGITWI  555



>ref|XP_008445155.1| PREDICTED: probable boron transporter 6 isoform X1 [Cucumis melo]
Length=672

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/366 (71%), Positives = 303/366 (83%), Gaps = 5/366 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             EY+F+WLY NGLLA+IFS G+L T+L+SR ARSW YGTG+FRSFIADYGVPLMVV WTA+
Sbjct  200   EYKFEWLYTNGLLAIIFSVGLLFTALQSRGARSWKYGTGWFRSFIADYGVPLMVVFWTAL  259

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP +VP  VPRRL CPLPWEPAS+YHWTV+KDMGKVP  YI A  +PA MIAGLYFF
Sbjct  260   SYGVPGKVPHGVPRRLFCPLPWEPASLYHWTVVKDMGKVPVTYIFAAALPAVMIAGLYFF  319

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+ PSAYHYD+ +LG+MTLICGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  320   DHSVASQMAQQKEFNLQNPSAYHYDVFLLGIMTLICGLIGLPPSNGVLPQSPMHTKSLAV  379

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL RK+M+  AKE +K +A+ SEIYG+M AV++EM ++P P   K+L  L  AVM  
Sbjct  380   LKRQLFRKKMVKRAKECIKQKASNSEIYGKMQAVFIEMDAAPVP---KDLETLTKAVMNA  436

Query  721   DE--KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
             DE  + G  D  K+ID +LPV VNEQR+SNLLQS  V  SI AVP+++MIPTSVLWGYFA
Sbjct  437   DEGAQKGKFDAEKNIDPYLPVRVNEQRMSNLLQSFLVAASIFAVPIMKMIPTSVLWGYFA  496

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPGNQFWER++LLF+ P+RRFKVLEG H ++VESVPFK IA FT+ QF Y L+C
Sbjct  497   YMAIDSLPGNQFWERMLLLFITPSRRFKVLEGSHLSFVESVPFKIIASFTLLQFAYFLLC  556

Query  1075  FGVTWI  1092
             FGVTWI
Sbjct  557   FGVTWI  562



>ref|XP_004138738.1| PREDICTED: probable boron transporter 6-like [Cucumis sativus]
 ref|XP_004164531.1| PREDICTED: probable boron transporter 6-like [Cucumis sativus]
Length=659

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/366 (71%), Positives = 303/366 (83%), Gaps = 6/366 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             EY+F+WLY NGLLAVIFS G+L T+L+SR ARSW YGTG+FRSFIADYG+PLMVV WTA+
Sbjct  188   EYKFEWLYTNGLLAVIFSVGLLFTALKSRGARSWKYGTGWFRSFIADYGIPLMVVFWTAL  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP +VP  VPRRL CPLPWEPAS+YHWTV+KD+GKVP  YI A  +PA MIAGLYFF
Sbjct  248   SYGVPGKVPDGVPRRLFCPLPWEPASLYHWTVVKDLGKVPVTYIFAAALPAVMIAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+ PSAYHYD+ +LG+MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  308   DHSVASQLAQQKEFNLQNPSAYHYDVFLLGIMTLICGLLGLPPSNGVLPQSPMHTKSLAV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL RK+M+  AKE +K +A+ SEIYG+MHAV++EM ++P     K+L  L  AVM  
Sbjct  368   LKRQLFRKKMVKRAKECIKQKASNSEIYGKMHAVFIEMDAAPP----KDLETLTKAVMNA  423

Query  721   DEKD--GNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
             DE D  G  D  K+ID +LPV VNEQR+SNLLQS  V  SI A+PV++MIPTSVLWGYFA
Sbjct  424   DEGDQKGKFDAEKNIDPYLPVRVNEQRMSNLLQSFLVAASIFAIPVMKMIPTSVLWGYFA  483

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPGNQFWER++LLF+ P+RRFKVLEG H ++VESVPFK IA FT+ QF Y L+C
Sbjct  484   YMAIDSLPGNQFWERMLLLFITPSRRFKVLEGSHLSFVESVPFKIIASFTLLQFAYFLLC  543

Query  1075  FGVTWI  1092
             FGVTWI
Sbjct  544   FGVTWI  549



>ref|XP_008445156.1| PREDICTED: probable boron transporter 6 isoform X2 [Cucumis melo]
Length=662

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/366 (71%), Positives = 303/366 (83%), Gaps = 5/366 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             EY+F+WLY NGLLA+IFS G+L T+L+SR ARSW YGTG+FRSFIADYGVPLMVV WTA+
Sbjct  200   EYKFEWLYTNGLLAIIFSVGLLFTALQSRGARSWKYGTGWFRSFIADYGVPLMVVFWTAL  259

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP +VP  VPRRL CPLPWEPAS+YHWTV+KDMGKVP  YI A  +PA MIAGLYFF
Sbjct  260   SYGVPGKVPHGVPRRLFCPLPWEPASLYHWTVVKDMGKVPVTYIFAAALPAVMIAGLYFF  319

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+ PSAYHYD+ +LG+MTLICGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  320   DHSVASQMAQQKEFNLQNPSAYHYDVFLLGIMTLICGLIGLPPSNGVLPQSPMHTKSLAV  379

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL RK+M+  AKE +K +A+ SEIYG+M AV++EM ++P P   K+L  L  AVM  
Sbjct  380   LKRQLFRKKMVKRAKECIKQKASNSEIYGKMQAVFIEMDAAPVP---KDLETLTKAVMNA  436

Query  721   DE--KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
             DE  + G  D  K+ID +LPV VNEQR+SNLLQS  V  SI AVP+++MIPTSVLWGYFA
Sbjct  437   DEGAQKGKFDAEKNIDPYLPVRVNEQRMSNLLQSFLVAASIFAVPIMKMIPTSVLWGYFA  496

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPGNQFWER++LLF+ P+RRFKVLEG H ++VESVPFK IA FT+ QF Y L+C
Sbjct  497   YMAIDSLPGNQFWERMLLLFITPSRRFKVLEGSHLSFVESVPFKIIASFTLLQFAYFLLC  556

Query  1075  FGVTWI  1092
             FGVTWI
Sbjct  557   FGVTWI  562



>ref|XP_002324278.1| hypothetical protein POPTR_0018s01350g [Populus trichocarpa]
 gb|EEF02843.1| hypothetical protein POPTR_0018s01350g [Populus trichocarpa]
Length=666

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/368 (72%), Positives = 307/368 (83%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQW YANGLL+VIFS GVL T+L+SR ARSW YGTG+ R FIADYGVPLMVVLWTA+
Sbjct  191   KYQFQWRYANGLLSVIFSLGVLFTALKSRRARSWRYGTGWIRGFIADYGVPLMVVLWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY  P EVPS VPRR+  PL  +  S++HWTVIKDMGKVP  YI A  IPA MIAGLYFF
Sbjct  251   SYVRPSEVPSGVPRRVHVPLLSDAESVHHWTVIKDMGKVPLTYIFAALIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYD+L+LG MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDVLLLGFMTLICGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-SPAPVADKELNNLKVAVMK  717
             LK QL+RK+M+ SAKE +  +A+ SEIYGRMHAV++EM + SP     KEL NLK AVMK
Sbjct  371   LKRQLIRKKMVKSAKECIGQKASNSEIYGRMHAVFLEMDAPSPDVSVHKELENLKQAVMK  430

Query  718   NDEKDG---NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +D+++      D  K IDA+LPV VNEQR+SNL+QSI VG+S+CA+P+I+ IPTSVLWGY
Sbjct  431   SDDEEDAKKKFDPEKHIDAYLPVRVNEQRMSNLIQSILVGVSMCALPLIKRIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P+RR+KVLEG+HA++VE VPFK IA FTIFQFVY  
Sbjct  491   FAYMAIDSLPGNQFWERMLLLFITPSRRYKVLEGVHASFVEVVPFKQIAIFTIFQFVYFF  550

Query  1069  VCFGVTWI  1092
             +CFGVTWI
Sbjct  551   ICFGVTWI  558



>ref|XP_010049958.1| PREDICTED: boron transporter 4-like isoform X2 [Eucalyptus grandis]
Length=660

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/366 (70%), Positives = 308/366 (84%), Gaps = 11/366 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
              Y FQW Y NGLL +IF+FG++ T+L+SR ARSWPYGT        DYGVPLMV++W+A+
Sbjct  191   RYHFQWRYVNGLLGIIFTFGLVSTALKSRRARSWPYGT--------DYGVPLMVLIWSAL  242

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             +++VPK VPS VPRRL  PLPWEPAS++HW+VIKDMG+VPP YI A FIPA M+AGLYFF
Sbjct  243   AFSVPKSVPSGVPRRLYSPLPWEPASLHHWSVIKDMGRVPPAYIFAAFIPAVMVAGLYFF  302

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFN+K PSAYHYD+L+LG+MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  303   DHSVASQMAQQKEFNIKNPSAYHYDVLVLGLMTLLCGLIGLPPSNGVLPQSPMHTKSLAV  362

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+RK+M+ SAKE MK +A+KSEIYG+M  V+VEM S+P     KEL  LK AVM +
Sbjct  363   LKRQLIRKKMVESAKECMKQKASKSEIYGKMQQVFVEMDSTPTLSVAKELKQLKDAVMGS  422

Query  721   DEKDGNLD--LAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
             +++D N+D   AK IDAHLPV VNEQRVSNLLQS+ +G +I A+PVI+ IPTSVLWGYFA
Sbjct  423   EDED-NVDGQFAKHIDAHLPVRVNEQRVSNLLQSLLLGAAILAMPVIKQIPTSVLWGYFA  481

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPGNQFWERI+LLFV P RR+K+LEG HA++VESVPFK++A FT+FQ VYLLVC
Sbjct  482   YMAIDSLPGNQFWERILLLFVTPRRRYKILEGAHASFVESVPFKWMAAFTLFQVVYLLVC  541

Query  1075  FGVTWI  1092
             FGVTWI
Sbjct  542   FGVTWI  547



>ref|XP_009592836.1| PREDICTED: boron transporter 4-like isoform X1 [Nicotiana tomentosiformis]
Length=674

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/372 (69%), Positives = 308/372 (83%), Gaps = 8/372 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F WLY NGLL +IF+ G+L T+L+SR+ARSW YGTG+FRSFIADYGVPLMV++W+A+
Sbjct  196   KYKFHWLYTNGLLGIIFTIGLLYTALKSRKARSWWYGTGWFRSFIADYGVPLMVLVWSAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP ++PS VPRRL  PLPWE AS+YHWTVIKDMGKVPP YI A  IPA MIAGLYFF
Sbjct  256   SFMVPGKLPSGVPRRLYSPLPWESASLYHWTVIKDMGKVPPAYIFAAVIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+RK+M+ SAKE ++ +A+ SEIY  M  V++E+ SSP     KEL +LK AVMK+
Sbjct  376   LKKQLIRKKMVESAKESIRRKASNSEIYVNMQTVFIEIDSSPVTAVVKELEHLKEAVMKH  435

Query  721   --------DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSV  876
                     +  +G  D  K IDA+LPV VNEQRVSNLLQS+ V  S+ A+PVI+ IPTS+
Sbjct  436   ELIEYENGENLNGKFDPEKHIDAYLPVRVNEQRVSNLLQSLLVAASVGAMPVIKKIPTSL  495

Query  877   LWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQF  1056
             LWGYFAYMA DSLPGNQ WERI+LLF+ P RRFKVLEG+HA++VE+VPFKY+A FT+FQF
Sbjct  496   LWGYFAYMAIDSLPGNQLWERILLLFITPGRRFKVLEGMHASFVEAVPFKYMAIFTVFQF  555

Query  1057  VYLLVCFGVTWI  1092
             V+LLVCFGVTWI
Sbjct  556   VFLLVCFGVTWI  567



>ref|XP_009592837.1| PREDICTED: boron transporter 4-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009592838.1| PREDICTED: boron transporter 4-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009592839.1| PREDICTED: boron transporter 4-like isoform X2 [Nicotiana tomentosiformis]
Length=669

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/372 (69%), Positives = 308/372 (83%), Gaps = 8/372 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F WLY NGLL +IF+ G+L T+L+SR+ARSW YGTG+FRSFIADYGVPLMV++W+A+
Sbjct  191   KYKFHWLYTNGLLGIIFTIGLLYTALKSRKARSWWYGTGWFRSFIADYGVPLMVLVWSAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP ++PS VPRRL  PLPWE AS+YHWTVIKDMGKVPP YI A  IPA MIAGLYFF
Sbjct  251   SFMVPGKLPSGVPRRLYSPLPWESASLYHWTVIKDMGKVPPAYIFAAVIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+RK+M+ SAKE ++ +A+ SEIY  M  V++E+ SSP     KEL +LK AVMK+
Sbjct  371   LKKQLIRKKMVESAKESIRRKASNSEIYVNMQTVFIEIDSSPVTAVVKELEHLKEAVMKH  430

Query  721   --------DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSV  876
                     +  +G  D  K IDA+LPV VNEQRVSNLLQS+ V  S+ A+PVI+ IPTS+
Sbjct  431   ELIEYENGENLNGKFDPEKHIDAYLPVRVNEQRVSNLLQSLLVAASVGAMPVIKKIPTSL  490

Query  877   LWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQF  1056
             LWGYFAYMA DSLPGNQ WERI+LLF+ P RRFKVLEG+HA++VE+VPFKY+A FT+FQF
Sbjct  491   LWGYFAYMAIDSLPGNQLWERILLLFITPGRRFKVLEGMHASFVEAVPFKYMAIFTVFQF  550

Query  1057  VYLLVCFGVTWI  1092
             V+LLVCFGVTWI
Sbjct  551   VFLLVCFGVTWI  562



>emb|CDX88179.1| BnaA06g27700D [Brassica napus]
Length=672

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/369 (70%), Positives = 303/369 (82%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E  F WLY NGLLAVIFS G+L+T+L+SR A+SW YG G+ RSFI DYGVPLMV+ WTA+
Sbjct  192   ESDFLWLYTNGLLAVIFSLGLLITALKSRRAKSWKYGFGWLRSFIGDYGVPLMVLFWTAL  251

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYTVP +VP +VPRRL CPLPWE AS++HWTVIKDMGKVP  YI AG IPA MIAGLYFF
Sbjct  252   SYTVPSKVPENVPRRLFCPLPWETASLHHWTVIKDMGKVPVIYIFAGIIPAVMIAGLYFF  311

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQAPMHTKSLA 
Sbjct  312   DHSVASQMAQQKEFNLKNPSAYHYDIFLLGIMTLICGLLGLPPSNGVIPQAPMHTKSLAI  371

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD--KELNNLKVAVM  714
             L  QL RK+M+ SAKEGMKM+A+KSEIYGRM  V++EM +S   V     +L +LK  VM
Sbjct  372   LNRQLTRKKMVKSAKEGMKMKASKSEIYGRMQTVFIEMETSSPQVCSVANDLKDLKEVVM  431

Query  715   KNDE---KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             + DE     G  D    I+A+LPV VNEQRVSNLLQS+ VGL++ AVPVI+MIP+SVLWG
Sbjct  432   RPDEGGDTKGKFDPDVHIEANLPVRVNEQRVSNLLQSVLVGLTLLAVPVIKMIPSSVLWG  491

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWER++LLF+P +R FKVLEG+HA++VE VP+K I  FT+FQ VY 
Sbjct  492   YFAYMAIDSLPGNQFWERLLLLFIPQSRLFKVLEGVHASFVELVPYKVIVMFTLFQLVYF  551

Query  1066  LVCFGVTWI  1092
             L+C+G+TW+
Sbjct  552   LLCYGMTWV  560



>ref|XP_009151072.1| PREDICTED: probable boron transporter 6 [Brassica rapa]
Length=672

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/369 (70%), Positives = 303/369 (82%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E  F WLY NGLLAVIFS G+L+T+L+SR A+SW YG G+ RSFI DYGVPLMV+ WTA+
Sbjct  192   ESDFLWLYTNGLLAVIFSLGLLITALKSRRAKSWKYGFGWLRSFIGDYGVPLMVLFWTAL  251

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYTVP +VP +VPRRL CPLPWE AS++HWTVIKDMGKVP  YI AG IPA MIAGLYFF
Sbjct  252   SYTVPSKVPENVPRRLFCPLPWETASLHHWTVIKDMGKVPVMYIFAGIIPAVMIAGLYFF  311

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQAPMHTKSLA 
Sbjct  312   DHSVASQMAQQKEFNLKNPSAYHYDIFLLGIMTLICGLLGLPPSNGVIPQAPMHTKSLAI  371

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD--KELNNLKVAVM  714
             L  QL RK+M+ SAKEGMKM+A+KSEIYGRM  V++EM +S   V     +L +LK  VM
Sbjct  372   LNRQLTRKKMVKSAKEGMKMKASKSEIYGRMQTVFIEMETSSPQVCSVANDLKDLKEVVM  431

Query  715   KNDE---KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             + DE     G  D    I+A+LPV VNEQRVSNLLQS+ VGL++ AVPVI+MIP+SVLWG
Sbjct  432   RPDEGGDTKGKFDPDVHIEANLPVRVNEQRVSNLLQSVLVGLTLLAVPVIKMIPSSVLWG  491

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWER++LLF+P +R FKVLEG+HA++VE VP+K I  FT+FQ VY 
Sbjct  492   YFAYMAIDSLPGNQFWERLLLLFIPQSRLFKVLEGVHASFVELVPYKVIVMFTLFQLVYF  551

Query  1066  LVCFGVTWI  1092
             L+C+G+TW+
Sbjct  552   LLCYGMTWV  560



>emb|CAN61936.1| hypothetical protein VITISV_001012 [Vitis vinifera]
Length=690

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/382 (68%), Positives = 310/382 (81%), Gaps = 18/382 (5%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY+NGLLA+IFSFG+L T+L+SR ARSW YGTG+ R FIADYGVPLMV++WTA+
Sbjct  191   KYQFQWLYSNGLLAIIFSFGLLXTALKSRRARSWSYGTGWSRGFIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIK---------------DMGKVPPFYIL  315
             S++VP +VPS VPRRL  PLPWE AS+ HW VIK               DMGK+PP YIL
Sbjct  251   SFSVPSKVPSGVPRRLFSPLPWESASLQHWXVIKVSASNSFWRSYFSFQDMGKIPPAYIL  310

Query  316   AGFIPATMIAGLYFFDHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSN  495
             A  IPA MIAGLYFFDHSVASQM Q KEFNLK PSAYHYDIL+LGVMTL+CG LGLPPSN
Sbjct  311   AAIIPAVMIAGLYFFDHSVASQMXQQKEFNLKNPSAYHYDILLLGVMTLLCGFLGLPPSN  370

Query  496   GVLPQAPMHTKSLAELKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPV  675
             GVLPQ+PMHTKSLA LK +L+R++M+ SAKE +K QA+ +EIY +M AV++EM  +P+ +
Sbjct  371   GVLPQSPMHTKSLAVLKRRLIRRKMVQSAKECIKQQASNTEIYXKMQAVFIEMDMAPSLL  430

Query  676   ADKELNNLKVAVMKNDE---KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAV  846
               +EL +LK A+MK ++    D   D  K ID +LPV VNEQRVSNLLQSI VG S+ ++
Sbjct  431   VTEELKDLKEAIMKGEDGKNADDKFDPEKHIDDYLPVRVNEQRVSNLLQSILVGASVFSM  490

Query  847   PVIRMIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFK  1026
             P+IR IPTSVLWGYFAYMA DSLPGNQFWER++LLF+ P RR+KVLEG+HA++VESVPFK
Sbjct  491   PIIRRIPTSVLWGYFAYMAIDSLPGNQFWERMLLLFITPARRYKVLEGVHASFVESVPFK  550

Query  1027  YIAGFTIFQFVYLLVCFGVTWI  1092
             YI  FT+FQFVYLLVCFGVTWI
Sbjct  551   YIFMFTLFQFVYLLVCFGVTWI  572



>ref|XP_009625163.1| PREDICTED: boron transporter 4-like [Nicotiana tomentosiformis]
 ref|XP_009625164.1| PREDICTED: boron transporter 4-like [Nicotiana tomentosiformis]
 ref|XP_009625165.1| PREDICTED: boron transporter 4-like [Nicotiana tomentosiformis]
Length=665

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/369 (69%), Positives = 304/369 (82%), Gaps = 7/369 (2%)
 Frame = +1

Query  7     QFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSY  186
             QF WLY NGLL +IF+FG+L T+L+SR+ARSW YGTG+ RSFIADYGVPLMV++W+A+S+
Sbjct  194   QFHWLYTNGLLGIIFTFGLLYTALKSRKARSWWYGTGWIRSFIADYGVPLMVLMWSALSF  253

Query  187   TVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDH  366
              +P +VPS +PR L  PLPWE AS+YHWTV+KDMGKVPP YI A  IPA MIAGLYFFDH
Sbjct  254   IIPNKVPSGIPRTLYSPLPWESASLYHWTVMKDMGKVPPAYIFAAIIPAVMIAGLYFFDH  313

Query  367   SVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELK  546
             SVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA LK
Sbjct  314   SVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLAVLK  373

Query  547   TQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKNDE  726
              QL+RK+M+ SAKE ++ +A+ SEIYG M AV++E+ S P     KEL +LK A+MK + 
Sbjct  374   KQLIRKKMVESAKESIRRKASNSEIYGNMQAVFIEIDSPPVNAVAKELKHLKEAIMKREI  433

Query  727   KDGN-------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             ++GN        D  K IDA+LPV VNEQRVSNLLQS+ V  S+ A+PVI+ IPTSVLWG
Sbjct  434   ENGNGEKSNGKFDPEKHIDAYLPVRVNEQRVSNLLQSLLVAASVGAMPVIKKIPTSVLWG  493

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQ WERI+LLF+ P RRFKVLEG+HA++VESV F+YIA FT+FQ VYL
Sbjct  494   YFAYMAIDSLPGNQLWERILLLFITPGRRFKVLEGVHASFVESVQFRYIAIFTVFQLVYL  553

Query  1066  LVCFGVTWI  1092
             LV FGVTWI
Sbjct  554   LVVFGVTWI  562



>gb|KHG17895.1| Putative boron transporter 5 -like protein [Gossypium arboreum]
Length=643

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 305/368 (83%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IFS G+L T+L+SR ARSW YGTG+FRSFIADYGVPLMVV+WTA+
Sbjct  164   KYQFQWLYTNGLLGIIFSLGLLYTALKSRRARSWWYGTGWFRSFIADYGVPLMVVVWTAM  223

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VPS VPR+L  PL WE AS+ HWT+IKDMG++P  YI A FIPA M+AGLYFF
Sbjct  224   SFSVPSKVPSGVPRKLFSPLAWESASLQHWTIIKDMGRIPALYIFAAFIPAVMVAGLYFF  283

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  284   DHSVASQLAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLAV  343

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK Q++R++M+ +AKE +K +A+ SEIYG+M AV++EM  SP     KEL +LK  VMK 
Sbjct  344   LKGQIIRRKMVETAKESVKQKASNSEIYGKMQAVFIEMDKSPETAVVKELEDLKKVVMKG  403

Query  721   DE----KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +     K    D  K IDA+LPV VNEQRVSNLLQS+ V  S  A+PVI++IPTSVLWGY
Sbjct  404   ENEGEIKKETFDPEKHIDAYLPVRVNEQRVSNLLQSLLVAASAFAMPVIKLIPTSVLWGY  463

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P+RR+KVLE +HA++VESVP+++I  FT+FQ VYLL
Sbjct  464   FAYMAIDSLPGNQFWERMLLLFIAPSRRYKVLEHVHASFVESVPYRFITMFTLFQLVYLL  523

Query  1069  VCFGVTWI  1092
             VCFGVTWI
Sbjct  524   VCFGVTWI  531



>ref|XP_010914933.1| PREDICTED: boron transporter 4-like [Elaeis guineensis]
Length=669

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/367 (69%), Positives = 303/367 (83%), Gaps = 4/367 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL +IF+ G+L T+L+SR AR W YGTG+FRSFIADYGVPLMVV+WTA+S
Sbjct  192   YQFQWLYTNGLLGIIFAIGLLYTALKSRRARGWRYGTGWFRSFIADYGVPLMVVVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             + VP ++PS VPRRL  PLPWE  S++HWTV KDM  VPP YI A  IP+ M+AGLYFFD
Sbjct  252   FAVPSKLPSGVPRRLFSPLPWESNSLHHWTVAKDMLSVPPVYIFAAIIPSLMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLK PSAYHYDIL+LG M LICGLLG+PPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQMAQQKEFNLKNPSAYHYDILVLGFMVLICGLLGIPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKND  723
             K QL+RK+M+ SAKE +K+QA+  EIYG+M  V++EM      ++ +EL +LK AVM+++
Sbjct  372   KRQLIRKKMVQSAKESIKLQASNLEIYGKMQEVFIEMDKGHTTISVEELKDLKDAVMRDE  431

Query  724   EKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
               +G L    D  K IDAHLPV VNEQR+SNLLQSI VG  + A+P+I+ IPTSVLWGYF
Sbjct  432   TGEGELKGRFDPDKHIDAHLPVRVNEQRLSNLLQSILVGACLGAMPIIKKIPTSVLWGYF  491

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+LLF+ P RR+KVLEG+HA++VESVPF+ IA FTIFQFVYLL+
Sbjct  492   AYMAIDSLPGNQFWERILLLFITPGRRYKVLEGVHASFVESVPFRQIAIFTIFQFVYLLL  551

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  552   CFGVTWI  558



>gb|KHG27141.1| Putative boron transporter 5 -like protein [Gossypium arboreum]
Length=643

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 305/368 (83%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IFS G+L T+L+SR ARSW YGTG+FRSFIADYGVPLMVV+WTA+
Sbjct  164   KYQFQWLYTNGLLGIIFSLGLLYTALKSRRARSWWYGTGWFRSFIADYGVPLMVVVWTAM  223

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VPS VPR+L  PL WE AS+ HWT+IKDMG++P  YI A FIPA M+AGLYFF
Sbjct  224   SFSVPSKVPSGVPRKLFSPLAWESASLQHWTIIKDMGRIPALYIFAAFIPAVMVAGLYFF  283

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  284   DHSVASQLAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLAV  343

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK Q++R++M+ +AKE +K +A+ SEIYG+M AV++EM  SP     KEL +LK  VMK 
Sbjct  344   LKGQIIRRKMVETAKESVKQKASNSEIYGKMQAVFIEMDKSPETAVVKELEDLKKVVMKG  403

Query  721   DE----KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +     K    D  K IDA+LPV VNEQRVSNLLQS+ V  S  A+PVI++IPTSVLWGY
Sbjct  404   ENEGEIKKETFDPEKHIDAYLPVRVNEQRVSNLLQSLLVAASAFAMPVIKLIPTSVLWGY  463

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P+RR+KVLE +HA++VESVP+++I  FT+FQ VYLL
Sbjct  464   FAYMAIDSLPGNQFWERMLLLFIAPSRRYKVLEHVHASFVESVPYRFITMFTLFQLVYLL  523

Query  1069  VCFGVTWI  1092
             VCFGVTWI
Sbjct  524   VCFGVTWI  531



>ref|XP_008394033.1| PREDICTED: probable boron transporter 6 isoform X3 [Malus domestica]
 ref|XP_008394034.1| PREDICTED: probable boron transporter 6 isoform X3 [Malus domestica]
Length=651

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/367 (70%), Positives = 303/367 (83%), Gaps = 4/367 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLYANGLLAVIF FG+  T+L+SR+ARSW YG+G+ RSFIADYGVPLMV++WTA+
Sbjct  184   EFQFQWLYANGLLAVIFCFGLTFTALKSRKARSWWYGSGWLRSFIADYGVPLMVLVWTAL  243

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY +P +VP  VPRRLVCP PW+  S+YHWTV+KDM  VP  YI A FIPA MIAGLYFF
Sbjct  244   SYALPGKVPHGVPRRLVCPFPWDSKSLYHWTVVKDMPNVPVMYIFAAFIPAVMIAGLYFF  303

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPSAYHYD+ +LGV TL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  304   DHSVASQLAQQKEFNLQKPSAYHYDMFLLGVTTLVCGLLGLPPSNGVLPQSPMHTKSLAV  363

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ Q++RK+M+ SAKE MK+ AT SE++GRM AV++EM    +P   KEL NL+ AVMK+
Sbjct  364   LRRQVIRKKMVKSAKECMKLNATNSEMFGRMEAVFIEMDRG-SPPNSKELENLREAVMKS  422

Query  721   DEK---DGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D+     G  D  K IDAHLPV VNEQRVSNLLQS+ VG S+ A+ VI+ IPTSVLWGYF
Sbjct  423   DDGGDLKGKFDPEKHIDAHLPVRVNEQRVSNLLQSLLVGGSVFAIFVIKKIPTSVLWGYF  482

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWER++LLF+ P RR+KVLE  HA++VE VPFKYI  FT+FQ VY L+
Sbjct  483   AYMAIDSLPGNQFWERLLLLFISPKRRYKVLEASHASFVELVPFKYIVAFTLFQLVYFLI  542

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  543   CFGVTWI  549



>ref|XP_006465393.1| PREDICTED: boron transporter 4-like [Citrus sinensis]
Length=677

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/369 (69%), Positives = 306/369 (83%), Gaps = 6/369 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLYANGLL +IF+FG++ T+L+SR+AR W YGTG+ RSF+ADYGVPLMVV+WTA+
Sbjct  191   KYQFQWLYANGLLGIIFTFGLVYTALKSRKARFWWYGTGWLRSFVADYGVPLMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VPS VPRRL  PLPWE  S+ HW+V+KDMGKVP  YI A FIPA MIAGLYFF
Sbjct  251   SFSVPSKVPSGVPRRLFSPLPWESGSLEHWSVMKDMGKVPLAYIFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLKKPSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLKKPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK Q M+K+M+ SAKE +K  A+ SEIYG+M AV++EM SSP     KEL +LK  +MK 
Sbjct  371   LKRQFMKKKMVKSAKESIKQNASNSEIYGKMQAVFIEMESSPVTSEVKELEDLKEVIMKG  430

Query  721   DEKDGN-----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
              EK+G       D  K IDA+LPV VNEQRVSNLLQS+ V  S+CA+P I++IPTSVLWG
Sbjct  431   -EKEGQKSKEKFDPEKHIDAYLPVRVNEQRVSNLLQSLLVAASVCAMPAIKLIPTSVLWG  489

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWER++LLF+ P R++KVLE  HA++VE VP+KYI  FT+FQFVY 
Sbjct  490   YFAYMAIDSLPGNQFWERMLLLFITPGRQYKVLEKDHASFVELVPYKYIVIFTLFQFVYF  549

Query  1066  LVCFGVTWI  1092
             LVC+GVTWI
Sbjct  550   LVCYGVTWI  558



>ref|XP_006394797.1| hypothetical protein EUTSA_v10003768mg [Eutrema salsugineum]
 gb|ESQ32083.1| hypothetical protein EUTSA_v10003768mg [Eutrema salsugineum]
Length=669

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/366 (70%), Positives = 307/366 (84%), Gaps = 5/366 (1%)
 Frame = +1

Query  10    FQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSYT  189
             F WLY NGLLA+IFS G+++T+L+SR A+SW YG G+ RSFI DYGVPLMV+LWTA+SYT
Sbjct  194   FLWLYTNGLLAIIFSLGLVITALKSRRAKSWKYGFGWLRSFIGDYGVPLMVLLWTALSYT  253

Query  190   VPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDHS  369
             +P +VP SVPRRL CPLPWEPAS+YHWTVIKDMGKVP  YI A FIPA MIAGLYFFDHS
Sbjct  254   IPSKVPPSVPRRLFCPLPWEPASLYHWTVIKDMGKVPVMYIFAAFIPALMIAGLYFFDHS  313

Query  370   VASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELKT  549
             VASQMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQAPMHTKSLA L  
Sbjct  314   VASQMAQQKEFNLKNPSAYHYDIFLLGIMTLICGLLGLPPSNGVIPQAPMHTKSLAILNR  373

Query  550   QLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD--KELNNLKVAVMKND  723
             QL RK+M+ SAKE MKM+A+KSEIYG+M  V++EM +    V++   +L +LK  VM+ +
Sbjct  374   QLTRKKMVKSAKECMKMKASKSEIYGKMQRVFIEMETCTPQVSNVATDLKDLKEVVMRAE  433

Query  724   EKD---GNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
             E +   G  D    I+A+LPV VNEQRVSNLLQSI VGL++ AVPVI+MIP+SVLWGYFA
Sbjct  434   EGEDTKGKFDPDVHIEANLPVRVNEQRVSNLLQSILVGLTLLAVPVIKMIPSSVLWGYFA  493

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPGNQF+ER++LLF+PP+R FKVLEG+HA++VE VP++ I  FT+FQFVY L+C
Sbjct  494   YMAIDSLPGNQFFERLLLLFIPPSRLFKVLEGVHASFVELVPYRVIVAFTLFQFVYFLLC  553

Query  1075  FGVTWI  1092
             +G+TWI
Sbjct  554   YGMTWI  559



>emb|CDX80510.1| BnaC07g29340D [Brassica napus]
Length=671

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/369 (70%), Positives = 302/369 (82%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E  F W Y NGLLAVIFS G+L+T+L+SR A+SW YG G+ RSFI DYGVPLMV+ WTA+
Sbjct  191   ESDFLWPYTNGLLAVIFSLGLLITALKSRRAKSWKYGFGWLRSFIGDYGVPLMVLFWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYTVP +VP SVPRRL CPLPWE AS+YHWTVIKDMGKVP  YI +G IPA MIAGLYFF
Sbjct  251   SYTVPSKVPESVPRRLFCPLPWETASLYHWTVIKDMGKVPVMYIFSGIIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQAPMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDIFLLGIMTLICGLLGLPPSNGVIPQAPMHTKSLAI  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD--KELNNLKVAVM  714
             L  QL RK+M+ SAKEGMKM+A+KSEIYGRM  V++EM +S   V     +L +LK  VM
Sbjct  371   LNRQLTRKKMVKSAKEGMKMKASKSEIYGRMQTVFIEMETSSPQVCSVANDLKDLKEVVM  430

Query  715   KNDE---KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             + DE     G  D    I+A+LPV VNEQRVSNLLQS+ VGL++ AVPVI+MIP+SVLWG
Sbjct  431   RPDEGGDTKGKFDPDVHIEANLPVRVNEQRVSNLLQSVLVGLTLLAVPVIKMIPSSVLWG  490

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWER++LLF+P +R FKVLEG+HA++VE VP+K I  FT+FQ VY 
Sbjct  491   YFAYMAIDSLPGNQFWERLLLLFIPQSRLFKVLEGVHASFVELVPYKVILMFTLFQLVYF  550

Query  1066  LVCFGVTWI  1092
             L+C+G+TW+
Sbjct  551   LLCYGMTWV  559



>ref|XP_008394032.1| PREDICTED: probable boron transporter 6 isoform X2 [Malus domestica]
Length=658

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/367 (70%), Positives = 303/367 (83%), Gaps = 4/367 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLYANGLLAVIF FG+  T+L+SR+ARSW YG+G+ RSFIADYGVPLMV++WTA+
Sbjct  191   EFQFQWLYANGLLAVIFCFGLTFTALKSRKARSWWYGSGWLRSFIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY +P +VP  VPRRLVCP PW+  S+YHWTV+KDM  VP  YI A FIPA MIAGLYFF
Sbjct  251   SYALPGKVPHGVPRRLVCPFPWDSKSLYHWTVVKDMPNVPVMYIFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPSAYHYD+ +LGV TL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLQKPSAYHYDMFLLGVTTLVCGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ Q++RK+M+ SAKE MK+ AT SE++GRM AV++EM    +P   KEL NL+ AVMK+
Sbjct  371   LRRQVIRKKMVKSAKECMKLNATNSEMFGRMEAVFIEMDRG-SPPNSKELENLREAVMKS  429

Query  721   DEK---DGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D+     G  D  K IDAHLPV VNEQRVSNLLQS+ VG S+ A+ VI+ IPTSVLWGYF
Sbjct  430   DDGGDLKGKFDPEKHIDAHLPVRVNEQRVSNLLQSLLVGGSVFAIFVIKKIPTSVLWGYF  489

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWER++LLF+ P RR+KVLE  HA++VE VPFKYI  FT+FQ VY L+
Sbjct  490   AYMAIDSLPGNQFWERLLLLFISPKRRYKVLEASHASFVELVPFKYIVAFTLFQLVYFLI  549

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  550   CFGVTWI  556



>ref|XP_010454873.1| PREDICTED: probable boron transporter 6 [Camelina sativa]
Length=672

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/369 (69%), Positives = 302/369 (82%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E  F  LYANGLLAVIFS G+++T+L+SR A+SW YG G+ RSFI DYGVPLMV+LWTA+
Sbjct  194   ESHFLLLYANGLLAVIFSLGLVITALKSRRAKSWKYGFGWLRSFIGDYGVPLMVLLWTAL  253

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYT+P EV  SVPRRL CPLPWEPAS+YHWTVIKDMGKVP  YI A FIP  MIAGLYFF
Sbjct  254   SYTIPSEVAPSVPRRLFCPLPWEPASLYHWTVIKDMGKVPVMYIFAAFIPGVMIAGLYFF  313

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQAPMHTKSLA 
Sbjct  314   DHSVASQMAQQKEFNLKNPSAYHYDIFLLGIMTLICGLLGLPPSNGVIPQAPMHTKSLAV  373

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP--VADKELNNLKVAVM  714
             L  QL RK+M+  AKE MKM+A+KSEIYG+M  V++EM + P       ++L +LK  VM
Sbjct  374   LNRQLTRKKMVKKAKECMKMKASKSEIYGKMQTVFIEMETCPPQDNSVARDLKDLKEVVM  433

Query  715   KNDE---KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             + DE     G  D    I+AHLPV VNEQRVSNLLQS+ VGL++ AVPVI+MIP+S+LWG
Sbjct  434   RPDEGGDTKGKFDPDLHIEAHLPVRVNEQRVSNLLQSVLVGLTLLAVPVIKMIPSSILWG  493

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWER++LLF+PP++ FKVLEG+HA+++E VP++ I  FT+FQ VY 
Sbjct  494   YFAYMAIDSLPGNQFWERLLLLFIPPSQLFKVLEGVHASFIELVPYRVIVTFTLFQLVYF  553

Query  1066  LVCFGVTWI  1092
             L+C+G+TWI
Sbjct  554   LLCYGMTWI  562



>ref|XP_008219893.1| PREDICTED: probable boron transporter 7 [Prunus mume]
Length=661

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/372 (70%), Positives = 304/372 (82%), Gaps = 8/372 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLY NGLLAVIF FGV+ TSL+SR+ARSW YGTG+ RS IADYGVPLMV++WTA+
Sbjct  191   EFQFQWLYTNGLLAVIFCFGVISTSLKSRKARSWWYGTGWLRSLIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP +VP  VPRRLVCP PW+ AS+YHWTV KDM  VP  YI A FIPA MIAGLYFF
Sbjct  251   SYVVPGKVPHGVPRRLVCPFPWDSASLYHWTVTKDMPNVPVLYIFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KP AYHYD+L+LG+MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLQKPPAYHYDMLLLGIMTLICGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP-----VADKELNNLKV  705
             L+ Q++RK+M+ SA+E +K++AT SE++GRM AV++EM     P     +  KEL NL+ 
Sbjct  371   LRKQVIRKKMIKSAQECIKLKATNSEMFGRMEAVFIEMDGGSPPNFSFVLQPKELQNLRE  430

Query  706   AVMKND---EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSV  876
             AVMK+D   E  G  D  K IDAHLPV VNEQRVSNLLQS+ VG S+ A+ VI+ IPTSV
Sbjct  431   AVMKSDDGGELKGKFDPEKHIDAHLPVRVNEQRVSNLLQSLLVGGSVFAIFVIKKIPTSV  490

Query  877   LWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQF  1056
             LWGYFAYMA DSL GNQFWERI+LLF+ P+RR+KVLEG HA++VE VPFKYI  F +FQ 
Sbjct  491   LWGYFAYMAIDSLHGNQFWERILLLFISPSRRYKVLEGSHASFVELVPFKYIVAFALFQL  550

Query  1057  VYLLVCFGVTWI  1092
             VY L+CFGVTWI
Sbjct  551   VYFLICFGVTWI  562



>ref|XP_006289519.1| hypothetical protein CARUB_v10003060mg, partial [Capsella rubella]
 gb|EOA22417.1| hypothetical protein CARUB_v10003060mg, partial [Capsella rubella]
Length=658

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/369 (70%), Positives = 304/369 (82%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E  F  LYANGLLAVIFS G+++T+L+SR A+SW YG G+ RSFI DYGVPLMV+LWTA+
Sbjct  195   ESHFLLLYANGLLAVIFSLGLVITALKSRRAKSWKYGFGWLRSFIGDYGVPLMVLLWTAL  254

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYT+P EV  +VPRRL CPLPWEPAS+YHWTVIKDMGKVP  YI A FIP  MIAGLYFF
Sbjct  255   SYTIPSEVVPNVPRRLFCPLPWEPASLYHWTVIKDMGKVPVMYIFAAFIPGVMIAGLYFF  314

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQAPMHTKSLA 
Sbjct  315   DHSVASQMAQQKEFNLKNPSAYHYDIFLLGIMTLICGLLGLPPSNGVIPQAPMHTKSLAV  374

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-SPAPVA-DKELNNLKVAVM  714
             L  QL RK+M+  AKE MKM+A+KSEIYGRM  V++EM + SP   +  K+L +LK  VM
Sbjct  375   LNRQLTRKKMVKKAKECMKMKASKSEIYGRMQTVFIEMETCSPQDNSVVKDLKDLKEVVM  434

Query  715   KNDE---KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             + DE     G  D    I+AHLPV VNEQRVSNLLQS+ VGL++ AVPVI+MIP+S+LWG
Sbjct  435   RPDEGGDTKGKFDPDVHIEAHLPVRVNEQRVSNLLQSLLVGLTLLAVPVIKMIPSSILWG  494

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWER++LLF+PP+R FKVLEG+HA++VE VP++ I  FT+FQ VY 
Sbjct  495   YFAYMAIDSLPGNQFWERLLLLFIPPSRIFKVLEGVHASFVELVPYRVIVTFTLFQLVYF  554

Query  1066  LVCFGVTWI  1092
             L+C+G+TWI
Sbjct  555   LLCYGMTWI  563



>ref|XP_009334783.1| PREDICTED: probable boron transporter 6 isoform X2 [Pyrus x bretschneideri]
Length=658

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/367 (69%), Positives = 303/367 (83%), Gaps = 4/367 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLYANGLLAVIF FG+  T+L+SR+AR W YG+G+ RSFIADYGVPLMV++WTA+
Sbjct  191   EFQFQWLYANGLLAVIFCFGLTFTALKSRKARLWWYGSGWLRSFIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY +P +VP  VPRRLVCPLPW+  S+YHWTV+KDM  VP  YI A FIPA MIAGLYFF
Sbjct  251   SYALPGKVPHGVPRRLVCPLPWDSKSLYHWTVVKDMPNVPVMYIFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPSAYHYD+ +LG+ TL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLQKPSAYHYDMFLLGITTLVCGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ Q++RK+M+ SAKE MK+ AT SE++GRM AV++EM    +P   KEL NL+ AVMK+
Sbjct  371   LRRQVIRKKMVKSAKECMKLNATNSEMFGRMEAVFIEMDGG-SPPHSKELENLREAVMKS  429

Query  721   DEK---DGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D+     G  D  K IDAHLPV VNEQRVSNLLQS+ VG S+ A+ VI+ IPTSVLWGYF
Sbjct  430   DDGGDLKGKFDPEKHIDAHLPVRVNEQRVSNLLQSLLVGGSVFAIFVIKKIPTSVLWGYF  489

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWER++LLF+ P RR+KVLE  HA++VE VPFKYI  FT+FQ VY L+
Sbjct  490   AYMAIDSLPGNQFWERLLLLFISPKRRYKVLEASHASFVELVPFKYIVAFTLFQLVYFLI  549

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  550   CFGVTWI  556



>ref|XP_010526199.1| PREDICTED: probable boron transporter 7 [Tarenaya hassleriana]
Length=672

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/368 (71%), Positives = 302/368 (82%), Gaps = 7/368 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             EY+FQW Y NGLLAVIFSFG+L T+L+SR ARSW YG  + RSF+ DYG  LMVVLWTA+
Sbjct  191   EYKFQWRYTNGLLAVIFSFGLLFTALKSRRARSWKYGFRWIRSFVGDYGTLLMVVLWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYT+P+EVPS+VPRRL CPLPWEPAS+YHWTV+KDMGKVP  YILA FIPA M+AGLYFF
Sbjct  251   SYTIPREVPSAVPRRLECPLPWEPASLYHWTVVKDMGKVPMIYILAAFIPAIMVAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSV++QMAQ KEFNLK P AYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA 
Sbjct  311   DHSVSAQMAQQKEFNLKNPPAYHYDIFVLGIMTLICGLLGLPPSNGVIPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMK  717
             LK Q MRK+M+ SAKE MK +A+ SEIYGRM  V++EM +SP A   ++EL NLK AVMK
Sbjct  371   LKRQQMRKKMVESAKECMKKKASHSEIYGRMQDVFIEMETSPKAASVEQELENLKEAVMK  430

Query  718   ND---EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +   +  G  D    I+AHLPV VNEQRVSNLLQSI VGL I  VPVIRMIPTSVLWGY
Sbjct  431   AEDGGDAKGKFDPEVHIEAHLPVRVNEQRVSNLLQSILVGLLILVVPVIRMIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             F+YMA DSLPGNQFWER++LL V P+RRFKVLEG+HA+++E VP K I  FT+F     L
Sbjct  491   FSYMAVDSLPGNQFWERLLLLLVTPSRRFKVLEGLHASFLEIVPSKSIVAFTLF---IPL  547

Query  1069  VCFGVTWI  1092
             VC+GVTWI
Sbjct  548   VCYGVTWI  555



>ref|XP_006581378.1| PREDICTED: boron transporter 4-like isoform X1 [Glycine max]
 ref|XP_006581379.1| PREDICTED: boron transporter 4-like isoform X2 [Glycine max]
 ref|XP_006581380.1| PREDICTED: boron transporter 4-like isoform X3 [Glycine max]
Length=655

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/367 (69%), Positives = 302/367 (82%), Gaps = 6/367 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLY NGLLA+IF FG+L+T+L+SR AR+W YGTG+ R FIADYGVP+MVVLWTA+
Sbjct  188   EFQFQWLYTNGLLAIIFCFGLLVTALKSRRARTWRYGTGWLRGFIADYGVPMMVVLWTAL  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP +VP  VPRRL+ PLPW+ AS+YHWTV+KDMGKVP  YI    IPA MIAGLYFF
Sbjct  248   SYAVPGKVPDGVPRRLIAPLPWDAASLYHWTVVKDMGKVPVVYIFGAIIPALMIAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+KPSAYHYD+L+LG+MTLICG+LGLPPSNGVLPQ+PMHTKSLA 
Sbjct  308   DHSVASQMAQQKEFNLQKPSAYHYDVLLLGIMTLICGILGLPPSNGVLPQSPMHTKSLAV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ +L+RK+++ SAKE +K + T SE+YG+M  V VEM + P     KEL NLK AVM++
Sbjct  368   LRRRLIRKKVVKSAKECIKQRRTNSELYGKMEEVIVEMDTDPTV---KELENLKEAVMQS  424

Query  721   DEKDG---NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D KDG     D  K ID +LPV VNEQR++NLLQS+ VG+SI A+ VI+ IPTSVLWGYF
Sbjct  425   DSKDGAREKFDPEKHIDEYLPVRVNEQRMTNLLQSLLVGVSILAMSVIKRIPTSVLWGYF  484

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+LLFV P+RR+K+LEG HA++VE+VPFK IA FT  Q  Y  +
Sbjct  485   AYMAIDSLPGNQFWERILLLFVTPSRRYKILEGSHASFVETVPFKTIAAFTALQLAYFAL  544

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  545   CFGVTWI  551



>ref|XP_009389936.1| PREDICTED: boron transporter 4-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=683

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 301/368 (82%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QF+WLY NGLL +IF+ G+LLT+++SR ARSW YGTG+ R   ADYGVPLMV+LWTA+S
Sbjct  192   FQFEWLYTNGLLGIIFAAGLLLTAIKSRRARSWKYGTGWLRGLTADYGVPLMVLLWTAMS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y VP +VPS VPRRL  PLPWE  S+YHWTV KDM  VPP YI A  IPA M+AGLYFFD
Sbjct  252   YAVPNKVPSGVPRRLFSPLPWEAKSLYHWTVAKDMLSVPPVYIFAAIIPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLKKPSAYHYDIL+LG M L+CGLLG+PPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQMAQQKEFNLKKPSAYHYDILVLGFMVLVCGLLGIPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMKN  720
             K +++RK+M+ +AKE ++ QAT SE+YG+M  V+V+M      ++ DKEL NLK AVM N
Sbjct  372   KRRIIRKKMVETAKESIRQQATNSEMYGKMQEVFVKMDEGSTSISIDKELKNLKDAVMGN  431

Query  721   ----DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
                 D+  G  D  K IDAHLPV VNEQR++NLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  432   GAGGDDSKGAFDPEKHIDAHLPVRVNEQRMTNLLQSLLVGACLAAMPVIKMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER +LL + P+RR+KVLEG+HA++VESVPF+ IA FTIFQF+YLL
Sbjct  492   FAYMAIDSLPGNQFWERTLLLLITPSRRYKVLEGMHASFVESVPFRQIAAFTIFQFLYLL  551

Query  1069  VCFGVTWI  1092
             +CFGVTWI
Sbjct  552   LCFGVTWI  559



>ref|XP_010033916.1| PREDICTED: boron transporter 4 [Eucalyptus grandis]
 ref|XP_010033917.1| PREDICTED: boron transporter 4 [Eucalyptus grandis]
 gb|KCW53788.1| hypothetical protein EUGRSUZ_J03035 [Eucalyptus grandis]
Length=669

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 307/368 (83%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IF+FG+L T+L+SR+ARSW YGTG+ R+F ADYGVPLMV+LWTA+
Sbjct  191   KYQFQWLYTNGLLGIIFTFGLLYTALKSRKARSWLYGTGWLRNFTADYGVPLMVLLWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+++PK++PS VPRRL  PLPWE AS++HWTVIKDMG+V P Y+ A FIPA MIAGLYFF
Sbjct  251   SFSIPKKLPSGVPRRLFSPLPWESASLHHWTVIKDMGRVSPAYVFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK  SAYHYDI +LG +TL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLKNSSAYHYDIFLLGFLTLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVM-  714
             LK Q +R++M+ SAKE ++ +A+ SEIYG+M   + +  SSP   +  KEL +LK AV+ 
Sbjct  371   LKRQHIRRKMIESAKESIRRKASNSEIYGKMQDAFFKTESSPVTSSVVKELEDLKEAVIQ  430

Query  715   --KNDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
               K DE+  + D  K IDA+LPV VNEQR+SNLLQS+ V  S+CA+P+I++IPTSVLWGY
Sbjct  431   SSKGDEEKASFDPEKQIDAYLPVRVNEQRLSNLLQSVLVAASVCAMPIIKLIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++ LF+ P+RR++VLEG+H +YVESVP KYIA FTIFQFVYLL
Sbjct  491   FAYMAIDSLPGNQFWERMLFLFITPSRRYRVLEGVHTSYVESVPSKYIAAFTIFQFVYLL  550

Query  1069  VCFGVTWI  1092
             +CFGVT I
Sbjct  551   LCFGVTKI  558



>ref|NP_197925.4| putative boron transporter 6 [Arabidopsis thaliana]
 sp|Q3E954.2|BOR6_ARATH RecName: Full=Probable boron transporter 6 [Arabidopsis thaliana]
 gb|ADF49545.1| boron transporter 6 [Arabidopsis thaliana]
 gb|AED93442.1| putative boron transporter 6 [Arabidopsis thaliana]
Length=671

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/367 (70%), Positives = 302/367 (82%), Gaps = 5/367 (1%)
 Frame = +1

Query  7     QFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSY  186
              F  +YANGLLAVIFS G+L+T+L+SR A+SW YG G+ RSFI DYGVPLMV+LWTA+SY
Sbjct  195   HFLLIYANGLLAVIFSLGLLITALKSRRAKSWKYGFGWLRSFIGDYGVPLMVLLWTALSY  254

Query  187   TVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDH  366
             TVP EV  SVPRRL CPLPWEPAS+YHWTV+KDMGKVP  YILA FIP  MIAGLYFFDH
Sbjct  255   TVPSEVLPSVPRRLFCPLPWEPASLYHWTVVKDMGKVPIMYILAAFIPGVMIAGLYFFDH  314

Query  367   SVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELK  546
             SVASQMAQ KEFNLK PSAYHYDI +LG++TLICGLLGLPPSNGVLPQAPMHTKSLA L 
Sbjct  315   SVASQMAQQKEFNLKNPSAYHYDIFLLGIITLICGLLGLPPSNGVLPQAPMHTKSLAVLN  374

Query  547   TQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP--VADKELNNLKVAVMKN  720
              QL+RK+M+  AKE MKM+A+KSEIYGRM +V++EM +SP        +L  LK  VM+ 
Sbjct  375   RQLIRKKMVKKAKECMKMKASKSEIYGRMQSVFIEMETSPPQDNSVATDLKELKEVVMRP  434

Query  721   DE---KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             DE     G  D    I+A+LPV VNEQRVSNLLQS+ VGL++ AV VI+MIP+SVLWGYF
Sbjct  435   DEGGDTKGKFDPDVHIEANLPVRVNEQRVSNLLQSVLVGLTLLAVTVIKMIPSSVLWGYF  494

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWER++LLF+PP+R FKVLEG+HA++VE VP++ I  FT+FQ VY L+
Sbjct  495   AYMAIDSLPGNQFWERLLLLFIPPSRLFKVLEGVHASFVELVPYRVIVTFTLFQLVYFLL  554

Query  1072  CFGVTWI  1092
             C+G+TWI
Sbjct  555   CYGMTWI  561



>gb|KHN07101.1| Boron transporter 4 [Glycine soja]
Length=672

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/367 (69%), Positives = 302/367 (82%), Gaps = 6/367 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLY NGLLA+IF FG+L+T+L+SR AR+W YGTG+ R FIADYGVP+MVVLWTA+
Sbjct  204   EFQFQWLYTNGLLAIIFCFGLLVTALKSRRARTWRYGTGWLRGFIADYGVPMMVVLWTAL  263

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP +VP  VPRRL+ PLPW+ AS+YHWTV+KDMGKVP  YI    IPA MIAGL+FF
Sbjct  264   SYAVPGKVPDGVPRRLIAPLPWDAASLYHWTVVKDMGKVPVVYIFGAIIPALMIAGLHFF  323

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+KPSAYHYD+L+LG+MTLICG+LGLPPSNGVLPQ+PMHTKSLA 
Sbjct  324   DHSVASQMAQQKEFNLQKPSAYHYDVLLLGIMTLICGILGLPPSNGVLPQSPMHTKSLAV  383

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ +L+RK+++ SAKE +K + T SE+YG+M  V VEM + P     KEL NLK AVM++
Sbjct  384   LRRRLIRKKVVKSAKECIKQRRTNSELYGKMEEVIVEMDTDPTV---KELENLKEAVMQS  440

Query  721   DEKDG---NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D KDG     D  K ID +LPV VNEQR++NLLQS+ VG+SI A+ VI+ IPTSVLWGYF
Sbjct  441   DSKDGAREKFDPEKHIDEYLPVRVNEQRMTNLLQSLLVGVSILAMSVIKRIPTSVLWGYF  500

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+LLFV P+RR+K+LEG HA++VE+VPFK IA FT  Q  Y  +
Sbjct  501   AYMAIDSLPGNQFWERILLLFVTPSRRYKILEGSHASFVETVPFKTIAAFTALQLAYFAL  560

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  561   CFGVTWI  567



>ref|XP_009400125.1| PREDICTED: boron transporter 4-like [Musa acuminata subsp. malaccensis]
Length=700

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 300/368 (82%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQF+WLY NGLL ++F+FG+L T+L+SR AR+W YGTG+ R FIADYGVPLMV+LWTA+S
Sbjct  192   YQFEWLYTNGLLGIVFAFGLLFTALKSRRARAWRYGTGWLRGFIADYGVPLMVLLWTAMS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y VP +VPS VPRRL  PLPWE  S+YHWTV KDM  VPP YI A  IPA M+AGLYFFD
Sbjct  252   YAVPSKVPSGVPRRLFSPLPWETKSLYHWTVAKDMLSVPPLYIFAAIIPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLK PSAYHYDIL+LG M L CGLLG+PPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQMAQQKEFNLKNPSAYHYDILILGFMVLACGLLGIPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMKN  720
             K ++MRK+M+ SAKE ++ QA+ SEIYG+M  V+V+M + P  ++ D EL NLK AVM N
Sbjct  372   KRRIMRKKMVESAKESIRQQASNSEIYGKMQEVFVKMDNGPTVISIDTELKNLKDAVMNN  431

Query  721   ----DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
                 ++     D  K IDA+LPV VNEQRV+NLLQS+FVG  + A+P+I+MIPTSVLWGY
Sbjct  432   GAGGEDSKVAFDPEKHIDAYLPVRVNEQRVTNLLQSLFVGACLGAMPIIKMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER + L V P+RR+KVLEG+HA+++ESVPF+ IA FTI QFVYLL
Sbjct  492   FAYMAIDSLPGNQFWERTLFLLVTPSRRYKVLEGMHASFMESVPFRKIAAFTILQFVYLL  551

Query  1069  VCFGVTWI  1092
             VCFGVTWI
Sbjct  552   VCFGVTWI  559



>gb|KHN08107.1| Boron transporter 4 [Glycine soja]
Length=663

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/367 (69%), Positives = 302/367 (82%), Gaps = 6/367 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLY NGLLA+IF FG+L+T+L+SR AR+W YGTG+ R FIADYGVP+MVVLWTA+
Sbjct  188   EFQFQWLYTNGLLAIIFCFGLLVTALKSRRARTWRYGTGWLRGFIADYGVPMMVVLWTAL  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYTVP +VP  VPRRL+ PLPW+ AS+YHWTV+KDMGKVP  YI    IPA MIAGLYFF
Sbjct  248   SYTVPGKVPDGVPRRLISPLPWDAASLYHWTVVKDMGKVPVVYIFGAIIPALMIAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+KPSAYHYD+L+LG+MTLICG+LGLPPSNGVLPQ+PMHTKSLA 
Sbjct  308   DHSVASQMAQQKEFNLQKPSAYHYDVLLLGIMTLICGILGLPPSNGVLPQSPMHTKSLAV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ +++RK+++ SAKE +K + T SE+YG+M  V VEM + P     KEL NLK AVM++
Sbjct  368   LRRRMIRKKVVKSAKECIKQRRTNSELYGKMQEVIVEMDTDPTV---KELENLKEAVMQS  424

Query  721   DEKDG---NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D KDG     D  K ID +LPV VNEQR++NLLQS+ V +SI A+ VI+ IPTSVLWGYF
Sbjct  425   DSKDGAKEKFDPEKHIDEYLPVRVNEQRMTNLLQSLLVAVSILAMSVIKRIPTSVLWGYF  484

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+LLFV  +RR+K+LEG HA++VE+VPFK IA FT  Q VY  +
Sbjct  485   AYMAIDSLPGNQFWERILLLFVTSSRRYKILEGSHASFVETVPFKTIAAFTALQLVYFAL  544

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  545   CFGVTWI  551



>ref|XP_010495500.1| PREDICTED: probable boron transporter 6 [Camelina sativa]
Length=682

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/369 (69%), Positives = 300/369 (81%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E  F  LYANGLLAVIFS G+++T+L+SR A+SW YG G+ RSFI DYGVPLMV+ WTA+
Sbjct  193   ESHFLLLYANGLLAVIFSLGLVITALKSRRAKSWKYGFGWLRSFIGDYGVPLMVLFWTAL  252

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYT+P EV  SVPRRL CPLPWEPAS+YHWTVIKDMGKVP  YI A FIP  MIAGLYFF
Sbjct  253   SYTIPSEVVPSVPRRLFCPLPWEPASLYHWTVIKDMGKVPVMYIFAAFIPGVMIAGLYFF  312

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK P AYHYDI +LG+MTLICGLLGLPPSNGV+PQAPMHTKSLA 
Sbjct  313   DHSVASQMAQQKEFNLKNPPAYHYDIFLLGIMTLICGLLGLPPSNGVIPQAPMHTKSLAV  372

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP--VADKELNNLKVAVM  714
             L  QL RK+M+  AKE MKM+A+KSEIYG+M  V++EM + P       ++L +LK  VM
Sbjct  373   LNRQLTRKKMVKKAKECMKMKASKSEIYGKMQTVFIEMETCPPQDNSVARDLKDLKEVVM  432

Query  715   KNDE---KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             + DE     G  D    I+AHLPV VNEQRVSNLLQS+ VGL++ AVPVI+MIP+S+LWG
Sbjct  433   RPDEGGDTKGKFDPDVHIEAHLPVRVNEQRVSNLLQSVLVGLTLLAVPVIKMIPSSILWG  492

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWER++LLF+PP+R FKVLEG+HA++VE VP++ I  FT+FQ VY 
Sbjct  493   YFAYMAIDSLPGNQFWERLLLLFIPPSRLFKVLEGVHASFVELVPYRVIVTFTLFQLVYF  552

Query  1066  LVCFGVTWI  1092
             L+C+G+TWI
Sbjct  553   LLCYGMTWI  561



>ref|XP_011013546.1| PREDICTED: boron transporter 4-like isoform X3 [Populus euphratica]
Length=560

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/367 (68%), Positives = 300/367 (82%), Gaps = 3/367 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y FQWLY NGLL VIF+FG+L T+L+SR ARSW YGTG+FR+ IADYGVPLMV++W A+
Sbjct  85    KYNFQWLYTNGLLGVIFTFGLLYTALKSRGARSWQYGTGWFRTLIADYGVPLMVLVWAAL  144

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP ++PS VPRRL  PLPW+ A + HWTVIKDM KVPP Y+ A FIPA M+AGLYFF
Sbjct  145   SFGVPGKLPSGVPRRLGSPLPWDTAPLEHWTVIKDMAKVPPAYLFAAFIPAVMVAGLYFF  204

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ K FNL+KPSAYHYDIL+LGV+TL CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  205   DHSVASQMAQQKNFNLRKPSAYHYDILVLGVLTLFCGLIGLPPSNGVLPQSPMHTKSLAV  264

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L  QL+RK+M+  AKE MK  A+ SEIYG+M AV++E+  +P P A  EL +LK   MK+
Sbjct  265   LSKQLIRKKMVKGAKECMKQNASNSEIYGKMQAVFIEINRTPLPSAANELKDLKDTAMKD  324

Query  721   DEKD---GNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D+     GN D  K IDAHLPV VNEQR SNLLQS+ VG+S+ A+P+I+ IPTSVLWGYF
Sbjct  325   DDGGIAYGNFDPEKHIDAHLPVQVNEQRFSNLLQSLLVGVSLLAMPIIKKIPTSVLWGYF  384

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+LLFV P+R  K+LE  HA++VE+VPF++I+ FT+FQ  YLL+
Sbjct  385   AYMAIDSLPGNQFWERILLLFVTPSRCHKILEAPHASFVENVPFRHISMFTLFQLAYLLI  444

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  445   CFGVTWI  451



>ref|XP_010421393.1| PREDICTED: probable boron transporter 6 [Camelina sativa]
Length=673

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/369 (69%), Positives = 299/369 (81%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E  F  LYANGLLAVIFS G+++T+L+SR A+SW YG G+ RSFI DYGVPL+V+ WTA+
Sbjct  195   ESHFLLLYANGLLAVIFSLGLVITALKSRRAKSWKYGFGWLRSFIGDYGVPLVVLFWTAL  254

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYT+P EV  SVPRRL CPLPWEP S+YHWTVI DMGKVP  YI A FIP  MIAGLYFF
Sbjct  255   SYTIPSEVAPSVPRRLFCPLPWEPTSLYHWTVIMDMGKVPVMYIFAAFIPGVMIAGLYFF  314

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQAPMHTKSLA 
Sbjct  315   DHSVASQMAQQKEFNLKNPSAYHYDIFLLGIMTLICGLLGLPPSNGVIPQAPMHTKSLAV  374

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP--VADKELNNLKVAVM  714
             L  QL RK+M+  AKE MKM+A+KSEIYG+M  V++EM + P       ++L +LK  VM
Sbjct  375   LNRQLTRKKMVKKAKECMKMKASKSEIYGKMQTVFIEMETCPPQDNTVARDLKDLKEVVM  434

Query  715   KNDE---KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             + DE     G  D    I+AHLPV VNEQRVSNLLQS+ VGL++ AVPVI+MIP+S+LWG
Sbjct  435   RPDEGGDTKGKFDPDVHIEAHLPVRVNEQRVSNLLQSVLVGLTLLAVPVIKMIPSSILWG  494

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWER++LLF+PP+R FKVLEG+HA++VE VP+K I  FT+FQ VY 
Sbjct  495   YFAYMAIDSLPGNQFWERLLLLFIPPSRLFKVLEGVHASFVELVPYKVIVTFTLFQLVYF  554

Query  1066  LVCFGVTWI  1092
             L+C+G+TWI
Sbjct  555   LLCYGMTWI  563



>ref|XP_002872164.1| anion exchange protein family [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48423.1| anion exchange protein family [Arabidopsis lyrata subsp. lyrata]
Length=642

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/367 (69%), Positives = 299/367 (81%), Gaps = 5/367 (1%)
 Frame = +1

Query  7     QFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSY  186
              F  LYANGLLAVIFS G++ T+L+SR A+SW YG G+ RSFI DYGVPLMV+LWTA+SY
Sbjct  165   HFLLLYANGLLAVIFSLGLVFTALKSRRAKSWKYGFGWLRSFIGDYGVPLMVLLWTALSY  224

Query  187   TVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDH  366
             T+P EV  SVPRRL CPLPWEPAS+YHWTVIKDMGKVP  YI A FIP  MIAGLYFFDH
Sbjct  225   TIPSEVLPSVPRRLFCPLPWEPASLYHWTVIKDMGKVPVMYIFAAFIPGVMIAGLYFFDH  284

Query  367   SVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELK  546
             SVASQMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGVLPQAPMHTKSLA L 
Sbjct  285   SVASQMAQQKEFNLKNPSAYHYDIFLLGIMTLICGLLGLPPSNGVLPQAPMHTKSLAVLN  344

Query  547   TQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP--VADKELNNLKVAVMKN  720
              QL RK+M+  AKE MKM+A+KSEIYGRM +V++EM + P        +L  LK  VM+ 
Sbjct  345   RQLTRKKMVKKAKECMKMKASKSEIYGRMQSVFIEMETCPPQDNSVATDLKELKEVVMRP  404

Query  721   D---EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D   +  G  D    I+A+LPV VNEQRVSNLLQS+ VGL++ AVPVI+MIP+S+LWGYF
Sbjct  405   DQGADTKGKFDPDVHIEANLPVRVNEQRVSNLLQSVLVGLTLLAVPVIKMIPSSILWGYF  464

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWER++LLF+PP+R FKVLEG+HA++VE VP++ I  FT+FQ VY L+
Sbjct  465   AYMAIDSLPGNQFWERLLLLFIPPSRLFKVLEGVHASFVELVPYRVIVTFTLFQLVYFLL  524

Query  1072  CFGVTWI  1092
             C+G+TWI
Sbjct  525   CYGMTWI  531



>ref|XP_010437902.1| PREDICTED: probable boron transporter 7 [Camelina sativa]
 ref|XP_010437903.1| PREDICTED: probable boron transporter 7 [Camelina sativa]
Length=673

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 293/368 (80%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A S
Sbjct  192   YQFQWLYTNGLLAVIFSFGLLYTALKSRRARSWKYGFRWMRGFIGDYGTLLMLVLWSAFS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YTVP+ +P  VPRRL  PLPW+  S+YHWTV+KDMGKVPP YILA FIPA MIAGLYFFD
Sbjct  252   YTVPRNLPEGVPRRLELPLPWDSESLYHWTVVKDMGKVPPLYILAAFIPAIMIAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
               V++QMAQ KEFNLK P AYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  312   QCVSAQMAQQKEFNLKNPPAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKND  723
             K Q MRK+M+  AKE MK +A+ SEIYGRM  V++EM +SP     KEL NLK AVMK D
Sbjct  372   KKQQMRKKMVQKAKECMKAKASNSEIYGRMQDVFIEMETSPKATVVKELENLKEAVMKAD  431

Query  724   EKDGN-----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +  G+      D    I+ HLPV VNEQRVSNLLQSI VGL I AVPV+RMIPTSVLWGY
Sbjct  432   DGGGDTKGKKFDPEVHIEDHLPVRVNEQRVSNLLQSILVGLLIFAVPVLRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             F YMA DSLPGNQFWER+ LLF+ P RRFKVLEG+HA++VE VP+K I  FT+FQ +Y L
Sbjct  492   FTYMAVDSLPGNQFWERLQLLFITPGRRFKVLEGLHASFVEIVPYKSIVMFTLFQLLYFL  551

Query  1069  VCFGVTWI  1092
             +C+GVTWI
Sbjct  552   ICYGVTWI  559



>ref|XP_004501300.1| PREDICTED: probable boron transporter 7-like [Cicer arietinum]
Length=668

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/367 (68%), Positives = 301/367 (82%), Gaps = 6/367 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQW Y NGLLA+IFSFG+++TSL+SR AR+W YGTG+ R FIADYGV +MVVLWTA+
Sbjct  188   EFQFQWRYTNGLLAIIFSFGLVVTSLKSRRARAWRYGTGWLRGFIADYGVAMMVVLWTAI  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY +P +VP+ VPRRL CPLPWEPAS+YHWTV+KDM KVP  YI    IPA MIAGLYFF
Sbjct  248   SYVIPGKVPNGVPRRLFCPLPWEPASLYHWTVVKDMWKVPLSYIFGAIIPALMIAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVAS+MAQ KEFNL+KPSAYHYD+ +LG+MTLICG+LGLPPSNGVLPQ+PMHTKSLA 
Sbjct  308   DHSVASKMAQQKEFNLQKPSAYHYDVFLLGIMTLICGILGLPPSNGVLPQSPMHTKSLAV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ QL+RKR++ SAKE ++   T SE+Y +M AV++EM + P     KEL  LK AVM +
Sbjct  368   LRRQLIRKRVVKSAKECIEQHTTSSELYRKMQAVFIEMDTVPTV---KELETLKEAVMNS  424

Query  721   DEKDG---NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D KDG   N D  K+IDA+LPV VNEQR++NLLQS+ VG SI  + V++ IPTSVLWGYF
Sbjct  425   DSKDGAKENFDPEKNIDAYLPVRVNEQRMTNLLQSLLVGASIIGISVMKKIPTSVLWGYF  484

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+LLF+ P+RR+K+L+G HA++VE+VPFK IAGFT  Q  Y L 
Sbjct  485   AYMAIDSLPGNQFWERILLLFITPSRRYKILQGSHASFVETVPFKTIAGFTALQLAYFLF  544

Query  1072  CFGVTWI  1092
             C+GVTWI
Sbjct  545   CYGVTWI  551



>ref|XP_006601135.1| PREDICTED: probable boron transporter 6-like [Glycine max]
Length=663

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/367 (69%), Positives = 306/367 (83%), Gaps = 12/367 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E QF W YANGLLA+I SFG+L+T+  SR+AR+W YG+G+ R FIADYGVP+M+V+WT +
Sbjct  195   ENQFHWRYANGLLAIILSFGLLITATMSRKARTWKYGSGWLRGFIADYGVPMMLVIWTGL  254

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYT+P ++PS+VPRRLVCPLPWE  S YHWTV+KDMGKVP  YI   FIPA MIAGLYFF
Sbjct  255   SYTLPGKIPSAVPRRLVCPLPWE--STYHWTVVKDMGKVPLGYIFGAFIPAVMIAGLYFF  312

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVAS+MAQ KEFNL+KPSAYHYDIL+LG+MTLICG+LGLPPSNGVLPQ+PMHTKSL  
Sbjct  313   DHSVASKMAQQKEFNLQKPSAYHYDILLLGIMTLICGILGLPPSNGVLPQSPMHTKSLTV  372

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ QL+RK+++ S K+    Q + SE+YG+M  V+VEM ++P     KEL NLK AVMK+
Sbjct  373   LRKQLIRKKVVKSVKQ----QGSNSELYGKMQVVFVEMDTTPT---TKELENLKEAVMKS  425

Query  721   DEKDG---NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             +EK+    N D  K IDA+LPV VNEQR+SNLLQS+ +GLSI +V +I+MIPTSVLWGYF
Sbjct  426   NEKNAAKENFDPDKHIDAYLPVRVNEQRMSNLLQSLLIGLSIFSVNIIKMIPTSVLWGYF  485

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI LLF+PP+RR+K+LEG HA++VESVPFK IA FTI QFVY L+
Sbjct  486   AYMAIDSLPGNQFWERISLLFIPPSRRYKILEGYHASFVESVPFKTIAVFTILQFVYFLI  545

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  546   CFGVTWI  552



>ref|XP_006578164.1| PREDICTED: boron transporter 4-like [Glycine max]
Length=662

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/367 (69%), Positives = 302/367 (82%), Gaps = 6/367 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLY NGLLA+IF FG+L+T+L+SR AR+W YGTG+ R FIADYGVP+MVVLWTA+
Sbjct  188   EFQFQWLYTNGLLAIIFCFGLLVTALKSRRARTWRYGTGWLRGFIADYGVPMMVVLWTAL  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYTVP +VP  VPRRL+ PLPW+ AS+YHWTV+KDMGKVP  YI    IPA MIAGLYFF
Sbjct  248   SYTVPGKVPDGVPRRLISPLPWDAASLYHWTVVKDMGKVPVVYIFGAIIPALMIAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+KPSAYHYD+L+LG+MTLICG+LGLPPSNGVLPQ+PMHTKSLA 
Sbjct  308   DHSVASQMAQQKEFNLQKPSAYHYDVLLLGIMTLICGILGLPPSNGVLPQSPMHTKSLAV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ +++RK+++ SAKE +K + T SE+YG+M  V VEM + P     KEL NLK AVM++
Sbjct  368   LRRRMIRKKVVKSAKECIKQRRTNSELYGKMQEVIVEMDTDPTV---KELENLKEAVMQS  424

Query  721   DEKDG---NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D KDG     D  K ID +LPV VNEQR++NLLQS+ V +SI A+ VI+ IPTSVLWGYF
Sbjct  425   DSKDGAKEKFDPEKHIDEYLPVRVNEQRMTNLLQSLLVAVSILAMSVIKRIPTSVLWGYF  484

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+LLFV  +RR+K+LEG HA++VE+VPFK IA FT  Q VY  +
Sbjct  485   AYMAIDSLPGNQFWERILLLFVTSSRRYKILEGSHASFVETVPFKTIAAFTALQLVYFAL  544

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  545   CFGVTWI  551



>ref|XP_010048993.1| PREDICTED: probable boron transporter 7 [Eucalyptus grandis]
 ref|XP_010048994.1| PREDICTED: probable boron transporter 7 [Eucalyptus grandis]
 gb|KCW81437.1| hypothetical protein EUGRSUZ_C02816 [Eucalyptus grandis]
Length=668

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/368 (72%), Positives = 312/368 (85%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLLA IF+ G+L T+L+SR+ARSW Y TG+FR FIADYGVPLMV+ WTA+
Sbjct  191   KYQFQWLYTNGLLASIFATGLLYTALKSRKARSWRYTTGWFRGFIADYGVPLMVLTWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VPK VP+ VPRRL CPLPW+ AS+YHWTVIKDM KVPP YI A FIPA MIAGLYFF
Sbjct  251   SFAVPKRVPNGVPRRLFCPLPWDTASLYHWTVIKDMWKVPPTYIFAAFIPAMMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLKKPSAYH+DI +LG++TL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLKKPSAYHFDIFLLGLLTLLCGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD-KELNNLKVAVMK  717
             L  Q++RKRM+ SAKE MK QAT SEIYG+M  V++EM  +P   +  KEL  LK AV+K
Sbjct  371   LNKQIIRKRMVQSAKECMKQQATNSEIYGKMQEVFIEMDRTPTFTSTVKELQELKDAVLK  430

Query  718   NDE-KDGN--LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              D+  DGN   D  K +DAHLPV VNEQR+SNLLQS  VG+S+CA+PVI++IPTSVLWGY
Sbjct  431   ADDGGDGNTKFDPEKYVDAHLPVRVNEQRMSNLLQSCLVGISVCAIPVIKLIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI++LF+ P RR+KVLEG+HA++VESVPFK IA FT+FQFVYLL
Sbjct  491   FAYMAIDSLPGNQFWERILILFITPGRRYKVLEGVHASFVESVPFKSIAMFTLFQFVYLL  550

Query  1069  VCFGVTWI  1092
             +CFGVTW+
Sbjct  551   ICFGVTWV  558



>gb|AES73690.2| boron transporter-like protein [Medicago truncatula]
Length=678

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/367 (69%), Positives = 301/367 (82%), Gaps = 6/367 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E QFQW Y NGLLAVIFSFG+++T+++SR+AR+W YG+   R FIADYGVP+MVVLWTAV
Sbjct  188   ELQFQWRYTNGLLAVIFSFGLIVTAVKSRKARTWRYGSRRLRGFIADYGVPVMVVLWTAV  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY +P ++P+ VPRRL CPLPWEPAS+YHWTV+KDM KVP  YI    IPA MIAGLYFF
Sbjct  248   SYIMPDDIPNGVPRRLFCPLPWEPASLYHWTVVKDMWKVPVVYIFGAIIPALMIAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+KPSAYHYD+ +LG+MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  308   DHSVASQMAQQKEFNLQKPSAYHYDVFLLGIMTLICGLLGLPPSNGVLPQSPMHTKSLAV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ QL+RKR++ SAKE M+ Q+T SE+YG+M AV++EM ++P     KEL  LK AVMK+
Sbjct  368   LRRQLIRKRVVKSAKECMEQQSTSSELYGKMQAVFIEMDTAPTV---KELETLKEAVMKS  424

Query  721   DEKDGNL---DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D K   +   D  K ID +LPV VNEQR++NLLQS+ +GLSI  + VI+ IPTSVLWGYF
Sbjct  425   DTKGCAMEPFDPEKYIDTYLPVRVNEQRMTNLLQSLLIGLSIIGISVIKRIPTSVLWGYF  484

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+LLFV P+RRFK+L+  HA++VE+VPFK IAGFT  Q  Y L 
Sbjct  485   AYMAIDSLPGNQFWERILLLFVTPSRRFKILQDTHASFVETVPFKTIAGFTALQLAYFLF  544

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  545   CFGVTWI  551



>ref|XP_010432710.1| PREDICTED: probable boron transporter 7 isoform X2 [Camelina 
sativa]
Length=673

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 292/368 (79%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A S
Sbjct  192   YQFQWLYTNGLLAVIFSFGLLYTALKSRRARSWKYGFRWMRGFIGDYGTLLMLVLWSAFS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YTVP+ +P  VPRRL  PLPWE  S+YHWTV+KDMGKVPP YILA FIPA MIAGLYFFD
Sbjct  252   YTVPRNLPEGVPRRLELPLPWESESLYHWTVVKDMGKVPPLYILAAFIPAIMIAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK P AYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  312   HCVSAQMAQQKEFNLKNPPAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKND  723
             K Q MRK+M+  AKE M+ +A+ SEIYGRM  V++EM +SP     KEL NLK  VMK D
Sbjct  372   KKQQMRKKMVQKAKECMRAKASNSEIYGRMQDVFIEMETSPKATVVKELENLKEVVMKAD  431

Query  724   EKDGN-----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +  G+      D    I+ HLP  VNEQRVSNLLQSI VGL I AVPV+RMIPTSVLWGY
Sbjct  432   DGGGDTKGKKFDPEVHIEDHLPARVNEQRVSNLLQSILVGLLIFAVPVLRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             F YMA DSLPGNQFWER+ LLF+ P RRFKVLEG+HA++VE VP+K I  FT+FQ +Y L
Sbjct  492   FTYMAVDSLPGNQFWERLQLLFITPGRRFKVLEGLHASFVEIVPYKSIVMFTLFQLLYFL  551

Query  1069  VCFGVTWI  1092
             +C+GVTWI
Sbjct  552   ICYGVTWI  559



>ref|XP_010432709.1| PREDICTED: probable boron transporter 7 isoform X1 [Camelina 
sativa]
Length=673

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 292/368 (79%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A S
Sbjct  192   YQFQWLYTNGLLAVIFSFGLLYTALKSRRARSWKYGFRWMRGFIGDYGTLLMLVLWSAFS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YTVP+ +P  VPRRL  PLPWE  S+YHWTV+KDMGKVPP YILA FIPA MIAGLYFFD
Sbjct  252   YTVPRNLPEGVPRRLELPLPWESESLYHWTVVKDMGKVPPLYILAAFIPAIMIAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK P AYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  312   HCVSAQMAQQKEFNLKNPPAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKND  723
             K Q MRK+M+  AKE M+ +A+ SEIYGRM  V++EM +SP     KEL NLK  VMK D
Sbjct  372   KKQQMRKKMVQKAKECMRAKASNSEIYGRMQDVFIEMETSPKATVVKELENLKEVVMKAD  431

Query  724   EKDGN-----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +  G+      D    I+ HLP  VNEQRVSNLLQSI VGL I AVPV+RMIPTSVLWGY
Sbjct  432   DGGGDTKGKKFDPEVHIEDHLPARVNEQRVSNLLQSILVGLLIFAVPVLRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             F YMA DSLPGNQFWER+ LLF+ P RRFKVLEG+HA++VE VP+K I  FT+FQ +Y L
Sbjct  492   FTYMAVDSLPGNQFWERLQLLFITPGRRFKVLEGLHASFVEIVPYKSIVMFTLFQLLYFL  551

Query  1069  VCFGVTWI  1092
             +C+GVTWI
Sbjct  552   ICYGVTWI  559



>ref|XP_004151241.1| PREDICTED: boron transporter 4-like [Cucumis sativus]
 ref|XP_004164402.1| PREDICTED: boron transporter 4-like [Cucumis sativus]
 gb|KGN58135.1| hypothetical protein Csa_3G536670 [Cucumis sativus]
Length=668

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/369 (70%), Positives = 308/369 (83%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
              YQF W+Y NGLL +IF+FG+L T+L+SR+ARSW YGTG+ RSFIADYGVPLMVV+WTA+
Sbjct  191   NYQFHWIYTNGLLGIIFTFGLLYTALKSRKARSWLYGTGWLRSFIADYGVPLMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VP  VPRRL  PL W+  S+ HWT++KDMGK+PP YI A FIPA MIAGLYFF
Sbjct  251   SFSVPSKVPVGVPRRLQSPLAWQSTSLNHWTIVKDMGKIPPAYIFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTK LA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKCLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMK  717
             L+ +LMR++M+ SAKE ++ +A+ SEIYG+M AV++EM S+P      KEL +LK AVMK
Sbjct  371   LRRRLMRRKMVKSAKESIERKASDSEIYGQMQAVFLEMESNPITTTVVKELEDLKEAVMK  430

Query  718   NDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
              + KD N     DL K IDA+LPV VNEQR+SNLLQS+ V  S+ A+P I+ IPTSVLWG
Sbjct  431   GESKDENANVTFDLEKHIDAYLPVRVNEQRLSNLLQSLLVAASVFALPAIKKIPTSVLWG  490

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWERI+LLFV P+RR+KVLEG HA++VESVPFKYIA FT+FQFVYL
Sbjct  491   YFAYMAIDSLPGNQFWERILLLFVMPSRRYKVLEGFHASFVESVPFKYIAAFTLFQFVYL  550

Query  1066  LVCFGVTWI  1092
             L+CFGVTWI
Sbjct  551   LLCFGVTWI  559



>ref|XP_002309238.2| hypothetical protein POPTR_0006s15960g [Populus trichocarpa]
 gb|EEE92761.2| hypothetical protein POPTR_0006s15960g [Populus trichocarpa]
Length=667

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/367 (68%), Positives = 298/367 (81%), Gaps = 3/367 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y FQWLY NGLL VIF+FG+L T L+SR ARSW YGTG+FR+ IADYGVPLMV+ W A+
Sbjct  192   KYNFQWLYTNGLLGVIFTFGLLYTGLKSRGARSWQYGTGWFRTLIADYGVPLMVLAWAAL  251

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP ++PS VPRRL  PLPW  AS+ HWTVIKDM KVPP Y+ A FIPA M+AGLYFF
Sbjct  252   SFGVPGKLPSGVPRRLESPLPWNTASLKHWTVIKDMAKVPPAYLFAAFIPAVMVAGLYFF  311

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ K FNL+KPSAYHYDIL+LGV+TL CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  312   DHSVASQMAQQKNFNLRKPSAYHYDILVLGVLTLFCGLIGLPPSNGVLPQSPMHTKSLAV  371

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L  QL+RK+M+  AKE MK  A+ SEIYG+M AV++E+  +P P A  EL +LK   MK+
Sbjct  372   LSKQLIRKKMVKGAKECMKQNASNSEIYGKMQAVFIEINRTPLPSAANELKDLKDTAMKD  431

Query  721   DEKD---GNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D+     GN D  K IDAHLPV VNEQR SNLLQS+ VG+S+ A+P+I+ IPTSVLWGYF
Sbjct  432   DDGGIAYGNFDPEKHIDAHLPVQVNEQRFSNLLQSLLVGVSLLAMPIIKKIPTSVLWGYF  491

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+LLFV P+R  K+LE  HA++VE+VPF++I+ FT+FQ  YLL+
Sbjct  492   AYMAIDSLPGNQFWERILLLFVTPSRCHKILEAPHASFVENVPFRHISMFTLFQLAYLLI  551

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  552   CFGVTWI  558



>ref|XP_006283276.1| hypothetical protein CARUB_v10004311mg, partial [Capsella rubella]
 gb|EOA16174.1| hypothetical protein CARUB_v10004311mg, partial [Capsella rubella]
Length=666

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/369 (69%), Positives = 294/369 (80%), Gaps = 6/369 (2%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG+ LM+VLW+A S
Sbjct  192   YQFQWLYTNGLLAVIFSFGLLYTALKSRRARSWRYGFRWMRGFIGDYGILLMLVLWSACS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YTVP+ +P  VPRRL  PLPWE  S+YHWTV+KDMGKVPP YILA FIPA MIAGLYFFD
Sbjct  252   YTVPRNLPEGVPRRLELPLPWESESLYHWTVVKDMGKVPPLYILAAFIPAIMIAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK P AYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  312   HCVSAQMAQQKEFNLKNPPAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K Q MRK+M+  AKE MK +A+ SEIYGRM  V++EM  SP A    KEL NLK AVMK 
Sbjct  372   KKQQMRKKMVQKAKECMKAKASNSEIYGRMQDVFIEMEKSPKANSVVKELENLKEAVMKA  431

Query  721   DEKDGN-----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             D+  G+      D    I+ HLPV VNEQRVSNLLQSI VGL I  VPV+RMIPTSVLWG
Sbjct  432   DDGGGDAKGKKFDPEVHIEDHLPVRVNEQRVSNLLQSILVGLLILVVPVLRMIPTSVLWG  491

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YF YMA DSLPGNQFWER+ LLF+ P RR+KVLEG+HA++VE VP+K I  FT+FQ +Y 
Sbjct  492   YFTYMAVDSLPGNQFWERLQLLFITPGRRYKVLEGLHASFVEIVPYKSIVMFTLFQLLYF  551

Query  1066  LVCFGVTWI  1092
             L+C+GVTWI
Sbjct  552   LICYGVTWI  560



>ref|XP_007013334.1| HCO3- transporter family [Theobroma cacao]
 gb|EOY30953.1| HCO3- transporter family [Theobroma cacao]
Length=669

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/364 (69%), Positives = 302/364 (83%), Gaps = 3/364 (1%)
 Frame = +1

Query  10    FQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSYT  189
             FQWLY NGLL VIF+FG+L+T+L+SR ARSW YGTG+ RS IADYGVPLMVV W+A+S+ 
Sbjct  194   FQWLYVNGLLGVIFTFGLLITALKSRGARSWRYGTGWCRSLIADYGVPLMVVAWSAMSFI  253

Query  190   VPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDHS  369
             VP +VPS VPRRLV PLPWE AS+ HWTV+KDM  VPP ++   F+PA MIAGLYFFDH+
Sbjct  254   VPGKVPSGVPRRLVSPLPWESASLEHWTVMKDMANVPPVHVFTAFLPAIMIAGLYFFDHT  313

Query  370   VASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELKT  549
             VASQ+AQ KEFNLKKPSAYHYDI +LG+MTLICGL+GLPPSNGVLPQ+PMHTKSLA LK 
Sbjct  314   VASQLAQQKEFNLKKPSAYHYDIFILGIMTLICGLIGLPPSNGVLPQSPMHTKSLAVLKR  373

Query  550   QLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKNDE-  726
             Q++RK+M+  AKE +K +A+KS IYGRM  ++ EM S+ AP A ++L +LK AV K ++ 
Sbjct  374   QIIRKKMVKGAKECLKQKASKSIIYGRMQEIFEEMDSTSAPSAAQDLKDLKAAVFKAEDG  433

Query  727   --KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAYM  900
                D   D  K I+AHLPV VNEQRV+NLLQSI VG+S+ A+P+I+ IPTSVLWGYFAYM
Sbjct  434   GNTDCKFDPEKHIEAHLPVRVNEQRVTNLLQSILVGVSLLAMPIIKKIPTSVLWGYFAYM  493

Query  901   ATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCFG  1080
             A DSLPGNQFWER++LL + P+RR+KVLEG HA++VESVPFK IA FT+ Q VYLL+CFG
Sbjct  494   AIDSLPGNQFWERMLLLVIAPSRRYKVLEGAHASFVESVPFKNIAVFTLLQLVYLLMCFG  553

Query  1081  VTWI  1092
             VTWI
Sbjct  554   VTWI  557



>ref|XP_010447377.1| PREDICTED: probable boron transporter 7 [Camelina sativa]
Length=673

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 291/368 (79%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A S
Sbjct  192   YQFQWLYTNGLLAVIFSFGLLYTALKSRRARSWKYGFRWMRGFIGDYGTLLMLVLWSAFS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YTVP  +P  VPRRL  PLPWE  S+YHWTV+KDMGKVPP YILA FIPA MIAGLYFFD
Sbjct  252   YTVPSNLPEGVPRRLELPLPWEAESLYHWTVVKDMGKVPPLYILAAFIPAIMIAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
               V++QMAQ KEFNLK P AYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  312   QCVSAQMAQQKEFNLKNPPAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKND  723
             K Q MRK+M+  AKE M+ +A+ SEIYGRM  V++EM +SP     KEL NLK AVMK D
Sbjct  372   KKQQMRKKMVQKAKECMRAKASNSEIYGRMQDVFIEMETSPKATVVKELENLKEAVMKAD  431

Query  724   EKDGN-----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +  G+      D    I+ HLPV VNEQRVSNLLQSI VGL I AVPV+RMIPTSVLWGY
Sbjct  432   DGGGDTKGKKFDPEVHIEDHLPVRVNEQRVSNLLQSILVGLLIFAVPVLRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             F YMA DSLPGNQFWER+ LLF+ P RRFKVLEG HA++VE VP+K I  FT+FQ +Y L
Sbjct  492   FTYMAVDSLPGNQFWERLQLLFITPGRRFKVLEGSHASFVEIVPYKSIVMFTLFQLLYFL  551

Query  1069  VCFGVTWI  1092
             +C+GVTWI
Sbjct  552   ICYGVTWI  559



>ref|XP_011013544.1| PREDICTED: boron transporter 4-like isoform X1 [Populus euphratica]
Length=673

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/367 (68%), Positives = 300/367 (82%), Gaps = 3/367 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y FQWLY NGLL VIF+FG+L T+L+SR ARSW YGTG+FR+ IADYGVPLMV++W A+
Sbjct  198   KYNFQWLYTNGLLGVIFTFGLLYTALKSRGARSWQYGTGWFRTLIADYGVPLMVLVWAAL  257

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP ++PS VPRRL  PLPW+ A + HWTVIKDM KVPP Y+ A FIPA M+AGLYFF
Sbjct  258   SFGVPGKLPSGVPRRLGSPLPWDTAPLEHWTVIKDMAKVPPAYLFAAFIPAVMVAGLYFF  317

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ K FNL+KPSAYHYDIL+LGV+TL CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  318   DHSVASQMAQQKNFNLRKPSAYHYDILVLGVLTLFCGLIGLPPSNGVLPQSPMHTKSLAV  377

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L  QL+RK+M+  AKE MK  A+ SEIYG+M AV++E+  +P P A  EL +LK   MK+
Sbjct  378   LSKQLIRKKMVKGAKECMKQNASNSEIYGKMQAVFIEINRTPLPSAANELKDLKDTAMKD  437

Query  721   DEKD---GNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D+     GN D  K IDAHLPV VNEQR SNLLQS+ VG+S+ A+P+I+ IPTSVLWGYF
Sbjct  438   DDGGIAYGNFDPEKHIDAHLPVQVNEQRFSNLLQSLLVGVSLLAMPIIKKIPTSVLWGYF  497

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+LLFV P+R  K+LE  HA++VE+VPF++I+ FT+FQ  YLL+
Sbjct  498   AYMAIDSLPGNQFWERILLLFVTPSRCHKILEAPHASFVENVPFRHISMFTLFQLAYLLI  557

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  558   CFGVTWI  564



>ref|XP_011013545.1| PREDICTED: boron transporter 4-like isoform X2 [Populus euphratica]
Length=667

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/367 (68%), Positives = 300/367 (82%), Gaps = 3/367 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y FQWLY NGLL VIF+FG+L T+L+SR ARSW YGTG+FR+ IADYGVPLMV++W A+
Sbjct  192   KYNFQWLYTNGLLGVIFTFGLLYTALKSRGARSWQYGTGWFRTLIADYGVPLMVLVWAAL  251

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP ++PS VPRRL  PLPW+ A + HWTVIKDM KVPP Y+ A FIPA M+AGLYFF
Sbjct  252   SFGVPGKLPSGVPRRLGSPLPWDTAPLEHWTVIKDMAKVPPAYLFAAFIPAVMVAGLYFF  311

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ K FNL+KPSAYHYDIL+LGV+TL CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  312   DHSVASQMAQQKNFNLRKPSAYHYDILVLGVLTLFCGLIGLPPSNGVLPQSPMHTKSLAV  371

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L  QL+RK+M+  AKE MK  A+ SEIYG+M AV++E+  +P P A  EL +LK   MK+
Sbjct  372   LSKQLIRKKMVKGAKECMKQNASNSEIYGKMQAVFIEINRTPLPSAANELKDLKDTAMKD  431

Query  721   DEKD---GNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             D+     GN D  K IDAHLPV VNEQR SNLLQS+ VG+S+ A+P+I+ IPTSVLWGYF
Sbjct  432   DDGGIAYGNFDPEKHIDAHLPVQVNEQRFSNLLQSLLVGVSLLAMPIIKKIPTSVLWGYF  491

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+LLFV P+R  K+LE  HA++VE+VPF++I+ FT+FQ  YLL+
Sbjct  492   AYMAIDSLPGNQFWERILLLFVTPSRCHKILEAPHASFVENVPFRHISMFTLFQLAYLLI  551

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  552   CFGVTWI  558



>ref|XP_008394031.1| PREDICTED: probable boron transporter 6 isoform X1 [Malus domestica]
Length=682

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/390 (66%), Positives = 303/390 (78%), Gaps = 26/390 (7%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLYANGLLAVIF FG+  T+L+SR+ARSW YG+G+ RSFIADYGVPLMV++WTA+
Sbjct  191   EFQFQWLYANGLLAVIFCFGLTFTALKSRKARSWWYGSGWLRSFIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY +P +VP  VPRRLVCP PW+  S+YHWTV+KDM  VP  YI A FIPA MIAGLYFF
Sbjct  251   SYALPGKVPHGVPRRLVCPFPWDSKSLYHWTVVKDMPNVPVMYIFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPSAYHYD+ +LGV TL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLQKPSAYHYDMFLLGVTTLVCGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP----------------  672
             L+ Q++RK+M+ SAKE MK+ AT SE++GRM AV++EM     P                
Sbjct  371   LRRQVIRKKMVKSAKECMKLNATNSEMFGRMEAVFIEMDRGSPPNVSAQSFPPSFVLFHC  430

Query  673   -------VADKELNNLKVAVMKNDEK---DGNLDLAKDIDAHLPVGVNEQRVSNLLQSIF  822
                    +  KEL NL+ AVMK+D+     G  D  K IDAHLPV VNEQRVSNLLQS+ 
Sbjct  431   QIIVFLSLQSKELENLREAVMKSDDGGDLKGKFDPEKHIDAHLPVRVNEQRVSNLLQSLL  490

Query  823   VGLSICAVPVIRMIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHAT  1002
             VG S+ A+ VI+ IPTSVLWGYFAYMA DSLPGNQFWER++LLF+ P RR+KVLE  HA+
Sbjct  491   VGGSVFAIFVIKKIPTSVLWGYFAYMAIDSLPGNQFWERLLLLFISPKRRYKVLEASHAS  550

Query  1003  YVESVPFKYIAGFTIFQFVYLLVCFGVTWI  1092
             +VE VPFKYI  FT+FQ VY L+CFGVTWI
Sbjct  551   FVELVPFKYIVAFTLFQLVYFLICFGVTWI  580



>ref|XP_002867240.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43499.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=690

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/369 (69%), Positives = 293/369 (79%), Gaps = 6/369 (2%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW Y NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A S
Sbjct  209   YQFQWRYTNGLLAVIFSFGLLYTALKSRRARSWKYGFRWIRGFIGDYGTLLMLVLWSAFS  268

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YTVP+ +P  VPRRL  PLPW   S+YHWTV+KDM KVPP YILA FIPA MIAGLYFFD
Sbjct  269   YTVPRNLPEGVPRRLELPLPWSSESLYHWTVVKDMAKVPPLYILAAFIPAIMIAGLYFFD  328

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  329   HCVSAQMAQQKEFNLKNPSAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  388

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QLMRK+M+  AKE M+ +A+ SEIYGRM  V++EM +SP A    KEL NLK AVMK 
Sbjct  389   KKQLMRKKMVQKAKECMREKASNSEIYGRMQDVFIEMETSPKATSVVKELENLKEAVMKA  448

Query  721   DEKDGN-----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             D+  G       D    I+ HLPV VNEQRVSNLLQSI VGL I AVPV+RMIPTSVLWG
Sbjct  449   DDGGGETKGKKFDPEVHIEDHLPVRVNEQRVSNLLQSILVGLLILAVPVLRMIPTSVLWG  508

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YF YMA DSLPGNQFWER+ LLF+ P RRFKVLEG+HA++VE VP+K I  FT+FQ +Y 
Sbjct  509   YFTYMAVDSLPGNQFWERLQLLFITPGRRFKVLEGLHASFVEIVPYKSIVMFTLFQLLYF  568

Query  1066  LVCFGVTWI  1092
             L+C+GVTWI
Sbjct  569   LICYGVTWI  577



>ref|XP_009334782.1| PREDICTED: probable boron transporter 6 isoform X1 [Pyrus x bretschneideri]
Length=682

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/390 (66%), Positives = 306/390 (78%), Gaps = 26/390 (7%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLYANGLLAVIF FG+  T+L+SR+AR W YG+G+ RSFIADYGVPLMV++WTA+
Sbjct  191   EFQFQWLYANGLLAVIFCFGLTFTALKSRKARLWWYGSGWLRSFIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY +P +VP  VPRRLVCPLPW+  S+YHWTV+KDM  VP  YI A FIPA MIAGLYFF
Sbjct  251   SYALPGKVPHGVPRRLVCPLPWDSKSLYHWTVVKDMPNVPVMYIFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPSAYHYD+ +LG+ TL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLQKPSAYHYDMFLLGITTLVCGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEM-GSSPAPVA-------------  678
             L+ Q++RK+M+ SAKE MK+ AT SE++GRM AV++EM G SP  V+             
Sbjct  371   LRRQVIRKKMVKSAKECMKLNATNSEMFGRMEAVFIEMDGGSPPHVSAQSFPPSFVLFHC  430

Query  679   ---------DKELNNLKVAVMKNDEK---DGNLDLAKDIDAHLPVGVNEQRVSNLLQSIF  822
                       KEL NL+ AVMK+D+     G  D  K IDAHLPV VNEQRVSNLLQS+ 
Sbjct  431   LIIVFLSLQSKELENLREAVMKSDDGGDLKGKFDPEKHIDAHLPVRVNEQRVSNLLQSLL  490

Query  823   VGLSICAVPVIRMIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHAT  1002
             VG S+ A+ VI+ IPTSVLWGYFAYMA DSLPGNQFWER++LLF+ P RR+KVLE  HA+
Sbjct  491   VGGSVFAIFVIKKIPTSVLWGYFAYMAIDSLPGNQFWERLLLLFISPKRRYKVLEASHAS  550

Query  1003  YVESVPFKYIAGFTIFQFVYLLVCFGVTWI  1092
             +VE VPFKYI  FT+FQ VY L+CFGVTWI
Sbjct  551   FVELVPFKYIVAFTLFQLVYFLICFGVTWI  580



>ref|XP_006412469.1| hypothetical protein EUTSA_v10024599mg [Eutrema salsugineum]
 gb|ESQ53922.1| hypothetical protein EUTSA_v10024599mg [Eutrema salsugineum]
Length=675

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/369 (69%), Positives = 296/369 (80%), Gaps = 6/369 (2%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW Y NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A S
Sbjct  192   YQFQWRYTNGLLAVIFSFGLLYTALKSRRARSWRYGFRWMRGFIGDYGTLLMLVLWSAFS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             +TVP+++P  VPRRL  PLPWE  S+YHWTV+KDMGKVPP YILA FIPA MIAGLYFFD
Sbjct  252   FTVPRDLPEGVPRRLELPLPWESESLYHWTVVKDMGKVPPLYILAAFIPAIMIAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK P AYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  312   HCVSAQMAQQKEFNLKNPPAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K Q MRK+M+  AKE MK +A+ SEIYGRM  V++EM +SP A    KEL NLK AVMK 
Sbjct  372   KRQQMRKKMVQKAKECMKAKASNSEIYGRMQDVFIEMETSPKATSVVKELENLKEAVMKA  431

Query  721   DEKDGN-----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             D+  G+      D    I+ HLPV VNEQRVSNLLQSI VGL I AVPV+RMIPTSVLWG
Sbjct  432   DDGGGDTKGNKFDPEVHIEDHLPVRVNEQRVSNLLQSILVGLLILAVPVLRMIPTSVLWG  491

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YF YMA DSLPGNQFWER++LLF+ P RRFKVLEG+HA+++E VP+K I  FT+FQ +Y 
Sbjct  492   YFTYMAVDSLPGNQFWERLLLLFITPGRRFKVLEGLHASFMEIVPYKSIVIFTLFQLLYF  551

Query  1066  LVCFGVTWI  1092
             L+C+GVTWI
Sbjct  552   LICYGVTWI  560



>ref|XP_002529372.1| Boron transporter, putative [Ricinus communis]
 gb|EEF33039.1| Boron transporter, putative [Ricinus communis]
Length=652

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/366 (70%), Positives = 299/366 (82%), Gaps = 4/366 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y FQWLY NGLL +IFSFG+L TSL+SR ARSW YGTG+FRSFIADYGV LMVVLW A+
Sbjct  191   KYSFQWLYTNGLLGIIFSFGLLFTSLKSRGARSWQYGTGWFRSFIADYGVSLMVVLWAAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+T+P + PS VPRRL  PLPW+ AS+ HWTV+ DM KVP  YI A  IPA M+ GLYFF
Sbjct  251   SFTIPGKAPSGVPRRLQSPLPWDSASLEHWTVVMDMLKVPLPYIFAASIPAVMVTGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ K+FNLKKPSAYHYDIL+LGVMTLICGLLGLPPSNGVLPQ+PMHTKSL+ 
Sbjct  311   DHSVASQLAQQKDFNLKKPSAYHYDILILGVMTLICGLLGLPPSNGVLPQSPMHTKSLSV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L  QL+RK+M+  AKEGMK+ AT SEIYGRM  V++E+  +P PV  KEL +LK AV+  
Sbjct  371   LNRQLIRKKMVKRAKEGMKLNATNSEIYGRMQEVFIELEKTP-PVT-KELQDLKDAVISE  428

Query  721   DE--KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
             D     G  D  K IDA+LPV VNEQR+SN LQS+ VG S+ A+P+I+ IPTSVLWGYFA
Sbjct  429   DGGITSGRFDPEKHIDAYLPVRVNEQRLSNFLQSVLVGGSLLAMPIIKKIPTSVLWGYFA  488

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPG+QFWER++LLFV P+RR+K+LE  HA+YVE VPFKYIA FT+ Q VYLLVC
Sbjct  489   YMAIDSLPGSQFWERLLLLFVAPSRRYKILETAHASYVERVPFKYIATFTLLQLVYLLVC  548

Query  1075  FGVTWI  1092
             FG+TWI
Sbjct  549   FGITWI  554



>ref|XP_010519936.1| PREDICTED: probable boron transporter 6 [Tarenaya hassleriana]
Length=678

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/380 (67%), Positives = 298/380 (78%), Gaps = 18/380 (5%)
 Frame = +1

Query  7     QFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSY  186
              F WLY NGLLAVIFS G ++T+L+SR A+SW YG G+ RSFI DYGVPLMV+ WT +SY
Sbjct  193   HFHWLYVNGLLAVIFSIGFIVTTLKSRRAKSWKYGFGWLRSFIGDYGVPLMVLFWTVLSY  252

Query  187   TVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDH  366
              +P +VP SVPRRL CPLPWEPAS+YHWTV+KDMGKVP FYI    IPA MIAGLYFFDH
Sbjct  253   ALPSKVPPSVPRRLFCPLPWEPASLYHWTVVKDMGKVPVFYIFVAVIPAVMIAGLYFFDH  312

Query  367   SVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELK  546
             SVASQMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQAPMHTKSLA L 
Sbjct  313   SVASQMAQQKEFNLKNPSAYHYDIFLLGIMTLICGLLGLPPSNGVIPQAPMHTKSLAVLN  372

Query  547   TQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPV------ADKELNNLKVA  708
              QL+RK+M+ SAKEGMKM AT S+IYGRM AV++EM      +       DK+L +LK A
Sbjct  373   RQLIRKKMVESAKEGMKMNATNSQIYGRMQAVFIEMEIGTPQINEQENSVDKDLKDLKEA  432

Query  709   VMK----NDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSV  876
             VM+     D   G  D    IDAHLPV VNEQRVSNLLQS+ VGL++ AVPVI+MIP+S+
Sbjct  433   VMRPNEGGDTTKGKFDPDVHIDAHLPVRVNEQRVSNLLQSVLVGLTLFAVPVIKMIPSSI  492

Query  877   LWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF--  1050
             LWGYF YMA DSLPGNQFWER++LLF+PP R FKVL+G+HA++VE VP++ I  FT+F  
Sbjct  493   LWGYFGYMAIDSLPGNQFWERLLLLFIPPRRLFKVLQGVHASFVELVPYRVIVAFTLFII  552

Query  1051  ------QFVYLLVCFGVTWI  1092
                   Q +Y LVC+G+TWI
Sbjct  553   HSVFGGQPLYFLVCYGMTWI  572



>ref|XP_006427176.1| hypothetical protein CICLE_v10025159mg [Citrus clementina]
 gb|ESR40416.1| hypothetical protein CICLE_v10025159mg [Citrus clementina]
Length=625

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 302/368 (82%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IF+FG++ T+L+SR+ R W YGTG+ RSF+ADYGVPLMVV+WTA+
Sbjct  191   KYQFQWLYTNGLLGIIFTFGLVYTALKSRKGRFWWYGTGWLRSFVADYGVPLMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VPS VPRRL  PLPWE  S+ HW+V+KDMGKVP  YI A FIPA MIAGLYFF
Sbjct  251   SFSVPSKVPSGVPRRLFSPLPWEAGSLEHWSVMKDMGKVPLAYIFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLKKPSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLKKPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVM--  714
             LK Q M+K+M+ SAKE +K  A+ SEIYG+M AV++EM SSP     KEL +LK  +M  
Sbjct  371   LKRQFMKKKMVKSAKESIKQNASNSEIYGKMQAVFIEMESSPVTSEVKELEDLKEVIMKG  430

Query  715   --KNDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
               + ++     D  K IDA+LPV VNEQRVSNLLQS+ V  S+CA+P I++IPTSVLWGY
Sbjct  431   EKEGEKSKEKFDPEKHIDAYLPVRVNEQRVSNLLQSLLVAASVCAMPAIKLIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P R++KVLE  HA++VE VP+KYI  FT+FQFVY L
Sbjct  491   FAYMAIDSLPGNQFWERMLLLFITPGRQYKVLEKDHASFVELVPYKYIVIFTLFQFVYFL  550

Query  1069  VCFGVTWI  1092
             VC+GVTWI
Sbjct  551   VCYGVTWI  558



>ref|XP_009786676.1| PREDICTED: boron transporter 4-like isoform X2 [Nicotiana sylvestris]
Length=665

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/372 (68%), Positives = 302/372 (81%), Gaps = 8/372 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F WLY NGLL +IF+ G+L T+L+SR+ARSW YGTG+FRSF+ADYGVPLMV++W+ +
Sbjct  191   KYKFHWLYTNGLLGIIFTIGLLYTALKSRKARSWWYGTGWFRSFVADYGVPLMVLVWSTL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP ++PS VPRRL  PLPWE  S+YHW VIKDMGKVP  YI A  IPA MIAGLYFF
Sbjct  251   SFMVPGKLPSGVPRRLYSPLPWESTSLYHWIVIKDMGKVPLVYIFAALIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL  PS+YHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSL  
Sbjct  311   DHSVASQMAQHKEFNLNNPSSYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLVV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMK-  717
             LK QL+RK+M+ SAKE ++ +A+ SEIY  M  V++E+ SSP     KEL +LK AVMK 
Sbjct  371   LKKQLIRKKMVESAKESIRRKASNSEIYVNMQTVFIEIDSSPVTAVVKELEHLKEAVMKH  430

Query  718   ------NDEK-DGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSV  876
                   N EK +G  D    IDA+LPV +NEQRVSNLLQS+ V  S+ A+PVI+ IPTSV
Sbjct  431   ELNEYENGEKLNGKFDPENHIDAYLPVRLNEQRVSNLLQSLLVAASVGAMPVIKKIPTSV  490

Query  877   LWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQF  1056
             LWGYFAYMA DSLPGNQ WERI LLF+ P+RRFKVL+G+HA++VE+VPFKYIA FT+FQF
Sbjct  491   LWGYFAYMAIDSLPGNQLWERIFLLFITPSRRFKVLKGMHASFVETVPFKYIAIFTVFQF  550

Query  1057  VYLLVCFGVTWI  1092
             V+LLVCFGVTWI
Sbjct  551   VFLLVCFGVTWI  562



>ref|XP_009786674.1| PREDICTED: boron transporter 4-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009786675.1| PREDICTED: boron transporter 4-like isoform X1 [Nicotiana sylvestris]
Length=669

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/372 (68%), Positives = 302/372 (81%), Gaps = 8/372 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F WLY NGLL +IF+ G+L T+L+SR+ARSW YGTG+FRSF+ADYGVPLMV++W+ +
Sbjct  191   KYKFHWLYTNGLLGIIFTIGLLYTALKSRKARSWWYGTGWFRSFVADYGVPLMVLVWSTL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP ++PS VPRRL  PLPWE  S+YHW VIKDMGKVP  YI A  IPA MIAGLYFF
Sbjct  251   SFMVPGKLPSGVPRRLYSPLPWESTSLYHWIVIKDMGKVPLVYIFAALIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL  PS+YHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSL  
Sbjct  311   DHSVASQMAQHKEFNLNNPSSYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLVV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMK-  717
             LK QL+RK+M+ SAKE ++ +A+ SEIY  M  V++E+ SSP     KEL +LK AVMK 
Sbjct  371   LKKQLIRKKMVESAKESIRRKASNSEIYVNMQTVFIEIDSSPVTAVVKELEHLKEAVMKH  430

Query  718   ------NDEK-DGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSV  876
                   N EK +G  D    IDA+LPV +NEQRVSNLLQS+ V  S+ A+PVI+ IPTSV
Sbjct  431   ELNEYENGEKLNGKFDPENHIDAYLPVRLNEQRVSNLLQSLLVAASVGAMPVIKKIPTSV  490

Query  877   LWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQF  1056
             LWGYFAYMA DSLPGNQ WERI LLF+ P+RRFKVL+G+HA++VE+VPFKYIA FT+FQF
Sbjct  491   LWGYFAYMAIDSLPGNQLWERIFLLFITPSRRFKVLKGMHASFVETVPFKYIAIFTVFQF  550

Query  1057  VYLLVCFGVTWI  1092
             V+LLVCFGVTWI
Sbjct  551   VFLLVCFGVTWI  562



>ref|XP_010249971.1| PREDICTED: probable boron transporter 7 [Nelumbo nucifera]
 ref|XP_010249974.1| PREDICTED: probable boron transporter 7 [Nelumbo nucifera]
Length=675

 Score =   529 bits (1363),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 260/370 (70%), Positives = 305/370 (82%), Gaps = 7/370 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y FQW Y NGLL ++FSFGVL T+L+SR AR+W YGTG FRSFIADYGVPLMV++WTA+
Sbjct  191   KYHFQWRYTNGLLGIVFSFGVLFTALKSRRARAWLYGTGPFRSFIADYGVPLMVLIWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP  VPS VPRRL  PLPWEPAS+YHWTV++DM KVPP YI A  IPA MIAGLYFF
Sbjct  251   SFSVPSRVPSGVPRRLFAPLPWEPASLYHWTVMEDMWKVPPVYIFAAIIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVA+QMAQ KEFNLK PSAYHYD+L+LG M L+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVAAQMAQQKEFNLKNPSAYHYDLLLLGFMVLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
             LK Q++RK+M+ + KE MK QA+ SEIYGRM  V+++M   P   +  KEL  LK AVM+
Sbjct  371   LKRQMIRKKMVENVKECMKHQASTSEIYGRMQEVFIQMDRPPETASVKKELKGLKEAVMR  430

Query  718   N-----DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLW  882
             +     D+KD   D  K I+A+LPV VNEQRVSNLLQS+ VG+S+ A+P+IR IPTSVLW
Sbjct  431   SQSTGGDDKD-KFDPEKHIEAYLPVRVNEQRVSNLLQSVLVGVSVFAMPIIRAIPTSVLW  489

Query  883   GYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVY  1062
             GYFAYMA DSLPGNQFWERI+LLFV P RRFKVLE  HA++VESVPFK IA FTIFQFVY
Sbjct  490   GYFAYMAIDSLPGNQFWERILLLFVTPRRRFKVLERDHASFVESVPFKIIAKFTIFQFVY  549

Query  1063  LLVCFGVTWI  1092
             LL+CFG+TWI
Sbjct  550   LLICFGLTWI  559



>ref|XP_010691218.1| PREDICTED: boron transporter 4-like [Beta vulgaris subsp. vulgaris]
Length=658

 Score =   529 bits (1362),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 252/369 (68%), Positives = 299/369 (81%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++QFQW Y NGLL +IF+FGV+ TSL SR+ARSW YGT   RSF+ADYGVPLMVVL TA+
Sbjct  188   KFQFQWRYVNGLLGIIFTFGVVTTSLMSRKARSWRYGTSHLRSFVADYGVPLMVVLGTAI  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY+VPK +P  VPRRL  PLPW+  S+YHW+V++DMGKVP  YI A  IPA M+AGLYFF
Sbjct  248   SYSVPKGIPHGVPRRLYSPLPWQSQSLYHWSVVQDMGKVPVVYIFAAIIPALMVAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DH VASQ+AQ KEFNLKKPSAYHYDIL+LGVMTLICGLLG+PP+NGVLPQ+PMHTKSLA 
Sbjct  308   DHCVASQLAQQKEFNLKKPSAYHYDILVLGVMTLICGLLGIPPANGVLPQSPMHTKSLAT  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP-VADKELNNLKVAVMK  717
             LK QL+R++M+ SAK+ +K  A+ +EIYG+M  V++EM  SP P    KEL  LK AVMK
Sbjct  368   LKKQLIRRKMVESAKQSIKRNASSTEIYGQMQDVFIEMDQSPNPHEVVKELEELKQAVMK  427

Query  718   NDEKDG----NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
              D K+G    N      ID +LPV VNEQRVSNLLQ+I VG ++ A+P I++IPTSVLWG
Sbjct  428   GDSKEGKDNNNAFRLDHIDVYLPVRVNEQRVSNLLQAILVGGALFAMPTIKLIPTSVLWG  487

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWERI+LLF+ P RR+KVLE  HA++VESVPFKYIA FTIFQ VYL
Sbjct  488   YFAYMAIDSLPGNQFWERILLLFITPTRRYKVLEDAHASFVESVPFKYIAAFTIFQVVYL  547

Query  1066  LVCFGVTWI  1092
              +CFG+TWI
Sbjct  548   GICFGITWI  556



>ref|XP_010088266.1| Boron transporter 4 [Morus notabilis]
 gb|EXB33250.1| Boron transporter 4 [Morus notabilis]
Length=672

 Score =   528 bits (1361),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 263/369 (71%), Positives = 310/369 (84%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+FQWLYANGLL +IF+FG+L T+L+SR ARSW YGTG+ RSFIADYGVPLMV++WTA+
Sbjct  191   KYKFQWLYANGLLGIIFTFGLLYTALKSRRARSWFYGTGWLRSFIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VPS VPR L  PLPWE +S+ HWTVI DMGKV P YI A FIPA MIAGLYFF
Sbjct  251   SFSVPSKVPSGVPRSLFSPLPWESSSLQHWTVINDMGKVSPVYIFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
             LK QL+R++M+ SAKE +K +A+ SEI+G+M AV++EM  SP   A  KEL +LK AVMK
Sbjct  371   LKGQLIRRKMVESAKESIKQKASNSEIFGQMQAVFIEMDISPETTAVVKELQDLKEAVMK  430

Query  718   NDEKD----GNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             ++ +D    G  D  K ID +LPV VNEQRVSNLLQS+ V  S+CA+P I+ IPTSVLWG
Sbjct  431   SENQDENAKGAFDPEKHIDEYLPVRVNEQRVSNLLQSLLVAASVCAMPAIKKIPTSVLWG  490

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWER++LLF+ P RR+KVLEG+HA++VESVPFKYIA FTIFQFVY 
Sbjct  491   YFAYMAIDSLPGNQFWERMLLLFITPGRRYKVLEGVHASFVESVPFKYIAIFTIFQFVYF  550

Query  1066  LVCFGVTWI  1092
             L+CFGVTWI
Sbjct  551   LLCFGVTWI  559



>ref|XP_008447479.1| PREDICTED: boron transporter 4-like [Cucumis melo]
Length=669

 Score =   527 bits (1358),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 257/369 (70%), Positives = 306/369 (83%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
              YQF W+Y NGLL +IF+FG+L T+L+SR+ARSW YGTG+ RSFIADYGVPLMVV+WTA+
Sbjct  191   NYQFHWVYTNGLLGIIFTFGLLYTALKSRKARSWLYGTGWLRSFIADYGVPLMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VP  VPRRL  PL W+  S+ HWTV+KDMGK+PP YI A FIPA MIAGLYFF
Sbjct  251   SFSVPSKVPFGVPRRLQSPLAWQSTSLNHWTVVKDMGKIPPAYIFAAFIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTK LA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKCLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMK  717
             L+ +LMR++M+ SAKE ++ +A+ SEIYG+M AV++EM S+P      KEL +LK AVMK
Sbjct  371   LRRRLMRRKMLRSAKESIERKASDSEIYGQMQAVFLEMESNPITTTVVKELEDLKEAVMK  430

Query  718   NDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
              + KD N     D  K IDA+LPV VNEQR+SNLLQS+ V  S+ A+P I+ IPTSVLWG
Sbjct  431   GESKDENANVTFDPEKHIDAYLPVRVNEQRLSNLLQSLLVAASVFALPAIKKIPTSVLWG  490

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWERI+LLFV P+RR+KVLEG HA++VESVPFKYIA FT+FQFVY 
Sbjct  491   YFAYMAIDSLPGNQFWERILLLFVMPSRRYKVLEGFHASFVESVPFKYIAAFTLFQFVYF  550

Query  1066  LVCFGVTWI  1092
             L+CFGVTWI
Sbjct  551   LICFGVTWI  559



>ref|NP_194977.6| HCO3- transporter family [Arabidopsis thaliana]
 sp|Q9SUU1.3|BOR7_ARATH RecName: Full=Probable boron transporter 7 [Arabidopsis thaliana]
 gb|ADF49546.1| boron transporter 7 [Arabidopsis thaliana]
 gb|AEE86070.1| HCO3- transporter family [Arabidopsis thaliana]
Length=673

 Score =   527 bits (1358),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 253/369 (69%), Positives = 292/369 (79%), Gaps = 6/369 (2%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW Y NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A S
Sbjct  192   YQFQWRYTNGLLAVIFSFGLLYTALKSRRARSWKYGFRWMRGFIGDYGTLLMLVLWSAFS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YTVP+ +P  VPRRL  PLPW   S+YHWTV+KDM KVPP YILA FIPA MIAGLYFFD
Sbjct  252   YTVPRNLPEGVPRRLELPLPWASESLYHWTVVKDMAKVPPLYILAAFIPAIMIAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK P+AYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  312   HCVSAQMAQQKEFNLKNPTAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K Q MRK+M+  AKE M+ +A+ SEIYGRM  V++EM +SP A    KEL NLK AVMK 
Sbjct  372   KKQQMRKKMVQKAKECMREKASNSEIYGRMQDVFIEMETSPKATSVVKELENLKEAVMKA  431

Query  721   DEKDGN-----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             D+  G       D    I+ HLPV VNEQRVSNLLQS+ VGL I AVPV+RMIPTSVLWG
Sbjct  432   DDGGGETKGKKFDPEVHIEDHLPVRVNEQRVSNLLQSVLVGLLILAVPVLRMIPTSVLWG  491

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YF YMA DSLPGNQFWER+ LLF+ P RRFKVLEG+HA++VE VP+K I  FT+FQ +Y 
Sbjct  492   YFTYMAVDSLPGNQFWERLQLLFITPGRRFKVLEGLHASFVEIVPYKSIVMFTLFQLLYF  551

Query  1066  LVCFGVTWI  1092
             L+C+GVTWI
Sbjct  552   LICYGVTWI  560



>ref|XP_009389934.1| PREDICTED: boron transporter 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=693

 Score =   528 bits (1359),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 252/391 (64%), Positives = 300/391 (77%), Gaps = 28/391 (7%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QF+WLY NGLL +IF+ G+LLT+++SR ARSW YGTG+ R   ADYGVPLMV+LWTA+S
Sbjct  192   FQFEWLYTNGLLGIIFAAGLLLTAIKSRRARSWKYGTGWLRGLTADYGVPLMVLLWTAMS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y VP +VPS VPRRL  PLPWE  S+YHWTV KDM  VPP YI A  IPA M+AGLYFFD
Sbjct  252   YAVPNKVPSGVPRRLFSPLPWEAKSLYHWTVAKDMLSVPPVYIFAAIIPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLKKPSAYHYDIL+LG M L+CGLLG+PPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQMAQQKEFNLKKPSAYHYDILVLGFMVLVCGLLGIPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA---------------  678
             K +++RK+M+ +AKE ++ QAT SE+YG+M  V+V+M      +                
Sbjct  372   KRRIIRKKMVETAKESIRQQATNSEMYGKMQEVFVKMDEGSTVIQQLLQDSLGFSAIYRR  431

Query  679   ---------DKELNNLKVAVMKN----DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSI  819
                      DKEL NLK AVM N    D+  G  D  K IDAHLPV VNEQR++NLLQS+
Sbjct  432   FRPVQSISIDKELKNLKDAVMGNGAGGDDSKGAFDPEKHIDAHLPVRVNEQRMTNLLQSL  491

Query  820   FVGLSICAVPVIRMIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHA  999
              VG  + A+PVI+MIPTSVLWGYFAYMA DSLPGNQFWER +LL + P+RR+KVLEG+HA
Sbjct  492   LVGACLAAMPVIKMIPTSVLWGYFAYMAIDSLPGNQFWERTLLLLITPSRRYKVLEGMHA  551

Query  1000  TYVESVPFKYIAGFTIFQFVYLLVCFGVTWI  1092
             ++VESVPF+ IA FTIFQF+YLL+CFGVTWI
Sbjct  552   SFVESVPFRQIAAFTIFQFLYLLLCFGVTWI  582



>ref|XP_009389933.1| PREDICTED: boron transporter 4-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=706

 Score =   528 bits (1359),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 252/391 (64%), Positives = 300/391 (77%), Gaps = 28/391 (7%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QF+WLY NGLL +IF+ G+LLT+++SR ARSW YGTG+ R   ADYGVPLMV+LWTA+S
Sbjct  192   FQFEWLYTNGLLGIIFAAGLLLTAIKSRRARSWKYGTGWLRGLTADYGVPLMVLLWTAMS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y VP +VPS VPRRL  PLPWE  S+YHWTV KDM  VPP YI A  IPA M+AGLYFFD
Sbjct  252   YAVPNKVPSGVPRRLFSPLPWEAKSLYHWTVAKDMLSVPPVYIFAAIIPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLKKPSAYHYDIL+LG M L+CGLLG+PPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQMAQQKEFNLKKPSAYHYDILVLGFMVLVCGLLGIPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA---------------  678
             K +++RK+M+ +AKE ++ QAT SE+YG+M  V+V+M      +                
Sbjct  372   KRRIIRKKMVETAKESIRQQATNSEMYGKMQEVFVKMDEGSTVIQQLLQDSLGFSAIYRR  431

Query  679   ---------DKELNNLKVAVMKN----DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSI  819
                      DKEL NLK AVM N    D+  G  D  K IDAHLPV VNEQR++NLLQS+
Sbjct  432   FRPVQSISIDKELKNLKDAVMGNGAGGDDSKGAFDPEKHIDAHLPVRVNEQRMTNLLQSL  491

Query  820   FVGLSICAVPVIRMIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHA  999
              VG  + A+PVI+MIPTSVLWGYFAYMA DSLPGNQFWER +LL + P+RR+KVLEG+HA
Sbjct  492   LVGACLAAMPVIKMIPTSVLWGYFAYMAIDSLPGNQFWERTLLLLITPSRRYKVLEGMHA  551

Query  1000  TYVESVPFKYIAGFTIFQFVYLLVCFGVTWI  1092
             ++VESVPF+ IA FTIFQF+YLL+CFGVTWI
Sbjct  552   SFVESVPFRQIAAFTIFQFLYLLLCFGVTWI  582



>ref|XP_003603439.1| Anion exchanger family protein [Medicago truncatula]
Length=696

 Score =   527 bits (1357),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 252/374 (67%), Positives = 301/374 (80%), Gaps = 13/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E QFQW Y NGLLAVIFSFG+++T+++SR+AR+W YG+   R FIADYGVP+MVVLWTAV
Sbjct  188   ELQFQWRYTNGLLAVIFSFGLIVTAVKSRKARTWRYGSRRLRGFIADYGVPVMVVLWTAV  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIK-------DMGKVPPFYILAGFIPATM  339
             SY +P ++P+ VPRRL CPLPWEPAS+YHWTV+K       DM KVP  YI    IPA M
Sbjct  248   SYIMPDDIPNGVPRRLFCPLPWEPASLYHWTVVKVLFYKLQDMWKVPVVYIFGAIIPALM  307

Query  340   IAGLYFFDHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPM  519
             IAGLYFFDHSVASQMAQ KEFNL+KPSAYHYD+ +LG+MTLICGLLGLPPSNGVLPQ+PM
Sbjct  308   IAGLYFFDHSVASQMAQQKEFNLQKPSAYHYDVFLLGIMTLICGLLGLPPSNGVLPQSPM  367

Query  520   HTKSLAELKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNL  699
             HTKSLA L+ QL+RKR++ SAKE M+ Q+T SE+YG+M AV++EM ++P     KEL  L
Sbjct  368   HTKSLAVLRRQLIRKRVVKSAKECMEQQSTSSELYGKMQAVFIEMDTAPTV---KELETL  424

Query  700   KVAVMKNDEKDGNL---DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             K AVMK+D K   +   D  K ID +LPV VNEQR++NLLQS+ +GLSI  + VI+ IPT
Sbjct  425   KEAVMKSDTKGCAMEPFDPEKYIDTYLPVRVNEQRMTNLLQSLLIGLSIIGISVIKRIPT  484

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             SVLWGYFAYMA DSLPGNQFWERI+LLFV P+RRFK+L+  HA++VE+VPFK IAGFT  
Sbjct  485   SVLWGYFAYMAIDSLPGNQFWERILLLFVTPSRRFKILQDTHASFVETVPFKTIAGFTAL  544

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y L CFGVTWI
Sbjct  545   QLAYFLFCFGVTWI  558



>ref|XP_010691216.1| PREDICTED: boron transporter 4-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=650

 Score =   525 bits (1351),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 300/368 (82%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++QFQW Y NGLL +IF+FG+L T+L+SR ARS  YGTG  RSFIADYGVPLMVV+WTA+
Sbjct  188   KFQFQWRYVNGLLGIIFTFGLLSTALKSRRARSSLYGTGRIRSFIADYGVPLMVVVWTAL  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+TVPK VP  VPRRL  PLPW+  S++HWTV+KDM KVP  YI A  IPA M+AGLYFF
Sbjct  248   SFTVPKGVPEGVPRRLYSPLPWQSQSLHHWTVLKDMAKVPVMYIFAAIIPAVMVAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPSAYHYDIL+LG+MTL+CGL+GLPPSNGVLPQ+PMH+KSLA 
Sbjct  308   DHSVASQLAQQKEFNLRKPSAYHYDILVLGLMTLLCGLIGLPPSNGVLPQSPMHSKSLAT  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP-VADKELNNLKVAVMK  717
             LK Q+M K+M+ SAK+ MK  A+ +EIYG+M  ++++M  SP P V   EL  LK AVMK
Sbjct  368   LKRQMMGKKMVESAKQNMKNNASSTEIYGQMQDIFIKMDQSPDPHVVAIELEELKRAVMK  427

Query  718   NDEKDGNLDLA---KDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              D K+G    A     +DA LPV VNEQR+SNLLQS+ V  +I A+PVI++IPTSVLWGY
Sbjct  428   GDNKEGKDKKAFRLDHVDAFLPVRVNEQRLSNLLQSVLVAGAIFAMPVIKLIPTSVLWGY  487

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYM  DSLPG+QFWERI+LLFV P RR+KVLE +HA+YVESVP KYIA FT+FQFVYLL
Sbjct  488   FAYMGIDSLPGSQFWERILLLFVAPARRYKVLEDVHASYVESVPAKYIAAFTLFQFVYLL  547

Query  1069  VCFGVTWI  1092
             +CFG+TW+
Sbjct  548   ICFGITWV  555



>ref|XP_009148940.1| PREDICTED: boron transporter 4 [Brassica rapa]
Length=682

 Score =   525 bits (1353),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 248/374 (66%), Positives = 305/374 (82%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F+WLY NGLL +IF+FG+L T+L+SR+ARSW YGTG++RSFIADYGVPLMVV+WTA+
Sbjct  194   KYKFEWLYTNGLLGLIFTFGLLYTALKSRKARSWRYGTGWYRSFIADYGVPLMVVVWTAL  253

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+T P ++PS VPRRL  PLPW+ AS+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  254   SFTTPSKLPSGVPRRLFSPLPWDSASLEHWTVIKDMGKVSPEYIFAAFIPALMIAGLYFF  313

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  314   DHSVASQLAQQKEFNLKNPSAYHYDILLLGFMTLICGLLGLPPSNGVLPQSPMHTKSLAV  373

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE ++ +AT SE+Y  M  V++EM  SP    ++    EL +LK A
Sbjct  374   LKRQLIRRKMVKTAKESIRKRATSSEVYENMQEVFIEMDKSPIAQTNRTVILELQDLKEA  433

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK++E +G        D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+P I+++PT
Sbjct  434   VMKSNEDEGERDEESGFDPEKHLDAYLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKLMPT  493

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             SVLWGYFAYMA DSLPGNQF+ER++LLFV P+RRFKVLEG HA++VE VP+K +A FTI 
Sbjct  494   SVLWGYFAYMAIDSLPGNQFFERMMLLFVLPSRRFKVLEGAHASFVEKVPYKSMAAFTIL  553

Query  1051  QFVYLLVCFGVTWI  1092
             Q VY  +C+GVTWI
Sbjct  554   QIVYFGICYGVTWI  567



>ref|XP_010691213.1| PREDICTED: boron transporter 4-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691214.1| PREDICTED: boron transporter 4-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=650

 Score =   524 bits (1350),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 300/368 (82%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++QFQW Y NGLL +IF+FG+L T+L+SR ARS  YGTG  RSFIADYGVPLMVV+WTA+
Sbjct  188   KFQFQWRYVNGLLGIIFTFGLLSTALKSRRARSSLYGTGRIRSFIADYGVPLMVVVWTAL  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+TVPK VP  VPRRL  PLPW+  S++HWTV+KDM KVP  YI A  IPA M+AGLYFF
Sbjct  248   SFTVPKGVPEGVPRRLYSPLPWQSQSLHHWTVLKDMAKVPVMYIFAAIIPAVMVAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPSAYHYDIL+LG+MTL+CGL+GLPPSNGVLPQ+PMH+KSLA 
Sbjct  308   DHSVASQLAQQKEFNLRKPSAYHYDILVLGLMTLLCGLIGLPPSNGVLPQSPMHSKSLAT  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP-VADKELNNLKVAVMK  717
             LK Q+M K+M+ SAK+ MK  A+ +EIYG+M  ++++M  SP P V   EL  LK AVMK
Sbjct  368   LKRQMMGKKMVESAKQNMKNNASSTEIYGQMQDIFIKMDQSPDPHVVAIELEELKRAVMK  427

Query  718   NDEKDGNLDLA---KDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              D K+G    A     +DA LPV VNEQR+SNLLQS+ V  +I A+PVI++IPTSVLWGY
Sbjct  428   GDNKEGKDKKAFRLDHVDAFLPVRVNEQRLSNLLQSVLVAGAIFAMPVIKLIPTSVLWGY  487

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYM  DSLPG+QFWERI+LLFV P RR+KVLE +HA+YVESVP KYIA FT+FQFVYLL
Sbjct  488   FAYMGIDSLPGSQFWERILLLFVAPARRYKVLEDVHASYVESVPAKYIAAFTLFQFVYLL  547

Query  1069  VCFGVTWI  1092
             +CFG+TW+
Sbjct  548   ICFGITWV  555



>ref|XP_010537968.1| PREDICTED: boron transporter 4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537969.1| PREDICTED: boron transporter 4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537970.1| PREDICTED: boron transporter 4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537971.1| PREDICTED: boron transporter 4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537972.1| PREDICTED: boron transporter 4 isoform X1 [Tarenaya hassleriana]
Length=676

 Score =   525 bits (1351),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 244/371 (66%), Positives = 299/371 (81%), Gaps = 7/371 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL VIF+FG+L T+L+SR+ARSW YGTG+FRSFIADYGVPLMVVLWTA+
Sbjct  191   KYQFQWLYTNGLLGVIFTFGLLYTALKSRKARSWRYGTGWFRSFIADYGVPLMVVLWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++   +VPS VPRRL  PLPWEP+S+ HW+V+KDM KV P YILA F+PA MIAGLYFF
Sbjct  251   SFSTSGKVPSGVPRRLFSPLPWEPSSLGHWSVVKDMVKVSPLYILAAFVPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLKNPSAYHYDILLLGFMTLVCGLVGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD---KELNNLKVAV  711
             LK QL+R++M+ +AKE ++   + SE+YG+M  V++EM  SP    +   +EL +LK AV
Sbjct  371   LKRQLIRRKMVETAKESIRKNESNSEVYGKMQEVFIEMDKSPLSQTNTVIRELQDLKDAV  430

Query  712   MKNDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVL  879
             MK +E   N     D  + +DA+LPV VNEQR+SNLLQS+ V  ++ A P I++IPTSVL
Sbjct  431   MKIEENRDNTGSGFDPEQHLDAYLPVRVNEQRLSNLLQSLLVAATVMATPAIKLIPTSVL  490

Query  880   WGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFV  1059
             WGYFAYMA DSLPGNQFWER +LLFV P+RR+K+LEG HA+YVE VP K I  FT+ Q V
Sbjct  491   WGYFAYMAIDSLPGNQFWERTLLLFVAPSRRYKILEGAHASYVEKVPCKSIGAFTLLQIV  550

Query  1060  YLLVCFGVTWI  1092
             Y  +C+G+TWI
Sbjct  551   YFAICYGITWI  561



>ref|XP_010537973.1| PREDICTED: boron transporter 4 isoform X2 [Tarenaya hassleriana]
Length=673

 Score =   524 bits (1350),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 244/371 (66%), Positives = 299/371 (81%), Gaps = 7/371 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL VIF+FG+L T+L+SR+ARSW YGTG+FRSFIADYGVPLMVVLWTA+
Sbjct  191   KYQFQWLYTNGLLGVIFTFGLLYTALKSRKARSWRYGTGWFRSFIADYGVPLMVVLWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++   +VPS VPRRL  PLPWEP+S+ HW+V+KDM KV P YILA F+PA MIAGLYFF
Sbjct  251   SFSTSGKVPSGVPRRLFSPLPWEPSSLGHWSVVKDMVKVSPLYILAAFVPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLKNPSAYHYDILLLGFMTLVCGLVGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD---KELNNLKVAV  711
             LK QL+R++M+ +AKE ++   + SE+YG+M  V++EM  SP    +   +EL +LK AV
Sbjct  371   LKRQLIRRKMVETAKESIRKNESNSEVYGKMQEVFIEMDKSPLSQTNTVIRELQDLKDAV  430

Query  712   MKNDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVL  879
             MK +E   N     D  + +DA+LPV VNEQR+SNLLQS+ V  ++ A P I++IPTSVL
Sbjct  431   MKIEENRDNTGSGFDPEQHLDAYLPVRVNEQRLSNLLQSLLVAATVMATPAIKLIPTSVL  490

Query  880   WGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFV  1059
             WGYFAYMA DSLPGNQFWER +LLFV P+RR+K+LEG HA+YVE VP K I  FT+ Q V
Sbjct  491   WGYFAYMAIDSLPGNQFWERTLLLFVAPSRRYKILEGAHASYVEKVPCKSIGAFTLLQIV  550

Query  1060  YLLVCFGVTWI  1092
             Y  +C+G+TWI
Sbjct  551   YFAICYGITWI  561



>emb|CDP04803.1| unnamed protein product [Coffea canephora]
Length=663

 Score =   524 bits (1349),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 260/366 (71%), Positives = 314/366 (86%), Gaps = 3/366 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLYANGLLAVIFS GV++T+L+SR ARSW YGTG+ R  IADYGVP +VVLWTA+S
Sbjct  192   YQFQWLYANGLLAVIFSIGVMITALKSRRARSWQYGTGWLRGLIADYGVPCIVVLWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y+VP++VP  VPRRL  PL W+P S++HWTV+KDM +VP  YI A FIPA MIAGLYFFD
Sbjct  252   YSVPEKVPDGVPRRLFSPLFWDPESLHHWTVMKDMARVPVGYIFAAFIPALMIAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNL+KPSAYHYD+L+LG +TL+CGLLGLPPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQKEFNLQKPSAYHYDLLLLGFLTLLCGLLGLPPSNGVLPQSPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKND  723
             K QL+RKRM+ SAKE MK QA+ +EIYG+MHAV++EM  +     DKEL NLK AV+K++
Sbjct  372   KKQLIRKRMVKSAKECMKQQASHTEIYGKMHAVFLEMDPASLTAVDKELENLKDAVLKHE  431

Query  724   ---EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFA  894
                +++G  D  K +DA+LPV VNEQRVSNLLQS+ VGLS+ A+P+I+MIPTSVLWGYFA
Sbjct  432   DGKDENGTFDPEKCVDANLPVRVNEQRVSNLLQSVLVGLSVFAMPLIKMIPTSVLWGYFA  491

Query  895   YMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVC  1074
             YMA DSLPG+QF+ER++LLF+PP RRFKVLEG HA++VESVPFK IA FT+FQFVYLL+C
Sbjct  492   YMAIDSLPGSQFFERMLLLFIPPGRRFKVLEGAHASFVESVPFKIIAAFTVFQFVYLLIC  551

Query  1075  FGVTWI  1092
             FG+TWI
Sbjct  552   FGITWI  557



>ref|XP_002308645.1| hypothetical protein POPTR_0006s26590g [Populus trichocarpa]
 gb|EEE92168.1| hypothetical protein POPTR_0006s26590g [Populus trichocarpa]
Length=666

 Score =   524 bits (1349),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 258/368 (70%), Positives = 298/368 (81%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++QFQWLYANGLL+VIFSFGVL TSL+SR AR+W YGTG+ R FIADYGVPLMV+LWTA+
Sbjct  191   KHQFQWLYANGLLSVIFSFGVLFTSLKSRRARTWRYGTGWLRGFIADYGVPLMVLLWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY  P +VPS VPRR+  PL W+  S+ HWTVI DM KVP  YI A  IPA MIAGLYFF
Sbjct  251   SYAGPGKVPSGVPRRVHVPLLWDSESLEHWTVINDMLKVPLTYIFAALIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYD+ +LG+MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDVFLLGLMTLICGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEM-GSSPAPVADKELNNLKVAVMK  717
             L+ QL+RK+M+  AKE +  +A+  EIYG M AV++EM  SSP     KEL + K AVMK
Sbjct  371   LRRQLIRKKMVKRAKECIGRKASNLEIYGSMQAVFLEMDASSPDVSVHKELEDFKQAVMK  430

Query  718   NDE--KDGN-LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
               E   D N  D  K IDA+LPV VNEQR+SNLLQS  VG S+CA+P+I+ IPTSVLWGY
Sbjct  431   AAEGWDDKNKFDPEKHIDAYLPVRVNEQRISNLLQSTLVGASMCALPLIKRIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLFV P+RR+KVLEG+HA++VE VPFK IA FTIFQ VY L
Sbjct  491   FAYMAIDSLPGNQFWERMLLLFVTPSRRYKVLEGLHASFVELVPFKQIAIFTIFQLVYFL  550

Query  1069  VCFGVTWI  1092
             +CFGVTWI
Sbjct  551   ICFGVTWI  558



>ref|XP_006390387.1| hypothetical protein EUTSA_v10018222mg [Eutrema salsugineum]
 gb|ESQ27673.1| hypothetical protein EUTSA_v10018222mg [Eutrema salsugineum]
Length=684

 Score =   524 bits (1349),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 248/374 (66%), Positives = 300/374 (80%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF+WLY NGLL +IF+FG+L TSL+SR+ARSW YGTG+ RSFIADYGVPLMVV+WTA+
Sbjct  197   KYQFEWLYTNGLLGLIFTFGLLYTSLKSRKARSWRYGTGWCRSFIADYGVPLMVVVWTAL  256

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRL  PLPW+ AS+ HWTVIKDMGKVPP YI AGFIPA MIAGLYFF
Sbjct  257   SFSTPSKLPSGVPRRLSSPLPWDSASLGHWTVIKDMGKVPPAYIFAGFIPAVMIAGLYFF  316

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSV SQ+AQ KEFNLK PS+YHYDIL+LG M L+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  317   DHSVVSQLAQQKEFNLKNPSSYHYDILLLGFMVLVCGLLGLPPSNGVLPQSPMHTKSLAV  376

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M  +AKE +K +AT S++Y  M  V++EM  SP P  +     EL +LK A
Sbjct  377   LKRQLIRRKMAMTAKESIKRRATSSQVYENMQEVFIEMDKSPLPQTNATHILELQDLKDA  436

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK  + DG+       D  K ++A LPV VNEQRVSNLLQS+ V  ++ A+P I++IPT
Sbjct  437   VMKKSDDDGDSFEESGFDPEKHLEAFLPVRVNEQRVSNLLQSLLVAGTVLAIPAIKLIPT  496

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLPGNQF+ER VLLFVPP+RRFK+LEG HA++VE VPFK IA FT+ 
Sbjct  497   SLLWGYFAYMAIDSLPGNQFFERTVLLFVPPSRRFKLLEGAHASFVEKVPFKSIAAFTLL  556

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  557   QIFYFGLCYGVTWI  570



>emb|CDY13492.1| BnaA03g52100D [Brassica napus]
Length=660

 Score =   522 bits (1344),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 252/369 (68%), Positives = 296/369 (80%), Gaps = 7/369 (2%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW Y NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A S
Sbjct  193   YQFQWRYTNGLLAVIFSFGLLYTALKSRRARSWRYGFRWMRGFIGDYGTLLMLVLWSAFS  252

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             +TVP+++P  VPRRL  PLPW+P S+YHWTV+KDMGKVPP +ILA FIPA MIAGLYFFD
Sbjct  253   FTVPRDIPEGVPRRLELPLPWDPESLYHWTVVKDMGKVPPLFILAAFIPAIMIAGLYFFD  312

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK P AYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  313   HCVSAQMAQQKEFNLKNPPAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  372

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMK--  717
             K Q MRK+M+  AKE MK +A+KSEIYG+M  V++EM  SP  +A KEL NLK AVMK  
Sbjct  373   KRQQMRKKMVQKAKECMKAKASKSEIYGKMQDVFIEMEKSPKALA-KELENLKEAVMKAD  431

Query  718   ----NDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
                  D K    D    I+ HLPV VNEQRVSNLLQSI VGL I AVP++RMIPTSVLWG
Sbjct  432   DGGGGDTKGKKFDPEVHIEDHLPVRVNEQRVSNLLQSILVGLLIFAVPLLRMIPTSVLWG  491

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YF YMA DSLPGNQFWER++LLF+ P RRFKVLEG+H++++E VP+K I  FT+FQ +Y 
Sbjct  492   YFTYMAVDSLPGNQFWERLLLLFITPGRRFKVLEGLHSSFMEIVPYKSIVMFTLFQLLYF  551

Query  1066  LVCFGVTWI  1092
             L+C+GVTWI
Sbjct  552   LICYGVTWI  560



>ref|XP_007137052.1| hypothetical protein PHAVU_009G095800g [Phaseolus vulgaris]
 gb|ESW09046.1| hypothetical protein PHAVU_009G095800g [Phaseolus vulgaris]
Length=654

 Score =   521 bits (1343),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 295/368 (80%), Gaps = 8/368 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLY NGLLA +F FG+L T+L+SR AR+W YGT + R FIADYGVPLMVVLWTA+
Sbjct  188   EFQFQWLYTNGLLATVFCFGLLFTALKSRRARAWRYGTAWLRGFIADYGVPLMVVLWTAL  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VPK+V   VPRRL+ PLPWEP ++ HWTV+KDMGKVP  YI A  IPA M+AGLYFF
Sbjct  248   SYFVPKQVIDGVPRRLISPLPWEPEALQHWTVVKDMGKVPLAYIFAAIIPAVMMAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ K+FNL+KPSAYHYD+ +LGVMTL+CG+LGLPPSNGVLPQ+PMHTKSL+ 
Sbjct  308   DHSVASQMAQQKKFNLQKPSAYHYDVFLLGVMTLVCGILGLPPSNGVLPQSPMHTKSLSV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ +L+RKR++ SAKE ++   T SE+YG+M  V VEM + P     KEL  LK AVMK+
Sbjct  368   LRRKLIRKRVVKSAKECIREHKTNSEVYGKMQDVIVEMDTDPTV---KELETLKQAVMKS  424

Query  721   DEKDG----NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             D  D     N D  K ID +LPV VNEQRV+NLLQS+ VG+SI A+ VI+ IPTSVLWGY
Sbjct  425   DNNDDAAEENFD-EKHIDDYLPVRVNEQRVTNLLQSVLVGVSILAMSVIKRIPTSVLWGY  483

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI+LLF+ P+RR+K+LEG HA++VE VPFK IA FT  Q  Y L
Sbjct  484   FAYMAIDSLPGNQFWERILLLFITPSRRYKILEGSHASFVEVVPFKTIAAFTGLQLAYFL  543

Query  1069  VCFGVTWI  1092
             +C+GVTWI
Sbjct  544   ICYGVTWI  551



>ref|XP_006416903.1| hypothetical protein EUTSA_v10007002mg [Eutrema salsugineum]
 gb|ESQ35256.1| hypothetical protein EUTSA_v10007002mg [Eutrema salsugineum]
Length=667

 Score =   522 bits (1344),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 246/374 (66%), Positives = 304/374 (81%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IF+FG+L T+L+SR+ARSW YGTG++RSFIADYGVPLMV++WTA+
Sbjct  196   KYQFQWLYTNGLLGLIFTFGLLYTALKSRKARSWRYGTGWYRSFIADYGVPLMVLVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRL  PLPWEPAS+ HWTVIKDM KV P YI A FIPA MIAGLYFF
Sbjct  256   SFSTPSKLPSGVPRRLFSPLPWEPASLEHWTVIKDMWKVSPGYIFAAFIPAVMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG+MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVASQLAQQKEFNLKNPSAYHYDILLLGIMTLICGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE ++ +AT SE+Y  M  V++EM  SP    ++    EL +LK A
Sbjct  376   LKRQLIRRKMVKTAKESIRKRATSSEVYENMQEVFIEMDKSPLAPTNRTVIIELQDLKEA  435

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK+++ +G        D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+P I++IPT
Sbjct  436   VMKSNKDEGERNEESGFDPEKHLDAYLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKLIPT  495

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLPGNQF+ER +LLFV P+RRFKVLEG HA++VE VP+K +A FT+ 
Sbjct  496   SLLWGYFAYMAIDSLPGNQFFERTMLLFVLPSRRFKVLEGAHASFVEKVPYKSVAAFTLL  555

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  556   QIFYFGMCYGVTWI  569



>ref|XP_004486699.1| PREDICTED: boron transporter 4-like [Cicer arietinum]
Length=676

 Score =   522 bits (1344),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 252/373 (68%), Positives = 303/373 (81%), Gaps = 9/373 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF WLYANGLL +IF+FG+L TSL+SR ARSW YGTG+ RSF ADYGVPLMVV+WT +
Sbjct  191   KYQFHWLYANGLLGIIFTFGLLYTSLKSRRARSWLYGTGWLRSFTADYGVPLMVVVWTVL  250

Query  181   SY-TVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYF  357
             S+  V  +VPS VPRRL+ PL WE AS++HWTVIKDMGKV P +I A F+PA MIAGLYF
Sbjct  251   SFIVVSNKVPSGVPRRLIAPLAWESASLHHWTVIKDMGKVSPAHIFAAFVPALMIAGLYF  310

Query  358   FDHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLA  537
             FDHSVASQ+AQ KEFNL+KPSAYHYDIL+LG MTL CGL+GLPPSNGVLPQ+PMHTKSLA
Sbjct  311   FDHSVASQLAQQKEFNLRKPSAYHYDILLLGFMTLFCGLVGLPPSNGVLPQSPMHTKSLA  370

Query  538   ELKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD----KELNNLKV  705
              LK QL+R++M+ SAKE ++  A+ SEIYG+M AV++EM ++   V +    KEL +LK 
Sbjct  371   VLKRQLIRRKMVKSAKESIRKNASNSEIYGKMQAVFIEMDNNIPDVQNNSVVKELEDLKE  430

Query  706   AVMKNDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTS  873
              V+  ++K  N     D  K ID +LPV V EQRVSNLLQS+FVG ++ A+P I+MIPTS
Sbjct  431   FVLNGEDKGDNNKSTFDPEKHIDTYLPVRVKEQRVSNLLQSLFVGAAVFAMPAIKMIPTS  490

Query  874   VLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQ  1053
             VLWGYFAYMA DSLPGNQFWERI+LLFV P+R +K+LEG HA++VESVPF+YI  FT+FQ
Sbjct  491   VLWGYFAYMAIDSLPGNQFWERILLLFVKPSRWYKLLEGDHASFVESVPFRYIFFFTLFQ  550

Query  1054  FVYLLVCFGVTWI  1092
              VY LVCFGVTWI
Sbjct  551   CVYFLVCFGVTWI  563



>ref|XP_006341714.1| PREDICTED: boron transporter 4-like [Solanum tuberosum]
Length=673

 Score =   522 bits (1344),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 261/371 (70%), Positives = 305/371 (82%), Gaps = 7/371 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF WLY NGLL +IF+FG+L T+L+SR+ARSW YGTG+ RSFIADYGVPLMV++W+A+
Sbjct  192   KYQFHWLYTNGLLGIIFTFGLLYTALKSRKARSWWYGTGWIRSFIADYGVPLMVLMWSAL  251

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP  VPS VPR L  PLPWE AS+YHWTVIKDM KVPP YI A  IPA MIAGLYFF
Sbjct  252   SFIVPSNVPSGVPRTLYSPLPWESASLYHWTVIKDMVKVPPVYIFAAIIPAVMIAGLYFF  311

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  312   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLLGLPPSNGVLPQSPMHTKSLAI  371

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+RK+M+ SAKE ++ +A+ SEIYG M AV++E+ SSP     KEL +LK A+MK 
Sbjct  372   LKKQLIRKKMVESAKESIRRKASNSEIYGNMQAVFIEIDSSPISAVAKELEHLKEAIMKG  431

Query  721   DEKDGN-------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVL  879
             + ++ N        D  K IDA+LPV VNEQRVSNLLQS+ V  S+ A+PVI+ IPTSVL
Sbjct  432   ESENANGEKSNGIFDPEKYIDAYLPVRVNEQRVSNLLQSLLVAASVGAMPVIKKIPTSVL  491

Query  880   WGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFV  1059
             WGYFAYMA DSLPGNQ WER +LLFV P RRFKVLEG+HA++VESVPF+YIA FTIFQF+
Sbjct  492   WGYFAYMAIDSLPGNQLWERTLLLFVAPGRRFKVLEGVHASFVESVPFRYIAIFTIFQFM  551

Query  1060  YLLVCFGVTWI  1092
             YLL+ FGVTWI
Sbjct  552   YLLLVFGVTWI  562



>gb|KFK41918.1| hypothetical protein AALP_AA2G189000 [Arabis alpina]
Length=683

 Score =   522 bits (1344),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 245/375 (65%), Positives = 301/375 (80%), Gaps = 11/375 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF+WLY NGLL ++F+FG+L TSL+SR+ARSW YGTG++RSFIADYGVPLMV++WTA+
Sbjct  196   KYQFEWLYTNGLLGLVFTFGLLYTSLKSRKARSWRYGTGWYRSFIADYGVPLMVLVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRL  PLPW+ AS+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  256   SFSTPSQLPSGVPRRLFSPLPWDSASLTHWTVIKDMGKVSPGYIFAAFIPAVMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DH+VASQ+AQ KEFNLK PSAYHYDIL+LG MTL CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHTVASQLAQQKEFNLKNPSAYHYDILLLGFMTLTCGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE ++ +AT S++Y  M  V++EM  SP    +     EL +LK A
Sbjct  376   LKRQLIRRKMLMTAKESIRQRATSSQVYENMQEVFIEMDKSPLVETNATLVMELQDLKEA  435

Query  709   VMKNDEKDGN-------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIP  867
             VMK  E  G+        D  K +DA LPV VNEQRVSNLLQS+ VG ++ A+P I++IP
Sbjct  436   VMKKSEDQGDSNEESSGFDPEKHLDAFLPVRVNEQRVSNLLQSLLVGGAVFAIPAIKLIP  495

Query  868   TSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTI  1047
             TS+LWGYFAYMA DSLPGNQF+ER +LLFVPP+RRFKVLEG HA++VE VP+K +A FT 
Sbjct  496   TSLLWGYFAYMAIDSLPGNQFFERTMLLFVPPSRRFKVLEGAHASFVEKVPYKSMAAFTA  555

Query  1048  FQFVYLLVCFGVTWI  1092
             FQ VY  +C+G+TWI
Sbjct  556   FQIVYFGLCYGITWI  570



>gb|KDP37147.1| hypothetical protein JCGZ_06203 [Jatropha curcas]
Length=672

 Score =   521 bits (1343),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 259/368 (70%), Positives = 309/368 (84%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLYANGLL +IF+FG++ T+L+SR+ARSW YGTG+ RSFIADYGVPLMVV+WT++
Sbjct  194   KYQFQWLYANGLLGIIFTFGLVYTALKSRKARSWWYGTGWLRSFIADYGVPLMVVVWTSL  253

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P +VPS VPRRL  PLPWE AS+ HWTVI+DMG VPP YI A FIPA MIAGLYFF
Sbjct  254   SFSTPSKVPSGVPRRLFSPLPWESASLRHWTVIEDMGNVPPAYIFAAFIPALMIAGLYFF  313

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG +TL+CGLLGLPPSNGVLPQ+PMHT SLA 
Sbjct  314   DHSVASQLAQQKEFNLKNPSAYHYDILLLGFLTLLCGLLGLPPSNGVLPQSPMHTTSLAV  373

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R++M+ SAKE +K +A+ SEIYG+M AV++EM S+PA    KEL +LK A MK 
Sbjct  374   LKRQLIRRKMVESAKESIKQKASNSEIYGKMQAVFIEMDSTPAISVAKELEDLKEAGMKG  433

Query  721   DEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             ++K+ N     D  K IDA+LPV VNEQRVSNLLQS+ V  S+CA+P I++IPTSVLWGY
Sbjct  434   EDKEENTKDAFDPEKHIDAYLPVRVNEQRVSNLLQSLLVAGSVCAMPAIKLIPTSVLWGY  493

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI+LLFV P RR+KVLE +HA++VESVPFKY A FT+ Q VY L
Sbjct  494   FAYMAIDSLPGNQFWERILLLFVMPGRRYKVLERVHASFVESVPFKYTAIFTLIQLVYFL  553

Query  1069  VCFGVTWI  1092
             VCFGVTW+
Sbjct  554   VCFGVTWV  561



>ref|XP_011019813.1| PREDICTED: probable boron transporter 7 [Populus euphratica]
Length=664

 Score =   521 bits (1342),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 257/368 (70%), Positives = 298/368 (81%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++QF WLYANGLL+VIFSFGVL TSL+SR AR+W YGTG+ R FIADYGVPLMV+LWTA+
Sbjct  191   KHQFHWLYANGLLSVIFSFGVLFTSLKSRRARTWRYGTGWLRGFIADYGVPLMVLLWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY    +VPS VPRR+  PL W+  S+ HWTVI DM KVP  YI A  IPA  IAGLYFF
Sbjct  251   SYAGTGKVPSGVPRRVHVPLLWDSESLEHWTVINDMLKVPLTYIFAALIPAVTIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYD+ +LG++TLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDVFLLGLLTLICGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEM-GSSPAPVADKELNNLKVAVMK  717
             L+ QL+RK+M+  AKE +  +A+ SEIYG M AV++EM  SSP     KEL +LK AVMK
Sbjct  371   LRRQLIRKKMVKRAKECIGRKASNSEIYGSMQAVFLEMDASSPDVSVHKELEDLKQAVMK  430

Query  718   NDE--KDGN-LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
               E   D N  D  K IDA+LPV VNEQR+SNLLQS  VG S+CA+P+I+ IPTSVLWGY
Sbjct  431   AAEGWDDKNKFDPEKHIDAYLPVRVNEQRMSNLLQSTLVGASMCALPLIKRIPTSVLWGY  490

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLFV P+RR+KVLEG+HA++VE VPFK IA FTIFQ VYLL
Sbjct  491   FAYMAIDSLPGNQFWERMLLLFVTPSRRYKVLEGLHASFVELVPFKQIAIFTIFQLVYLL  550

Query  1069  VCFGVTWI  1092
             +CFGVTWI
Sbjct  551   ICFGVTWI  558



>ref|XP_004291480.1| PREDICTED: boron transporter 4-like [Fragaria vesca subsp. vesca]
Length=658

 Score =   521 bits (1341),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 259/369 (70%), Positives = 307/369 (83%), Gaps = 8/369 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QFQWLY NGLLAVIF FG+LLT+L+SR+ARSW YGTG+ RSFIADYGVPLMV++WTA+
Sbjct  191   EFQFQWLYTNGLLAVIFCFGLLLTALKSRKARSWLYGTGWLRSFIADYGVPLMVLVWTAM  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP++VP +VPRRL+CP PW+  S+YHWTVI DMG+VP  YI A  IPA MIAGLYFF
Sbjct  251   SYGVPRKVPHAVPRRLLCPYPWDKDSLYHWTVIMDMGEVPVTYIFAAIIPAIMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPSAYHYD+ +LG+MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLQKPSAYHYDLFLLGIMTLICGLLGLPPSNGVLPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEM--GSSPAPVADKELNNLKVAVM  714
             L+ Q++RK+M+ SAK+ MK   + SEIYGRM AV++EM  GS P P   KEL NLK AVM
Sbjct  371   LRKQVIRKKMVKSAKDCMKENGSNSEIYGRMEAVFIEMEGGSPPNP---KELANLKEAVM  427

Query  715   K---NDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
                   +  G  D  K IDAHLPV VNEQRVSNLLQS+ VG+SI  +  I+MIPTSVLWG
Sbjct  428   NAADGGDLKGKFDPEKHIDAHLPVRVNEQRVSNLLQSLLVGVSILGIAAIKMIPTSVLWG  487

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPG+QF+ER++LLF+ P+RR+KVLEG HA++VE VP+KYI GFT+FQ VY 
Sbjct  488   YFAYMAIDSLPGSQFFERVLLLFISPSRRYKVLEGSHASFVELVPYKYIVGFTLFQVVYF  547

Query  1066  LVCFGVTWI  1092
             L+CFGVTWI
Sbjct  548   LMCFGVTWI  556



>gb|KEH15890.1| boron transporter-like protein [Medicago truncatula]
Length=659

 Score =   520 bits (1338),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 253/370 (68%), Positives = 304/370 (82%), Gaps = 6/370 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF WLYANGLL +IF+F +L TSL+SR+ARSW YGTG+ RSFIADYGVP +VV+WTA+
Sbjct  199   KYQFHWLYANGLLGIIFTFCLLYTSLKSRKARSWLYGTGWLRSFIADYGVPFLVVVWTAL  258

Query  181   SYTV-PKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYF  357
             S+TV   +VPS VPRRLV PL WE AS++HWTVIKDMGKV   +I A F+PA MIAGLYF
Sbjct  259   SFTVVASKVPSGVPRRLVAPLAWESASLHHWTVIKDMGKVSLEHIFAAFVPALMIAGLYF  318

Query  358   FDHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLA  537
             FDHSVASQ+AQ KEFNLKK SAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA
Sbjct  319   FDHSVASQLAQQKEFNLKKSSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLA  378

Query  538   ELKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVM  714
              LK QL+R++M+ SAKE +  +A+ SEIYG M AV++EM + P   +  KEL +LK  V+
Sbjct  379   VLKKQLIRRKMVKSAKESIGKKASNSEIYGMMQAVFIEMDNDPNNHSVVKELEDLKDFVL  438

Query  715   KNDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLW  882
               ++K  N     DL K ID +LPV V EQRVSNLLQS+FVG+++ A+P I+MIPTSVLW
Sbjct  439   NGEDKGDNNKSTFDLEKHIDTYLPVRVKEQRVSNLLQSLFVGVAVFAMPAIKMIPTSVLW  498

Query  883   GYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVY  1062
             GYFAYMA DSLPGNQFWERI+LLFV P+R +K+LEG HA++VESVPFK+I  FT+FQ VY
Sbjct  499   GYFAYMAIDSLPGNQFWERILLLFVRPSRWYKLLEGDHASFVESVPFKHIVLFTLFQCVY  558

Query  1063  LLVCFGVTWI  1092
              LVCFGVTWI
Sbjct  559   FLVCFGVTWI  568



>emb|CDX72362.1| BnaC07g43840D [Brassica napus]
Length=661

 Score =   519 bits (1337),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 250/370 (68%), Positives = 296/370 (80%), Gaps = 8/370 (2%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW Y NGLLAVIF+FG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A S
Sbjct  193   YQFQWRYTNGLLAVIFAFGLLYTALKSRRARSWRYGFRWMRGFIGDYGTLLMLVLWSAFS  252

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             +TVP+++P  VPRRL  PLPW+P S+YHWTV+KDMGKVPP +ILA FIPA MIAGLYFFD
Sbjct  253   FTVPRDIPEGVPRRLELPLPWDPESLYHWTVVKDMGKVPPLFILAAFIPAIMIAGLYFFD  312

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK P AYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  313   HCVSAQMAQQKEFNLKNPPAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  372

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMK--  717
             K Q MRK+M+  AKE MK +A+KSEIYG+M  V++EM +SP  +  KEL NLK AVMK  
Sbjct  373   KRQQMRKKMVQKAKECMKAKASKSEIYGKMQDVFIEMETSPKALV-KELENLKEAVMKAD  431

Query  718   -----NDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLW  882
                   D K    D    I+ HLPV VNEQRVSNLLQSI VGL I AVP++RMIPTSVLW
Sbjct  432   DGGGGGDTKGKKFDPEVHIEDHLPVRVNEQRVSNLLQSILVGLLIFAVPLLRMIPTSVLW  491

Query  883   GYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVY  1062
             GYF YMA DSLPGNQFWER++LLF+ P RRFKVLEG+H++++E VP+K I  FT+FQ +Y
Sbjct  492   GYFTYMAVDSLPGNQFWERLLLLFITPGRRFKVLEGLHSSFMEIVPYKSIVMFTLFQLLY  551

Query  1063  LLVCFGVTWI  1092
              L+C+GVTWI
Sbjct  552   FLICYGVTWI  561



>dbj|BAD67809.1| band 3 anion transport protein -like [Oryza sativa Japonica Group]
Length=665

 Score =   519 bits (1337),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 297/368 (81%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFS G+L T+LRSR ARSW YG G+ R FIADYGVPLMV++WTA S
Sbjct  185   YQFQWLYVNGLLGVIFSIGLLYTALRSRRARSWVYGQGWLRGFIADYGVPLMVIVWTAFS  244

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YT+PK+VPS VPRRL  PLPWE +S+ HWTV KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  245   YTLPKDVPSGVPRRLFSPLPWESSSLQHWTVAKDLFSVPPAYIFAAILPALMVAGLYFFD  304

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPSAYHYDIL+LG M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  305   HSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  364

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+RK+M+ +A EG+  +A+  EIYG++  V++EM         DKEL +LK A+++ 
Sbjct  365   KGQLLRKKMVQTANEGLMNRASSLEIYGKIQGVFIEMDCEKNTDSVDKELKSLKDAILQE  424

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +K+G L    D  K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  425   VDKEGTLAEEFDPIKHIEAHLPVRVNEQRLSNLLQSLLVGACVGAMPVIKMIPTSVLWGY  484

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER+ L+F+P +RR+KVLEG HA+++ESVP K I  FTIFQ VYLL
Sbjct  485   FAYMAIDSLPGNQFWERLRLIFIPSSRRYKVLEGPHASFMESVPSKTITVFTIFQLVYLL  544

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  545   ICFGITWI  552



>ref|XP_006595477.1| PREDICTED: boron transporter 4-like [Glycine max]
Length=621

 Score =   518 bits (1333),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 306/369 (83%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F WLYANGLL +IF+FG+L TSL+SR ARSW YGTG+FRSFIADYGVP MVV+WTA+
Sbjct  143   KYKFHWLYANGLLGIIFTFGLLYTSLKSRRARSWLYGTGWFRSFIADYGVPFMVVVWTAL  202

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+TVP++VPS VPRRL  PL WE  S++HWTVIK+MG+V P Y+ A FIPA MIAGLYFF
Sbjct  203   SFTVPRKVPSGVPRRLTSPLAWESTSLHHWTVIKNMGEVSPAYVFAAFIPALMIAGLYFF  262

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+KPSAYHYDIL+L + TL+CGL+GLPPSNGVLPQ+PMH+KSLA 
Sbjct  263   DHSVASQMAQQKEFNLRKPSAYHYDILLLALTTLLCGLIGLPPSNGVLPQSPMHSKSLAV  322

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
             LK QL+R++M+ SAKE ++ +A+KSEIYG+M AV++EM + P   +  KEL +LK  V+ 
Sbjct  323   LKKQLIRRKMVKSAKESIRQKASKSEIYGKMQAVFMEMDNCPDNHSVVKELEDLKDVVLN  382

Query  718   NDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
              ++K  N     D  K+IDA+LPV V EQRVSNLLQS+ VG S+ A+P I+ IPTSVLWG
Sbjct  383   GEDKGLNNKSTFDPEKNIDAYLPVRVKEQRVSNLLQSLLVGASVFAMPAIKKIPTSVLWG  442

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWERI+ LFV PNR +K+LEG HA+++ESVP+KYI  FT+FQ +Y 
Sbjct  443   YFAYMAIDSLPGNQFWERILFLFVTPNRWYKLLEGDHASFIESVPYKYIVFFTLFQCIYF  502

Query  1066  LVCFGVTWI  1092
             LVCFGVTWI
Sbjct  503   LVCFGVTWI  511



>emb|CDY46028.1| BnaA02g16980D [Brassica napus]
Length=533

 Score =   514 bits (1324),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 242/374 (65%), Positives = 301/374 (80%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IF+FG+L T+L+SR+ARSW YGTG++R+FIADYGVPLMVV+WTA+
Sbjct  46    KYQFQWLYTNGLLGLIFTFGLLYTALKSRKARSWRYGTGWYRNFIADYGVPLMVVVWTAL  105

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P  +PS VPRRL  PLPW+ AS+ HWTVIKDMGKVPP YI AGFIPA MIAGLYFF
Sbjct  106   SFSTPSTLPSGVPRRLSSPLPWDSASLGHWTVIKDMGKVPPPYIFAGFIPALMIAGLYFF  165

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSV +Q+AQ KEFNLK PSAYHYD+L+LG M L+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  166   DHSVVAQLAQQKEFNLKNPSAYHYDVLLLGFMVLVCGLLGLPPSNGVLPQSPMHTKSLAV  225

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE M+ +A+ S++Y  M  V++EM  SP    +     EL +LK A
Sbjct  226   LKRQLIRRKMVMTAKESMRKRASSSQVYENMQEVFIEMDKSPLVQTNSTHILELQDLKDA  285

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK  +++G+       D  K ++A LPV VNEQRVSNLLQS+ V  ++ A+P I++IPT
Sbjct  286   VMKKTDEEGDSSEEGGFDPEKHLEAFLPVRVNEQRVSNLLQSLLVAGAVLAIPAIKLIPT  345

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLPGNQF+ER VLLFVPP+RRFKVLEG HA++VE VP+K +A FT+ 
Sbjct  346   SLLWGYFAYMAIDSLPGNQFFERTVLLFVPPSRRFKVLEGAHASFVEKVPYKSMAAFTML  405

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  406   QIFYFGLCYGVTWI  419



>emb|CAA22578.1| putative protein [Arabidopsis thaliana]
 emb|CAB79968.1| putative protein [Arabidopsis thaliana]
Length=710

 Score =   520 bits (1340),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 253/389 (65%), Positives = 292/389 (75%), Gaps = 26/389 (7%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW Y NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A S
Sbjct  209   YQFQWRYTNGLLAVIFSFGLLYTALKSRRARSWKYGFRWMRGFIGDYGTLLMLVLWSAFS  268

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YTVP+ +P  VPRRL  PLPW   S+YHWTV+KDM KVPP YILA FIPA MIAGLYFFD
Sbjct  269   YTVPRNLPEGVPRRLELPLPWASESLYHWTVVKDMAKVPPLYILAAFIPAIMIAGLYFFD  328

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK P+AYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  329   HCVSAQMAQQKEFNLKNPTAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  388

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-------------------  666
             K Q MRK+M+  AKE M+ +A+ SEIYGRM  V++EM +SP                   
Sbjct  389   KKQQMRKKMVQKAKECMREKASNSEIYGRMQDVFIEMETSPKASNHICLINSLPLFLFSY  448

Query  667   --APVADKELNNLKVAVMKNDEKDGN-----LDLAKDIDAHLPVGVNEQRVSNLLQSIFV  825
               A    KEL NLK AVMK D+  G       D    I+ HLPV VNEQRVSNLLQS+ V
Sbjct  449   QEATSVVKELENLKEAVMKADDGGGETKGKKFDPEVHIEDHLPVRVNEQRVSNLLQSVLV  508

Query  826   GLSICAVPVIRMIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATY  1005
             GL I AVPV+RMIPTSVLWGYF YMA DSLPGNQFWER+ LLF+ P RRFKVLEG+HA++
Sbjct  509   GLLILAVPVLRMIPTSVLWGYFTYMAVDSLPGNQFWERLQLLFITPGRRFKVLEGLHASF  568

Query  1006  VESVPFKYIAGFTIFQFVYLLVCFGVTWI  1092
             VE VP+K I  FT+FQ +Y L+C+GVTWI
Sbjct  569   VEIVPYKSIVMFTLFQLLYFLICYGVTWI  597



>gb|ABD78950.1| boron transporter [Oryza sativa Japonica Group]
Length=672

 Score =   519 bits (1336),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 297/368 (81%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFS G+L T+LRSR ARSW YG G+ R FIADYGVPLMV++WTA S
Sbjct  192   YQFQWLYVNGLLGVIFSIGLLYTALRSRRARSWVYGQGWLRGFIADYGVPLMVIVWTAFS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YT+PK+VPS VPRRL  PLPWE +S+ HWTV KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  252   YTLPKDVPSGVPRRLFSPLPWESSSLQHWTVAKDLFSVPPAYIFAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPSAYHYDIL+LG M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+RK+M+ +A EG+  +A+  EIYG++  V++EM         DKEL +LK A+++ 
Sbjct  372   KGQLLRKKMVQTANEGLMNRASSLEIYGKIQGVFIEMDCEKNTDSVDKELKSLKDAILQE  431

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +K+G L    D  K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  432   VDKEGTLAEEFDPIKHIEAHLPVRVNEQRLSNLLQSLLVGACVGAMPVIKMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER+ L+F+P +RR+KVLEG HA+++ESVP K I  FTIFQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWERLRLIFIPSSRRYKVLEGPHASFMESVPSKTITVFTIFQLVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>ref|NP_001042174.2| Os01g0175600 [Oryza sativa Japonica Group]
 dbj|BAG92966.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04088.2| Os01g0175600 [Oryza sativa Japonica Group]
Length=672

 Score =   518 bits (1335),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 298/368 (81%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             Y+FQWLY NGLL VIFS G+L T+LRSR ARSW YG G+ R FI+DYGVPLMV++WTA+S
Sbjct  192   YRFQWLYVNGLLGVIFSIGLLYTALRSRRARSWVYGQGWLRGFISDYGVPLMVIVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y +PK+VPS VPRRL  PLPWE +S++HWT+ KD+  VPP YI A  +PA MIAGLYFFD
Sbjct  252   YALPKDVPSGVPRRLFSPLPWESSSLHHWTIAKDLFSVPPAYIFAAILPALMIAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPSAYHYDIL+LG M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+RK+M+ +A EG+  +A+  EIYG+M  V++EM         DKEL +LK A+++ 
Sbjct  372   KGQLLRKKMVQTANEGLMNRASSLEIYGKMQGVFIEMDCEKNTDSVDKELKSLKDAMLQE  431

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +K+G L    D  K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  432   GDKEGTLAEEFDPIKHIEAHLPVRVNEQRLSNLLQSLLVGACVGAMPVIKMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI L+F+P +RR+KVLEG HA+++ESVP K I  FTIFQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWERIRLIFIPSSRRYKVLEGPHASFMESVPSKTITVFTIFQLVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>ref|XP_009138133.1| PREDICTED: probable boron transporter 7 [Brassica rapa]
 ref|XP_009138134.1| PREDICTED: probable boron transporter 7 [Brassica rapa]
Length=662

 Score =   518 bits (1334),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 251/370 (68%), Positives = 295/370 (80%), Gaps = 7/370 (2%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW Y NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A S
Sbjct  193   YQFQWRYTNGLLAVIFSFGLLYTALKSRRARSWRYGFRWMRGFIGDYGTLLMLVLWSAFS  252

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             +TVP+++P  VPRRL  PLPW+P S+YHWTV+KDM KVPP +ILA FIPA MIAGLYFFD
Sbjct  253   FTVPRDIPEGVPRRLEVPLPWDPESLYHWTVVKDMWKVPPLFILAAFIPAIMIAGLYFFD  312

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  313   HCVSAQMAQQKEFNLKNPSAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  372

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMK-  717
             K Q +RK+M+  AKE MK +A+KSEIYG+M  V++EM  SP A    KEL NLK AVMK 
Sbjct  373   KRQQIRKKMVQKAKECMKAKASKSEIYGKMQDVFIEMEKSPKATSVAKELENLKEAVMKA  432

Query  718   -----NDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLW  882
                   D K    D    I+ HLPV VNEQRVSNLLQSI VGL I AVP++RMIPTSVLW
Sbjct  433   DDGGGGDTKGKKFDPEVHIEDHLPVRVNEQRVSNLLQSILVGLLIFAVPLLRMIPTSVLW  492

Query  883   GYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVY  1062
             GYF YMA DSLPGNQFWER++LLF+ P RRFKVLEG+H++++E VP+K I  FT+FQ +Y
Sbjct  493   GYFTYMAVDSLPGNQFWERLLLLFITPGRRFKVLEGLHSSFMEIVPYKSIVMFTLFQLLY  552

Query  1063  LLVCFGVTWI  1092
              L+C+GVTWI
Sbjct  553   FLICYGVTWI  562



>emb|CDY39649.1| BnaC05g11780D [Brassica napus]
Length=675

 Score =   518 bits (1335),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 247/374 (66%), Positives = 305/374 (82%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F+WLY NGLL +IF+FG+L T+L+SR+ARSW YGTG++RSFIADYGVPLMVV+WTA+
Sbjct  194   KYKFEWLYTNGLLGLIFTFGLLYTALKSRKARSWRYGTGWYRSFIADYGVPLMVVVWTAL  253

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+T P ++PS VPRRL  PLPW+ AS+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  254   SFTTPSKLPSGVPRRLFSPLPWDSASLEHWTVIKDMGKVSPGYIFAAFIPALMIAGLYFF  313

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  314   DHSVASQLAQQKEFNLKNPSAYHYDILLLGFMTLICGLLGLPPSNGVLPQSPMHTKSLAV  373

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE ++ +AT SE+Y  M  V++EM  SP    ++    EL +LK A
Sbjct  374   LKRQLIRRKMVKTAKESIRKRATSSEVYENMQEVFIEMDKSPIAQTNRTVILELQDLKEA  433

Query  709   VMKND------EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK++      E++   D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+P I+++PT
Sbjct  434   VMKSNEDEGEREEESGFDPEKHLDAYLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKLMPT  493

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             SVLWGYFAYMA DSLPGNQF+ER++LLFV P+RRFKVLEG HA++VE VP+K +A FTI 
Sbjct  494   SVLWGYFAYMAIDSLPGNQFFERMMLLFVLPSRRFKVLEGAHASFVEKVPYKSMAAFTIL  553

Query  1051  QFVYLLVCFGVTWI  1092
             Q VY  +C+GVTWI
Sbjct  554   QIVYFGICYGVTWI  567



>ref|XP_010318581.1| PREDICTED: boron transporter 4 [Solanum lycopersicum]
Length=673

 Score =   518 bits (1334),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 263/371 (71%), Positives = 305/371 (82%), Gaps = 7/371 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF WLY NGLL +IF+FG+L T+L+SR+ARSW YGTG+ RSFIADYGVPLMV++W+++
Sbjct  192   KYQFHWLYMNGLLGIIFTFGLLYTALKSRKARSWWYGTGWMRSFIADYGVPLMVLMWSSL  251

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP  VPS VPR L  PLPWE AS+YHWTV+KDM KVPP YI A  IPA MIAGLYFF
Sbjct  252   SFIVPSNVPSGVPRTLYSPLPWESASLYHWTVMKDMVKVPPVYIFAAIIPAVMIAGLYFF  311

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  312   DHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLLGLPPSNGVLPQSPMHTKSLAI  371

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMK-  717
             LK QL+RK+M+ SAKE ++ +A+ SEIYG M AV++E+ SSP     KEL +LK A+MK 
Sbjct  372   LKKQLIRKKMVESAKESIRQKASNSEIYGNMQAVFIEIDSSPISAVAKELEHLKEAIMKC  431

Query  718   -----NDEK-DGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVL  879
                  NDEK  G  D  K IDA+LPV VNEQRVSNLLQS+ V  S  A+PVI+ IPTSVL
Sbjct  432   ESDNANDEKSSGIFDPEKYIDAYLPVRVNEQRVSNLLQSLLVAASAGAMPVIKKIPTSVL  491

Query  880   WGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFV  1059
             WGYFAYMA DSLPGNQ WER++LLF+ P RRFKVLEG+HA++VESVPF+ IA FTIFQFV
Sbjct  492   WGYFAYMAIDSLPGNQLWERMLLLFISPGRRFKVLEGVHASFVESVPFRCIAIFTIFQFV  551

Query  1060  YLLVCFGVTWI  1092
             YLLV FGVTWI
Sbjct  552   YLLVVFGVTWI  562



>ref|XP_004498650.1| PREDICTED: probable boron transporter 7-like [Cicer arietinum]
Length=680

 Score =   518 bits (1334),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 250/367 (68%), Positives = 304/367 (83%), Gaps = 6/367 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             EYQF W Y NGLL++IF FG++ T+++SR AR+W YGTG  R FIADYGVP+MVVLWTA+
Sbjct  190   EYQFHWRYTNGLLSIIFFFGLIFTAIKSRRARTWRYGTGCIRGFIADYGVPMMVVLWTAL  249

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYTVP +VPS VPRRL CPLPWE AS+YHWTV+KDM KVP  YIL  FIPA MIAGLYFF
Sbjct  250   SYTVPSKVPSGVPRRLFCPLPWESASLYHWTVVKDMVKVPLPYILGAFIPAMMIAGLYFF  309

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVAS+MAQ KEFNL+KPS+YHYD+L+LG++TLICG+LGLPPSNGVLPQ+PMHTKSLA 
Sbjct  310   DHSVASKMAQQKEFNLQKPSSYHYDLLLLGILTLICGILGLPPSNGVLPQSPMHTKSLAV  369

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ QL+RK+++ SAKE ++ Q T SE+YG+M AV++EM ++P     KEL  LK AVMK+
Sbjct  370   LRKQLIRKKVVKSAKECIRQQGTNSELYGKMRAVFIEMDAAPTV---KELETLKEAVMKS  426

Query  721   DEKDGN---LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             +EK G     D  K IDA+LPV VNEQR+SNLLQS+ VGLS+ A+ VI+MIPTSVLWGYF
Sbjct  427   NEKSGTKEKFDPIKHIDAYLPVRVNEQRMSNLLQSLLVGLSLLAISVIKMIPTSVLWGYF  486

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWER++LLF+ P R +K+LEG HA++VESVP K IA FT+ QF++   
Sbjct  487   AYMAIDSLPGNQFWERLLLLFIAPKRHYKILEGSHASFVESVPLKTIAAFTVLQFLFFAF  546

Query  1072  CFGVTWI  1092
             C+GVTWI
Sbjct  547   CYGVTWI  553



>ref|XP_007161235.1| hypothetical protein PHAVU_001G053300g [Phaseolus vulgaris]
 gb|ESW33229.1| hypothetical protein PHAVU_001G053300g [Phaseolus vulgaris]
Length=649

 Score =   517 bits (1331),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 245/367 (67%), Positives = 298/367 (81%), Gaps = 6/367 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+QF W Y NGLL+VIFS G+LLT+L SR AR+W  GTG+ R+ +ADYG+PLMVV WT +
Sbjct  187   EHQFHWRYINGLLSVIFSLGILLTALMSRRARTWKLGTGWQRALVADYGIPLMVVFWTGM  246

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYTVP +VPS++PRRLVCPLPWE  S+YHWTVI DMGKVP  YI A FIPA M+AGLYFF
Sbjct  247   SYTVPSKVPSTIPRRLVCPLPWESESLYHWTVIMDMGKVPVLYIFAAFIPAVMVAGLYFF  306

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVAS+MAQ KE+NL+KPS++HYD+ +LG+MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  307   DHSVASKMAQQKEYNLQKPSSFHYDMFLLGIMTLICGLLGLPPSNGVLPQSPMHTKSLAV  366

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+TQL+RK+++ SAK+ +K Q   +E+YG+M AV +EM S P   + K + NLK AVMK+
Sbjct  367   LRTQLIRKKVVKSAKDCIKQQGNTTELYGKMQAVLIEMDSEP---STKTMTNLKEAVMKS  423

Query  721   DEKDGN---LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
              E +G     D  K IDA++PV VNEQRVSNLLQS+ +GLSI ++ VI+ IPTSVLWGYF
Sbjct  424   SENNGENPKFDPEKHIDAYIPVRVNEQRVSNLLQSLLIGLSIFSISVIKTIPTSVLWGYF  483

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQF+ERI+LLFV  +RR K+LEG HA++VESVPFK IA FTI Q  Y LV
Sbjct  484   AYMAIDSLPGNQFYERILLLFVSQSRRKKILEGPHASFVESVPFKTIAIFTILQCAYFLV  543

Query  1072  CFGVTWI  1092
             C+GV  I
Sbjct  544   CYGVQLI  550



>gb|EEE53967.1| hypothetical protein OsJ_00580 [Oryza sativa Japonica Group]
Length=684

 Score =   518 bits (1333),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 298/368 (81%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             Y+FQWLY NGLL VIFS G+L T+LRSR ARSW YG G+ R FI+DYGVPLMV++WTA+S
Sbjct  204   YRFQWLYVNGLLGVIFSIGLLYTALRSRRARSWVYGQGWLRGFISDYGVPLMVIVWTALS  263

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y +PK+VPS VPRRL  PLPWE +S++HWT+ KD+  VPP YI A  +PA MIAGLYFFD
Sbjct  264   YALPKDVPSGVPRRLFSPLPWESSSLHHWTIAKDLFSVPPAYIFAAILPALMIAGLYFFD  323

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPSAYHYDIL+LG M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  324   HSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  383

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+RK+M+ +A EG+  +A+  EIYG+M  V++EM         DKEL +LK A+++ 
Sbjct  384   KGQLLRKKMVQTANEGLMNRASSLEIYGKMQGVFIEMDCEKNTDSVDKELKSLKDAMLQE  443

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +K+G L    D  K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  444   GDKEGTLAEEFDPIKHIEAHLPVRVNEQRLSNLLQSLLVGACVGAMPVIKMIPTSVLWGY  503

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI L+F+P +RR+KVLEG HA+++ESVP K I  FTIFQ VYLL
Sbjct  504   FAYMAIDSLPGNQFWERIRLIFIPSSRRYKVLEGPHASFMESVPSKTITVFTIFQLVYLL  563

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  564   ICFGITWI  571



>ref|XP_006465502.1| PREDICTED: boron transporter 4-like [Citrus sinensis]
Length=720

 Score =   518 bits (1335),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 245/369 (66%), Positives = 300/369 (81%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF W Y NGLL +IF+ G++ T+++SR+ RSW YGTG+FRSFIADYGVPLMV++W+A+
Sbjct  223   KYQFHWPYTNGLLGIIFTSGLVCTAIKSRKTRSWWYGTGWFRSFIADYGVPLMVLVWSAL  282

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VPS VPRRL  PLPWE AS+ HW+VIKDMGKVP  YI A FIPA MIAGLYFF
Sbjct  283   SFSVPSKVPSGVPRRLFSPLPWESASLDHWSVIKDMGKVPVAYIFAAFIPAVMIAGLYFF  342

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGV-LPQAPMHTKSLA  537
             DHSVASQ+AQ KEFNLKKPSAYHYD  +LG MTL CGL+GLPPSNGV LPQ+PMHTKSLA
Sbjct  343   DHSVASQLAQQKEFNLKKPSAYHYDTFLLGFMTLACGLIGLPPSNGVLLPQSPMHTKSLA  402

Query  538   ELKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMK  717
              LKTQ M+K+M+ SA E +K +AT SEIYG++ AV+++M +SP     KEL +    +MK
Sbjct  403   VLKTQFMKKKMVESATESIKQKATDSEIYGKIQAVFIQMDNSPVNSEVKELEDQTELIMK  462

Query  718   ----NDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
                  ++   NLD  K IDA+LPV VNEQRVSNLLQS+ V  S+CA+P I++IPTSVLWG
Sbjct  463   GCKEREKGKENLDPEKHIDAYLPVRVNEQRVSNLLQSLLVAASVCAMPAIKLIPTSVLWG  522

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA D+LPGNQFWERI+LLF+ P R++KVLE  HA++V+SVP+KYI  FT+FQ VY 
Sbjct  523   YFAYMAIDTLPGNQFWERILLLFITPGRQYKVLEKAHASFVKSVPYKYIVMFTLFQLVYF  582

Query  1066  LVCFGVTWI  1092
             LVC+GVTWI
Sbjct  583   LVCYGVTWI  591



>ref|XP_002892869.1| anion exchange family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69128.1| anion exchange family protein [Arabidopsis lyrata subsp. lyrata]
Length=683

 Score =   517 bits (1332),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 302/374 (81%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F+WLY NGLL +IF+FG+L T+L+SR+ARSW YGTG++RSFIADYGVPLMVV+WTA+
Sbjct  196   KYRFEWLYTNGLLGLIFTFGLLYTALKSRKARSWRYGTGWYRSFIADYGVPLMVVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRL  PLPW+ AS+ HWTVIKDMG+V P YI A FIPA MIAGLYFF
Sbjct  256   SFSTPSKLPSGVPRRLFSPLPWDSASLSHWTVIKDMGEVSPGYIFAAFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLKKPSAYHYDIL+LG MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVASQLAQQKEFNLKKPSAYHYDILLLGFMTLICGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ SAKE ++ + T S++Y  M  V++EM  S     D     EL +LK A
Sbjct  376   LKRQLIRRKMVKSAKESIRKRETSSQVYENMQEVFIEMDKSHLAQTDLAVIIELQDLKEA  435

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK++E++G        D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+P I++IPT
Sbjct  436   VMKSNEEEGEGDKESGFDPEKHLDAYLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKLIPT  495

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLPGNQF+ER +LLFVP +RRFKVLEG HA++VE VP+K +A FT+ 
Sbjct  496   SILWGYFAYMAIDSLPGNQFFERTMLLFVPTSRRFKVLEGAHASFVEKVPYKSMAAFTLL  555

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  556   QIFYFGLCYGVTWI  569



>ref|XP_003597847.1| Anion exchanger family protein [Medicago truncatula]
Length=746

 Score =   519 bits (1337),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 253/370 (68%), Positives = 304/370 (82%), Gaps = 6/370 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF WLYANGLL +IF+F +L TSL+SR+ARSW YGTG+ RSFIADYGVP +VV+WTA+
Sbjct  256   KYQFHWLYANGLLGIIFTFCLLYTSLKSRKARSWLYGTGWLRSFIADYGVPFLVVVWTAL  315

Query  181   SYTV-PKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYF  357
             S+TV   +VPS VPRRLV PL WE AS++HWTVIKDMGKV   +I A F+PA MIAGLYF
Sbjct  316   SFTVVASKVPSGVPRRLVAPLAWESASLHHWTVIKDMGKVSLEHIFAAFVPALMIAGLYF  375

Query  358   FDHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLA  537
             FDHSVASQ+AQ KEFNLKK SAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA
Sbjct  376   FDHSVASQLAQQKEFNLKKSSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLA  435

Query  538   ELKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVM  714
              LK QL+R++M+ SAKE +  +A+ SEIYG M AV++EM + P   +  KEL +LK  V+
Sbjct  436   VLKKQLIRRKMVKSAKESIGKKASNSEIYGMMQAVFIEMDNDPNNHSVVKELEDLKDFVL  495

Query  715   KNDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLW  882
               ++K  N     DL K ID +LPV V EQRVSNLLQS+FVG+++ A+P I+MIPTSVLW
Sbjct  496   NGEDKGDNNKSTFDLEKHIDTYLPVRVKEQRVSNLLQSLFVGVAVFAMPAIKMIPTSVLW  555

Query  883   GYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVY  1062
             GYFAYMA DSLPGNQFWERI+LLFV P+R +K+LEG HA++VESVPFK+I  FT+FQ VY
Sbjct  556   GYFAYMAIDSLPGNQFWERILLLFVRPSRWYKLLEGDHASFVESVPFKHIVLFTLFQCVY  615

Query  1063  LLVCFGVTWI  1092
              LVCFGVTWI
Sbjct  616   FLVCFGVTWI  625



>ref|XP_006306092.1| hypothetical protein CARUB_v10011515mg [Capsella rubella]
 gb|EOA38990.1| hypothetical protein CARUB_v10011515mg [Capsella rubella]
Length=686

 Score =   517 bits (1332),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 248/374 (66%), Positives = 300/374 (80%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y F+WLYANGLL +IF+FG+L T+L+SR+ARSW YGTG++RSFIADYGVPLMVV+WTA+
Sbjct  195   KYHFEWLYANGLLGIIFTFGLLYTALKSRKARSWRYGTGWWRSFIADYGVPLMVVVWTAL  254

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRL  PLPW+ AS+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  255   SFSTPSKLPSGVPRRLFSPLPWDSASLSHWTVIKDMGKVSPGYIFAAFIPALMIAGLYFF  314

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  315   DHSVASQLAQQKEFNLKNPSAYHYDILLLGFMTLICGLLGLPPSNGVLPQSPMHTKSLAV  374

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP----APVADKELNNLKVA  708
             LK QL+R++M+ +AKE +K + T S++Y  M  V++EM  SP     P    EL +LK A
Sbjct  375   LKRQLIRRKMVKTAKESIKKRETSSQVYESMQEVFIEMDKSPLTQTNPTVIIELQDLKEA  434

Query  709   VMK-NDEK-----DGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK N+EK     D   D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+P I+ IPT
Sbjct  435   VMKCNEEKGERNEDSGFDPEKHLDAYLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKRIPT  494

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLPGNQF+ER +LLFVP +RRFKVLEG HA++VE VP+K +A FT+ 
Sbjct  495   SLLWGYFAYMANDSLPGNQFFERTMLLFVPTSRRFKVLEGDHASFVEKVPYKSMAAFTLL  554

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  555   QIFYFGICYGVTWI  568



>ref|XP_004968394.1| PREDICTED: boron transporter 4-like isoform X3 [Setaria italica]
Length=654

 Score =   516 bits (1328),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 295/368 (80%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFS G+L T+LR+R ARSW YG G+ RSFIADYGVPLMV++WTA+S
Sbjct  173   YQFQWLYVNGLLGVIFSIGLLFTALRTRRARSWLYGVGWLRSFIADYGVPLMVIVWTALS  232

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YT+P +VPS VPRRL  PLPWE +S+ HWT++KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  233   YTLPSKVPSGVPRRLFSPLPWESSSLGHWTIVKDLFSVPPAYIFAAILPALMVAGLYFFD  292

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ  E+NLKKPSAYHYDIL+LG+M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  293   HSVASQLAQQNEYNLKKPSAYHYDILVLGIMVLLCGLIGIPPSNGVLPQSPMHTRSLAIL  352

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+ K+M+ +AKE +   AT  EIYG+M  V++EM S       DKEL N K AV++ 
Sbjct  353   KRQLLSKKMVDTAKESIGKSATSLEIYGKMQEVFIEMDSEQNTDSVDKELKNFKDAVLQE  412

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +++G L    D  K I+AHLPV VNEQR+SNLLQSI VG  + A+PVIRMIPTSVLWGY
Sbjct  413   GDEEGKLAGEFDPRKHIEAHLPVRVNEQRLSNLLQSILVGGCVGAMPVIRMIPTSVLWGY  472

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER+ LLF+  +R +KVLEG HA++VESVP + I  FT+FQ VYLL
Sbjct  473   FAYMAIDSLPGNQFWERMQLLFIAESRHYKVLEGPHASFVESVPPRTITIFTVFQLVYLL  532

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  533   ICFGITWI  540



>ref|NP_172999.1| boron transporter 4 [Arabidopsis thaliana]
 sp|Q9XI23.1|BOR4_ARATH RecName: Full=Boron transporter 4 [Arabidopsis thaliana]
 gb|AAD39673.1|AC007591_38 Is a member of the PF|00955 Anion exchanger family [Arabidopsis 
thaliana]
 gb|AAL47440.1| At1g15460/T16N11_24 [Arabidopsis thaliana]
 gb|AEE29326.1| boron transporter 4 [Arabidopsis thaliana]
Length=683

 Score =   516 bits (1330),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 303/374 (81%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F+WLY NGLL +IF+FG+L T+L+SR+ARSW YGTG++RSFIADYGVPLMVV+WTA+
Sbjct  196   KYKFEWLYTNGLLGLIFTFGLLYTALKSRKARSWRYGTGWYRSFIADYGVPLMVVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRL  PLPW+  S+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  256   SFSTPSKLPSGVPRRLFSPLPWDSPSLSHWTVIKDMGKVSPGYIFAAFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLKKPSAYHYDIL+LG MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVASQLAQQKEFNLKKPSAYHYDILLLGFMTLICGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE ++ + T S++Y  M  V++EM  SP    D     EL +LK A
Sbjct  376   LKRQLIRRKMVKTAKESIRKRETSSQVYENMQEVFIEMDKSPLAQTDPSVIIELQDLKEA  435

Query  709   VMK--NDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK  ++E++G+     D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+P I++IPT
Sbjct  436   VMKSNDEEREGDEESGFDPEKHLDAYLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKLIPT  495

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLPGNQF+ER+ LLFVP +RRFKVLEG HA++VE VP+K +A FT+ 
Sbjct  496   SILWGYFAYMAIDSLPGNQFFERLTLLFVPTSRRFKVLEGAHASFVEKVPYKSMAAFTLL  555

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  556   QIFYFGLCYGVTWI  569



>ref|XP_010691217.1| PREDICTED: boron transporter 4-like [Beta vulgaris subsp. vulgaris]
Length=657

 Score =   515 bits (1327),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 296/368 (80%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++QFQW Y NGL  +IF+F VL TSL+SR+ARSW YGT  FRSFIADYGVPLMVVL TA+
Sbjct  188   KFQFQWRYVNGLCGIIFTFVVLTTSLKSRKARSWRYGTSHFRSFIADYGVPLMVVLGTAI  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VPK VP  VPRRL  PLPW+  S+YHWTV++DMGKVP  YI A  IPA MI GLYFF
Sbjct  248   SFSVPKGVPEGVPRRLYSPLPWQSQSLYHWTVVQDMGKVPVIYIFAAIIPALMITGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DH VA+Q+AQ KEFNL+KPSAYHYD+L+LG  T+ICGLLG+PP+NGVLPQ+PMHTKSLA 
Sbjct  308   DHGVAAQLAQQKEFNLRKPSAYHYDVLLLGFTTVICGLLGIPPANGVLPQSPMHTKSLAT  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP-VADKELNNLKVAVMK  717
             LK QL+R++++ S KE +K  A+  EIYG+M  V++++  SP P    +EL +LK AVMK
Sbjct  368   LKKQLIRRKLVESVKESIKKNASSREIYGQMQDVFIKIDQSPDPHEVVRELEDLKQAVMK  427

Query  718   NDEKDGNLDLA---KDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              + K+G  + A     IDA LPV VNEQRVSNLLQS+ V  ++ A+PVI++IPTSVLWGY
Sbjct  428   GNSKEGKDEKAFRLDHIDAFLPVRVNEQRVSNLLQSVLVAGAMFAMPVIKLIPTSVLWGY  487

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPG+QFWERI+LLF+ P RR+KVLE  H +YVESVPFKYIA FTIFQ VYL+
Sbjct  488   FAYMAIDSLPGSQFWERILLLFITPARRYKVLEDAHVSYVESVPFKYIAAFTIFQLVYLM  547

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  548   ICFGITWI  555



>ref|XP_009348429.1| PREDICTED: boron transporter 4-like isoform X2 [Pyrus x bretschneideri]
Length=665

 Score =   516 bits (1328),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 311/368 (85%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFSFG+L T+L+SR+ARSW Y TG+FRSFIADYGVPLMV++WTA+S
Sbjct  192   YQFQWLYTNGLLGVIFSFGLLYTALKSRKARSWWYATGWFRSFIADYGVPLMVLVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             ++VP  +P  VPRRL  P+ W+ +S++HWTVIKDMGKV P YI A  IPA M+AGLYFFD
Sbjct  252   FSVPHNIPPRVPRRLYSPVAWDSSSLHHWTVIKDMGKVSPGYIFAAVIPAVMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ +EFNLKKPSAYHYDIL+LG MTL+CGLLGLPPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQMAQQQEFNLKKPSAYHYDILLLGFMTLLCGLLGLPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD-KELNNLKVAVMKN  720
             K QL+R++M+ SAKE +K +A+ SEIYG+M AV++EM +   P ++ KELN LK AVMK+
Sbjct  372   KKQLIRRKMVKSAKESIKQKASNSEIYGKMQAVFIEMDNLTTPTSEVKELNELKEAVMKS  431

Query  721   DEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             + K+ +     D  K IDA+LPV VNEQR+SNLLQS+ V  S+ A+PVI+ IPTSVLWGY
Sbjct  432   ENKEDDAKNAFDPEKHIDAYLPVRVNEQRLSNLLQSLLVAASVFAMPVIKKIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P+R++KVLEG HA++VESVPFK+IA FT+F+FVY L
Sbjct  492   FAYMAIDSLPGNQFWERMLLLFISPSRQYKVLEGGHASFVESVPFKFIAIFTLFKFVYFL  551

Query  1069  VCFGVTWI  1092
             VCFG+TWI
Sbjct  552   VCFGITWI  559



>emb|CDX68852.1| BnaC01g06010D [Brassica napus]
Length=670

 Score =   516 bits (1328),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 251/369 (68%), Positives = 294/369 (80%), Gaps = 6/369 (2%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQ QW Y NGLLAVIFSFG+L T+L+SR ARSW YG  + R F  DYG  LM+VLW+A+S
Sbjct  192   YQSQWRYTNGLLAVIFSFGLLYTALKSRRARSWRYGFRWMRGFTGDYGTLLMLVLWSALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             +TVP+++P  VPRRL  PLPW+  S+YHWTV+KDMGKVPP YILA FIPA MIAGLYFFD
Sbjct  252   FTVPRDIPEGVPRRLELPLPWDSESLYHWTVVKDMGKVPPLYILAAFIPAIMIAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  312   HCVSAQMAQQKEFNLKNPSAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMK-  717
             K Q MRK+M+  AKE MK +A+ SEIYG+M  V++EM +SP A    KEL NLK AVMK 
Sbjct  372   KRQQMRKKMVQKAKECMKAKASNSEIYGKMQDVFIEMETSPKATSVVKELENLKEAVMKA  431

Query  718   ----NDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
                  D K    D    I+ HLPV VNEQRVSNLLQSI VGL I AVP++RMIPTSVLWG
Sbjct  432   DGGGGDTKGKKFDPEVLIEDHLPVRVNEQRVSNLLQSILVGLLIFAVPLLRMIPTSVLWG  491

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YF YMA DSLPGNQFWER++LLF+ P RRFKVLEG+HA+++E VP+K I  FT+FQ +Y 
Sbjct  492   YFTYMAVDSLPGNQFWERLLLLFITPGRRFKVLEGLHASFMEIVPYKSIVMFTLFQLLYF  551

Query  1066  LVCFGVTWI  1092
             L+C+GVTWI
Sbjct  552   LICYGVTWI  560



>ref|XP_009348427.1| PREDICTED: boron transporter 4-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009348428.1| PREDICTED: boron transporter 4-like isoform X1 [Pyrus x bretschneideri]
Length=674

 Score =   516 bits (1328),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 311/368 (85%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFSFG+L T+L+SR+ARSW Y TG+FRSFIADYGVPLMV++WTA+S
Sbjct  192   YQFQWLYTNGLLGVIFSFGLLYTALKSRKARSWWYATGWFRSFIADYGVPLMVLVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             ++VP  +P  VPRRL  P+ W+ +S++HWTVIKDMGKV P YI A  IPA M+AGLYFFD
Sbjct  252   FSVPHNIPPRVPRRLYSPVAWDSSSLHHWTVIKDMGKVSPGYIFAAVIPAVMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ +EFNLKKPSAYHYDIL+LG MTL+CGLLGLPPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQMAQQQEFNLKKPSAYHYDILLLGFMTLLCGLLGLPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD-KELNNLKVAVMKN  720
             K QL+R++M+ SAKE +K +A+ SEIYG+M AV++EM +   P ++ KELN LK AVMK+
Sbjct  372   KKQLIRRKMVKSAKESIKQKASNSEIYGKMQAVFIEMDNLTTPTSEVKELNELKEAVMKS  431

Query  721   DEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             + K+ +     D  K IDA+LPV VNEQR+SNLLQS+ V  S+ A+PVI+ IPTSVLWGY
Sbjct  432   ENKEDDAKNAFDPEKHIDAYLPVRVNEQRLSNLLQSLLVAASVFAMPVIKKIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P+R++KVLEG HA++VESVPFK+IA FT+F+FVY L
Sbjct  492   FAYMAIDSLPGNQFWERMLLLFISPSRQYKVLEGGHASFVESVPFKFIAIFTLFKFVYFL  551

Query  1069  VCFGVTWI  1092
             VCFG+TWI
Sbjct  552   VCFGITWI  559



>ref|XP_004968395.1| PREDICTED: boron transporter 4-like isoform X4 [Setaria italica]
Length=611

 Score =   513 bits (1321),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 295/368 (80%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFS G+L T+LR+R ARSW YG G+ RSFIADYGVPLMV++WTA+S
Sbjct  192   YQFQWLYVNGLLGVIFSIGLLFTALRTRRARSWLYGVGWLRSFIADYGVPLMVIVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YT+P +VPS VPRRL  PLPWE +S+ HWT++KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  252   YTLPSKVPSGVPRRLFSPLPWESSSLGHWTIVKDLFSVPPAYIFAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ  E+NLKKPSAYHYDIL+LG+M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQNEYNLKKPSAYHYDILVLGIMVLLCGLIGIPPSNGVLPQSPMHTRSLAIL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+ K+M+ +AKE +   AT  EIYG+M  V++EM S       DKEL N K AV++ 
Sbjct  372   KRQLLSKKMVDTAKESIGKSATSLEIYGKMQEVFIEMDSEQNTDSVDKELKNFKDAVLQE  431

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +++G L    D  K I+AHLPV VNEQR+SNLLQSI VG  + A+PVIRMIPTSVLWGY
Sbjct  432   GDEEGKLAGEFDPRKHIEAHLPVRVNEQRLSNLLQSILVGGCVGAMPVIRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER+ LLF+  +R +KVLEG HA++VESVP + I  FT+FQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWERMQLLFIAESRHYKVLEGPHASFVESVPPRTITIFTVFQLVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>gb|AAG51913.1|AC013258_7 putative anion exchanger; 94836-91832 [Arabidopsis thaliana]
Length=668

 Score =   515 bits (1326),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 296/374 (79%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF+WLY NGLL +IF+ G++ T+L+SR+ARSWPYGTG  RSF+ADYGVPLMVV+WTA+
Sbjct  181   KYQFEWLYTNGLLGLIFTVGLVYTALKSRKARSWPYGTGCCRSFVADYGVPLMVVVWTAL  240

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRLV PLPW+  S+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  241   SFSTPSKLPSGVPRRLVSPLPWDSVSLTHWTVIKDMGKVSPGYIFAAFIPALMIAGLYFF  300

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSV SQ+AQ KEFNLK PSAYHYDIL+LG M LICG+LGLPPSNGVLPQ+PMHTKSLA 
Sbjct  301   DHSVVSQLAQQKEFNLKNPSAYHYDILLLGFMVLICGMLGLPPSNGVLPQSPMHTKSLAV  360

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD----KELNNLKVA  708
              K QLMR++M+ +AKE ++ +AT S++Y  M  V++EM  SP          EL +LK A
Sbjct  361   FKRQLMRRKMVMTAKESIRQKATSSQVYEDMEQVFIEMDKSPLAETHTTLINELQDLKEA  420

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK  + DG+       D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+PVI++IPT
Sbjct  421   VMKKSDDDGDTGEESGFDPEKHVDAYLPVRVNEQRVSNLLQSLLVIGAVFALPVIKLIPT  480

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLP NQF+ER VLLFVPP RRFKVLEG HA++VE VP K IA FT+F
Sbjct  481   SLLWGYFAYMAIDSLPDNQFFERTVLLFVPPTRRFKVLEGAHASFVEKVPHKSIAAFTLF  540

Query  1051  QFVYLLVCFGVTWI  1092
             Q +Y  +C+GVTWI
Sbjct  541   QILYFGLCYGVTWI  554



>ref|XP_007216756.1| hypothetical protein PRUPE_ppa024840mg, partial [Prunus persica]
 gb|EMJ17955.1| hypothetical protein PRUPE_ppa024840mg, partial [Prunus persica]
Length=655

 Score =   514 bits (1324),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 308/368 (84%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QF WLY NGLL VIF+FG+L T+L+SR+ARSW Y TG FRSFIADYGVPLMV+LWTA+S
Sbjct  192   HQFPWLYTNGLLGVIFTFGLLYTALKSRKARSWWYATGRFRSFIADYGVPLMVLLWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             ++VP+ VPS +PRRL  PL WE AS++HWTV+KDMGKVPP Y+ A  IPA M+AGLYFFD
Sbjct  252   FSVPRNVPSDIPRRLYSPLAWESASLHHWTVMKDMGKVPPAYVFAAIIPAVMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ +EFNLKKPSAYHYD+L+LG+MTL+CGL+GLPPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQLAQQQEFNLKKPSAYHYDMLLLGLMTLLCGLIGLPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD-KELNNLKVAVMKN  720
             K QL+RK+M+ SAKE +K +A+ SEIYG+M AV++EM +S  P +  KEL +LK AVMK+
Sbjct  372   KRQLIRKKMVKSAKESIKQKASNSEIYGKMQAVFIEMDNSTTPTSQVKELEDLKEAVMKS  431

Query  721   DEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             + K  N     D  K ID +LPV V EQRVSNLLQS+ V  S+ ++P I+ IP SVLWGY
Sbjct  432   ENKGDNAKDAFDPEKHIDDYLPVRVKEQRVSNLLQSLLVAASVFSMPAIKKIPKSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P+RR+KVLEG HA++VESVPFKYIA FT+FQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWERLLLLFITPSRRYKVLEGGHASFVESVPFKYIAIFTLFQLVYLL  551

Query  1069  VCFGVTWI  1092
             VCFGVTWI
Sbjct  552   VCFGVTWI  559



>emb|CDY37274.1| BnaCnng08280D [Brassica napus]
Length=683

 Score =   515 bits (1327),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 242/374 (65%), Positives = 301/374 (80%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IF+FG+L T+L+SR+ARSW YGTG++R+FIADYGVPLMVV+WTA+
Sbjct  196   KYQFQWLYTNGLLGLIFTFGLLYTALKSRKARSWRYGTGWYRNFIADYGVPLMVVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P  +PS VPRRL  PLPW+ AS+ HWTVIKDMGKVPP YI AGFIPA MIAGLYFF
Sbjct  256   SFSTPSTLPSGVPRRLSSPLPWDSASLGHWTVIKDMGKVPPAYIFAGFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSV +Q+AQ KEFNLK PSAYHYD+L+LG M L+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVVAQLAQQKEFNLKNPSAYHYDVLLLGFMVLVCGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE M+ +A+ S++Y  M  V++EM  SP    +     EL +LK A
Sbjct  376   LKRQLIRRKMVMTAKESMRKRASSSQVYENMQEVFIEMDKSPLVQTNSTHIMELQDLKDA  435

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK  +++G+       D  K ++A LPV VNEQRVSNLLQS+ V  ++ A+P I++IPT
Sbjct  436   VMKKTDEEGDSSEEGGFDPEKHLEAFLPVRVNEQRVSNLLQSLLVAGAVLAIPAIKLIPT  495

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLPGNQF+ER VLLFVPP+RRFKVLEG HA++VE VP+K +A FT+ 
Sbjct  496   SLLWGYFAYMAIDSLPGNQFFERTVLLFVPPSRRFKVLEGAHASFVEKVPYKSMAAFTML  555

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  556   QIFYFGLCYGVTWI  569



>ref|XP_004968392.1| PREDICTED: boron transporter 4-like isoform X1 [Setaria italica]
Length=673

 Score =   514 bits (1325),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 295/368 (80%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFS G+L T+LR+R ARSW YG G+ RSFIADYGVPLMV++WTA+S
Sbjct  192   YQFQWLYVNGLLGVIFSIGLLFTALRTRRARSWLYGVGWLRSFIADYGVPLMVIVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YT+P +VPS VPRRL  PLPWE +S+ HWT++KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  252   YTLPSKVPSGVPRRLFSPLPWESSSLGHWTIVKDLFSVPPAYIFAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ  E+NLKKPSAYHYDIL+LG+M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQNEYNLKKPSAYHYDILVLGIMVLLCGLIGIPPSNGVLPQSPMHTRSLAIL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+ K+M+ +AKE +   AT  EIYG+M  V++EM S       DKEL N K AV++ 
Sbjct  372   KRQLLSKKMVDTAKESIGKSATSLEIYGKMQEVFIEMDSEQNTDSVDKELKNFKDAVLQE  431

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +++G L    D  K I+AHLPV VNEQR+SNLLQSI VG  + A+PVIRMIPTSVLWGY
Sbjct  432   GDEEGKLAGEFDPRKHIEAHLPVRVNEQRLSNLLQSILVGGCVGAMPVIRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER+ LLF+  +R +KVLEG HA++VESVP + I  FT+FQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWERMQLLFIAESRHYKVLEGPHASFVESVPPRTITIFTVFQLVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>ref|XP_004968393.1| PREDICTED: boron transporter 4-like isoform X2 [Setaria italica]
Length=663

 Score =   514 bits (1324),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 295/368 (80%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFS G+L T+LR+R ARSW YG G+ RSFIADYGVPLMV++WTA+S
Sbjct  192   YQFQWLYVNGLLGVIFSIGLLFTALRTRRARSWLYGVGWLRSFIADYGVPLMVIVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YT+P +VPS VPRRL  PLPWE +S+ HWT++KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  252   YTLPSKVPSGVPRRLFSPLPWESSSLGHWTIVKDLFSVPPAYIFAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ  E+NLKKPSAYHYDIL+LG+M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQNEYNLKKPSAYHYDILVLGIMVLLCGLIGIPPSNGVLPQSPMHTRSLAIL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+ K+M+ +AKE +   AT  EIYG+M  V++EM S       DKEL N K AV++ 
Sbjct  372   KRQLLSKKMVDTAKESIGKSATSLEIYGKMQEVFIEMDSEQNTDSVDKELKNFKDAVLQE  431

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +++G L    D  K I+AHLPV VNEQR+SNLLQSI VG  + A+PVIRMIPTSVLWGY
Sbjct  432   GDEEGKLAGEFDPRKHIEAHLPVRVNEQRLSNLLQSILVGGCVGAMPVIRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER+ LLF+  +R +KVLEG HA++VESVP + I  FT+FQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWERMQLLFIAESRHYKVLEGPHASFVESVPPRTITIFTVFQLVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>ref|XP_008792104.1| PREDICTED: boron transporter 4-like isoform X2 [Phoenix dactylifera]
Length=639

 Score =   513 bits (1322),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 297/369 (80%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
              YQFQWLY NGLL +IF+ G+L T+L+SR AR W YGTG+FRSFIADYGVPLMV++WTA+
Sbjct  161   RYQFQWLYINGLLGIIFAIGLLYTALKSRRARGWRYGTGWFRSFIADYGVPLMVLVWTAL  220

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP +VPS VPRRL  PLPWE  S++HWTV KDM  VP  YI A  IPA M+AGLYFF
Sbjct  221   SFAVPSKVPSGVPRRLFSPLPWESNSLHHWTVAKDMLSVPAVYIFAAIIPAFMVAGLYFF  280

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDI +LG M LICGLLG+PPSNGVLPQ+PMHTKSLA 
Sbjct  281   DHSVASQMAQQKEFNLKNPSAYHYDIFVLGFMVLICGLLGIPPSNGVLPQSPMHTKSLAV  340

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPV-ADKELNNLKVAVMK  717
             LK QL+RK+M+ SAKE +K +A+  EIYG+M  V++EM      + A +EL +LK AVM+
Sbjct  341   LKKQLIRKKMVQSAKESIKRRASNLEIYGKMQDVFIEMDDGHTTISAARELQDLKDAVMR  400

Query  718   NDEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             N+  +G L    D  + IDAHLPV VNEQR+SNLLQSI VG  + A+P+I+ IPTSVLWG
Sbjct  401   NEPGEGELKDRFDPERHIDAHLPVRVNEQRLSNLLQSILVGACLGAMPIIKKIPTSVLWG  460

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWERI+LLF+ P RR+KVLEG+HA++VESVPF+ IA FT+ Q  YL
Sbjct  461   YFAYMAIDSLPGNQFWERILLLFITPGRRYKVLEGVHASFVESVPFRQIAIFTLLQLAYL  520

Query  1066  LVCFGVTWI  1092
             L+CFGVTWI
Sbjct  521   LLCFGVTWI  529



>gb|ABS83564.1| boron transporter [Hordeum vulgare subsp. vulgare]
Length=666

 Score =   514 bits (1324),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 296/368 (80%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW+Y NGLL VIFS G+L ++L++R ARSW YG G+ RSFIADYGVPLMV++WTA S
Sbjct  195   YQFQWIYVNGLLGVIFSIGLLYSALKTRRARSWLYGIGWLRSFIADYGVPLMVIVWTAFS  254

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y +P  VPS VPRRL  PLPWE +S+ HWTV KD+  VPP YI A  +PA+M+AGLYFFD
Sbjct  255   YALPSGVPSGVPRRLFSPLPWESSSLGHWTVAKDLFSVPPAYIFAAIVPASMVAGLYFFD  314

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ +EFNLKKPSAYHYDIL+LG M L+CGL+G+PP+NGVLPQ+PMHT+SLA L
Sbjct  315   HSVASQLAQQQEFNLKKPSAYHYDILVLGFMVLLCGLIGIPPANGVLPQSPMHTRSLAVL  374

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-SPAPVADKELNNLKVAVMKN  720
             K QLMRKRM+ +AKEGM  +A+  EIYG+MH V++EM +   A   DK+L +LK AV++ 
Sbjct  375   KGQLMRKRMLRTAKEGMSNRASSLEIYGKMHEVFIEMDNKQDADSVDKDLKSLKDAVLRE  434

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              ++DG L    D  K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  435   GDEDGKLAGEFDPRKHIEAHLPVRVNEQRLSNLLQSLLVGGCVGAMPVIKMIPTSVLWGY  494

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI LLFV  +RR+KVLEG HA++VESV  + I  FTIFQ VY L
Sbjct  495   FAYMAIDSLPGNQFWERIQLLFVGASRRYKVLEGPHASFVESVSSRTIYVFTIFQIVYFL  554

Query  1069  VCFGVTWI  1092
             +CFG TWI
Sbjct  555   ICFGTTWI  562



>ref|XP_006300811.1| hypothetical protein CARUB_v10019898mg [Capsella rubella]
 ref|XP_006300812.1| hypothetical protein CARUB_v10019898mg [Capsella rubella]
 gb|EOA33709.1| hypothetical protein CARUB_v10019898mg [Capsella rubella]
 gb|EOA33710.1| hypothetical protein CARUB_v10019898mg [Capsella rubella]
Length=684

 Score =   514 bits (1325),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 243/374 (65%), Positives = 300/374 (80%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF+WLY NGLL +IF+ G++ T+L+SR+ARSW YGTG+FRSFIADYGVPLMVV+WTA+
Sbjct  197   KYQFEWLYTNGLLGLIFTVGLVYTALKSRKARSWRYGTGWFRSFIADYGVPLMVVVWTAL  256

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRLV PLPW+  S+ HWTVIKDMGKV P YI A F+PA MIAGLYFF
Sbjct  257   SFSTPSKLPSGVPRRLVSPLPWDSVSLTHWTVIKDMGKVSPGYIFAAFVPALMIAGLYFF  316

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSV SQ+AQ KEFNLK PSAYHYDIL+LG M LICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  317   DHSVVSQLAQQKEFNLKNPSAYHYDILLLGFMVLICGLLGLPPSNGVLPQSPMHTKSLAV  376

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD----KELNNLKVA  708
             L+ QLMR++M+ +AKE ++ +AT S++Y  M  V++EM  SP    +     EL +LK A
Sbjct  377   LRRQLMRRKMVMTAKESIRQRATSSQVYEDMQQVFIEMDKSPLAETNTILVNELQDLKEA  436

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             +MK +E  G+       D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+P I++IPT
Sbjct  437   MMKKNEDGGDSSDESGFDPEKHLDAYLPVRVNEQRVSNLLQSLLVIGAVFAIPAIKLIPT  496

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLP NQF+ER VLLFVPP+RRFKVLEG HA++VE+VP+K IA FT+F
Sbjct  497   SLLWGYFAYMAIDSLPDNQFFERTVLLFVPPSRRFKVLEGAHASFVETVPYKSIAAFTMF  556

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  557   QIFYFGLCYGVTWI  570



>emb|CDY68117.1| BnaA02g35930D [Brassica napus]
Length=683

 Score =   514 bits (1325),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 242/374 (65%), Positives = 301/374 (80%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IF+FG+L T+L+SR+ARSW YGTG++R+FIADYGVPLMVV+WTA+
Sbjct  196   KYQFQWLYTNGLLGLIFTFGLLYTALKSRKARSWRYGTGWYRNFIADYGVPLMVVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P  +PS VPRRL  PLPW+ AS+ HWTVIKDMGKVPP YI AGFIPA MIAGLYFF
Sbjct  256   SFSTPSTLPSGVPRRLSSPLPWDSASLGHWTVIKDMGKVPPPYIFAGFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSV +Q+AQ KEFNLK PSAYHYD+L+LG M L+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVVAQLAQQKEFNLKNPSAYHYDVLLLGFMVLVCGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE M+ +A+ S++Y  M  V++EM  SP    +     EL +LK A
Sbjct  376   LKRQLIRRKMVMTAKESMRKRASSSQVYENMQEVFIEMDKSPLVQTNSTHILELQDLKDA  435

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK  +++G+       D  K ++A LPV VNEQRVSNLLQS+ V  ++ A+P I++IPT
Sbjct  436   VMKKTDEEGDSSEEGGFDPEKHLEAFLPVRVNEQRVSNLLQSLLVAGAVLAIPAIKLIPT  495

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLPGNQF+ER VLLFVPP+RRFKVLEG HA++VE VP+K +A FT+ 
Sbjct  496   SLLWGYFAYMAIDSLPGNQFFERTVLLFVPPSRRFKVLEGAHASFVEKVPYKSMAAFTML  555

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  556   QIFYFGLCYGVTWI  569



>ref|XP_009128063.1| PREDICTED: boron transporter 4 [Brassica rapa]
 ref|XP_009128064.1| PREDICTED: boron transporter 4 [Brassica rapa]
 ref|XP_009128065.1| PREDICTED: boron transporter 4 [Brassica rapa]
Length=683

 Score =   514 bits (1325),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 242/374 (65%), Positives = 301/374 (80%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IF+FG+L T+L+SR+ARSW YGTG++R+FIADYGVPLMVV+WTA+
Sbjct  196   KYQFQWLYTNGLLGLIFTFGLLYTALKSRKARSWRYGTGWYRNFIADYGVPLMVVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P  +PS VPRRL  PLPW+ AS+ HWTVIKDMGKVPP YI AGFIPA MIAGLYFF
Sbjct  256   SFSTPSTLPSGVPRRLSSPLPWDSASLGHWTVIKDMGKVPPPYIFAGFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSV +Q+AQ KEFNLK PSAYHYD+L+LG M L+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVVAQLAQQKEFNLKNPSAYHYDVLLLGFMVLVCGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE M+ +A+ S++Y  M  V++EM  SP    +     EL +LK A
Sbjct  376   LKRQLIRRKMVMTAKESMRKRASSSQVYENMQEVFIEMDKSPLVQTNSTHILELQDLKDA  435

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK  +++G+       D  K ++A LPV VNEQRVSNLLQS+ V  ++ A+P I++IPT
Sbjct  436   VMKKTDEEGDSSEEGGFDPEKHLEAFLPVRVNEQRVSNLLQSLLVAGAVLAIPAIKLIPT  495

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLPGNQF+ER VLLFVPP+RRFKVLEG HA++VE VP+K +A FT+ 
Sbjct  496   SLLWGYFAYMAIDSLPGNQFFERTVLLFVPPSRRFKVLEGAHASFVEKVPYKSMAAFTML  555

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  556   QIFYFGLCYGVTWI  569



>ref|XP_010691211.1| PREDICTED: boron transporter 4-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010691212.1| PREDICTED: boron transporter 4-like [Beta vulgaris subsp. vulgaris]
Length=657

 Score =   513 bits (1322),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 298/368 (81%), Gaps = 4/368 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++QFQW YANGLL V+F+FGV + SL+S  ARSW YGTG  R FIADYGVPLMVVLWT +
Sbjct  188   KFQFQWRYANGLLGVVFTFGVFIMSLKSPRARSWRYGTGRMRGFIADYGVPLMVVLWTIL  247

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP  +P  VPRRL  PLPWE  S+YHWTV+KDM KVP  YI A  IPA M+AGLYFF
Sbjct  248   SFSVPSGIPKGVPRRLYSPLPWESESVYHWTVVKDMFKVPVAYIFAAIIPALMVAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLKKPSAYHYDIL+LG  TL+CG++GLPPSNGVLPQ+PMHTKSLA 
Sbjct  308   DHSVASQLAQQKEFNLKKPSAYHYDILVLGFTTLLCGIIGLPPSNGVLPQSPMHTKSLAV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP-VADKELNNLKVAVMK  717
             LK QLM K+M+ SAK+ ++  AT +EIYG+M  V+++M  +P P    +EL +LK AVMK
Sbjct  368   LKRQLMGKKMVQSAKDSIRQNATSNEIYGQMQDVFIQMDQNPDPHEVVRELEDLKQAVMK  427

Query  718   NDEKDG---NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              D K+G   N    + I+ +LPV VNEQRVSNLLQS+ VG ++ A+PVI+++PTSVLWGY
Sbjct  428   GDSKEGKDNNTFKLEHINNYLPVRVNEQRVSNLLQSVLVGAAMFAMPVIKLVPTSVLWGY  487

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPG+QFWERI+LLF+ P+RR+KVLE  HA++VESVPFK IA FT+FQ VYLL
Sbjct  488   FAYMAIDSLPGSQFWERILLLFITPSRRYKVLEEPHASFVESVPFKSIAAFTLFQIVYLL  547

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  548   ICFGITWI  555



>gb|ABX26206.1| boron transporter 2 [Triticum aestivum]
Length=666

 Score =   514 bits (1323),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 300/368 (82%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW+Y NGLL VIFS G+L T+L++R ARSW YG G+ RSFIADYGVPLMV++WTA S
Sbjct  195   YQFQWIYVNGLLGVIFSIGLLYTALKTRRARSWLYGIGWLRSFIADYGVPLMVIVWTAFS  254

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             +T+P +VPS VPRRL  PLPWE  S+ HWTV KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  255   FTLPSKVPSGVPRRLFSPLPWESISLRHWTVAKDLFSVPPTYIFAAIVPALMVAGLYFFD  314

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPSAYHYDIL+LG M L+CGLLG+PPSNGVLPQ+PMHT+SLA L
Sbjct  315   HSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLLGIPPSNGVLPQSPMHTRSLAVL  374

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+RK+M+ +AKEGM  +A+  EIYG+M  V+++M S+  A   DK+L +LK AV+  
Sbjct  375   KGQLLRKKMLQTAKEGMSNRASSLEIYGKMQEVFIQMDSNQNANSVDKDLKSLKDAVLWE  434

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +++G L    D +K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  435   GDEEGKLAGEFDPSKYIEAHLPVRVNEQRLSNLLQSLLVGGCVGAMPVIKMIPTSVLWGY  494

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER+ LL +  +RR+KVLEG HA++VESVP + I+ FT+FQFVYLL
Sbjct  495   FAYMAIDSLPGNQFWERMQLLCIGASRRYKVLEGPHASFVESVPSRTISAFTVFQFVYLL  554

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  555   ICFGITWI  562



>emb|CDM81925.1| unnamed protein product [Triticum aestivum]
Length=666

 Score =   513 bits (1322),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 242/368 (66%), Positives = 300/368 (82%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW+Y NGLL VIFS G+L T+L++R ARSW YG G+ RSFIADYGVPLMV++WTA S
Sbjct  195   YQFQWIYVNGLLGVIFSIGLLYTALKTRRARSWLYGIGWLRSFIADYGVPLMVIVWTAFS  254

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             + +P +VPS VPRRL  PLPWE  S+ HWTV KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  255   FALPSKVPSGVPRRLFSPLPWESISLRHWTVAKDLFSVPPTYIFAAIVPALMVAGLYFFD  314

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPSAYHYDIL+LG M L+CGLLG+PPSNGVLPQ+PMHT+SLA L
Sbjct  315   HSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLLGIPPSNGVLPQSPMHTRSLAVL  374

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSS-PAPVADKELNNLKVAVMKN  720
             K QL+RK+M+ +AKEGM  +A+  EIYG+M  V+++M S+  A   DK+L +LK AV++ 
Sbjct  375   KGQLLRKKMLQTAKEGMSNRASSLEIYGKMQEVFIQMDSNMNANSVDKDLKSLKDAVLRE  434

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +++G L    D +K I+AHLPV VNEQR+SNLLQS+ VG  + A+PV++MIPTSVLWGY
Sbjct  435   GDEEGKLAGEFDPSKYIEAHLPVRVNEQRLSNLLQSLLVGGCVGAMPVLKMIPTSVLWGY  494

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER+ LL +  +RR+KVLEG HA++VESVP + I+ FT+FQFVYLL
Sbjct  495   FAYMAIDSLPGNQFWERLQLLCIGASRRYKVLEGPHASFVESVPSRTISAFTVFQFVYLL  554

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  555   ICFGITWI  562



>ref|NP_177619.2| boron transporter 5 [Arabidopsis thaliana]
 sp|Q9SSG5.1|BOR5_ARATH RecName: Full=Putative boron transporter 5 [Arabidopsis thaliana]
 gb|AAD55295.1|AC008263_26 Is a member of the PF|00955 Anion exchanger family [Arabidopsis 
thaliana]
 gb|AEE35634.1| boron transporter 5 [Arabidopsis thaliana]
Length=683

 Score =   514 bits (1323),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 296/374 (79%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF+WLY NGLL +IF+ G++ T+L+SR+ARSWPYGTG  RSF+ADYGVPLMVV+WTA+
Sbjct  196   KYQFEWLYTNGLLGLIFTVGLVYTALKSRKARSWPYGTGCCRSFVADYGVPLMVVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRLV PLPW+  S+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  256   SFSTPSKLPSGVPRRLVSPLPWDSVSLTHWTVIKDMGKVSPGYIFAAFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSV SQ+AQ KEFNLK PSAYHYDIL+LG M LICG+LGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVVSQLAQQKEFNLKNPSAYHYDILLLGFMVLICGMLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD----KELNNLKVA  708
              K QLMR++M+ +AKE ++ +AT S++Y  M  V++EM  SP          EL +LK A
Sbjct  376   FKRQLMRRKMVMTAKESIRQKATSSQVYEDMEQVFIEMDKSPLAETHTTLINELQDLKEA  435

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK  + DG+       D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+PVI++IPT
Sbjct  436   VMKKSDDDGDTGEESGFDPEKHVDAYLPVRVNEQRVSNLLQSLLVIGAVFALPVIKLIPT  495

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLP NQF+ER VLLFVPP RRFKVLEG HA++VE VP K IA FT+F
Sbjct  496   SLLWGYFAYMAIDSLPDNQFFERTVLLFVPPTRRFKVLEGAHASFVEKVPHKSIAAFTLF  555

Query  1051  QFVYLLVCFGVTWI  1092
             Q +Y  +C+GVTWI
Sbjct  556   QILYFGLCYGVTWI  569



>ref|XP_008228633.1| PREDICTED: boron transporter 4 [Prunus mume]
Length=665

 Score =   513 bits (1320),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 307/368 (83%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QF WLY NGLL VIF+FG+L T+L+SR+ARSW Y TG FRSFIADYGVPLMV+LWTA+S
Sbjct  192   HQFPWLYTNGLLGVIFTFGLLYTALKSRKARSWWYATGRFRSFIADYGVPLMVLLWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             ++VP+ VPS +PRRL  PL WE AS++HWTV+KDMGKVPP Y+ A  IPA M+AGLYFFD
Sbjct  252   FSVPRNVPSDIPRRLYSPLAWESASLHHWTVMKDMGKVPPAYVFAAIIPAVMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ +EFNLKKPSAYHYD+L+LG+MTL+CGL+GLPPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQLAQQQEFNLKKPSAYHYDMLLLGLMTLLCGLIGLPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD-KELNNLKVAVMKN  720
             K QL+RK+M+ SAKE +K +A+ SEIYG++ AV++EM +S  P +  KEL +LK AVMK+
Sbjct  372   KRQLIRKKMVKSAKESIKQKASNSEIYGKLQAVFIEMDNSTTPTSQVKELEDLKEAVMKS  431

Query  721   DEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             + K  N     D  K ID +LPV V EQRVSNLLQS+ V  S+ A+P I+ IP SVLWGY
Sbjct  432   ENKGDNAKDAFDPEKHIDDYLPVRVKEQRVSNLLQSLLVAASVFAMPAIKKIPKSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P+RR+KVLEG HA++VESVPFKYIA FT+FQ VY L
Sbjct  492   FAYMAIDSLPGNQFWERLLLLFITPSRRYKVLEGGHASFVESVPFKYIAIFTLFQLVYFL  551

Query  1069  VCFGVTWI  1092
             VCFGVTWI
Sbjct  552   VCFGVTWI  559



>ref|XP_008357258.1| PREDICTED: boron transporter 4-like isoform X1 [Malus domestica]
 ref|XP_008357259.1| PREDICTED: boron transporter 4-like isoform X1 [Malus domestica]
Length=674

 Score =   513 bits (1321),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 309/368 (84%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFSFG+L T+L+SR+ARSW Y TG+FRSFIADYGVPLMV++WTA+S
Sbjct  192   YQFQWLYTNGLLGVIFSFGLLCTALKSRKARSWWYATGWFRSFIADYGVPLMVLVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             ++VP  +P  VPRRL  P+ W+ +S++HWTVIKDMGKV P YI A  IPA M+AGLYFFD
Sbjct  252   FSVPHNIPPRVPRRLYSPVAWDSSSLHHWTVIKDMGKVSPGYIFAAIIPAVMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ +EFNLKKPSAYHYDIL+LG MTL+CGLLGLPPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQMAQQQEFNLKKPSAYHYDILLLGFMTLLCGLLGLPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD-KELNNLKVAVMKN  720
             K QL+R++M+ SAKE +K +A+ SEIY +M AV++EM +   P ++ KELN LK AVMK+
Sbjct  372   KKQLIRRKMVKSAKESIKQKASNSEIYRKMQAVFIEMDNLTTPTSEVKELNELKEAVMKS  431

Query  721   DEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             + K+ +     D  K IDA LPV VNEQR+SNLLQS+ V  S+ A+PVI+ IPTSVLWGY
Sbjct  432   ENKEDDAKSAFDPEKHIDACLPVRVNEQRLSNLLQSLLVAASVFAMPVIKKIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P+R++KVLEG HA++VESVPFK+IA FT+FQFVY L
Sbjct  492   FAYMAIDSLPGNQFWERMLLLFISPSRQYKVLEGGHASFVESVPFKFIAIFTLFQFVYFL  551

Query  1069  VCFGVTWI  1092
             VCFG+TWI
Sbjct  552   VCFGITWI  559



>ref|XP_008357260.1| PREDICTED: boron transporter 4-like isoform X2 [Malus domestica]
Length=665

 Score =   513 bits (1320),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 309/368 (84%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFSFG+L T+L+SR+ARSW Y TG+FRSFIADYGVPLMV++WTA+S
Sbjct  192   YQFQWLYTNGLLGVIFSFGLLCTALKSRKARSWWYATGWFRSFIADYGVPLMVLVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             ++VP  +P  VPRRL  P+ W+ +S++HWTVIKDMGKV P YI A  IPA M+AGLYFFD
Sbjct  252   FSVPHNIPPRVPRRLYSPVAWDSSSLHHWTVIKDMGKVSPGYIFAAIIPAVMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ +EFNLKKPSAYHYDIL+LG MTL+CGLLGLPPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQMAQQQEFNLKKPSAYHYDILLLGFMTLLCGLLGLPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD-KELNNLKVAVMKN  720
             K QL+R++M+ SAKE +K +A+ SEIY +M AV++EM +   P ++ KELN LK AVMK+
Sbjct  372   KKQLIRRKMVKSAKESIKQKASNSEIYRKMQAVFIEMDNLTTPTSEVKELNELKEAVMKS  431

Query  721   DEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             + K+ +     D  K IDA LPV VNEQR+SNLLQS+ V  S+ A+PVI+ IPTSVLWGY
Sbjct  432   ENKEDDAKSAFDPEKHIDACLPVRVNEQRLSNLLQSLLVAASVFAMPVIKKIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P+R++KVLEG HA++VESVPFK+IA FT+FQFVY L
Sbjct  492   FAYMAIDSLPGNQFWERMLLLFISPSRQYKVLEGGHASFVESVPFKFIAIFTLFQFVYFL  551

Query  1069  VCFGVTWI  1092
             VCFG+TWI
Sbjct  552   VCFGITWI  559



>ref|XP_008792103.1| PREDICTED: boron transporter 4-like isoform X1 [Phoenix dactylifera]
Length=669

 Score =   513 bits (1320),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 297/369 (80%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
              YQFQWLY NGLL +IF+ G+L T+L+SR AR W YGTG+FRSFIADYGVPLMV++WTA+
Sbjct  191   RYQFQWLYINGLLGIIFAIGLLYTALKSRRARGWRYGTGWFRSFIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP +VPS VPRRL  PLPWE  S++HWTV KDM  VP  YI A  IPA M+AGLYFF
Sbjct  251   SFAVPSKVPSGVPRRLFSPLPWESNSLHHWTVAKDMLSVPAVYIFAAIIPAFMVAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDI +LG M LICGLLG+PPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDIFVLGFMVLICGLLGIPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPV-ADKELNNLKVAVMK  717
             LK QL+RK+M+ SAKE +K +A+  EIYG+M  V++EM      + A +EL +LK AVM+
Sbjct  371   LKKQLIRKKMVQSAKESIKRRASNLEIYGKMQDVFIEMDDGHTTISAARELQDLKDAVMR  430

Query  718   NDEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             N+  +G L    D  + IDAHLPV VNEQR+SNLLQSI VG  + A+P+I+ IPTSVLWG
Sbjct  431   NEPGEGELKDRFDPERHIDAHLPVRVNEQRLSNLLQSILVGACLGAMPIIKKIPTSVLWG  490

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWERI+LLF+ P RR+KVLEG+HA++VESVPF+ IA FT+ Q  YL
Sbjct  491   YFAYMAIDSLPGNQFWERILLLFITPGRRYKVLEGVHASFVESVPFRQIAIFTLLQLAYL  550

Query  1066  LVCFGVTWI  1092
             L+CFGVTWI
Sbjct  551   LLCFGVTWI  559



>gb|ABS83562.1| boron transporter [Hordeum vulgare]
 gb|ABS83563.1| boron transporter [Hordeum vulgare]
 gb|ABX26122.1| putative boron transporter 2 [Hordeum vulgare]
Length=666

 Score =   513 bits (1320),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 295/368 (80%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW+Y NGLL VIFS G+L ++L++R ARSW YG G+ RSFIADYGVPLMV++WTA S
Sbjct  195   YQFQWIYVNGLLGVIFSIGLLYSALKTRRARSWLYGIGWLRSFIADYGVPLMVIVWTAFS  254

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y +P  VPS VPRRL  PLPWE +S+ HWTV KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  255   YALPSGVPSGVPRRLFSPLPWESSSLGHWTVAKDLFSVPPAYIFAAIVPALMVAGLYFFD  314

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ +EFNLKKPSAYHYDIL+LG M L+CGL+G+PP+NGVLPQ+PMHT+SLA L
Sbjct  315   HSVASQLAQQQEFNLKKPSAYHYDILVLGFMVLLCGLIGIPPANGVLPQSPMHTRSLAVL  374

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-SPAPVADKELNNLKVAVMKN  720
             K QLMRKRM+ +AKEGM  +A+  EIYG+MH V++EM +   A   DK+L +LK AV++ 
Sbjct  375   KGQLMRKRMLRTAKEGMSNRASSLEIYGKMHEVFIEMDNKQDADSVDKDLKSLKDAVLRE  434

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              ++DG L    D  K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  435   GDEDGKLAGEFDPRKHIEAHLPVRVNEQRLSNLLQSLLVGGCVGAMPVIKMIPTSVLWGY  494

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI LLFV  +RR+KVLEG HA++VESV  + I  FTIFQ VY L
Sbjct  495   FAYMAIDSLPGNQFWERIQLLFVGASRRYKVLEGPHASFVESVSSRTIYVFTIFQIVYFL  554

Query  1069  VCFGVTWI  1092
             +CFG TWI
Sbjct  555   ICFGTTWI  562



>gb|AES58965.2| boron transporter-like protein [Medicago truncatula]
Length=647

 Score =   512 bits (1318),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 244/367 (66%), Positives = 299/367 (81%), Gaps = 6/367 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             EY+F W Y NGLLA+IFSFG+L T++ SR AR W Y TG  R  IADYGVP+MVV WTA+
Sbjct  187   EYKFHWCYTNGLLAIIFSFGLLFTAMVSRSARKWRYLTGCIRGVIADYGVPIMVVCWTAL  246

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYT+P +VPS VPRRL+CPLPWEP S+YHWTV+KDMGK+P  YI   FIPA MIAGLYFF
Sbjct  247   SYTIPSKVPSGVPRRLLCPLPWEPESLYHWTVVKDMGKIPLPYIFGAFIPAVMIAGLYFF  306

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVAS+MAQ KEFNL+KPSAYHYD+ +LG+MTLICG+LGLPP NGVLPQ+PMHTKSLA 
Sbjct  307   DHSVASKMAQQKEFNLQKPSAYHYDVFLLGIMTLICGILGLPPVNGVLPQSPMHTKSLAT  366

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ QL+R++++ SAKE +K Q + SE+YG+M AV++EM ++P     KEL  LK AVMK 
Sbjct  367   LRRQLIRRKLVKSAKECIKQQGSNSELYGKMRAVFIEMDAAPTV---KELETLKEAVMKT  423

Query  721   DEKDGN---LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             +EK+G     D  K IDA+ PV VNEQR+SNLLQS+ + LS+ AVP+I+ IPTSVLWGYF
Sbjct  424   NEKNGTNEKFDPIKHIDAYFPVRVNEQRMSNLLQSLLIALSLLAVPIIKRIPTSVLWGYF  483

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI+LLF+ P R +K+LEG HA++VESVP+K IA FT+ QF+Y  +
Sbjct  484   AYMAIDSLPGNQFWERILLLFISPRRHYKILEGSHASFVESVPYKTIATFTVLQFLYFAI  543

Query  1072  CFGVTWI  1092
             C+G+TWI
Sbjct  544   CYGLTWI  550



>ref|XP_010459081.1| PREDICTED: boron transporter 4 isoform X3 [Camelina sativa]
Length=684

 Score =   513 bits (1320),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 297/374 (79%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y F+WLY NGLL +IF+FG+L T+L+SR+ARSW YG+G+ RSFIADYGVPLMVV+WTA+
Sbjct  196   KYHFEWLYTNGLLGIIFTFGLLYTALKSRKARSWRYGSGWIRSFIADYGVPLMVVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRL  PLPW+ AS+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  256   SFSTPSKLPSGVPRRLFSPLPWDSASLSHWTVIKDMGKVSPGYIFAAFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LGVMTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVASQLAQQKEFNLKNPSAYHYDILLLGVMTLICGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE ++ + T +++Y  M  V++EM  SP    D     EL +LK A
Sbjct  376   LKRQLIRRKMVKTAKESIRKRETSTQVYENMQEVFIEMDKSPLAQTDPTVIIELQDLKEA  435

Query  709   VMKNDE------KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK +E      +D   D  K +DA LPV VNEQRVSNLLQS+ V  ++ A+P I+ IPT
Sbjct  436   VMKCNEVEGERNEDSGFDPEKHLDACLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKRIPT  495

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLPGNQF+ER +LLFVP NRRFKVLEG HA++VE VP+K +A FT+ 
Sbjct  496   SLLWGYFAYMAIDSLPGNQFFERTMLLFVPTNRRFKVLEGAHASFVEKVPYKSMATFTLL  555

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  556   QMFYFGLCYGVTWI  569



>ref|XP_007150705.1| hypothetical protein PHAVU_005G174400g [Phaseolus vulgaris]
 gb|ESW22699.1| hypothetical protein PHAVU_005G174400g [Phaseolus vulgaris]
Length=673

 Score =   512 bits (1318),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 255/369 (69%), Positives = 303/369 (82%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y F WLYANGLL +IF+FG+L TSL+SR+ARSW YGTG+FRSF+ADYGVPLMVV+WTA+
Sbjct  191   KYHFHWLYANGLLGIIFTFGLLYTSLKSRKARSWLYGTGWFRSFVADYGVPLMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP +VPS VPRRL  PL W+  S++HWTVI DMGKV P YI A FIPA MIAGLYFF
Sbjct  251   SFIVPSKVPSGVPRRLTSPLVWDSTSLHHWTVINDMGKVSPSYIFAAFIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLKKPSAYHYDIL+LG+ TL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLKKPSAYHYDILLLGLTTLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
             LK QL+R++M+ SAKE +  +A+ SEIYG+M AV++EM + P   +  KEL +LK  V+ 
Sbjct  371   LKKQLIRRKMVKSAKESINQKASNSEIYGKMQAVFIEMDNCPDNHSVVKELEDLKEVVLN  430

Query  718   NDEK----DGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
              ++K      N D  K IDA+LPV V EQRVSNLLQSI +G SI  +PVI+ IPTSVLWG
Sbjct  431   GEDKGVDNKSNFDPEKHIDAYLPVRVKEQRVSNLLQSILIGASIFGMPVIKQIPTSVLWG  490

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWER++LLFV P+R +K+LEG HA++VESVP KYI  FTIFQFVY 
Sbjct  491   YFAYMAIDSLPGNQFWERLLLLFVRPSRWYKLLEGDHASFVESVPHKYIVAFTIFQFVYF  550

Query  1066  LVCFGVTWI  1092
             LVCFGVTWI
Sbjct  551   LVCFGVTWI  559



>ref|XP_011081148.1| PREDICTED: boron transporter 4-like isoform X3 [Sesamum indicum]
 ref|XP_011081154.1| PREDICTED: boron transporter 4-like isoform X3 [Sesamum indicum]
 ref|XP_011081161.1| PREDICTED: boron transporter 4-like isoform X3 [Sesamum indicum]
Length=674

 Score =   511 bits (1317),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 259/370 (70%), Positives = 307/370 (83%), Gaps = 6/370 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IFSFG+L T+L+SR AR+W YGTG+ RSFIADYGVPLMV++WTA+
Sbjct  191   KYQFQWLYTNGLLGIIFSFGLLYTALKSRRARAWRYGTGWIRSFIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP  VPS VPRRL  PLPWE  S+YHWTVIKDM KVPP YI A FIPA MIAGLYFF
Sbjct  251   SYGVPGRVPSGVPRRLFSPLPWESVSLYHWTVIKDMTKVPPVYIFAAFIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDI +LG+MTL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLKNPSAYHYDIFLLGIMTLLCGLLGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMK  717
             L+ Q +R++M+ +AKE +K +A+ SEIYG+M AV++E+  SP   +  KEL NLK AVMK
Sbjct  371   LRRQFIRRKMVKTAKESIKRKASTSEIYGQMQAVFIEIDKSPVTTLVVKELQNLKDAVMK  430

Query  718   NDE-----KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLW  882
              +      +    D  K IDA+LPV VNEQRVSNLLQS+ V  ++CAVP++++IPTSVLW
Sbjct  431   TENEGEKPEGATFDPEKYIDAYLPVRVNEQRVSNLLQSVLVAAAVCAVPLLKLIPTSVLW  490

Query  883   GYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVY  1062
             GYFAYMA DSLPGNQ WERI+ LFV P+RR+KVLEG HA++VE+VPFKYIA FTIFQF+Y
Sbjct  491   GYFAYMAIDSLPGNQLWERILFLFVAPSRRYKVLEGDHASFVETVPFKYIAAFTIFQFMY  550

Query  1063  LLVCFGVTWI  1092
             LL+CFGVTWI
Sbjct  551   LLLCFGVTWI  560



>ref|XP_010476636.1| PREDICTED: boron transporter 4-like [Camelina sativa]
Length=683

 Score =   512 bits (1318),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 297/374 (79%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y F+WLY NGLL +IF+FG+L T+L SR+ARSW YG+G+ RSFIADYGVPLMVV+WTA+
Sbjct  196   KYHFEWLYTNGLLGIIFTFGLLYTALTSRKARSWRYGSGWMRSFIADYGVPLMVVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRL  PLPW+ AS+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  256   SFSTPSKLPSGVPRRLFSPLPWDSASLSHWTVIKDMGKVSPGYIFAAFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LGVMTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVASQLAQQKEFNLKNPSAYHYDILLLGVMTLICGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE ++ + T S++Y  M  V++EM  SP    D     EL +LK A
Sbjct  376   LKRQLIRRKMVKTAKESIRKRETSSQVYENMQEVFIEMDKSPLAQTDPAVIIELQDLKEA  435

Query  709   VMKNDEKDGNL------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VM  +EK+G +      D  K +DA LPV VNEQRVSNLLQS+ V  ++ A+P I+ IPT
Sbjct  436   VMNCNEKEGEMNEDSGFDPEKHLDACLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKRIPT  495

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLPGNQF+ER +LLFVP +RRFKVLEG HA++VE VP+K +A FT+ 
Sbjct  496   SLLWGYFAYMAIDSLPGNQFFERTMLLFVPASRRFKVLEGAHASFVEKVPYKSMATFTLL  555

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  556   QMFYFGLCYGVTWI  569



>ref|XP_010459078.1| PREDICTED: boron transporter 4 isoform X1 [Camelina sativa]
 ref|XP_010459080.1| PREDICTED: boron transporter 4 isoform X2 [Camelina sativa]
Length=685

 Score =   512 bits (1318),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 244/375 (65%), Positives = 297/375 (79%), Gaps = 11/375 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y F+WLY NGLL +IF+FG+L T+L+SR+ARSW YG+G+ RSFIADYGVPLMVV+WTA+
Sbjct  196   KYHFEWLYTNGLLGIIFTFGLLYTALKSRKARSWRYGSGWIRSFIADYGVPLMVVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRL  PLPW+ AS+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  256   SFSTPSKLPSGVPRRLFSPLPWDSASLSHWTVIKDMGKVSPGYIFAAFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LGVMTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVASQLAQQKEFNLKNPSAYHYDILLLGVMTLICGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-----APVADKELNNLKV  705
             LK QL+R++M+ +AKE ++ + T +++Y  M  V++EM  SP      P    EL +LK 
Sbjct  376   LKRQLIRRKMVKTAKESIRKRETSTQVYENMQEVFIEMDKSPLQAQTDPTVIIELQDLKE  435

Query  706   AVMKNDE------KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIP  867
             AVMK +E      +D   D  K +DA LPV VNEQRVSNLLQS+ V  ++ A+P I+ IP
Sbjct  436   AVMKCNEVEGERNEDSGFDPEKHLDACLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKRIP  495

Query  868   TSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTI  1047
             TS+LWGYFAYMA DSLPGNQF+ER +LLFVP NRRFKVLEG HA++VE VP+K +A FT+
Sbjct  496   TSLLWGYFAYMAIDSLPGNQFFERTMLLFVPTNRRFKVLEGAHASFVEKVPYKSMATFTL  555

Query  1048  FQFVYLLVCFGVTWI  1092
              Q  Y  +C+GVTWI
Sbjct  556   LQMFYFGLCYGVTWI  570



>gb|EEC70033.1| hypothetical protein OsI_00611 [Oryza sativa Indica Group]
Length=731

 Score =   513 bits (1322),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 243/369 (66%), Positives = 295/369 (80%), Gaps = 6/369 (2%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             Y+FQWLY NGLL VIFS G+L T+LRSR ARSW YG G+ R FIADYGVPLMV++WTA+S
Sbjct  250   YRFQWLYVNGLLGVIFSIGLLYTALRSRRARSWVYGQGWLRGFIADYGVPLMVIVWTALS  309

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y +PK+VPS VPRRL  PLPWE +S++HWT+ KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  310   YALPKDVPSGVPRRLFSPLPWESSSLHHWTIAKDLFSVPPAYIFAAILPALMVAGLYFFD  369

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPSAYHYDIL+LG M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  370   HSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  429

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVM--  714
             K QL+RK+M+ +A EG+  +A+  EIYG+M  V++EM         DKEL +LK A++  
Sbjct  430   KGQLLRKKMVQTATEGLMNRASSLEIYGKMQGVFIEMDCEKNTDSVDKELKSLKDAMLHE  489

Query  715   ---KNDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
                K D+     D  K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWG
Sbjct  490   GFDKEDKLAEEFDPKKHIEAHLPVRVNEQRLSNLLQSLLVGACVGAMPVIKMIPTSVLWG  549

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWERI L+F+P +RR+KVLEG HA+++ESVP K I  FTIFQ VYL
Sbjct  550   YFAYMAIDSLPGNQFWERIRLMFIPSSRRYKVLEGPHASFMESVPSKTITVFTIFQLVYL  609

Query  1066  LVCFGVTWI  1092
             L+CFG+TWI
Sbjct  610   LICFGITWI  618



>ref|XP_011081141.1| PREDICTED: boron transporter 4-like isoform X2 [Sesamum indicum]
Length=682

 Score =   511 bits (1317),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 259/370 (70%), Positives = 307/370 (83%), Gaps = 6/370 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IFSFG+L T+L+SR AR+W YGTG+ RSFIADYGVPLMV++WTA+
Sbjct  202   KYQFQWLYTNGLLGIIFSFGLLYTALKSRRARAWRYGTGWIRSFIADYGVPLMVLVWTAL  261

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP  VPS VPRRL  PLPWE  S+YHWTVIKDM KVPP YI A FIPA MIAGLYFF
Sbjct  262   SYGVPGRVPSGVPRRLFSPLPWESVSLYHWTVIKDMTKVPPVYIFAAFIPALMIAGLYFF  321

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDI +LG+MTL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  322   DHSVASQLAQQKEFNLKNPSAYHYDIFLLGIMTLLCGLLGLPPSNGVLPQSPMHTKSLAV  381

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMK  717
             L+ Q +R++M+ +AKE +K +A+ SEIYG+M AV++E+  SP   +  KEL NLK AVMK
Sbjct  382   LRRQFIRRKMVKTAKESIKRKASTSEIYGQMQAVFIEIDKSPVTTLVVKELQNLKDAVMK  441

Query  718   NDE-----KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLW  882
              +      +    D  K IDA+LPV VNEQRVSNLLQS+ V  ++CAVP++++IPTSVLW
Sbjct  442   TENEGEKPEGATFDPEKYIDAYLPVRVNEQRVSNLLQSVLVAAAVCAVPLLKLIPTSVLW  501

Query  883   GYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVY  1062
             GYFAYMA DSLPGNQ WERI+ LFV P+RR+KVLEG HA++VE+VPFKYIA FTIFQF+Y
Sbjct  502   GYFAYMAIDSLPGNQLWERILFLFVAPSRRYKVLEGDHASFVETVPFKYIAAFTIFQFMY  561

Query  1063  LLVCFGVTWI  1092
             LL+CFGVTWI
Sbjct  562   LLLCFGVTWI  571



>ref|XP_010497166.1| PREDICTED: boron transporter 4-like isoform X2 [Camelina sativa]
 ref|XP_010497177.1| PREDICTED: boron transporter 4-like isoform X4 [Camelina sativa]
Length=683

 Score =   511 bits (1317),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 243/374 (65%), Positives = 298/374 (80%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F+WLY NGLL +IF+FG+L T+L+SR+ARSW YG+G+ RSF ADYGVPLMVV+WTA+
Sbjct  196   KYRFEWLYTNGLLGIIFTFGLLYTALKSRKARSWRYGSGWIRSFTADYGVPLMVVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRL  PLPW+ AS+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  256   SFSTPSKLPSGVPRRLFSPLPWDSASLSHWTVIKDMGKVSPGYIFAAFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LGVMTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVASQLAQQKEFNLKNPSAYHYDILLLGVMTLICGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE ++ + T +++Y  M  V++EM  SP    D     EL +LK A
Sbjct  376   LKRQLIRRKMVKTAKESIRKRETSTQVYENMQEVFIEMDKSPLAQTDPTVIIELQDLKEA  435

Query  709   VMKNDE------KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK +E      +D   D  K +DA LPV VNEQRVSNLLQS+ V  ++ A+P I+ IPT
Sbjct  436   VMKCNEVEGERNEDSGFDPEKHLDACLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKRIPT  495

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLPGNQF+ER +LLFVP +RRFKVLEG HA++VE VP+K +A FT+ 
Sbjct  496   SLLWGYFAYMAIDSLPGNQFFERTMLLFVPTSRRFKVLEGAHASFVEKVPYKSMATFTLL  555

Query  1051  QFVYLLVCFGVTWI  1092
             Q VY  +C+GVTWI
Sbjct  556   QIVYFGLCYGVTWI  569



>ref|XP_006643819.1| PREDICTED: boron transporter 4-like [Oryza brachyantha]
Length=670

 Score =   511 bits (1316),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 245/367 (67%), Positives = 297/367 (81%), Gaps = 5/367 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW+Y NGLL VIFS G+L T+LRSR ARSW YG G+ R FIADYGVPLMV++WTA S
Sbjct  192   YQFQWMYVNGLLGVIFSIGLLYTALRSRRARSWVYGQGWLRGFIADYGVPLMVIVWTAFS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YT+PK+VPS VPRRL  PLPWE +S++HWTV KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  252   YTLPKDVPSGVPRRLFSPLPWESSSLHHWTVAKDLFSVPPAYIFAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPS+YHYDIL+LG M L+CGLLG+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQKEFNLKKPSSYHYDILVLGFMVLLCGLLGIPPSNGVLPQSPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMKN  720
             K QL+ K+M+ +AKEG+  +A+  EIYG+M  V++EM       + DKEL +LK A+++ 
Sbjct  372   KGQLLCKKMVQTAKEGLMNRASSLEIYGKMQEVFIEMDCDKNTDSIDKELKSLKNAMLQE  431

Query  721   DEKDGNLDLAKD---IDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
              +K G L    D   I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+ IPTSVLWGYF
Sbjct  432   GDK-GKLAEELDPRHIEAHLPVRVNEQRLSNLLQSLLVGACVGAMPVIKTIPTSVLWGYF  490

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI L+F+P +RR+KVLEG HA+++ESVP K I  FTIFQFVYLL+
Sbjct  491   AYMAIDSLPGNQFWERIQLIFIPSSRRYKVLEGPHASFMESVPSKTITVFTIFQFVYLLI  550

Query  1072  CFGVTWI  1092
             CFG+TWI
Sbjct  551   CFGITWI  557



>ref|XP_011081134.1| PREDICTED: boron transporter 4-like isoform X1 [Sesamum indicum]
Length=685

 Score =   511 bits (1317),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 259/370 (70%), Positives = 307/370 (83%), Gaps = 6/370 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL +IFSFG+L T+L+SR AR+W YGTG+ RSFIADYGVPLMV++WTA+
Sbjct  202   KYQFQWLYTNGLLGIIFSFGLLYTALKSRRARAWRYGTGWIRSFIADYGVPLMVLVWTAL  261

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY VP  VPS VPRRL  PLPWE  S+YHWTVIKDM KVPP YI A FIPA MIAGLYFF
Sbjct  262   SYGVPGRVPSGVPRRLFSPLPWESVSLYHWTVIKDMTKVPPVYIFAAFIPALMIAGLYFF  321

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDI +LG+MTL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  322   DHSVASQLAQQKEFNLKNPSAYHYDIFLLGIMTLLCGLLGLPPSNGVLPQSPMHTKSLAV  381

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMK  717
             L+ Q +R++M+ +AKE +K +A+ SEIYG+M AV++E+  SP   +  KEL NLK AVMK
Sbjct  382   LRRQFIRRKMVKTAKESIKRKASTSEIYGQMQAVFIEIDKSPVTTLVVKELQNLKDAVMK  441

Query  718   NDE-----KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLW  882
              +      +    D  K IDA+LPV VNEQRVSNLLQS+ V  ++CAVP++++IPTSVLW
Sbjct  442   TENEGEKPEGATFDPEKYIDAYLPVRVNEQRVSNLLQSVLVAAAVCAVPLLKLIPTSVLW  501

Query  883   GYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVY  1062
             GYFAYMA DSLPGNQ WERI+ LFV P+RR+KVLEG HA++VE+VPFKYIA FTIFQF+Y
Sbjct  502   GYFAYMAIDSLPGNQLWERILFLFVAPSRRYKVLEGDHASFVETVPFKYIAAFTIFQFMY  561

Query  1063  LLVCFGVTWI  1092
             LL+CFGVTWI
Sbjct  562   LLLCFGVTWI  571



>ref|XP_010497173.1| PREDICTED: boron transporter 4-like isoform X3 [Camelina sativa]
Length=679

 Score =   511 bits (1315),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 243/375 (65%), Positives = 298/375 (79%), Gaps = 11/375 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F+WLY NGLL +IF+FG+L T+L+SR+ARSW YG+G+ RSF ADYGVPLMVV+WTA+
Sbjct  196   KYRFEWLYTNGLLGIIFTFGLLYTALKSRKARSWRYGSGWIRSFTADYGVPLMVVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRL  PLPW+ AS+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  256   SFSTPSKLPSGVPRRLFSPLPWDSASLSHWTVIKDMGKVSPGYIFAAFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LGVMTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVASQLAQQKEFNLKNPSAYHYDILLLGVMTLICGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-----APVADKELNNLKV  705
             LK QL+R++M+ +AKE ++ + T +++Y  M  V++EM  SP      P    EL +LK 
Sbjct  376   LKRQLIRRKMVKTAKESIRKRETSTQVYENMQEVFIEMDKSPLQAQTDPTVIIELQDLKE  435

Query  706   AVMKNDE------KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIP  867
             AVMK +E      +D   D  K +DA LPV VNEQRVSNLLQS+ V  ++ A+P I+ IP
Sbjct  436   AVMKCNEVEGERNEDSGFDPEKHLDACLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKRIP  495

Query  868   TSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTI  1047
             TS+LWGYFAYMA DSLPGNQF+ER +LLFVP +RRFKVLEG HA++VE VP+K +A FT+
Sbjct  496   TSLLWGYFAYMAIDSLPGNQFFERTMLLFVPTSRRFKVLEGAHASFVEKVPYKSMATFTL  555

Query  1048  FQFVYLLVCFGVTWI  1092
              Q VY  +C+GVTWI
Sbjct  556   LQIVYFGLCYGVTWI  570



>ref|XP_010497162.1| PREDICTED: boron transporter 4-like isoform X1 [Camelina sativa]
Length=684

 Score =   511 bits (1315),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 243/375 (65%), Positives = 298/375 (79%), Gaps = 11/375 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F+WLY NGLL +IF+FG+L T+L+SR+ARSW YG+G+ RSF ADYGVPLMVV+WTA+
Sbjct  196   KYRFEWLYTNGLLGIIFTFGLLYTALKSRKARSWRYGSGWIRSFTADYGVPLMVVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++ P ++PS VPRRL  PLPW+ AS+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  256   SFSTPSKLPSGVPRRLFSPLPWDSASLSHWTVIKDMGKVSPGYIFAAFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LGVMTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVASQLAQQKEFNLKNPSAYHYDILLLGVMTLICGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-----APVADKELNNLKV  705
             LK QL+R++M+ +AKE ++ + T +++Y  M  V++EM  SP      P    EL +LK 
Sbjct  376   LKRQLIRRKMVKTAKESIRKRETSTQVYENMQEVFIEMDKSPLQAQTDPTVIIELQDLKE  435

Query  706   AVMKNDE------KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIP  867
             AVMK +E      +D   D  K +DA LPV VNEQRVSNLLQS+ V  ++ A+P I+ IP
Sbjct  436   AVMKCNEVEGERNEDSGFDPEKHLDACLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKRIP  495

Query  868   TSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTI  1047
             TS+LWGYFAYMA DSLPGNQF+ER +LLFVP +RRFKVLEG HA++VE VP+K +A FT+
Sbjct  496   TSLLWGYFAYMAIDSLPGNQFFERTMLLFVPTSRRFKVLEGAHASFVEKVPYKSMATFTL  555

Query  1048  FQFVYLLVCFGVTWI  1092
              Q VY  +C+GVTWI
Sbjct  556   LQIVYFGLCYGVTWI  570



>ref|XP_003546177.1| PREDICTED: boron transporter 4-like isoform X1 [Glycine max]
 ref|XP_006597133.1| PREDICTED: boron transporter 4-like isoform X2 [Glycine max]
Length=669

 Score =   510 bits (1313),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 256/369 (69%), Positives = 304/369 (82%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF WLYANGLL +IF+FG+L TSL+SR ARSW YGTG+FRSFIADYGVP MVV+WTA+
Sbjct  191   KYQFHWLYANGLLGIIFTFGLLYTSLKSRRARSWLYGTGWFRSFIADYGVPFMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP +VPS VPRRL  PL WE  S++HWTVIKDMG+V   YI A FIPA MIAGLYFF
Sbjct  251   SFIVPSKVPSGVPRRLTSPLAWESTSLHHWTVIKDMGEVSLAYIFAAFIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+KPSAYHYDIL+LG+ TL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLRKPSAYHYDILLLGLTTLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP-VADKELNNLKVAVMK  717
             LK QL+R++M+ SAKE ++ +A+KSEIYG+M AV++EM S P   +  KEL +LK  V+ 
Sbjct  371   LKKQLIRRKMVKSAKESIRQKASKSEIYGKMQAVFIEMDSCPDNHLVVKELEDLKEVVLN  430

Query  718   NDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
              ++K  N     D  K IDA+LPV V EQRVSNLLQS+ VG S+ A+P I+ IPTSVLWG
Sbjct  431   GEDKGLNNKSTFDPEKHIDAYLPVRVKEQRVSNLLQSLLVGASVFAMPAIKKIPTSVLWG  490

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWERI+LLFV P+R +K+LEG HA++VESVP+KYI  FT+FQ VY 
Sbjct  491   YFAYMAIDSLPGNQFWERILLLFVTPSRWYKLLEGDHASFVESVPYKYIVFFTLFQCVYF  550

Query  1066  LVCFGVTWI  1092
             LVCFGVTWI
Sbjct  551   LVCFGVTWI  559



>gb|EMS45494.1| Boron transporter 4 [Triticum urartu]
Length=784

 Score =   514 bits (1323),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 242/368 (66%), Positives = 300/368 (82%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW+Y NGLL VIFS G+L T+L++R ARSW +G G+ RSFIADYGVPLMV++WTA S
Sbjct  271   YQFQWIYVNGLLGVIFSIGLLYTALKTRRARSWLFGIGWLRSFIADYGVPLMVIVWTAFS  330

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             + +P +VPS VPRRL  PLPWE  S+ HWTV KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  331   FALPSKVPSGVPRRLFSPLPWESISLRHWTVAKDLFSVPPTYIFAAIVPALMVAGLYFFD  390

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPSAYHYDIL+LG M L+CGLLG+PPSNGVLPQ+PMHT+SLA L
Sbjct  391   HSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLLGIPPSNGVLPQSPMHTRSLAVL  450

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSS-PAPVADKELNNLKVAVMKN  720
             K QL+RK+M+ +AKEGM  +A+  EIYG+M  V+++M S+  A   DK+L +LK AV++ 
Sbjct  451   KGQLLRKKMLQTAKEGMSNRASSLEIYGKMQEVFIQMDSNMNANSVDKDLKSLKDAVLRE  510

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +++G L    D +K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  511   GDEEGKLAGEFDPSKHIEAHLPVRVNEQRLSNLLQSLLVGGCVGAMPVIKMIPTSVLWGY  570

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER+ LL +  +RR+KVLEG HA++VESVP + I+ FT+FQFVYLL
Sbjct  571   FAYMAIDSLPGNQFWERLQLLCIGASRRYKVLEGPHASFVESVPSRTISAFTVFQFVYLL  630

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  631   ICFGITWI  638



>gb|KHN22473.1| Boron transporter 4 [Glycine soja]
Length=669

 Score =   510 bits (1313),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 256/369 (69%), Positives = 304/369 (82%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF WLYANGLL +IF+FG+L TSL+SR ARSW YGTG+FRSFIADYGVP MVV+WTA+
Sbjct  191   KYQFHWLYANGLLGIIFTFGLLYTSLKSRRARSWLYGTGWFRSFIADYGVPFMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP +VPS VPRRL  PL WE  S++HWTVIKDMG+V   YI A FIPA MIAGLYFF
Sbjct  251   SFIVPSKVPSGVPRRLTSPLAWESTSLHHWTVIKDMGEVSLAYIFAAFIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+KPSAYHYDIL+LG+ TL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLRKPSAYHYDILLLGLTTLLCGLIGLPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAP-VADKELNNLKVAVMK  717
             LK QL+R++M+ SAKE ++ +A+KSEIYG+M AV++EM S P   +  KEL +LK  V+ 
Sbjct  371   LKKQLIRRKMVKSAKESIRQKASKSEIYGKMQAVFIEMDSCPDNHLVVKELEDLKEVVLN  430

Query  718   NDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
              ++K  N     D  K IDA+LPV V EQRVSNLLQS+ VG S+ A+P I+ IPTSVLWG
Sbjct  431   GEDKGLNNKSTFDPEKHIDAYLPVRVKEQRVSNLLQSLLVGASVFAMPAIKKIPTSVLWG  490

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWERI+LLFV P+R +K+LEG HA++VESVP+KYI  FT+FQ VY 
Sbjct  491   YFAYMAIDSLPGNQFWERILLLFVTPSRWYKLLEGDHASFVESVPYKYIVFFTLFQCVYF  550

Query  1066  LVCFGVTWI  1092
             LVCFGVTWI
Sbjct  551   LVCFGVTWI  559



>dbj|BAJ87955.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=666

 Score =   509 bits (1312),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 294/368 (80%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW+Y NGLL VIFS G+L ++L++R ARSW YG G+ RSFIADYGVPLMV++WTA S
Sbjct  195   YQFQWIYVNGLLGVIFSIGLLYSALKTRRARSWLYGIGWHRSFIADYGVPLMVIVWTAFS  254

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y +P  VPS VPRRL  PLPWE +S+ HWTV KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  255   YALPSGVPSGVPRRLFSPLPWESSSLGHWTVAKDLFSVPPAYIFAAIVPALMVAGLYFFD  314

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ +EFNLKKPSAYHYDIL+LG M L+CGL+G+PP+NGVLPQ+PMHT+SLA L
Sbjct  315   HSVASQLAQQQEFNLKKPSAYHYDILVLGFMVLLCGLIGIPPANGVLPQSPMHTRSLAVL  374

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-SPAPVADKELNNLKVAVMKN  720
             K QLMRKRM+ +AKEGM  +A+  EIYG+MH V++EM +   A   DK+L +LK AV++ 
Sbjct  375   KGQLMRKRMLRTAKEGMSNRASSLEIYGKMHEVFIEMDNKQDADSVDKDLKSLKDAVLRE  434

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              ++DG L    D  K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  435   GDEDGKLAGEFDPRKHIEAHLPVRVNEQRLSNLLQSLLVGGCVGAMPVIKMIPTSVLWGY  494

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQ WERI LLFV  +RR+KVLEG HA++VESV  + I  FTIFQ VY L
Sbjct  495   FAYMAIDSLPGNQLWERIQLLFVGASRRYKVLEGPHASFVESVSSRMIYVFTIFQIVYFL  554

Query  1069  VCFGVTWI  1092
             +CFG TWI
Sbjct  555   ICFGTTWI  562



>ref|XP_009125922.1| PREDICTED: probable boron transporter 7 isoform X2 [Brassica 
rapa]
Length=671

 Score =   509 bits (1312),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 248/370 (67%), Positives = 291/370 (79%), Gaps = 7/370 (2%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQ  W Y NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A+S
Sbjct  192   YQSHWRYTNGLLAVIFSFGLLYTALKSRRARSWRYGFRWMRGFIGDYGTLLMLVLWSALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             +TVP+++P  VPRRL  PLPW+  S+YHWTV+KDMG VPP YILA FIPA MIAGLYFFD
Sbjct  252   FTVPRDIPEGVPRRLELPLPWDSESLYHWTVVKDMGNVPPLYILAAFIPAIMIAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  312   HCVSAQMAQQKEFNLKNPSAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVM--  714
             K Q MRK+M+  AKE MK +A+ SEIYG+M  V++EM +SP A    KEL NLK AVM  
Sbjct  372   KRQQMRKKMVQKAKECMKAKASNSEIYGKMQDVFIEMETSPKATSVVKELENLKEAVMKA  431

Query  715   ----KNDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLW  882
                   D K    D    I+ HLPV VNEQRVSNLLQSI VGL I  VP++RMIPTSVLW
Sbjct  432   DGGGGGDTKGKKFDPEVLIEDHLPVRVNEQRVSNLLQSILVGLLIFVVPLLRMIPTSVLW  491

Query  883   GYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVY  1062
             GYF YMA DSLPGNQFWER++LLF+ P RRFKVLEG+HA+++E VP+K I  FT+FQ +Y
Sbjct  492   GYFTYMAVDSLPGNQFWERLLLLFITPGRRFKVLEGLHASFMEIVPYKSIVMFTLFQLLY  551

Query  1063  LLVCFGVTWI  1092
              L+C+GVTWI
Sbjct  552   FLICYGVTWI  561



>ref|XP_006854912.1| hypothetical protein AMTR_s00052p00085150 [Amborella trichopoda]
 gb|ERN16379.1| hypothetical protein AMTR_s00052p00085150 [Amborella trichopoda]
Length=673

 Score =   509 bits (1312),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 256/365 (70%), Positives = 298/365 (82%), Gaps = 4/365 (1%)
 Frame = +1

Query  10    FQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSYT  189
             FQWLY NGLL +IFSFG+  T+L+SR ARSW YG G+ RSFIADYGVPLMVVLWTA+SY+
Sbjct  194   FQWLYMNGLLGIIFSFGLFFTALKSRRARSWRYGAGWMRSFIADYGVPLMVVLWTALSYS  253

Query  190   VPKEVPSSVPRRLVCPLPWEP-ASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDH  366
             VPK+VP  +PRRL  PLPW    +M +WT++KDMG VPP YI A FIPA MIAGLYFFDH
Sbjct  254   VPKKVPDDIPRRLDSPLPWSTTGAMSNWTIMKDMGLVPPLYIFAAFIPAMMIAGLYFFDH  313

Query  367   SVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELK  546
             SVASQMAQ KEFNLK PSAYHYDIL+LG+M L+CGLLGLPPSNGVLPQ+PMHTKSLA LK
Sbjct  314   SVASQMAQQKEFNLKNPSAYHYDILLLGIMVLLCGLLGLPPSNGVLPQSPMHTKSLAVLK  373

Query  547   TQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD-KELNNLKVAVMKND  723
              QL+R +M+ SAKE +K+QA+ SEIYG M AV+++M    + V+D KEL  LK AVM + 
Sbjct  374   RQLVRNKMVKSAKESIKLQASNSEIYGNMQAVFIKMDDKQSAVSDVKELKELKEAVMGSK  433

Query  724   EKDGN--LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAY  897
             E  G+   D  K IDA+LPV VNEQR+SNLLQS+ V   +  +PVIRMIPTSVLWGYFAY
Sbjct  434   EGGGDHVFDPEKHIDAYLPVQVNEQRLSNLLQSVLVACCLGGMPVIRMIPTSVLWGYFAY  493

Query  898   MATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCF  1077
             MA DSLPGNQFWER +LLF+ P RR+KVLEGIHA++VE VPFKYIAGFT+ Q VYLL CF
Sbjct  494   MAIDSLPGNQFWERFLLLFITPRRRYKVLEGIHASFVELVPFKYIAGFTLMQVVYLLTCF  553

Query  1078  GVTWI  1092
             G+TWI
Sbjct  554   GITWI  558



>ref|XP_009333648.1| PREDICTED: boron transporter 4-like [Pyrus x bretschneideri]
 ref|XP_009333649.1| PREDICTED: boron transporter 4-like [Pyrus x bretschneideri]
 ref|XP_009333650.1| PREDICTED: boron transporter 4-like [Pyrus x bretschneideri]
Length=674

 Score =   509 bits (1312),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 308/368 (84%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIF+FG+L T+L+SR+ARSW Y TG+FRSF+ADYGVPLMV++WTA+S
Sbjct  192   YQFQWLYTNGLLGVIFTFGLLYTALKSRKARSWWYATGWFRSFVADYGVPLMVLVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             ++VP  VP  VPRRL  P+ W+ AS++HWTVIKDMGKV P Y+ A  IPA M+AGLYFFD
Sbjct  252   FSVPHNVPPRVPRRLYSPVAWDSASLHHWTVIKDMGKVSPAYVFAAIIPAVMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ  EFNLKKPSAYHYDIL+LG MTL+CGLLGLPPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQMAQQHEFNLKKPSAYHYDILLLGFMTLLCGLLGLPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD-KELNNLKVAVMKN  720
             K Q +R++M+ SAKE +K +A+ SEIYG+M AV++EM +   P ++ KELN+LK AVMK+
Sbjct  372   KKQSIRRKMVKSAKESIKQKASNSEIYGKMQAVFIEMDNLTTPTSEVKELNDLKEAVMKS  431

Query  721   DEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             + K  +     D  K IDA+LPV VNEQR+SNLLQS+ V  S+ ++P I+ IPTSVLWGY
Sbjct  432   ENKGEDTTDAFDPEKHIDAYLPVRVNEQRLSNLLQSLLVAASVFSMPAIKKIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P+R++KVLEG HA++VESVPFK+IA FT+FQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWERMLLLFISPSRQYKVLEGGHASFVESVPFKFIAIFTLFQIVYLL  551

Query  1069  VCFGVTWI  1092
             VCFG+TWI
Sbjct  552   VCFGITWI  559



>gb|AHY28555.1| boron transporter [Triticum aestivum]
 gb|AHY28558.1| boron transporter [Triticum turgidum subsp. durum]
Length=660

 Score =   509 bits (1310),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 238/368 (65%), Positives = 297/368 (81%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QFQW+Y NGLL VIFS G+L T+LR+R ARSW YG G+ RSFIADYGVPLMV++WTA+S
Sbjct  192   HQFQWMYLNGLLGVIFSTGLLYTALRTRRARSWLYGLGWLRSFIADYGVPLMVIVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y +P +VPS VPRRL  PLPWE +S+ HWTV KD+  VPP +I A  +PA M+AGLYFFD
Sbjct  252   YALPSKVPSGVPRRLFSPLPWESSSLQHWTVAKDLFSVPPAFIFAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KE+NLKKPSAYHYDIL+LG+M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQKEYNLKKPSAYHYDILVLGLMVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             + Q +RK+M+ +AKE +  +A+K EIYG++H V++EM +       D EL +LK AV++ 
Sbjct  372   RGQFLRKKMVETAKESVGNRASKMEIYGKLHEVFIEMDNEQNTGSVDMELKSLKEAVLRE  431

Query  721   D----EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +    E+ G  D  K I+ HLPV VNEQR+SNLLQS+ VG  + A+PVIRMIPTSVLWGY
Sbjct  432   NGEDGEQTGEFDPRKHIEPHLPVRVNEQRLSNLLQSLMVGGCVAAMPVIRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI L+F+  +RR+KVLEG HA++VESVP +  + FTIFQFVYLL
Sbjct  492   FAYMAIDSLPGNQFWERIQLIFISSSRRYKVLEGPHASFVESVPSRTTSAFTIFQFVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>gb|AHY28556.1| boron transporter [Triticum aestivum]
Length=660

 Score =   508 bits (1308),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 237/368 (64%), Positives = 297/368 (81%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QFQW+Y NGLL VIFS G+L T+LR+R ARSW YG G+ RSFIADYGVPLMV++WTA+S
Sbjct  192   HQFQWMYLNGLLGVIFSTGLLYTALRTRRARSWLYGLGWLRSFIADYGVPLMVIVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y +P +VPS VPRRL  PLPWE +S+ HWTV KD+  VPP +I A  +PA M+AGLYFFD
Sbjct  252   YALPSKVPSGVPRRLFSPLPWESSSLQHWTVAKDLFSVPPAFIFAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KE+NLKKPSAYHYDIL+LG+M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQKEYNLKKPSAYHYDILVLGLMVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             + Q +RK+M+ +AKE +  +A++ EIYG++H V++EM +       D EL +LK AV++ 
Sbjct  372   RGQFLRKKMVETAKESVGNRASRMEIYGKLHEVFIEMDNEQNTGSVDMELKSLKEAVLRE  431

Query  721   D----EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +    E+ G  D  K I+ HLPV VNEQR+SNLLQS+ VG  + A+PVIRMIPTSVLWGY
Sbjct  432   NGEDGEQTGEFDPRKHIEPHLPVRVNEQRLSNLLQSLMVGGCVAAMPVIRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI L+F+  +RR+KVLEG HA++VESVP +  + FTIFQFVYLL
Sbjct  492   FAYMAIDSLPGNQFWERIQLIFISSSRRYKVLEGPHASFVESVPSRTTSAFTIFQFVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>ref|XP_008792146.1| PREDICTED: boron transporter 4-like [Phoenix dactylifera]
Length=671

 Score =   508 bits (1309),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 249/369 (67%), Positives = 297/369 (80%), Gaps = 5/369 (1%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
              YQFQWLY NGLL +IF+ G+L T+L+SR AR W YG G+FRSFIADYGVPLMV++WTA+
Sbjct  191   RYQFQWLYINGLLGIIFAIGLLYTALKSRRARGWRYGMGWFRSFIADYGVPLMVLVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+ VP +VPS VPRRL  PLPWE  S++HWTV KDM  VP  YI+A  IPA M+AGLYFF
Sbjct  251   SFAVPSKVPSGVPRRLFSPLPWESNSLHHWTVAKDMLSVPAVYIVAAIIPALMVAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYDIL+LG M LICGLLG+PPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDILVLGFMVLICGLLGIPPSNGVLPQSPMHTKSLAV  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
             LK QL+RK+M+ SAKE +K +A+  EIYGRM  V++EM      ++  +EL +LK AVM+
Sbjct  371   LKRQLIRKKMVQSAKESIKRRASNLEIYGRMQDVFIEMDEGHTTISVARELKDLKDAVMR  430

Query  718   NDEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             N+  +G L    D  K IDAHLPV  NEQR+SNLLQSI VG  + A+P+I+ IPTSVLWG
Sbjct  431   NEPGEGELKGRFDPKKHIDAHLPVRGNEQRLSNLLQSILVGACLGAMPIIKKIPTSVLWG  490

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFA+MA DSLPGNQFWERI+LLF+ P RR+KVLEG+HA++VESVPF+ IA FT+ Q  YL
Sbjct  491   YFAFMAIDSLPGNQFWERILLLFITPGRRYKVLEGVHASFVESVPFRQIAIFTLLQLAYL  550

Query  1066  LVCFGVTWI  1092
             L+CFGVTWI
Sbjct  551   LLCFGVTWI  559



>gb|AHY28557.1| boron transporter [Triticum aestivum]
Length=660

 Score =   508 bits (1308),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 237/368 (64%), Positives = 297/368 (81%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QFQW+Y NGLL VIFS G+L T+LR+R ARSW YG G+ RSFIADYGVPLMV++WTA+S
Sbjct  192   HQFQWMYLNGLLGVIFSTGLLYTALRTRRARSWLYGLGWLRSFIADYGVPLMVIVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y +P +VPS VPRRL  PLPWE +S+ HWTV KD+  VPP +I A  +PA M+AGLYFFD
Sbjct  252   YALPSKVPSGVPRRLFSPLPWESSSLQHWTVAKDLFSVPPAFIFAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KE+NLKKPSAYHYDIL+LG+M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQKEYNLKKPSAYHYDILVLGLMVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             + Q +RK+M+ +AKE +  +A++ EIYG++H V++EM +       D EL +LK AV++ 
Sbjct  372   RGQFLRKKMVETAKESVGNRASRMEIYGKLHEVFIEMDNEQNTGSVDMELKSLKEAVLRE  431

Query  721   D----EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +    E+ G  D  K I+ HLPV VNEQR+SNLLQS+ VG  + A+PVIRMIPTSVLWGY
Sbjct  432   NGEDGEQTGEFDPRKHIEPHLPVRVNEQRLSNLLQSLMVGGCVAAMPVIRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI L+F+  +RR+KVLEG HA++VESVP +  + FTIFQFVYLL
Sbjct  492   FAYMAIDSLPGNQFWERIQLIFISSSRRYKVLEGPHASFVESVPSRTTSAFTIFQFVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>ref|XP_009125916.1| PREDICTED: probable boron transporter 7 isoform X1 [Brassica 
rapa]
Length=675

 Score =   508 bits (1308),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 248/374 (66%), Positives = 291/374 (78%), Gaps = 11/374 (3%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQ  W Y NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A+S
Sbjct  192   YQSHWRYTNGLLAVIFSFGLLYTALKSRRARSWRYGFRWMRGFIGDYGTLLMLVLWSALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             +TVP+++P  VPRRL  PLPW+  S+YHWTV+KDMG VPP YILA FIPA MIAGLYFFD
Sbjct  252   FTVPRDIPEGVPRRLELPLPWDSESLYHWTVVKDMGNVPPLYILAAFIPAIMIAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  312   HCVSAQMAQQKEFNLKNPSAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-----APVADKELNNLKVA  708
             K Q MRK+M+  AKE MK +A+ SEIYG+M  V++EM +SP     A    KEL NLK A
Sbjct  372   KRQQMRKKMVQKAKECMKAKASNSEIYGKMQDVFIEMETSPKIPVQATSVVKELENLKEA  431

Query  709   VM------KNDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VM        D K    D    I+ HLPV VNEQRVSNLLQSI VGL I  VP++RMIPT
Sbjct  432   VMKADGGGGGDTKGKKFDPEVLIEDHLPVRVNEQRVSNLLQSILVGLLIFVVPLLRMIPT  491

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             SVLWGYF YMA DSLPGNQFWER++LLF+ P RRFKVLEG+HA+++E VP+K I  FT+F
Sbjct  492   SVLWGYFTYMAVDSLPGNQFWERLLLLFITPGRRFKVLEGLHASFMEIVPYKSIVMFTLF  551

Query  1051  QFVYLLVCFGVTWI  1092
             Q +Y L+C+GVTWI
Sbjct  552   QLLYFLICYGVTWI  565



>ref|XP_002455089.1| hypothetical protein SORBIDRAFT_03g004180 [Sorghum bicolor]
 gb|EES00209.1| hypothetical protein SORBIDRAFT_03g004180 [Sorghum bicolor]
Length=670

 Score =   506 bits (1304),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 291/368 (79%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFS G+L T+LR+R ARSW YG    RSFIADYGVPLMV++WTA+S
Sbjct  192   YQFQWLYVNGLLGVIFSIGLLYTALRTRRARSWLYGIRRLRSFIADYGVPLMVIVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YT+P ++PS VPRRL  PLPWE +S  HWT+ +D+  VPP YILA  +PA M+AGLYFFD
Sbjct  252   YTLPGKLPSGVPRRLFSPLPWESSSQGHWTIARDLFSVPPAYILAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KE+NLKKPSAYHYDIL+LG+M L+CGLLG+PPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQLAQQKEYNLKKPSAYHYDILVLGIMVLLCGLLGIPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+ K+M+ +AK+ +   AT  EIYG+M  +++EM S       DKEL N K AV++ 
Sbjct  372   KRQLLSKKMVDTAKDSIGRSATTLEIYGKMEEIFIEMDSEQNTGSVDKELKNFKDAVLQE  431

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
               ++G L    D  K I+AHLPV VNEQR+SNLLQSI VG  + A+PVIRMIPTSVLWGY
Sbjct  432   GNEEGKLAREFDPRKHIEAHLPVRVNEQRLSNLLQSILVGGCVGAMPVIRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI LLFV  +R +KVLEG HA++VESV  K I  FTIFQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWERIQLLFVAESRLYKVLEGPHASFVESVVPKTITIFTIFQLVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>gb|KHN44152.1| Boron transporter 4 [Glycine soja]
Length=666

 Score =   506 bits (1304),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 247/369 (67%), Positives = 302/369 (82%), Gaps = 8/369 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F WLYANGLL +IF+FG+L TSL+SR ARSW YGTG+FRSFIADYGVP MVV+WTA+
Sbjct  191   KYKFHWLYANGLLGIIFTFGLLYTSLKSRRARSWLYGTGWFRSFIADYGVPFMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+TVP +VPS VPRRL  PL WE  S++HWT   +MG+V P Y+ A FIPA MIAGLYFF
Sbjct  251   SFTVPSKVPSGVPRRLTSPLAWESTSLHHWT---NMGEVSPAYVFAAFIPALMIAGLYFF  307

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNL+KPSAYHYDIL+L + TL+CGL+GLPPSNGVLPQ+PMH+KSLA 
Sbjct  308   DHSVASQMAQQKEFNLRKPSAYHYDILLLALTTLLCGLIGLPPSNGVLPQSPMHSKSLAV  367

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
             LK QL+R++M+ SAKE ++ +A+KSEIYG+M AV++EM + P   +  KEL +LK  V+ 
Sbjct  368   LKKQLIRRKMVKSAKESIRQKASKSEIYGKMQAVFMEMDNCPDNHSVVKELEDLKDVVLN  427

Query  718   NDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
              ++K  N     D  K+IDA+LPV V EQRVSNLLQS+ VG S+ A+P I+ IPTSVLWG
Sbjct  428   GEDKGLNNKSTFDPEKNIDAYLPVRVKEQRVSNLLQSLLVGASVFAMPAIKKIPTSVLWG  487

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWERI+ LFV PNR +K+LEG HA+++ESVP+KYI  FT+FQ +Y 
Sbjct  488   YFAYMAIDSLPGNQFWERILFLFVTPNRWYKLLEGDHASFIESVPYKYIVFFTLFQCIYF  547

Query  1066  LVCFGVTWI  1092
             LVCFGVTWI
Sbjct  548   LVCFGVTWI  556



>ref|XP_008809478.1| PREDICTED: boron transporter 4 [Phoenix dactylifera]
Length=681

 Score =   507 bits (1305),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 242/368 (66%), Positives = 291/368 (79%), Gaps = 6/368 (2%)
 Frame = +1

Query  7     QFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSY  186
             QF+W Y NGLL +IFS G+L T+L+SR AR+W  GTG+FRSF+A+YGV  MV++WTA+SY
Sbjct  193   QFEWRYTNGLLGIIFSIGLLYTALKSRRARTWRCGTGWFRSFMAEYGVTFMVLVWTALSY  252

Query  187   TVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDH  366
              VP +VPS VPRRL  PLPWEP S+ HWTV KD+  VP  YI A  +PA M+AGLYFFDH
Sbjct  253   AVPNDVPSGVPRRLFSPLPWEPKSLQHWTVAKDLLSVPLVYIFAAIVPAVMVAGLYFFDH  312

Query  367   SVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELK  546
             SVASQMAQ KEFNL+ PSAYHYDIL+LG M LICGLLG+PPSNGVLPQ+PMHTKSLA LK
Sbjct  313   SVASQMAQQKEFNLQNPSAYHYDILVLGFMVLICGLLGIPPSNGVLPQSPMHTKSLAVLK  372

Query  547   TQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSS--PAPVADKELNNLKVAVMKN  720
              QL+ K+M+ +A+EG+K  A++SEIYG+M  V++EMG     A   D+EL +LK AVM+N
Sbjct  373   RQLIHKKMVKTAREGIKQHASRSEIYGKMQDVFIEMGKGHKHAVSIDRELKDLKDAVMQN  432

Query  721   D----EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +    E +G  D  K +DAHLPV VNEQRV+NL QSI VG  + A+PVI+ IPTS+LWGY
Sbjct  433   EAGEGEHEGKFDPEKPVDAHLPVRVNEQRVTNLCQSILVGACLGAMPVIQKIPTSILWGY  492

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPG+QFWERI LLFV P RRFKVLEG HA +VESVPF+ I  FT+FQ  Y L
Sbjct  493   FAYMAVDSLPGSQFWERIKLLFVTPGRRFKVLEGEHAPFVESVPFRAINCFTMFQLAYFL  552

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  553   LCFGLTWI  560



>ref|XP_008347793.1| PREDICTED: boron transporter 4-like [Malus domestica]
 ref|XP_008347798.1| PREDICTED: boron transporter 4-like [Malus domestica]
 ref|XP_008347804.1| PREDICTED: boron transporter 4-like [Malus domestica]
Length=673

 Score =   505 bits (1300),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 305/368 (83%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIF+FG+L T+L+SR+ARSW Y TG+FRSFIADYGVPLMV++WTA+S
Sbjct  192   YQFQWLYTNGLLGVIFTFGLLYTALKSRKARSWWYATGWFRSFIADYGVPLMVLVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             ++VP  VP  VPRRL  P+ W+ AS++HWTVIKDMGKV P Y+ A  IPA M+AGLYFFD
Sbjct  252   FSVPHNVPPRVPRRLYIPVAWDSASLHHWTVIKDMGKVSPGYVFAAIIPAVMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ  EFNLKKP AYHYDIL+LG MTL+CGLLGLPPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQMAQQHEFNLKKPPAYHYDILLLGFMTLLCGLLGLPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD-KELNNLKVAVMKN  720
             K Q +R++M+ SAKE +K +A  SEIYG+M AV++EM +   P ++ KELN+LK AVMK+
Sbjct  372   KKQSIRRKMVKSAKESIKQKANNSEIYGKMQAVFIEMDNLTTPTSEVKELNDLKEAVMKS  431

Query  721   DEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             + K  +     D  K IDA+LPV V EQR+SNLLQS+ V  S+ A+P I+ IPTSVLWGY
Sbjct  432   ENKGEDTTDAFDPEKHIDAYLPVRVTEQRLSNLLQSLLVAASVFAMPAIKKIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER++LLF+ P+R++KVLEG HA++VESVPFK+IA FT+FQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWERMLLLFISPSRQYKVLEGGHASFVESVPFKFIAIFTLFQIVYLL  551

Query  1069  VCFGVTWI  1092
             VCFG+TWI
Sbjct  552   VCFGITWI  559



>ref|XP_010428474.1| PREDICTED: putative boron transporter 5 [Camelina sativa]
Length=683

 Score =   505 bits (1300),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 240/374 (64%), Positives = 295/374 (79%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF+WLY NGLL +IF+ G++ T+L+SR+ARSW YGTG+ RSFIADYGVPLM+V+WTA+
Sbjct  196   KYQFEWLYTNGLLGLIFTVGLVYTALKSRKARSWRYGTGWCRSFIADYGVPLMIVVWTAM  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+  P ++PS VPRRLV PLPW+  S+ HWTVIKDMGKV   YI A FIPA MIAGLYFF
Sbjct  256   SFGTPSKLPSGVPRRLVSPLPWDSVSLTHWTVIKDMGKVSVVYIFAAFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSV SQ+AQ KEFNLK PSAYHYDIL+LG M LICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVVSQLAQQKEFNLKNPSAYHYDILLLGFMVLICGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD----KELNNLKVA  708
             L+ QLMR++M+ +AKE ++ +AT S++Y  M  V++EM  SP          EL +LK A
Sbjct  376   LRRQLMRRKMVMTAKESIRQRATSSQVYEDMQQVFIEMDKSPLAETSLTLVNELQDLKEA  435

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK  +  G+       D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+P I++IPT
Sbjct  436   VMKKSDDGGDSSDESGFDPEKHLDAYLPVRVNEQRVSNLLQSLLVIGAVFAIPAIKLIPT  495

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLP NQF+ER+VLLFVPP+RRFKVLEG HA++VE VP+K +A FT+F
Sbjct  496   SLLWGYFAYMAIDSLPDNQFFERVVLLFVPPSRRFKVLEGAHASFVEKVPYKSMAAFTLF  555

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  556   QIFYFGLCYGVTWI  569



>ref|XP_008672825.1| PREDICTED: boron transporter-like protein 2 isoform X1 [Zea mays]
 tpg|DAA53205.1| TPA: hypothetical protein ZEAMMB73_362768 [Zea mays]
Length=670

 Score =   504 bits (1299),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 291/368 (79%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFS G+L T+LR+R ARSW YGTG+FRSFIADYGVPLMV++WT +S
Sbjct  192   YQFQWLYVNGLLGVIFSIGLLYTALRTRRARSWLYGTGWFRSFIADYGVPLMVIVWTGLS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y  P +VPS VPRRL  PLPWE +S+ HWT  +D+  VPP YI    +PA M+AGLYFFD
Sbjct  252   YLHPGKVPSGVPRRLSSPLPWESSSLGHWTTARDLFSVPPAYIFGAILPAFMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KE+NLKKPSAYHYDIL+LG + L+CGLLG+PPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQLAQQKEYNLKKPSAYHYDILVLGFVVLLCGLLGIPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+ K+M+ +AKE +   AT  EIYG+M  V+++M S       D+EL N K AV++ 
Sbjct  372   KRQLLSKKMVDTAKESIGGSATSLEIYGKMEEVFIKMDSEQNTDSVDRELKNFKDAVLQE  431

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +++G L    D  K I+AHLPV VNEQR+SNLLQSI VG  + A+PVIRMIPTSVLWGY
Sbjct  432   GDEEGRLAREFDPRKHIEAHLPVRVNEQRLSNLLQSILVGGCVGAMPVIRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI LLF+  +RR+KVLEG HA++VESV  K +  FTIFQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWERIQLLFITESRRYKVLEGPHASFVESVVPKTVTIFTIFQLVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>ref|NP_001147798.1| boron transporter-like protein 2 [Zea mays]
 gb|ACG28728.1| boron transporter-like protein 2 [Zea mays]
 tpg|DAA53206.1| TPA: boron transporter-like protein 2 [Zea mays]
Length=664

 Score =   504 bits (1298),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 291/368 (79%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFS G+L T+LR+R ARSW YGTG+FRSFIADYGVPLMV++WT +S
Sbjct  192   YQFQWLYVNGLLGVIFSIGLLYTALRTRRARSWLYGTGWFRSFIADYGVPLMVIVWTGLS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y  P +VPS VPRRL  PLPWE +S+ HWT  +D+  VPP YI    +PA M+AGLYFFD
Sbjct  252   YLHPGKVPSGVPRRLSSPLPWESSSLGHWTTARDLFSVPPAYIFGAILPAFMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KE+NLKKPSAYHYDIL+LG + L+CGLLG+PPSNGVLPQ+PMHTKSLA L
Sbjct  312   HSVASQLAQQKEYNLKKPSAYHYDILVLGFVVLLCGLLGIPPSNGVLPQSPMHTKSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+ K+M+ +AKE +   AT  EIYG+M  V+++M S       D+EL N K AV++ 
Sbjct  372   KRQLLSKKMVDTAKESIGGSATSLEIYGKMEEVFIKMDSEQNTDSVDRELKNFKDAVLQE  431

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +++G L    D  K I+AHLPV VNEQR+SNLLQSI VG  + A+PVIRMIPTSVLWGY
Sbjct  432   GDEEGRLAREFDPRKHIEAHLPVRVNEQRLSNLLQSILVGGCVGAMPVIRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI LLF+  +RR+KVLEG HA++VESV  K +  FTIFQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWERIQLLFITESRRYKVLEGPHASFVESVVPKTVTIFTIFQLVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>gb|EMT12936.1| Boron transporter-like protein 2 [Aegilops tauschii]
Length=666

 Score =   504 bits (1297),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 242/368 (66%), Positives = 292/368 (79%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW+Y NGLL VIFS G+L ++L++R ARSW YG G  RSFIADYGVPLMV++WTA S
Sbjct  195   YQFQWIYVNGLLGVIFSIGLLYSALKTRRARSWLYGIGCVRSFIADYGVPLMVIVWTAFS  254

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YT+P  VPS VPRRL  PLPWE +S+ HWTV KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  255   YTLPGGVPSGVPRRLFSPLPWESSSLGHWTVAKDLFSVPPAYIFAAIVPALMVAGLYFFD  314

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ +EFNLKKPSAYHYDIL+LG M L+CGL+G+PP+NGVLPQ+PMHT+SLA L
Sbjct  315   HSVASQLAQQQEFNLKKPSAYHYDILLLGFMVLLCGLIGIPPANGVLPQSPMHTRSLAVL  374

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-SPAPVADKELNNLKVAVMKN  720
             K QLMRKRM+ +AKEGM  +A+  EIYG+MH V++EM +   A   DK+L +LK AV++ 
Sbjct  375   KGQLMRKRMLRTAKEGMSNRASSLEIYGKMHEVFIEMDNKQDADSVDKDLKSLKDAVLRE  434

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              ++DG L    D  K I+AHLPV VNEQR+SNLLQS+ VG S+ A+PVI+MIPTSVLWGY
Sbjct  435   GDEDGKLAGEFDPRKHIEAHLPVRVNEQRLSNLLQSLLVGGSVGAMPVIKMIPTSVLWGY  494

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI  L +  +RR+KVL G HA++VE V  + I  FTIFQ VY L
Sbjct  495   FAYMAIDSLPGNQFWERIQFLCIGASRRYKVLVGPHASFVELVSPRTIYVFTIFQIVYFL  554

Query  1069  VCFGVTWI  1092
             +CFG TWI
Sbjct  555   ICFGTTWI  562



>gb|AHY28551.1| boron transporter [Triticum aestivum]
Length=660

 Score =   503 bits (1296),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 236/368 (64%), Positives = 295/368 (80%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QFQW+Y NGLL VIFS G+L T+LR+R ARSW YG G+ RSFIADYGVPLMV++WTA+S
Sbjct  192   HQFQWMYLNGLLGVIFSTGLLYTALRTRRARSWLYGLGWLRSFIADYGVPLMVIVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y +P +VPS VPRRL  PLPWE +S+ HWTV KD+  VPP +I A  +PA M+AGLYFFD
Sbjct  252   YALPSKVPSGVPRRLFSPLPWESSSLQHWTVAKDLFSVPPAFIFAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KE+NLKKPSAYHYDIL+LG+  L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQKEYNLKKPSAYHYDILVLGLTVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             + Q + K+M+ +AKE +  +A++ EIYG++H V+VEM +       D EL +LK AV++ 
Sbjct  372   RGQFLHKKMVQTAKESVVNRASRMEIYGKLHEVFVEMDNEQNTGSVDMELKSLKEAVLRE  431

Query  721   DEKD----GNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             + +D    G  D  K I+ HLPV VNEQR+SNLLQS+ VG  + A+PVIRMIPTSVLWGY
Sbjct  432   NGEDGKPAGEFDPRKHIEPHLPVRVNEQRLSNLLQSLMVGGCVAAMPVIRMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI L+F+  +RR+KVLEG HA++VESVP +  + FTIFQFVYLL
Sbjct  492   FAYMAIDSLPGNQFWERIQLIFISSSRRYKVLEGPHASFVESVPSRTTSAFTIFQFVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>ref|XP_010925146.1| PREDICTED: LOW QUALITY PROTEIN: boron transporter 4-like [Elaeis 
guineensis]
Length=682

 Score =   504 bits (1297),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 239/368 (65%), Positives = 287/368 (78%), Gaps = 6/368 (2%)
 Frame = +1

Query  7     QFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSY  186
             QF+W Y NGLL +IFS G+L T+L+SR AR+W YGTG+FRSF+ADYGV  MV++WTA+SY
Sbjct  194   QFEWQYTNGLLGIIFSIGLLYTALKSRRARAWRYGTGWFRSFVADYGVTFMVLVWTALSY  253

Query  187   TVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDH  366
              VP  VPS VPRRL  PLPWEP S+ HWTV+KD+  VPP YI A  IPA M+AGLYFFDH
Sbjct  254   AVPNNVPSGVPRRLFSPLPWEPKSLQHWTVVKDLLSVPPVYIFAAIIPAVMVAGLYFFDH  313

Query  367   SVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELK  546
             SVASQMAQ KEFNL+ PSAYHYDIL+LG M LICGLLG+PPSNGVLPQ+PMHTKSLA LK
Sbjct  314   SVASQMAQQKEFNLQNPSAYHYDILVLGFMVLICGLLGIPPSNGVLPQSPMHTKSLAVLK  373

Query  547   TQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEM--GSSPAPVADKELNNLKVAVMKN  720
              QL+ K M+ ++ EG+K  A+KS IYG++  V++E+  G       D+EL +LK  V++N
Sbjct  374   RQLIHKXMVETSNEGVKQDASKSGIYGKIQEVFIEVDKGHKHTVSIDRELKDLKDGVLQN  433

Query  721   ----DEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
                  E +G  D  K IDAHLPV VNEQRVSNL QS+ VG  + A+P+I+ IPTS+LWGY
Sbjct  434   GSGEGEDEGKFDPEKPIDAHLPVRVNEQRVSNLCQSLLVGACLGAMPIIQKIPTSILWGY  493

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPG+QFWERI LLFV P RRFKVLEG HA ++ESVPF+ I  FT+FQ  Y L
Sbjct  494   FAYMAVDSLPGSQFWERIKLLFVTPGRRFKVLEGEHAPFIESVPFRVINCFTMFQLAYFL  553

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  554   LCFGLTWI  561



>gb|AHY28552.1| boron transporter [Triticum aestivum]
 gb|AHY28553.1| boron transporter [Triticum aestivum]
 gb|AHY28554.1| boron transporter [Triticum turgidum subsp. durum]
Length=660

 Score =   502 bits (1292),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 236/368 (64%), Positives = 296/368 (80%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QFQW+Y NGLL VIFS G+L T+LRSR ARSW YG G+ RSFIADYGVPLMV++WTA+S
Sbjct  192   HQFQWMYLNGLLGVIFSTGLLYTALRSRPARSWLYGLGWLRSFIADYGVPLMVIVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y +P +VPS VPRRL  PLPWE +S+ HWTV KD+  VPP +I A  +PA M+AGLYFFD
Sbjct  252   YALPSKVPSGVPRRLFSPLPWESSSLQHWTVAKDLFSVPPAFIFAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KE+NLKKPSAYHYDIL+LG+  L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQKEYNLKKPSAYHYDILVLGLTVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSS-PAPVADKELNNLKVAVMKN  720
             + Q +RK+M+ +AKE +  +A++ EIYG++H V+VEM +       D EL +LK AV++ 
Sbjct  372   RGQFLRKKMVETAKESVGNRASRMEIYGKLHEVFVEMDNEHNTGSVDMELKSLKEAVLRE  431

Query  721   D----EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             +    E+ G  D  K I+ +LPV VNEQR+SNLLQS+ VG  + A+PVIR+IPTSVLWGY
Sbjct  432   NGEDGEQTGEFDPRKHIEPNLPVRVNEQRLSNLLQSLMVGGCVAAMPVIRIIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI L+F+  +RR+KVLEG HA++VESVP +  + FTIFQFVYLL
Sbjct  492   FAYMAIDSLPGNQFWERIQLIFISSSRRYKVLEGPHASFVESVPSRTTSAFTIFQFVYLL  551

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  552   ICFGITWI  559



>emb|CDY36563.1| BnaA06g10160D [Brassica napus]
Length=1571

 Score =   526 bits (1354),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 248/374 (66%), Positives = 305/374 (82%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+F+WLY NGLL +IF+FG+L T+L+SR+ARSW YGTG++RSFIADYGVPLMVV+WTA+
Sbjct  194   KYKFEWLYTNGLLGLIFTFGLLYTALKSRKARSWRYGTGWYRSFIADYGVPLMVVVWTAL  253

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+T P ++PS VPRRL  PLPW+ AS+ HWTVIKDMGKV P YI A FIPA MIAGLYFF
Sbjct  254   SFTTPSKLPSGVPRRLFSPLPWDSASLEHWTVIKDMGKVSPEYIFAAFIPALMIAGLYFF  313

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  314   DHSVASQLAQQKEFNLKNPSAYHYDILLLGFMTLICGLLGLPPSNGVLPQSPMHTKSLAV  373

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK----ELNNLKVA  708
             LK QL+R++M+ +AKE ++ +AT SE+Y  M  V++EM  SP    ++    EL +LK A
Sbjct  374   LKRQLIRRKMVKTAKESIRKRATSSEVYENMQEVFIEMDKSPIAQTNRTVILELQDLKEA  433

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK++E +G        D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+P I+++PT
Sbjct  434   VMKSNEDEGERDEESGFDPEKHLDAYLPVRVNEQRVSNLLQSLLVAGAVLAMPAIKLMPT  493

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             SVLWGYFAYMA DSLPGNQF+ER++LLFV P+RRFKVLEG HA++VE VP+K +A FTI 
Sbjct  494   SVLWGYFAYMAIDSLPGNQFFERMMLLFVLPSRRFKVLEGAHASFVEKVPYKSMAAFTIL  553

Query  1051  QFVYLLVCFGVTWI  1092
             Q VY  +C+GVTWI
Sbjct  554   QIVYFGICYGVTWI  567



>gb|EMT07454.1| Boron transporter-like protein 2 [Aegilops tauschii]
Length=1239

 Score =   518 bits (1335),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 301/368 (82%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW+Y NGLL VIFS G+L T+L++R ARSW YG G+ RSFIADYGVPLMV++WTA S
Sbjct  195   YQFQWIYVNGLLGVIFSIGLLYTALKTRRARSWLYGIGWLRSFIADYGVPLMVIVWTAFS  254

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             +T+P +VPS VPRRL  PLPWE  S+ HWTV KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  255   FTLPSKVPSGVPRRLFSPLPWESISLRHWTVAKDLFSVPPTYIFAAIVPALMVAGLYFFD  314

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPSAYHYDIL+LG M L+CGLLG+PPSNGVLPQ+PMHT+SLA L
Sbjct  315   HSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLLGIPPSNGVLPQSPMHTRSLAVL  374

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+RK+M+ +AKEGM  +A+  EIYG+M  V+++M S+  A   DK+L +LK AV++ 
Sbjct  375   KGQLLRKKMLQTAKEGMSNRASSLEIYGKMQEVFIQMDSNQNANSVDKDLKSLKDAVLRE  434

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +++G L    D +K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  435   GDEEGKLAGEFDPSKYIEAHLPVRVNEQRLSNLLQSLLVGGCVGAMPVIKMIPTSVLWGY  494

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER+ LL +  +RR+KVLEG HA++VESVP + I+ FT+FQFVYLL
Sbjct  495   FAYMAIDSLPGNQFWERLQLLCIGASRRYKVLEGPHASFVESVPSRTISAFTVFQFVYLL  554

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  555   ICFGITWI  562



>ref|XP_010416339.1| PREDICTED: putative boron transporter 5 [Camelina sativa]
Length=683

 Score =   502 bits (1292),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 239/374 (64%), Positives = 294/374 (79%), Gaps = 10/374 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF+WLY NGLL +IF+ G++ T+L+SR+ARSW YGTG+ RSFIADYGVPLM+V+WTA+
Sbjct  196   KYQFEWLYTNGLLGLIFTVGLVYTALKSRKARSWRYGTGWCRSFIADYGVPLMIVVWTAL  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+  P ++PS VPRRLV PLPW+  S+ HWTVIKDMGKV   YI A FIPA  IAGLYFF
Sbjct  256   SFGTPSKLPSGVPRRLVSPLPWDSVSLTHWTVIKDMGKVSVVYIFAAFIPALTIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSV SQ+AQ KEFNLK PSAYHYDIL+LG M LICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVVSQLAQQKEFNLKNPSAYHYDILLLGFMVLICGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD----KELNNLKVA  708
             L+ QLMR++M+ +AKE ++  AT S++Y  M  V++EM  SP    +     EL +LK A
Sbjct  376   LRRQLMRRKMVMTAKETIRQGATSSQVYEDMQQVFIEMDKSPLAETNLTLVNELQDLKEA  435

Query  709   VMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
             VMK ++  G+       D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+P I++IPT
Sbjct  436   VMKKNDDGGDSSDESGFDPEKHLDAYLPVRVNEQRVSNLLQSLLVIGAVFAIPAIKLIPT  495

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             S+LWGYFAYMA DSLP NQF+ER VLLFVPP+RRFKVLEG HA++VE VP+K +A FT+F
Sbjct  496   SLLWGYFAYMAIDSLPDNQFFERTVLLFVPPSRRFKVLEGAHASFVEKVPYKSMAAFTLF  555

Query  1051  QFVYLLVCFGVTWI  1092
             Q  Y  +C+GVTWI
Sbjct  556   QIFYFGLCYGVTWI  569



>ref|XP_003569518.2| PREDICTED: boron transporter 4-like [Brachypodium distachyon]
Length=1157

 Score =   515 bits (1327),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 294/368 (80%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             Y FQW+Y NGLL VIFS G+L T+L+SR ARSW YG G  RSFIADYGVPLMV++WTA+S
Sbjct  195   YDFQWIYVNGLLGVIFSIGLLYTALKSRRARSWLYGIGCLRSFIADYGVPLMVIVWTALS  254

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YT+P +VPS VPRRL  PLPWE +S+ HWTV KD+  VPP +I A  +PA M+AGLYFFD
Sbjct  255   YTLPSKVPSGVPRRLFSPLPWESSSLGHWTVAKDLFSVPPAFIFAAIVPALMVAGLYFFD  314

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPSAYHYDIL+LG M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  315   HSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  374

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QLMR +M+ +AKEGM  +A+  EIYG+M  V+++M         DKEL +LK AV++ 
Sbjct  375   KGQLMRNKMLQTAKEGMTNRASSLEIYGKMQEVFIQMDREKNTDSVDKELKSLKDAVLRE  434

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +++G L    D  K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  435   GDEEGKLAGEFDPRKHIEAHLPVRVNEQRLSNLLQSLLVGGCVGAMPVIKMIPTSVLWGY  494

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI LLF+   RR+KVLEG HA++VESVP K I+ FTIFQ VYLL
Sbjct  495   FAYMAIDSLPGNQFWERIKLLFIGSTRRYKVLEGPHASFVESVPSKTISVFTIFQLVYLL  554

Query  1069  VCFGVTWI  1092
             +CFG TWI
Sbjct  555   ICFGTTWI  562



>ref|XP_010471571.1| PREDICTED: putative boron transporter 5 [Camelina sativa]
 ref|XP_010471572.1| PREDICTED: putative boron transporter 5 [Camelina sativa]
Length=683

 Score =   501 bits (1290),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 241/376 (64%), Positives = 297/376 (79%), Gaps = 14/376 (4%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF+WLY NGLL +IF+ G++ T+L+SR+ARSW YGTG+ RSFIADYGVPLM+V+WTA+
Sbjct  196   KYQFEWLYTNGLLGLIFTVGLVYTALKSRKARSWRYGTGWCRSFIADYGVPLMIVVWTAM  255

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S+  P ++PS VPRRLV PLPW+  S+ HWTVIKDMGKV   YI A FIPA MIAGLYFF
Sbjct  256   SFGTPSKLPSGVPRRLVSPLPWDSVSLTHWTVIKDMGKVSVVYIFAAFIPALMIAGLYFF  315

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSV SQ+AQ KEFNLK PSAYHYDIL+LG M LICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  316   DHSVVSQLAQQKEFNLKNPSAYHYDILLLGFMVLICGLLGLPPSNGVLPQSPMHTKSLAV  375

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADK------ELNNLK  702
             L+ QLMR++M+ +AKE ++ +AT S++Y  M  V++EM  S   +A+K      EL +LK
Sbjct  376   LRRQLMRRKMVMTAKESIRQRATSSQVYEDMQQVFIEMDKS--QLAEKNLTLVNELQDLK  433

Query  703   VAVMKNDEKDGN------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMI  864
              AVMK +   G+       D  K +DA+LPV VNEQRVSNLLQS+ V  ++ A+P I++I
Sbjct  434   EAVMKKNYDGGDSSDESGFDPEKHLDAYLPVRVNEQRVSNLLQSLLVIGAVFAIPAIKLI  493

Query  865   PTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFT  1044
             PTS+LWGYFAYMA DSLP NQF+ER VLLFVPP+RRFKVLEG HA++VE VP+K +A FT
Sbjct  494   PTSLLWGYFAYMAIDSLPDNQFFERTVLLFVPPSRRFKVLEGAHASFVEKVPYKSMAAFT  553

Query  1045  IFQFVYLLVCFGVTWI  1092
             +FQ  Y  +C+GVTWI
Sbjct  554   LFQIFYFGLCYGVTWI  569



>ref|XP_002517531.1| Boron transporter, putative [Ricinus communis]
 gb|EEF44695.1| Boron transporter, putative [Ricinus communis]
Length=647

 Score =   497 bits (1280),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 287/374 (77%), Gaps = 35/374 (9%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL                         G+FRSFIADYGVPL+VV+WTA+
Sbjct  191   KYQFQWLYTNGLL-------------------------GWFRSFIADYGVPLLVVVWTAL  225

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VPS VPRRL  PLPWE AS+ HWTVIKDMG VPP YI A  +PA MIAGLYFF
Sbjct  226   SFSVPSKVPSGVPRRLFSPLPWESASLGHWTVIKDMGNVPPAYIFAAIVPAVMIAGLYFF  285

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA 
Sbjct  286   DHSVASQLAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLAI  345

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD------KELNNLK  702
             LK  L+R++M+ SAKE +K +A+ SEIYG+M AV++EM SSP           KEL +LK
Sbjct  346   LKRLLIRRKMVESAKESIKQKASNSEIYGKMQAVFIEMDSSPVVKFFTFFFVAKELEDLK  405

Query  703   VAVMKNDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
              A+MK +    N     D  K IDA+LPV VNEQRVSNLLQS+ V  S+CAVP+I++IPT
Sbjct  406   EAIMKGENNGENTKNTFDPEKTIDAYLPVRVNEQRVSNLLQSLLVAASVCAVPIIKLIPT  465

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             SVLWGYFAYMA DSLPGNQFWERI+LLF+ P+RR+KVLE +HA+++E VPFK+IA FTIF
Sbjct  466   SVLWGYFAYMAIDSLPGNQFWERILLLFITPSRRYKVLEVVHASFMELVPFKHIAIFTIF  525

Query  1051  QFVYLLVCFGVTWI  1092
             Q VY LVCFGVTWI
Sbjct  526   QLVYFLVCFGVTWI  539



>emb|CDX75250.1| BnaA01g04520D [Brassica napus]
Length=1215

 Score =   514 bits (1323),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 249/370 (67%), Positives = 292/370 (79%), Gaps = 7/370 (2%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQ  W Y NGLLAVIFSFG+L T+L+SR ARSW YG  + R FI DYG  LM+VLW+A+S
Sbjct  736   YQSHWRYTNGLLAVIFSFGLLYTALKSRRARSWRYGFRWMRGFIGDYGTLLMLVLWSALS  795

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             +TVP+++P  VPRRL  PLPW+  S+YHWTV+KDMGKVPP YILA FIPA MIAGLYFFD
Sbjct  796   FTVPRDIPEGVPRRLELPLPWDSESLYHWTVVKDMGKVPPLYILAAFIPAIMIAGLYFFD  855

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             H V++QMAQ KEFNLK PSAYHYDI +LG+MTLICGLLGLPPSNGV+PQ+PMHTKSLA L
Sbjct  856   HCVSAQMAQQKEFNLKNPSAYHYDIFILGIMTLICGLLGLPPSNGVIPQSPMHTKSLAVL  915

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVM--  714
             K Q MRK+M+  AKE MK +A+ SEIYG+M  V++EM +SP A    KEL NLK AVM  
Sbjct  916   KRQQMRKKMVQKAKECMKAKASNSEIYGKMQDVFIEMETSPKATSVVKELENLKEAVMKA  975

Query  715   ----KNDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLW  882
                   D K    D    I+ HLPV VNEQRVSNLLQSI VGL I  VP++RMIPTSVLW
Sbjct  976   DGGGGGDTKGKKFDPEVLIEDHLPVRVNEQRVSNLLQSILVGLLIFVVPLLRMIPTSVLW  1035

Query  883   GYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVY  1062
             GYF YMA DSLPGNQFWER++LLF+ P RRFKVLEG+HA+++E VP+K I  FT+FQ +Y
Sbjct  1036  GYFTYMAVDSLPGNQFWERLLLLFITPGRRFKVLEGLHASFMEIVPYKSIVMFTLFQLLY  1095

Query  1063  LLVCFGVTWI  1092
              L+C+GVTWI
Sbjct  1096  FLICYGVTWI  1105



>ref|XP_004960830.1| PREDICTED: boron transporter 4-like isoform X3 [Setaria italica]
Length=651

 Score =   495 bits (1275),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 237/368 (64%), Positives = 287/368 (78%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QFQWLY NGLL VIFS GVL TSL SREAR   YGTG+ RS IADYGVPLMV+LWTA+S
Sbjct  163   FQFQWLYVNGLLGVIFSMGVLYTSLASREARLSLYGTGWQRSLIADYGVPLMVILWTALS  222

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y++P ++PS VPRRL  PLPWEP S+ HWTV KD+  VPP YI    +PA M+AGLYFFD
Sbjct  223   YSLPSKIPSGVPRRLFTPLPWEPKSLQHWTVAKDLFSVPPAYIFLAIVPAAMVAGLYFFD  282

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLK PSAYHYDIL+L + TLICGLLG+PPSNGVLPQ+PMHT+SLA L
Sbjct  283   HSVASQMAQQKEFNLKNPSAYHYDILVLSLTTLICGLLGIPPSNGVLPQSPMHTRSLAVL  342

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPV-ADKELNNLKVAVMKN  720
             K QL+RK+M+ +AKEGM   AT SE+YG+M  V+++M      V A  EL +LK A++  
Sbjct  343   KRQLLRKKMIRTAKEGMMQNATSSEVYGKMQDVFIKMDLGGDSVSAHNELKDLKNAIIPE  402

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              + +G +    D  K ++A+LPV VNEQR+SNLLQS+ V   I   P+I+ IPTSVLWGY
Sbjct  403   GDGEGKVPEVFDPEKHVEAYLPVRVNEQRLSNLLQSLLVAGCIGVTPLIQRIPTSVLWGY  462

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYM+ DS+PGNQFWERI LLF+ P RR+KV EG HA++VESVPF  I+ FT+FQ +YLL
Sbjct  463   FAYMSIDSVPGNQFWERIQLLFITPQRRYKVFEGAHASFVESVPFNIISAFTLFQLIYLL  522

Query  1069  VCFGVTWI  1092
             + FG+TWI
Sbjct  523   LVFGMTWI  530



>ref|XP_002285279.1| PREDICTED: boron transporter 4 [Vitis vinifera]
 ref|XP_010654729.1| PREDICTED: boron transporter 4 [Vitis vinifera]
 emb|CBI36246.3| unnamed protein product [Vitis vinifera]
Length=668

 Score =   494 bits (1272),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 248/373 (66%), Positives = 297/373 (80%), Gaps = 9/373 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQFQWLY NGLL++IF FG+L T+L+SR+ARSW YGTG FRSFIADYGVPLMVV+WTA+
Sbjct  191   KYQFQWLYVNGLLSIIFVFGLLYTALKSRKARSWLYGTGLFRSFIADYGVPLMVVVWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             S++VP +VPS VPRRL  PLPW+  S+YHWTVIKDMG VPP YI A  IPA MIAGLYFF
Sbjct  251   SFSVPSKVPSGVPRRLNSPLPWDSESVYHWTVIKDMGNVPPAYIFAAIIPALMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLKKPSAYH+DIL+LG MTL+CGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  311   DHSVASQMAQQKEFNLKKPSAYHHDILLLGFMTLLCGLLGLPPSNGVLPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSS-PAPVADKELNNLKVAVMK  717
             LK QL+RK+M+ SAKE +K +A   EIY  M AV+++M ++ P     KEL +LK AVMK
Sbjct  371   LKRQLIRKKMVKSAKESIKQKAANPEIYSNMQAVFIKMDNTQPTKSVVKELEDLKEAVMK  430

Query  718   NDEKDGN--------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTS  873
              + K  N         D  + ID +LPV VNEQRVSNLLQS+ V  ++ A+P+I+ IPTS
Sbjct  431   GENKQANKEENATGTFDPEQHIDPYLPVRVNEQRVSNLLQSLLVAAAVFAMPLIKKIPTS  490

Query  874   VLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQ  1053
             VL GYFAYMA DSLPGNQFWER +L+F+ P R +KV EG+HA++V+ VPFK I  FT+FQ
Sbjct  491   VLAGYFAYMAIDSLPGNQFWERFLLVFITPQRLYKVKEGVHASFVDMVPFKSITMFTLFQ  550

Query  1054  FVYLLVCFGVTWI  1092
               Y ++CFGVTWI
Sbjct  551   LAYFMLCFGVTWI  563



>gb|EEE53968.1| hypothetical protein OsJ_00581 [Oryza sativa Japonica Group]
Length=659

 Score =   494 bits (1272),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 239/368 (65%), Positives = 286/368 (78%), Gaps = 18/368 (5%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFS G+L T+LRSR ARSW YG G+ R FIADYGVPLMV++WTA S
Sbjct  192   YQFQWLYVNGLLGVIFSIGLLYTALRSRRARSWVYGQGWLRGFIADYGVPLMVIVWTAFS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YT+PK+VPS VPRRL  PLPWE +S+ HWTV KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  252   YTLPKDVPSGVPRRLFSPLPWESSSLQHWTVAKDLFSVPPAYIFAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPSAYHYDIL+LG M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+RK+M+ +A EG+  +A+  EIYG++  V++EM         DKEL +LK A+++ 
Sbjct  372   KGQLLRKKMVQTANEGLMNRASSLEIYGKIQGVFIEMDCEKNTDSVDKELKSLKDAILQE  431

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +K+G L    D  K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  432   VDKEGTLAEEFDPIKHIEAHLPVRVNEQRLSNLLQSLLVGACVGAMPVIKMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER             VLEG HA+++ESVP K I  FTIFQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWER-------------VLEGPHASFMESVPSKTITVFTIFQLVYLL  538

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  539   ICFGITWI  546



>ref|XP_004960829.1| PREDICTED: boron transporter 4-like isoform X2 [Setaria italica]
Length=686

 Score =   494 bits (1273),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 237/373 (64%), Positives = 288/373 (77%), Gaps = 10/373 (3%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QFQWLY NGLL VIFS GVL TSL SREAR   YGTG+ RS IADYGVPLMV+LWTA+S
Sbjct  193   FQFQWLYVNGLLGVIFSMGVLYTSLASREARLSLYGTGWQRSLIADYGVPLMVILWTALS  252

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y++P ++PS VPRRL  PLPWEP S+ HWTV KD+  VPP YI    +PA M+AGLYFFD
Sbjct  253   YSLPSKIPSGVPRRLFTPLPWEPKSLQHWTVAKDLFSVPPAYIFLAIVPAAMVAGLYFFD  312

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLK PSAYHYDIL+L + TLICGLLG+PPSNGVLPQ+PMHT+SLA L
Sbjct  313   HSVASQMAQQKEFNLKNPSAYHYDILVLSLTTLICGLLGIPPSNGVLPQSPMHTRSLAVL  372

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEM------GSSPAPVADKELNNLKV  705
             K QL+RK+M+ +AKEGM   AT SE+YG+M  V+++M         P+  A  EL +LK 
Sbjct  373   KRQLLRKKMIRTAKEGMMQNATSSEVYGKMQDVFIKMDLGGDVSVHPSVSAHNELKDLKN  432

Query  706   AVMKNDEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTS  873
             A++   + +G +    D  K ++A+LPV VNEQR+SNLLQS+ V   I   P+I+ IPTS
Sbjct  433   AIIPEGDGEGKVPEVFDPEKHVEAYLPVRVNEQRLSNLLQSLLVAGCIGVTPLIQRIPTS  492

Query  874   VLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQ  1053
             VLWGYFAYM+ DS+PGNQFWERI LLF+ P RR+KV EG HA++VESVPF  I+ FT+FQ
Sbjct  493   VLWGYFAYMSIDSVPGNQFWERIQLLFITPQRRYKVFEGAHASFVESVPFNIISAFTLFQ  552

Query  1054  FVYLLVCFGVTWI  1092
              +YLL+ FG+TWI
Sbjct  553   LIYLLLVFGMTWI  565



>ref|XP_004960828.1| PREDICTED: boron transporter 4-like isoform X1 [Setaria italica]
Length=681

 Score =   494 bits (1272),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 237/368 (64%), Positives = 287/368 (78%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QFQWLY NGLL VIFS GVL TSL SREAR   YGTG+ RS IADYGVPLMV+LWTA+S
Sbjct  193   FQFQWLYVNGLLGVIFSMGVLYTSLASREARLSLYGTGWQRSLIADYGVPLMVILWTALS  252

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y++P ++PS VPRRL  PLPWEP S+ HWTV KD+  VPP YI    +PA M+AGLYFFD
Sbjct  253   YSLPSKIPSGVPRRLFTPLPWEPKSLQHWTVAKDLFSVPPAYIFLAIVPAAMVAGLYFFD  312

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLK PSAYHYDIL+L + TLICGLLG+PPSNGVLPQ+PMHT+SLA L
Sbjct  313   HSVASQMAQQKEFNLKNPSAYHYDILVLSLTTLICGLLGIPPSNGVLPQSPMHTRSLAVL  372

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPV-ADKELNNLKVAVMKN  720
             K QL+RK+M+ +AKEGM   AT SE+YG+M  V+++M      V A  EL +LK A++  
Sbjct  373   KRQLLRKKMIRTAKEGMMQNATSSEVYGKMQDVFIKMDLGGDSVSAHNELKDLKNAIIPE  432

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              + +G +    D  K ++A+LPV VNEQR+SNLLQS+ V   I   P+I+ IPTSVLWGY
Sbjct  433   GDGEGKVPEVFDPEKHVEAYLPVRVNEQRLSNLLQSLLVAGCIGVTPLIQRIPTSVLWGY  492

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYM+ DS+PGNQFWERI LLF+ P RR+KV EG HA++VESVPF  I+ FT+FQ +YLL
Sbjct  493   FAYMSIDSVPGNQFWERIQLLFITPQRRYKVFEGAHASFVESVPFNIISAFTLFQLIYLL  552

Query  1069  VCFGVTWI  1092
             + FG+TWI
Sbjct  553   LVFGMTWI  560



>gb|EEC70035.1| hypothetical protein OsI_00613 [Oryza sativa Indica Group]
Length=659

 Score =   493 bits (1268),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 239/368 (65%), Positives = 286/368 (78%), Gaps = 18/368 (5%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQWLY NGLL VIFS G+L T+LRSR ARSW YG G+ R FIADYGVPLMV++WTA S
Sbjct  192   YQFQWLYVNGLLGVIFSIGLLYTALRSRRARSWVYGQGWLRGFIADYGVPLMVIVWTAFS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             YT+PK+VPS VPRRL  PLPWE +S+ HWTV KD+  VPP YI A  +PA M+AGLYFFD
Sbjct  252   YTLPKDVPSGVPRRLFSPLPWESSSLQHWTVAKDLFSVPPAYIFAAILPALMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLKKPSAYHYDIL+LG M L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             K QL+RK+M+ +A EG+  +A+  EIYG++  V++EM         DKEL +LK A+++ 
Sbjct  372   KGQLLRKKMVQTANEGLMNRASSLEIYGKIQGVFIEMDCEKNTDSVDKELKSLKDAMLQE  431

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
              +K+G L    D  K I+AHLPV VNEQR+SNLLQS+ VG  + A+PVI+MIPTSVLWGY
Sbjct  432   GDKEGTLAEEFDPIKHIEAHLPVRVNEQRLSNLLQSLLVGACVGAMPVIKMIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWER             VLEG HA+++ESVP K I  FTIFQ VYLL
Sbjct  492   FAYMAIDSLPGNQFWER-------------VLEGPHASFMESVPSKTIIVFTIFQLVYLL  538

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  539   ICFGITWI  546



>ref|XP_004302934.1| PREDICTED: boron transporter 4-like [Fragaria vesca subsp. vesca]
Length=667

 Score =   492 bits (1266),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 251/369 (68%), Positives = 301/369 (82%), Gaps = 6/369 (2%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQ + +Y NGLL VIF+ GVL TSL++R+ARSW YGTG+FRSFIADYGVPLMVVLWT +S
Sbjct  192   YQRESMYTNGLLGVIFTVGVLYTSLKTRKARSWWYGTGWFRSFIADYGVPLMVVLWTVIS  251

Query  184   YTVPKE-VPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             ++VP   VPS VPRRL  PL W+  S++HW+VIKDMGK+ P YI A FIPA M+AGLYFF
Sbjct  252   FSVPHNIVPSQVPRRLYSPLAWDSESLHHWSVIKDMGKISPGYIFAAFIPAMMVAGLYFF  311

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLKKPSAYHYDIL+LG++TL+CGL+GLPP NGVLPQAPMHTKSLA 
Sbjct  312   DHSVASQMAQQKEFNLKKPSAYHYDILLLGILTLLCGLIGLPPCNGVLPQAPMHTKSLAV  371

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
             LK QL+RK+M+ SAKE +K +A+ SE+YG M AV++EM +  A  +  KEL +LK AVMK
Sbjct  372   LKKQLIRKKMVKSAKESIKQKASNSELYGNMQAVFIEMDNWTADTSVVKELTDLKEAVMK  431

Query  718   NDEKDGN----LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
             ++ +  N     D  K IDA LPV VNEQRVSNLLQS+ V  S+ A+P I+ IPTSVLWG
Sbjct  432   SEHEGENAKDAFDPEKHIDAFLPVRVNEQRVSNLLQSLLVAASVFAMPAIKKIPTSVLWG  491

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWER++ LF+ P+RR++VLEG HA+++ESVPFKYIA FT+FQ VY 
Sbjct  492   YFAYMAIDSLPGNQFWERLLFLFITPSRRYRVLEGGHASFMESVPFKYIAIFTLFQLVYF  551

Query  1066  LVCFGVTWI  1092
             L CFGVTWI
Sbjct  552   LFCFGVTWI  560



>gb|EMT25132.1| Boron transporter-like protein 2 [Aegilops tauschii]
Length=592

 Score =   485 bits (1248),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 232/368 (63%), Positives = 287/368 (78%), Gaps = 16/368 (4%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QFQW+Y NGLL VIFS G+L T+LR+R ARSW YG G+ RSFIADYGVPLMV++WTA+S
Sbjct  129   HQFQWMYLNGLLGVIFSTGLLYTALRTRRARSWLYGLGWLRSFIADYGVPLMVIVWTALS  188

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y +P +VPS VPRRL  PLPWE +S+ HWTV KD+  VPP +I A  +PA M+AGLYFFD
Sbjct  189   YALPSKVPSGVPRRLFSPLPWESSSLQHWTVAKDLFSVPPAFIFAAILPALMVAGLYFFD  248

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KE+NLKKPSAYHYDIL+LG+  L+CGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  249   HSVASQLAQQKEYNLKKPSAYHYDILVLGLTVLLCGLIGIPPSNGVLPQSPMHTRSLAVL  308

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP-APVADKELNNLKVAVMKN  720
             + Q           E +  +A++ EIYG++H V+VEM +       D EL +LK AV++ 
Sbjct  309   RGQ-----------ESVVNRASRMEIYGKLHEVFVEMDNEQNTGSVDMELKSLKEAVLRE  357

Query  721   DEKD----GNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             + +D    G  D  K I+ HLPV VNEQR+SNLLQS+ VG  + A+PVIRMIPTSVLWGY
Sbjct  358   NGEDGKPAGEFDPRKHIEPHLPVRVNEQRLSNLLQSLMVGGCVAAMPVIRMIPTSVLWGY  417

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI L+F+  +RR+KVLEG HA++VESVP +  + FTIFQFVYLL
Sbjct  418   FAYMAIDSLPGNQFWERIQLIFISSSRRYKVLEGPHASFVESVPSRTTSAFTIFQFVYLL  477

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  478   ICFGITWI  485



>gb|EPS73271.1| hypothetical protein M569_01481, partial [Genlisea aurea]
Length=643

 Score =   487 bits (1253),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 245/365 (67%), Positives = 298/365 (82%), Gaps = 1/365 (0%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E  F W Y NGLL+VIFS G+LL+++ SR+ARSW YGTG+ RSFIADYGVPLMVV+WTA+
Sbjct  189   ENTFPWPYVNGLLSVIFSNGLLLSAITSRKARSWRYGTGWLRSFIADYGVPLMVVVWTAL  248

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY+VP  +PS VPRRL+ PLPWE +S+ HWTV +DMG+VP  YI    IPA MIAGLYFF
Sbjct  249   SYSVPGSIPSGVPRRLIGPLPWERSSLQHWTVTQDMGRVPVGYIFGAIIPALMIAGLYFF  308

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVA+QMAQ K+FNLK PSAYHYDIL+LG MTL+CGLLGLPPSNGVLPQ+PMHT+SLA 
Sbjct  309   DHSVAAQMAQQKDFNLKNPSAYHYDILLLGGMTLLCGLLGLPPSNGVLPQSPMHTRSLAV  368

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEM-GSSPAPVADKELNNLKVAVMK  717
             L  Q++RKRM+  AKEGMK  A+  EIYGRMHAV+V+M  +S +   +++L NLK  V++
Sbjct  369   LTKQMLRKRMVKCAKEGMKENASNQEIYGRMHAVFVKMENASSSQNVEQDLANLKEGVLQ  428

Query  718   NDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAY  897
             +DE+ G  D    ID +LPV VNEQRVSNLLQS  VG+++CA+PVI+ IPTSVLWGYFAY
Sbjct  429   HDEEGGKFDPETCIDENLPVRVNEQRVSNLLQSFLVGVAVCAMPVIKKIPTSVLWGYFAY  488

Query  898   MATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCF  1077
             MA DSLPGNQFWER++LL VP +RRFKV++  HA++V+SVPFKYIA FT+FQ  YLL  F
Sbjct  489   MAFDSLPGNQFWERLLLLLVPKSRRFKVIQEYHASFVQSVPFKYIATFTLFQLCYLLAVF  548

Query  1078  GVTWI  1092
             G+T I
Sbjct  549   GITKI  553



>gb|KEH35928.1| boron transporter-like protein [Medicago truncatula]
Length=513

 Score =   481 bits (1238),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 272/329 (83%), Gaps = 6/329 (2%)
 Frame = +1

Query  1    EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
            E QFQW Y NGLLAVIFSFG+++T+++SR+AR+W YG+   R FIADYGVP+MVVLWTAV
Sbjct  188  ELQFQWRYTNGLLAVIFSFGLIVTAVKSRKARTWRYGSRRLRGFIADYGVPVMVVLWTAV  247

Query  181  SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
            SY +P ++P+ VPRRL CPLPWEPAS+YHWTV+KDM KVP  YI    IPA MIAGLYFF
Sbjct  248  SYIMPDDIPNGVPRRLFCPLPWEPASLYHWTVVKDMWKVPVVYIFGAIIPALMIAGLYFF  307

Query  361  DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
            DHSVASQMAQ KEFNL+KPSAYHYD+ +LG+MTLICGLLGLPPSNGVLPQ+PMHTKSLA 
Sbjct  308  DHSVASQMAQQKEFNLQKPSAYHYDVFLLGIMTLICGLLGLPPSNGVLPQSPMHTKSLAV  367

Query  541  LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
            L+ QL+RKR++ SAKE M+ Q+T SE+YG+M AV++EM ++P     KEL  LK AVMK+
Sbjct  368  LRRQLIRKRVVKSAKECMEQQSTSSELYGKMQAVFIEMDTAPTV---KELETLKEAVMKS  424

Query  721  DEKDGNL---DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
            D K   +   D  K ID +LPV VNEQR++NLLQS+ +GLSI  + VI+ IPTSVLWGYF
Sbjct  425  DTKGCAMEPFDPEKYIDTYLPVRVNEQRMTNLLQSLLIGLSIIGISVIKRIPTSVLWGYF  484

Query  892  AYMATDSLPGNQFWERIVLLFVPPNRRFK  978
            AYMA DSLPGNQFWERI+LLFV P+RRFK
Sbjct  485  AYMAIDSLPGNQFWERILLLFVTPSRRFK  513



>gb|KHN06659.1| Putative boron transporter 6 [Glycine soja]
Length=620

 Score =   484 bits (1247),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 238/367 (65%), Positives = 279/367 (76%), Gaps = 47/367 (13%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E QF W YANGLLA+I SFG+L+T+  SR+AR+W YG+G+ R FIADYGVP+M+V+WT +
Sbjct  187   ENQFHWRYANGLLAIILSFGLLITATMSRKARTWKYGSGWLRGFIADYGVPMMLVIWTGL  246

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SYT+P ++PS+VPRRLVCPLPWE  S YHWTV+KDMGKVP  YI   FIPA MIAGLYFF
Sbjct  247   SYTLPGKIPSAVPRRLVCPLPWE--STYHWTVVKDMGKVPLGYIFGAFIPAVMIAGLYFF  304

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVAS+MAQ KEFNL+KPSAYHYDIL+LG+MTLICG+LGLPPSNGVLPQ+PMHTKSL  
Sbjct  305   DHSVASKMAQQKEFNLQKPSAYHYDILLLGIMTLICGILGLPPSNGVLPQSPMHTKSLTV  364

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             L+ Q                                           KEL NLK AVMK+
Sbjct  365   LRKQ------------------------------------------TKELENLKEAVMKS  382

Query  721   DEKDG---NLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             +EK+    N D  K IDA+LPV VNEQR+SNLLQS+ +GLSI +V +I+MIPTSVLWGYF
Sbjct  383   NEKNAAKENFDPDKHIDAYLPVRVNEQRMSNLLQSLLIGLSIFSVNIIKMIPTSVLWGYF  442

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA DSLPGNQFWERI LLF+PP+RR+K+LEG HA++VESVPFK IA FTI QFVY L+
Sbjct  443   AYMAIDSLPGNQFWERISLLFIPPSRRYKILEGYHASFVESVPFKTIAVFTILQFVYFLI  502

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  503   CFGVTWI  509



>gb|ABD78951.1| boron transporter [Oryza sativa Japonica Group]
Length=677

 Score =   486 bits (1251),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 233/368 (63%), Positives = 286/368 (78%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW Y NGLL +IFS G+L T++RSR ARS  YGTG+ RSFIADYGVPLMVV+WTA+S
Sbjct  193   YQFQWAYVNGLLGIIFSMGLLYTAIRSRSARSSLYGTGWQRSFIADYGVPLMVVVWTALS  252

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y++P ++PS VPRRL  PLPWEP S+ HWTV KD+  VPP YI    +PA M+AGLYFFD
Sbjct  253   YSLPSKIPSGVPRRLFTPLPWEPKSLQHWTVAKDLFSVPPPYIFLAIVPAVMVAGLYFFD  312

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQ+AQ KEFNLK PSAYHYDIL+L  M LICGL+G+PPSNGVLPQ+PMHT+SLA L
Sbjct  313   HSVASQLAQQKEFNLKNPSAYHYDILVLSFMVLICGLIGIPPSNGVLPQSPMHTRSLAVL  372

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-SPAPVADKELNNLKVAVMKN  720
             K QL+RK+M+ +AKEGM   A+ SE+YG+M  V+++M   S A    KEL  LK AV+  
Sbjct  373   KGQLLRKKMVQTAKEGMMNNASSSEVYGKMQEVFIKMDDKSNAKSVRKELKELKDAVIPE  432

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
                 G +    D  K I+A+LPV VNEQRVSNLLQS+ +   +  +P+I+ IPTSVLWGY
Sbjct  433   GNGAGRVSEVFDPEKHIEAYLPVRVNEQRVSNLLQSLLIAGCVGVMPIIQKIPTSVLWGY  492

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYM+ DS+PGNQFWER  LLF+ P RR+K+LEG HA+++ESVP K I+ FTIFQ VYLL
Sbjct  493   FAYMSIDSVPGNQFWERTQLLFISPQRRYKLLEGAHASFMESVPIKKISAFTIFQLVYLL  552

Query  1069  VCFGVTWI  1092
             + +G+TWI
Sbjct  553   IVWGMTWI  560



>ref|XP_008656127.1| PREDICTED: boron transporter 4-like [Zea mays]
Length=673

 Score =   486 bits (1250),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 234/368 (64%), Positives = 282/368 (77%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QFQWLY NGLL  IFS GVL T+L SR ARS  YGT + RS IADYGVPLMV+LWTA+S
Sbjct  193   FQFQWLYINGLLGFIFSMGVLYTALASRSARSSLYGTAWQRSLIADYGVPLMVILWTALS  252

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y++P  +PS VPRRL  PLPWEP S+ HWTV KD+  VP  +I    +PATM+AGLYFFD
Sbjct  253   YSLPSRIPSGVPRRLFTPLPWEPKSLQHWTVAKDLFSVPTVHIFLAIVPATMVAGLYFFD  312

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQM+Q KEFNLK PSAYHYDIL+L + TLICGLLG+PPSNGVLPQ+PMHT+SLA L
Sbjct  313   HSVASQMSQQKEFNLKNPSAYHYDILVLSLTTLICGLLGIPPSNGVLPQSPMHTRSLAVL  372

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPV-ADKELNNLKVAVMKN  720
             K QL+RK+M+ +AKEGM   AT SE+Y +M  V+++M      V A KEL +LK A++  
Sbjct  373   KRQLLRKKMVQTAKEGMMNNATSSEVYVKMQDVFIKMDHGGDSVSAHKELKDLKDAIIPE  432

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
                 G +    D  K +DA+LPV VNEQRVSNLLQS+ +   I   P+I+ IPTSVLWGY
Sbjct  433   GNGSGTVPEVFDPEKHVDAYLPVRVNEQRVSNLLQSLLIAGCIGVTPLIQKIPTSVLWGY  492

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYM+ DSLPGNQFWERI LLF+ P RR+KVLEG HA+++ESVPF  I  FT+FQ +YLL
Sbjct  493   FAYMSIDSLPGNQFWERIQLLFITPQRRYKVLEGAHASFMESVPFNTICTFTLFQLIYLL  552

Query  1069  VCFGVTWI  1092
             + FG+TWI
Sbjct  553   IVFGMTWI  560



>ref|XP_003568821.1| PREDICTED: boron transporter 4-like [Brachypodium distachyon]
 ref|XP_010231659.1| PREDICTED: boron transporter 4-like [Brachypodium distachyon]
Length=678

 Score =   483 bits (1242),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 232/368 (63%), Positives = 282/368 (77%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQF W+Y NGLL +IFS G+L T+LRSR ARS  YGTG+ RS IADYGVP+MV+LWTA+S
Sbjct  192   YQFHWVYINGLLGIIFSMGLLYTALRSRAARSSLYGTGWQRSLIADYGVPIMVILWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y++P ++PS VPRRL  PLPWEP S+ HWTV KD+  VPP YI    +PA M+AGLYFFD
Sbjct  252   YSLPSKIPSGVPRRLFTPLPWEPKSLQHWTVAKDLFSVPPAYIFLAIVPAAMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLK PSAYHYDIL+L    LICGLLG+PPSNGVLPQ+PMHT+SLA L
Sbjct  312   HSVASQMAQQKEFNLKNPSAYHYDILVLSFSVLICGLLGIPPSNGVLPQSPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMKN  720
             + Q +RK+M+ +AKEGM   A  SE+YG+M  V++EM      V+  KEL +LK AV+  
Sbjct  372   RRQALRKKMIQTAKEGMMNNANCSEVYGKMQEVFIEMDDKSNEVSVHKELRDLKDAVIPE  431

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
                 GN+    D  K ++A+LPV VNEQRVSNLLQS+ V   +  +P+I+ IPTSVLWGY
Sbjct  432   GNGAGNVPEVFDPEKHLEAYLPVRVNEQRVSNLLQSLLVAGCVGVMPIIQKIPTSVLWGY  491

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYM+ DSLPGNQFWER  LLFV P RR+KVLEG HA+++ESVPF  I  FT+FQ  YLL
Sbjct  492   FAYMSIDSLPGNQFWERFQLLFVAPQRRYKVLEGAHASFLESVPFNKIFAFTLFQLFYLL  551

Query  1069  VCFGVTWI  1092
             + +G+TWI
Sbjct  552   IVWGMTWI  559



>emb|CAN78158.1| hypothetical protein VITISV_032799 [Vitis vinifera]
Length=637

 Score =   481 bits (1238),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 231/368 (63%), Positives = 279/368 (76%), Gaps = 36/368 (10%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +Y+FQWLY NGLL +IFSFGVL TSL+SR ARSW Y TG+ R FIADYGVPLMV+LWTA+
Sbjct  191   KYEFQWLYTNGLLGIIFSFGVLFTSLKSRRARSWRYSTGWVREFIADYGVPLMVLLWTAL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY++PK+VPS VPRRL C  PW+  S Y W V++DMGKVP  YI A  IPA MIAGLYFF
Sbjct  251   SYSIPKKVPSGVPRRLFCRAPWDSDSNYQWAVVQDMGKVPLGYIFAALIPAVMIAGLYFF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQMAQ KEFNLK PSAYHYD+ +LGVM                            
Sbjct  311   DHSVASQMAQQKEFNLKNPSAYHYDLFLLGVM----------------------------  342

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
                 L+RK+M+ SAKE +K QA+ SE+YGRM AV++EM ++P  V+ DKEL +LK AVM 
Sbjct  343   ----LIRKKMVKSAKECIKEQASNSEMYGRMQAVFIEMDTAPXDVSVDKELKDLKEAVMN  398

Query  718   ND---EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
             ++   +  G  D  K ID +LPV VNEQRV+NLLQS+ VG+S+CA+PVI+ IPTSVLWGY
Sbjct  399   SEDGGDTKGKFDPEKHIDPYLPVRVNEQRVTNLLQSLLVGISVCAIPVIKAIPTSVLWGY  458

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYMA DSLPGNQFWERI+LLF+ P RR+KVLEG+HA++VE+VPFKYIA FT+FQ VYL+
Sbjct  459   FAYMAVDSLPGNQFWERILLLFITPGRRYKVLEGVHASFVETVPFKYIATFTLFQLVYLM  518

Query  1069  VCFGVTWI  1092
             +CFG+TWI
Sbjct  519   ICFGITWI  526



>ref|XP_010670707.1| PREDICTED: probable boron transporter 7 [Beta vulgaris subsp. 
vulgaris]
Length=676

 Score =   481 bits (1238),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 231/363 (64%), Positives = 277/363 (76%), Gaps = 1/363 (0%)
 Frame = +1

Query  7     QFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSY  186
              FQ +Y NGLL ++FSFGVL TSL++  ARSW YGTG+FRSFIADYGVPLM+V WTA+SY
Sbjct  190   DFQIIYMNGLLGLLFSFGVLFTSLKTITARSWLYGTGWFRSFIADYGVPLMIVFWTALSY  249

Query  187   TVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDH  366
              +P  + S +PRRL  P PW+  S  HWTV KDM KVP  YILA  IPA MIAGLYFFDH
Sbjct  250   AIPSRLSSEIPRRLDVPSPWDSGSQSHWTVFKDMSKVPVLYILAASIPAVMIAGLYFFDH  309

Query  367   SVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELK  546
             SVA+QMAQ +EFNLKK S++HYD+ +LG MTLICGLLGLPP NGVLPQAPMHTKSLA L+
Sbjct  310   SVAAQMAQQEEFNLKKSSSFHYDLFLLGFMTLICGLLGLPPCNGVLPQAPMHTKSLAVLR  369

Query  547   TQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMKND  723
              QL+RK+M+A AKE +   A+  E+Y ++   ++EM  +    A   EL  LK AVM + 
Sbjct  370   RQLIRKKMIAKAKECIDQDASNMEMYEKLQDAFLEMEPARDEAAVTSELRGLKEAVMSHS  429

Query  724   EKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAYMA  903
                   D AK IDAHLP+ V EQR SNL+QS+ VGL+  A+P+I+ IPTSVLWGYFA+M+
Sbjct  430   GYVKKFDPAKHIDAHLPIRVCEQRWSNLMQSLLVGLAAGAIPIIKQIPTSVLWGYFAFMS  489

Query  904   TDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCFGV  1083
              DSLPGNQFWER+ LLFV P RR+KV EG HA++VESVPFKYI  FT+FQ +Y L CFGV
Sbjct  490   LDSLPGNQFWERLPLLFVTPYRRYKVFEGNHASFVESVPFKYIMTFTLFQLIYFLFCFGV  549

Query  1084  TWI  1092
             TWI
Sbjct  550   TWI  552



>gb|EEC78613.1| hypothetical protein OsI_18656 [Oryza sativa Indica Group]
Length=673

 Score =   477 bits (1227),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 232/374 (62%), Positives = 285/374 (76%), Gaps = 11/374 (3%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW Y NGLL +IFS G+L T++RSR ARS  YGTG+ RSFIADYGVPLMVV+WTA+S
Sbjct  192   YQFQWAYVNGLLGIIFSMGLLYTAIRSRSARSSLYGTGWQRSFIADYGVPLMVVVWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y++P ++PS VPRRL  PLPWEP S+ HWTV KD+  VPP YI    +PA M+AGLYFFD
Sbjct  252   YSLPSKIPSGVPRRLFTPLPWEPKSLQHWTVAKDLFSVPPPYIFLAIVPAVMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVM------TLICGLLGLPPSNGVLPQAPMHT  525
             HSVASQ+AQ KE NLK PSAYHYDIL+L  M       LICGL+G+PPSNGVLPQ+PMHT
Sbjct  312   HSVASQLAQQKELNLKNPSAYHYDILVLSFMDTNALQVLICGLIGIPPSNGVLPQSPMHT  371

Query  526   KSLAELKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-SPAPVADKELNNLK  702
             +SLA LK QL+RK+M+ +AKEGM   A+ SE+YG+M  V+++M   S A    KEL  LK
Sbjct  372   RSLAVLKGQLLRKKMVQTAKEGMMNNASSSEVYGKMQEVFIKMDDKSNAKSVRKELKELK  431

Query  703   VAVMKNDEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
              AV+      G +    D  K I+A+LPV VNEQRVSNLLQS+ +   +  +P+I+ IPT
Sbjct  432   DAVIPEGNGAGRVSEVFDPEKHIEAYLPVRVNEQRVSNLLQSLLIAGCVGVMPIIQKIPT  491

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             SVLWGYFAYM+ DS+PGNQFWER  LLF+ P RR+K+LEG HA+++ESVP K I+ FTIF
Sbjct  492   SVLWGYFAYMSIDSVPGNQFWERTQLLFISPQRRYKLLEGAHASFMESVPIKKISAFTIF  551

Query  1051  QFVYLLVCFGVTWI  1092
             Q VYLL+ +G+TWI
Sbjct  552   QLVYLLIVWGMTWI  565



>ref|XP_002440699.1| hypothetical protein SORBIDRAFT_09g005350 [Sorghum bicolor]
 gb|EES19129.1| hypothetical protein SORBIDRAFT_09g005350 [Sorghum bicolor]
Length=660

 Score =   476 bits (1226),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 236/368 (64%), Positives = 284/368 (77%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             +QFQWLY NGLL +IFS GVL TSL S  ARS  YGTG+ RS IADYGVPL+V+LWTA+S
Sbjct  166   FQFQWLYINGLLGLIFSMGVLYTSLSSGSARSSLYGTGWQRSLIADYGVPLIVILWTALS  225

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y++P ++PS VPRRL  PLPWEP S+ HWTV KD+  VPP +I    +PA M+AGLYFFD
Sbjct  226   YSLPSKIPSGVPRRLFTPLPWEPKSLQHWTVAKDLFSVPPAHIFLAIVPAAMVAGLYFFD  285

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLK PSAYHYDIL+L + TLICGLLG+PPSNGVLPQ+PMHT+SLA L
Sbjct  286   HSVASQMAQQKEFNLKNPSAYHYDILVLSLTTLICGLLGIPPSNGVLPQSPMHTRSLAVL  345

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPV-ADKELNNLKVAVMKN  720
             K QL+RK+M+ +AKEGM   AT SE+YG+M  V+++M      V A KEL +LK A++  
Sbjct  346   KRQLLRKKMVQTAKEGMMNNATSSEVYGKMQDVFIKMDHGGDTVSAHKELKDLKDAIIPE  405

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
                 G +    D  K +DA+LPV VNEQRVSNLLQS+ +   I   P+I+ IPTSVLWGY
Sbjct  406   GNGAGTVPEVFDPEKHVDAYLPVRVNEQRVSNLLQSLLIAGCIGITPLIQRIPTSVLWGY  465

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYM+ DSLPGNQFWERI LLF+ P RR+KVLEG HA+++ESVPF  I  FT FQ +YLL
Sbjct  466   FAYMSIDSLPGNQFWERIKLLFITPQRRYKVLEGAHASFMESVPFNTICAFTAFQLIYLL  525

Query  1069  VCFGVTWI  1092
             + FG+TWI
Sbjct  526   IVFGMTWI  533



>gb|EMT10235.1| Boron transporter-like protein 2 [Aegilops tauschii]
Length=698

 Score =   472 bits (1214),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 231/374 (62%), Positives = 283/374 (76%), Gaps = 11/374 (3%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW+Y NGLL +IFS G+L T+L+SR ARS  YG G+ R+ IADYGVPLMV+LWTA+S
Sbjct  192   YQFQWVYINGLLGIIFSMGLLYTALKSRSARSSLYGAGWLRNVIADYGVPLMVILWTALS  251

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y++P ++PS VPRRL  PLPWEP S+ HWTV K++  VP  YIL   +PA M+AGLYFFD
Sbjct  252   YSLPTKIPSGVPRRLFTPLPWEPKSLQHWTVAKELFSVPLAYILLAIVPAMMVAGLYFFD  311

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLK PSAYHYDIL+L    LICGLLG+PPSNGVLPQAPMHT+SLA L
Sbjct  312   HSVASQMAQQKEFNLKNPSAYHYDILVLSFSVLICGLLGIPPSNGVLPQAPMHTRSLAVL  371

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-SPAPVADKELNNLKVAVMKN  720
             + Q +RK+M+ +AKEGM   A+ SE+YG+M  V+++M        A KEL  LK AV+  
Sbjct  372   RRQALRKQMVRTAKEGMMNNASSSEVYGKMQEVFIKMDDKGNEDSAHKELKELKDAVITE  431

Query  721   DEK--DGN--------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
              +K  +GN         D  K ++A+LPV VNEQRVSNLLQS+ V   I  VPVI+ IPT
Sbjct  432   GKKITEGNGAVTAPEVFDPEKHLEAYLPVRVNEQRVSNLLQSLLVVGCIGVVPVIQKIPT  491

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             SVLWGYF YM+ DSLPGNQF ER+ LLF+ P RR+KVLEG HA+++ESVPF  I  FT+F
Sbjct  492   SVLWGYFGYMSIDSLPGNQFGERLQLLFIAPRRRYKVLEGAHASFLESVPFNQILAFTLF  551

Query  1051  QFVYLLVCFGVTWI  1092
             Q +YLL+ +G+TWI
Sbjct  552   QLIYLLIVWGMTWI  565



>ref|XP_009786677.1| PREDICTED: boron transporter 4-like isoform X3 [Nicotiana sylvestris]
Length=531

 Score =   464 bits (1194),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 222/334 (66%), Positives = 265/334 (79%), Gaps = 8/334 (2%)
 Frame = +1

Query  1    EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
            +Y+F WLY NGLL +IF+ G+L T+L+SR+ARSW YGTG+FRSF+ADYGVPLMV++W+ +
Sbjct  191  KYKFHWLYTNGLLGIIFTIGLLYTALKSRKARSWWYGTGWFRSFVADYGVPLMVLVWSTL  250

Query  181  SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
            S+ VP ++PS VPRRL  PLPWE  S+YHW VIKDMGKVP  YI A  IPA MIAGLYFF
Sbjct  251  SFMVPGKLPSGVPRRLYSPLPWESTSLYHWIVIKDMGKVPLVYIFAALIPALMIAGLYFF  310

Query  361  DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
            DHSVASQMAQ KEFNL  PS+YHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSL  
Sbjct  311  DHSVASQMAQHKEFNLNNPSSYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLVV  370

Query  541  LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMK-  717
            LK QL+RK+M+ SAKE ++ +A+ SEIY  M  V++E+ SSP     KEL +LK AVMK 
Sbjct  371  LKKQLIRKKMVESAKESIRRKASNSEIYVNMQTVFIEIDSSPVTAVVKELEHLKEAVMKH  430

Query  718  ------NDEK-DGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSV  876
                  N EK +G  D    IDA+LPV +NEQRVSNLLQS+ V  S+ A+PVI+ IPTSV
Sbjct  431  ELNEYENGEKLNGKFDPENHIDAYLPVRLNEQRVSNLLQSLLVAASVGAMPVIKKIPTSV  490

Query  877  LWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFK  978
            LWGYFAYMA DSLPGNQ WERI LLF+ P+RRFK
Sbjct  491  LWGYFAYMAIDSLPGNQLWERIFLLFITPSRRFK  524



>ref|XP_006654099.1| PREDICTED: putative boron transporter 5-like [Oryza brachyantha]
Length=676

 Score =   467 bits (1202),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 229/368 (62%), Positives = 283/368 (77%), Gaps = 5/368 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW+Y NGLL +IFS G+L T++ SR ARS  YGTG+ R  IADYGVPLM VLWTA+S
Sbjct  193   YQFQWVYVNGLLGIIFSMGLLYTAISSRSARSSLYGTGWQRGLIADYGVPLMTVLWTALS  252

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y++P ++PS VPRRL  PLPWEP S+ HWTV KD+  VPP YI    +PA M+AGLYFFD
Sbjct  253   YSLPSKIPSGVPRRLFTPLPWEPKSLQHWTVAKDLFSVPPAYIFLAIVPAVMVAGLYFFD  312

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLK P AYHYDIL+L +  LICGLLG+PPSNGVLPQ+PMHT+SLA L
Sbjct  313   HSVASQMAQQKEFNLKNPPAYHYDILVLSLTVLICGLLGIPPSNGVLPQSPMHTRSLAVL  372

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-SPAPVADKELNNLKVAVMKN  720
             K QL+RK+M+ +AKEGMK  A+ SE+Y +M  V+++M   +      KEL +LK AV+  
Sbjct  373   KGQLLRKKMIRTAKEGMKNNASSSEVYDKMQEVFIKMDDKTSVSSVHKELKDLKDAVIPE  432

Query  721   DEKDGNL----DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGY  888
                 G +    D  K ++A+LPV VNEQRVSNLLQS+ +   + A+P+I+ IPTSVLWGY
Sbjct  433   GNGAGRVSEVFDPDKHLEAYLPVRVNEQRVSNLLQSLLIAGCLGAMPIIQKIPTSVLWGY  492

Query  889   FAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLL  1068
             FAYM+ DS+PGNQFWER  LLF+ P RR+K+LEG HA+++ESVP K I+ FTIFQ VYLL
Sbjct  493   FAYMSIDSVPGNQFWERTQLLFISPQRRYKLLEGAHASFMESVPIKKISAFTIFQLVYLL  552

Query  1069  VCFGVTWI  1092
             + FG+TWI
Sbjct  553   LVFGMTWI  560



>gb|EMS54934.1| Boron transporter 4 [Triticum urartu]
Length=989

 Score =   474 bits (1221),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 232/374 (62%), Positives = 283/374 (76%), Gaps = 11/374 (3%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQFQW+Y NGLL VIFS G+L T+L+SR ARS  YG G+ R+ IADYGVPLMV+LWTA+S
Sbjct  205   YQFQWVYINGLLGVIFSMGLLYTALKSRSARSSLYGAGWLRNVIADYGVPLMVILWTALS  264

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y++P ++PS VPRRL  PLPWEP S+ HWTV K++  VP  YIL   +PA M+AGLYFFD
Sbjct  265   YSLPTKIPSGVPRRLFTPLPWEPKSLQHWTVAKELFSVPLAYILLAIVPAVMVAGLYFFD  324

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ KEFNLK PSAYHYDIL+L    LICGLLG+PPSNGVLPQAPMHT+SLA L
Sbjct  325   HSVASQMAQQKEFNLKNPSAYHYDILVLSFSVLICGLLGIPPSNGVLPQAPMHTRSLAVL  384

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-SPAPVADKELNNLKVAVMKN  720
             + Q +RK+M+ +AKEGM   A+ SE+YG+M  V+++M        A KEL  LK AV+  
Sbjct  385   RRQALRKQMVRTAKEGMMNNASSSEVYGKMQEVFIKMDDKGNEDSAHKELKELKDAVITE  444

Query  721   DEK--DGN--------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPT  870
              +K  +GN         D  K ++A+LPV VNEQRVSNLLQS+ V   I  VPVI+ IPT
Sbjct  445   GKKITEGNGAVTAPEVFDPEKHLEAYLPVRVNEQRVSNLLQSLLVAGCIGVVPVIQKIPT  504

Query  871   SVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIF  1050
             SVLWGYF YM+ DSLPGNQF ER+ LLF+ P RR+KVLEG HA+++ESVPF  I  FT+F
Sbjct  505   SVLWGYFGYMSIDSLPGNQFGERLQLLFIAPRRRYKVLEGAHASFLESVPFNQILAFTVF  564

Query  1051  QFVYLLVCFGVTWI  1092
             Q +YLL+ +G+TWI
Sbjct  565   QLIYLLIVWGMTWI  578



>ref|XP_003597850.1| Anion exchanger family protein [Medicago truncatula]
Length=723

 Score =   460 bits (1183),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 229/365 (63%), Positives = 278/365 (76%), Gaps = 34/365 (9%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             +YQF WLYANGLL +IF+F +L TSL+SR ARSW YGTG+ RSFIADYG           
Sbjct  281   KYQFHWLYANGLLGIIFTFCLLYTSLKSRRARSWLYGTGWLRSFIADYG-----------  329

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
                  ++VPS VPRRLV PL WE AS++HWTVIKDMGKV   +I A F+PA MIAGLYFF
Sbjct  330   -----RKVPSGVPRRLVAPLAWESASLHHWTVIKDMGKVSLEHIFAAFVPALMIAGLYFF  384

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNLKK SAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTK+LA 
Sbjct  385   DHSVASQLAQQKEFNLKKSSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKNLAV  444

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVA-DKELNNLKVAVMK  717
             LK QL+R++M+ SAKE +  +A+ SEIYG M AV++EM + P   +  KEL +LK  V+ 
Sbjct  445   LKKQLIRRKMVKSAKESIGKKASNSEIYGMMQAVFIEMDNDPNNHSVVKELEDLKDFVLN  504

Query  718   NDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYFAY  897
              ++K  N                  ++SNLLQS+FVG+++ A+P I+MIPTSVLWGYFAY
Sbjct  505   GEDKGDN-----------------NKMSNLLQSLFVGVAVFAMPAIKMIPTSVLWGYFAY  547

Query  898   MATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLVCF  1077
             MA DSLPGNQFWERI+LLFV P+R +K+LEG HA++VESVPFK+I  FT+FQ VY LVCF
Sbjct  548   MAIDSLPGNQFWERILLLFVRPSRWYKLLEGDHASFVESVPFKHIVLFTLFQCVYFLVCF  607

Query  1078  GVTWI  1092
             GVTWI
Sbjct  608   GVTWI  612



>ref|XP_008352715.1| PREDICTED: probable boron transporter 2 [Malus domestica]
Length=711

 Score =   457 bits (1177),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 219/378 (58%), Positives = 283/378 (75%), Gaps = 17/378 (4%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++Q  W +ANG+ A++ SFG+LLTSLRSR+ARSW YG+G+ R F+ADYGVPLMV++W+AV
Sbjct  191   QFQPSWRFANGMFALVLSFGLLLTSLRSRKARSWRYGSGWLRGFVADYGVPLMVLIWSAV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY     VP  +PRRL  P PW P +  +WTVIKDM  VP  YI+  FIPATMIA LY+F
Sbjct  251   SYIPAGNVPKGIPRRLFSPNPWSPGAYENWTVIKDMLNVPVLYIIGAFIPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KP ++HYD+L+LG M +ICGLLG+PPSNGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPPSFHYDLLLLGFMVIICGLLGIPPSNGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKE-----LNNLKV  705
             LK QL+R R++A+A+  M+  A+  ++YG M   Y +M +   P+  +E     LN+LK 
Sbjct  371   LKHQLLRNRLVATARRCMRNNASLEQVYGSMQESYQQMQT---PLVYQEPSARGLNDLKD  427

Query  706   AVMKNDEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIR  858
             + ++     G++         D+ K+ID  LPV V EQR+SNLLQ+ FVG  + A+P ++
Sbjct  428   STVQMASSMGHIDAPVDETVFDVEKEIDDLLPVEVKEQRLSNLLQATFVGGCVAAMPFLK  487

Query  859   MIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAG  1038
             MIPTSVLWGYFA+MA ++LPGNQ WERI+LLF  P RR+KVLE  HAT+VE+VPFK IA 
Sbjct  488   MIPTSVLWGYFAFMAVENLPGNQCWERILLLFTAPTRRYKVLEEYHATFVETVPFKTIAA  547

Query  1039  FTIFQFVYLLVCFGVTWI  1092
             FTIFQ  YLLVCFG+TWI
Sbjct  548   FTIFQTAYLLVCFGITWI  565



>ref|XP_010679449.1| PREDICTED: probable boron transporter 2 [Beta vulgaris subsp. 
vulgaris]
Length=720

 Score =   457 bits (1177),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 219/376 (58%), Positives = 282/376 (75%), Gaps = 13/376 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+   W +ANG+ A++ SFG+LLT+LRSR+ARSW YG+G+ RS IADYGVPLMVV+WT +
Sbjct  191   EFLPSWRFANGMFALVLSFGLLLTALRSRKARSWRYGSGWLRSLIADYGVPLMVVIWTGL  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY     VP  +PRRL  P PW P +  +WTVIKDM  VP  +I+  F+PATMIA LY+F
Sbjct  251   SYIPSASVPHGIPRRLFSPNPWSPGAYENWTVIKDMLNVPVLHIIGAFVPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KP ++HYD+L+LG MTL CGL+G+PP+NGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPPSFHYDLLLLGFMTLFCGLIGIPPANGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSS---PAPVADKELNNLKVAV  711
             LK QL+R R++A+AK+ M M A+  ++YG M   Y +M +      P +D+ L  LK + 
Sbjct  371   LKHQLLRNRLVAAAKKSMGMNASLGQLYGNMQEAYQQMQTPLIYQGP-SDRGLKELKDST  429

Query  712   MKNDEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMI  864
             ++     G++         D+ K+ID  LPV V EQRVSNLLQS+ VG  + A+P+++ I
Sbjct  430   IQAAASMGHIDAPVDESIFDVDKEIDDLLPVEVKEQRVSNLLQSVMVGGCVAAMPILKKI  489

Query  865   PTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFT  1044
             PTSVLWGYFA+MA +SLPGNQFWERI+LLF  P RR+KVLE  HAT+VE+VPFK IA FT
Sbjct  490   PTSVLWGYFAFMAIESLPGNQFWERILLLFTAPTRRYKVLEDYHATFVETVPFKTIAIFT  549

Query  1045  IFQFVYLLVCFGVTWI  1092
             IFQ +YLLVCFG+TWI
Sbjct  550   IFQTLYLLVCFGITWI  565



>gb|KDO72103.1| hypothetical protein CISIN_1g004693mg [Citrus sinensis]
Length=620

 Score =   454 bits (1168),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 217/371 (58%), Positives = 279/371 (75%), Gaps = 10/371 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             EYQ  W +ANG+ A++ SFG+L T+LRSR+ARSW YG+G  R FIADYGVPLMV++WTAV
Sbjct  191   EYQPSWRFANGMFALVLSFGLLHTALRSRKARSWRYGSGCLRGFIADYGVPLMVLVWTAV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY   + VP  +PRRL  P PW P +  +WTVIKDM  VP  YI+  FIPATMIA LY+F
Sbjct  251   SYIPARSVPKGIPRRLFSPNPWSPGAYENWTVIKDMLNVPLLYIIGAFIPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPS++HYD+L+LG+M +ICGLLG+PP+NGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPSSFHYDLLLLGLMVIICGLLGIPPANGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKE-----LNNLKV  705
             LK QL+R R++ +A + +   A+  ++YG M   Y +M S   P+  +E     L  LK 
Sbjct  371   LKHQLLRNRLVETAHKCISNNASLGQVYGSMQEAYQQMQS---PLIYQESSAQGLKELKE  427

Query  706   AVMKNDE--KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVL  879
             + ++ D    +   D+ K+ID  LPV V EQR+SNLLQS  VG  + A+P+++ IPTSVL
Sbjct  428   SRIQMDAPVDENAFDIEKEIDDLLPVEVKEQRLSNLLQSTMVGGCVAAMPLLKRIPTSVL  487

Query  880   WGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFV  1059
             WGYFA+MA +SLPGNQFWERI+L+F  P+RR+KVLE  HAT+VE+VPFK I  FTIFQ  
Sbjct  488   WGYFAFMAIESLPGNQFWERILLIFTAPSRRYKVLENYHATFVETVPFKTILVFTIFQTA  547

Query  1060  YLLVCFGVTWI  1092
             YLLVCFG+TW+
Sbjct  548   YLLVCFGITWV  558



>ref|XP_004297106.1| PREDICTED: probable boron transporter 2-like [Fragaria vesca 
subsp. vesca]
Length=715

 Score =   457 bits (1175),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 220/378 (58%), Positives = 284/378 (75%), Gaps = 15/378 (4%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++Q  W +ANG+ A++ SFG+LLTSL+SR+ARSW YG+G  R FIADYGVPLMV++W+A+
Sbjct  191   QFQPSWRFANGMFALVLSFGLLLTSLKSRKARSWRYGSGSLRGFIADYGVPLMVLIWSAI  250

Query  181   SY--TVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLY  354
             SY  T    VP  +PRRL  P PW P +  +WTVIKDM  VP  YI+  FIPATMIA LY
Sbjct  251   SYIPTGSGSVPKELPRRLFSPNPWSPGAYENWTVIKDMLDVPVLYIIGAFIPATMIAVLY  310

Query  355   FFDHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSL  534
             +FDHSVASQ+AQ KEFNL+KP ++HYD+L+LG M +ICGL+G+PP+NGV+PQ+PMHT+SL
Sbjct  311   YFDHSVASQLAQQKEFNLRKPPSFHYDLLLLGFMVIICGLIGIPPANGVIPQSPMHTRSL  370

Query  535   AELKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSS---PAPVADKELNNLKV  705
             A LK QL+R R++A+A++ MK  A+  ++YG M   Y +M +      P A + L  LKV
Sbjct  371   ATLKHQLLRNRLVAAARKCMKNNASLGQVYGGMQEAYQQMQTPLIYQEPSA-RGLKELKV  429

Query  706   AVMKNDEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIR  858
             + ++     GN+         D+ KDID  LPV V EQR+SNLLQ+I VG  + A+P ++
Sbjct  430   STIQMASSMGNMDAPLDETVFDVEKDIDDLLPVEVKEQRLSNLLQAILVGGCVGAMPFLK  489

Query  859   MIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAG  1038
             MIPTSVLWGYFA+MA +SLPGNQFWERI+LLF  P+RR+KVLE  HAT+VE+VPF  IA 
Sbjct  490   MIPTSVLWGYFAFMAVESLPGNQFWERILLLFTAPSRRYKVLEEYHATFVETVPFNTIAA  549

Query  1039  FTIFQFVYLLVCFGVTWI  1092
             FT+FQ VYLLVCFG+TWI
Sbjct  550   FTVFQTVYLLVCFGITWI  567



>ref|XP_010319275.1| PREDICTED: boron transporter 1 isoform X1 [Solanum lycopersicum]
 ref|XP_010319279.1| PREDICTED: boron transporter 1 isoform X1 [Solanum lycopersicum]
Length=714

 Score =   457 bits (1175),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 217/378 (57%), Positives = 281/378 (74%), Gaps = 17/378 (4%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+Q  W +ANG+ A++ SFG+LLT+LRSR+ARSW YG+G+ R F ADYGVPLMV++WTAV
Sbjct  191   EFQPSWRFANGMFALVLSFGLLLTALRSRKARSWRYGSGWLRGFTADYGVPLMVLIWTAV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY   K VP+ +PRRL  P PW P +  +WTVIKDM  VP  +I+  FIPATM+A LY+F
Sbjct  251   SYIPGKNVPTGIPRRLFSPNPWSPGAYENWTVIKDMLDVPVLHIIGAFIPATMVAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPS+YHYD+L+LG M LICGLLG+PP+NGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPSSYHYDLLLLGFMVLICGLLGIPPANGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKE-----LNNLKV  705
             LK QL+R R++A A++ M      +E+Y  M   Y +M S   P+  +E     L  LK 
Sbjct  371   LKHQLLRNRLVAKARKCMTENGNLAEVYESMQEAYQQMQS---PLIHQEPSSRGLKELKE  427

Query  706   AVMKNDEKDGN---------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIR  858
             + ++   + GN          D+ KDID  LPV V EQR+SNLLQS  VG  + A+P+++
Sbjct  428   STIELASRIGNRDEPVDETIFDVEKDIDDLLPVEVKEQRLSNLLQSAMVGGCVAAMPLLK  487

Query  859   MIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAG  1038
             MIPTSVLWGYF +MA +SLPGNQFWERI+LLF  P+RR+KV+E  HA ++E+VP+K IA 
Sbjct  488   MIPTSVLWGYFGFMAIESLPGNQFWERILLLFTAPSRRYKVIEECHAVFIETVPYKTIAF  547

Query  1039  FTIFQFVYLLVCFGVTWI  1092
             FTIFQ +YLL+CFG+TW+
Sbjct  548   FTIFQSIYLLICFGITWV  565



>ref|XP_004229035.1| PREDICTED: boron transporter 1 isoform X2 [Solanum lycopersicum]
Length=713

 Score =   457 bits (1175),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 217/378 (57%), Positives = 281/378 (74%), Gaps = 17/378 (4%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+Q  W +ANG+ A++ SFG+LLT+LRSR+ARSW YG+G+ R F ADYGVPLMV++WTAV
Sbjct  191   EFQPSWRFANGMFALVLSFGLLLTALRSRKARSWRYGSGWLRGFTADYGVPLMVLIWTAV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY   K VP+ +PRRL  P PW P +  +WTVIKDM  VP  +I+  FIPATM+A LY+F
Sbjct  251   SYIPGKNVPTGIPRRLFSPNPWSPGAYENWTVIKDMLDVPVLHIIGAFIPATMVAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPS+YHYD+L+LG M LICGLLG+PP+NGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPSSYHYDLLLLGFMVLICGLLGIPPANGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKE-----LNNLKV  705
             LK QL+R R++A A++ M      +E+Y  M   Y +M S   P+  +E     L  LK 
Sbjct  371   LKHQLLRNRLVAKARKCMTENGNLAEVYESMQEAYQQMQS---PLIHQEPSSRGLKELKE  427

Query  706   AVMKNDEKDGN---------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIR  858
             + ++   + GN          D+ KDID  LPV V EQR+SNLLQS  VG  + A+P+++
Sbjct  428   STIELASRIGNRDEPVDETIFDVEKDIDDLLPVEVKEQRLSNLLQSAMVGGCVAAMPLLK  487

Query  859   MIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAG  1038
             MIPTSVLWGYF +MA +SLPGNQFWERI+LLF  P+RR+KV+E  HA ++E+VP+K IA 
Sbjct  488   MIPTSVLWGYFGFMAIESLPGNQFWERILLLFTAPSRRYKVIEECHAVFIETVPYKTIAF  547

Query  1039  FTIFQFVYLLVCFGVTWI  1092
             FTIFQ +YLL+CFG+TW+
Sbjct  548   FTIFQSIYLLICFGITWV  565



>ref|XP_006419285.1| hypothetical protein CICLE_v10004419mg [Citrus clementina]
 ref|XP_006488773.1| PREDICTED: boron transporter 1-like isoform X1 [Citrus sinensis]
 ref|XP_006488774.1| PREDICTED: boron transporter 1-like isoform X2 [Citrus sinensis]
 ref|XP_006488775.1| PREDICTED: boron transporter 1-like isoform X3 [Citrus sinensis]
 gb|ESR32525.1| hypothetical protein CICLE_v10004419mg [Citrus clementina]
Length=736

 Score =   457 bits (1176),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 215/369 (58%), Positives = 275/369 (75%), Gaps = 6/369 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             EYQ  W +ANG+ A++ SFG+L T+LRSR+ARSW YG+G  R FIADYGVPLMV++WTAV
Sbjct  191   EYQPSWRFANGMFALVLSFGLLHTALRSRKARSWRYGSGCLRGFIADYGVPLMVLVWTAV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY   + VP  +PRRL  P PW P +  +WTVIKDM  VP  YI+  FIPATMIA LY+F
Sbjct  251   SYIPARSVPKGIPRRLFSPNPWSPGAYENWTVIKDMLNVPLLYIIGAFIPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPS++HYD+L+LG+M +ICGLLG+PP+NGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPSSFHYDLLLLGLMVIICGLLGIPPANGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-----SPAPVADKELNNLKV  705
             LK QL+R R++ +A + +   A+  ++YG M   Y +M S       +    KEL   ++
Sbjct  371   LKHQLLRNRLVETAHKCISNNASLGQVYGSMQEAYQQMQSPLIYQESSAQGLKELKESRI  430

Query  706   AVMKNDEKDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
               M     +   D+ K+ID  LPV V EQR+SNLLQS  VG  + A+P+++ IPTSVLWG
Sbjct  431   Q-MDASVDENAFDIEKEIDDLLPVEVKEQRLSNLLQSTMVGGCVAAMPLLKRIPTSVLWG  489

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFA+MA +SLPGNQFWERI+L+F  P+RR+KVLE  HAT+VE+VPFK I  FTIFQ  YL
Sbjct  490   YFAFMAIESLPGNQFWERILLIFTAPSRRYKVLENYHATFVETVPFKTILVFTIFQTAYL  549

Query  1066  LVCFGVTWI  1092
             LVCFG+TW+
Sbjct  550   LVCFGITWV  558



>gb|KHG23009.1| Putative boron transporter 5 -like protein [Gossypium arboreum]
Length=363

 Score =   443 bits (1140),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 211/309 (68%), Positives = 251/309 (81%), Gaps = 7/309 (2%)
 Frame = +1

Query  178   VSYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYF  357
             +S++VP +VPS VPRRL  PLPWE AS  HWT   DMG+VPP YI A FIPA MIAGLYF
Sbjct  1     MSFSVPSKVPSGVPRRLFSPLPWESASTQHWT---DMGRVPPLYIFAAFIPAVMIAGLYF  57

Query  358   FDHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLA  537
             FDHSVASQMAQ KEFNLK PSAYHYDIL+LG MTL+CGL+GLPPSNGVLPQ+PMHTKSLA
Sbjct  58    FDHSVASQMAQQKEFNLKNPSAYHYDILLLGFMTLLCGLIGLPPSNGVLPQSPMHTKSLA  117

Query  538   ELKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMK  717
              LK Q++R++M+ SAKE +K++A+ SEIYG+M AV++EM  SP     KEL +LK  VMK
Sbjct  118   VLKGQVIRRKMVESAKESIKLKASDSEIYGKMQAVFIEMDKSPETAVVKELEDLKKVVMK  177

Query  718   NDE----KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWG  885
              +     K    D  K IDA+LPV VNEQRVSNLLQS+ V  S  A+PVI++IPTSVLWG
Sbjct  178   GENEGEIKKETFDPEKHIDAYLPVRVNEQRVSNLLQSLLVAASAFAMPVIKLIPTSVLWG  237

Query  886   YFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYL  1065
             YFAYMA DSLPGNQFWER++LLF+ P+RR+KVLE +HA++VESVP+++I  FT+FQ VYL
Sbjct  238   YFAYMAIDSLPGNQFWERMLLLFIAPSRRYKVLEHVHASFVESVPYRFITMFTLFQLVYL  297

Query  1066  LVCFGVTWI  1092
             LVCFGVTWI
Sbjct  298   LVCFGVTWI  306



>gb|KDO72102.1| hypothetical protein CISIN_1g004693mg [Citrus sinensis]
Length=736

 Score =   456 bits (1174),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 217/371 (58%), Positives = 279/371 (75%), Gaps = 10/371 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             EYQ  W +ANG+ A++ SFG+L T+LRSR+ARSW YG+G  R FIADYGVPLMV++WTAV
Sbjct  191   EYQPSWRFANGMFALVLSFGLLHTALRSRKARSWRYGSGCLRGFIADYGVPLMVLVWTAV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY   + VP  +PRRL  P PW P +  +WTVIKDM  VP  YI+  FIPATMIA LY+F
Sbjct  251   SYIPARSVPKGIPRRLFSPNPWSPGAYENWTVIKDMLNVPLLYIIGAFIPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPS++HYD+L+LG+M +ICGLLG+PP+NGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPSSFHYDLLLLGLMVIICGLLGIPPANGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKE-----LNNLKV  705
             LK QL+R R++ +A + +   A+  ++YG M   Y +M S   P+  +E     L  LK 
Sbjct  371   LKHQLLRNRLVETAHKCISNNASLGQVYGSMQEAYQQMQS---PLIYQESSAQGLKELKE  427

Query  706   AVMKNDE--KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVL  879
             + ++ D    +   D+ K+ID  LPV V EQR+SNLLQS  VG  + A+P+++ IPTSVL
Sbjct  428   SRIQMDAPVDENAFDIEKEIDDLLPVEVKEQRLSNLLQSTMVGGCVAAMPLLKRIPTSVL  487

Query  880   WGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFV  1059
             WGYFA+MA +SLPGNQFWERI+L+F  P+RR+KVLE  HAT+VE+VPFK I  FTIFQ  
Sbjct  488   WGYFAFMAIESLPGNQFWERILLIFTAPSRRYKVLENYHATFVETVPFKTILVFTIFQTA  547

Query  1060  YLLVCFGVTWI  1092
             YLLVCFG+TW+
Sbjct  548   YLLVCFGITWV  558



>gb|ABR18319.1| unknown [Picea sitchensis]
Length=671

 Score =   454 bits (1168),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 237/367 (65%), Positives = 292/367 (80%), Gaps = 4/367 (1%)
 Frame = +1

Query  4     YQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVS  183
             YQF WL+ANGL  ++ SFG+L+T+L+SR AR+W YGTG+ R FIADYGVP+M+++W+AVS
Sbjct  195   YQFPWLFANGLFGLLLSFGLLITALKSRRARAWRYGTGWLRGFIADYGVPVMILVWSAVS  254

Query  184   YTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFD  363
             Y+   +VP+ VPRRL  P PW P +  +WT+I+DM  VPP YILA  IPA MIAGLYFFD
Sbjct  255   YSASDKVPTGVPRRLFSPNPWAPGASSNWTIIRDMLNVPPMYILAALIPAIMIAGLYFFD  314

Query  364   HSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAEL  543
             HSVASQMAQ K+FNLK PSAYHYD+L+LG M L+CGLLGLPPSNGVLPQ+PMHTKSLA L
Sbjct  315   HSVASQMAQQKDFNLKNPSAYHYDMLLLGFMVLLCGLLGLPPSNGVLPQSPMHTKSLAVL  374

Query  544   KTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVAD-KELNNLKVAVM--  714
             K Q++RK+M+ SAK+ ++ QA+  EIYG M  V+V+M        D  EL +LK  V+  
Sbjct  375   KRQMIRKKMVESAKKSIEEQASTLEIYGNMQEVFVKMEQKGPTSKDLNELKDLKAIVLRS  434

Query  715   KNDEKDGN-LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLWGYF  891
             K DEKDGN  D  K I+A LPV V EQR+SNL+QS+ VG S+  +PVI+ IPTSVLWGYF
Sbjct  435   KEDEKDGNAFDPEKHIEACLPVRVKEQRLSNLMQSLLVGGSVGLMPVIKKIPTSVLWGYF  494

Query  892   AYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVYLLV  1071
             AYMA +SLPGNQFWER++LLF+ P RR+KVLE +HA++VE+VPFK IA FTIFQF+YLL 
Sbjct  495   AYMAIESLPGNQFWERLLLLFIAPTRRYKVLEDLHASFVETVPFKTIALFTIFQFIYLLS  554

Query  1072  CFGVTWI  1092
             CFGVTWI
Sbjct  555   CFGVTWI  561



>ref|XP_009372058.1| PREDICTED: probable boron transporter 2 [Pyrus x bretschneideri]
 ref|XP_009372059.1| PREDICTED: probable boron transporter 2 [Pyrus x bretschneideri]
Length=711

 Score =   455 bits (1171),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 217/378 (57%), Positives = 282/378 (75%), Gaps = 17/378 (4%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++Q  W +ANG+ A++ SFG+LLTSLRSR+ARSW YG+G+ R FIADYGVPLMV++W+A+
Sbjct  191   QFQPSWRFANGMFALVLSFGLLLTSLRSRKARSWRYGSGWLRGFIADYGVPLMVLIWSAI  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY     VP  +PRRL  P PW P S  +WTVIKDM  VP  +I   FIPATMIA LY+F
Sbjct  251   SYIPAGNVPKGIPRRLFSPNPWSPGSYENWTVIKDMLNVPVLFIFGAFIPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KP ++HYD+L+LG M +ICGLLG+PPSNGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPPSFHYDLLLLGFMVIICGLLGIPPSNGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKE-----LNNLKV  705
             LK QL+R R++A+A+  ++  A+  ++YG M   Y +M +   P+A +E     LN+LK 
Sbjct  371   LKHQLLRNRLVATARRCIRNNASLEQVYGSMQESYQQMQT---PLAYQEPSARGLNDLKD  427

Query  706   AVMKNDEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIR  858
             + ++     G++         D+ K+ID  LPV V EQR+SNLLQ+ FVG  + A+P ++
Sbjct  428   STVQMASSMGDIDAPVAETVFDVEKEIDDLLPVEVKEQRLSNLLQAAFVGGCVAAMPFLK  487

Query  859   MIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAG  1038
             MIPTSVLWGYFA+MA ++LPGNQ WERI+LLF  P RR+KVLE  HAT+VE+VPFK IA 
Sbjct  488   MIPTSVLWGYFAFMAVENLPGNQCWERILLLFTAPTRRYKVLEEYHATFVETVPFKTIAA  547

Query  1039  FTIFQFVYLLVCFGVTWI  1092
              TIFQ  YLLVCFG+TW+
Sbjct  548   LTIFQTAYLLVCFGITWV  565



>ref|XP_004241498.1| PREDICTED: probable boron transporter 2 [Solanum lycopersicum]
Length=720

 Score =   455 bits (1171),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 215/370 (58%), Positives = 278/370 (75%), Gaps = 11/370 (3%)
 Frame = +1

Query  16    WLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSYTVP  195
             W + NG+ A++ SFG+LLT+LRSR+ARSW YGTG+FR FIADYGVPLMV++WTAVSY   
Sbjct  196   WRFGNGMFALVLSFGLLLTALRSRKARSWRYGTGWFRGFIADYGVPLMVLVWTAVSYIPA  255

Query  196   KEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDHSVA  375
             ++VP  +PRRL  P PW P +  +WTVIK+M  VPP YI+  FIPATMIA LY+FDHSVA
Sbjct  256   RDVPQGIPRRLFSPNPWSPGAYSNWTVIKEMMHVPPLYIVGAFIPATMIAVLYYFDHSVA  315

Query  376   SQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELKTQL  555
             SQ++Q KEFNLKKPS+YHYD+L+LG + +ICGLLG+PPSNGV+PQ+PMHTKSLA LK QL
Sbjct  316   SQLSQQKEFNLKKPSSYHYDLLLLGFLVIICGLLGIPPSNGVIPQSPMHTKSLATLKHQL  375

Query  556   MRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-----SPAPVADKELNNLKVAVMKN  720
             +R ++ ++AK+ +   A   ++Y  M   Y EM +     +P+ +  KEL    V    +
Sbjct  376   LRNKLASTAKKNIDKNANLGQLYRSMQEAYNEMQTPLVYQTPSGLGLKELKETTVQRASS  435

Query  721   DE------KDGNLDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTSVLW  882
                      +   D+ KDID  LPV V EQR+SNLLQ++ VG  + A+P+++ IP+SVLW
Sbjct  436   TGYIDAPVDETVFDVDKDIDELLPVEVKEQRLSNLLQALMVGACVAAMPILKRIPSSVLW  495

Query  883   GYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQFVY  1062
             GYFA+MA +SLPGNQFWERI+LLF  P+RR+KVLE  HAT+VE+VPFK IA FT+FQ  Y
Sbjct  496   GYFAFMAIESLPGNQFWERILLLFTAPSRRYKVLEDNHATFVETVPFKTIAWFTLFQTFY  555

Query  1063  LLVCFGVTWI  1092
             LL+CFG+TWI
Sbjct  556   LLLCFGITWI  565



>ref|XP_006347452.1| PREDICTED: probable boron transporter 2-like [Solanum tuberosum]
Length=715

 Score =   455 bits (1170),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 216/373 (58%), Positives = 281/373 (75%), Gaps = 17/373 (5%)
 Frame = +1

Query  16    WLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAVSYTVP  195
             W + NG+ A++ SFG+LLT+LRSR+ARSW YG+G+FR FIADYGVPLMV++WTAVSY   
Sbjct  196   WRFGNGMFALVLSFGLLLTALRSRKARSWRYGSGWFRGFIADYGVPLMVLVWTAVSYIPA  255

Query  196   KEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFFDHSVA  375
             ++VP  +PRRL  P PW P +  +WTVIK+M  VPP YI+  FIPATMIA LY+FDHSVA
Sbjct  256   RDVPQGIPRRLFSPNPWSPGAYSNWTVIKEMMHVPPLYIVGAFIPATMIAVLYYFDHSVA  315

Query  376   SQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAELKTQL  555
             SQ++Q KEFNLKKPS+YHYD+L+LG + +ICGLLG+PPSNGV+PQ+PMHTKSLA LK QL
Sbjct  316   SQLSQQKEFNLKKPSSYHYDLLLLGFLVIICGLLGIPPSNGVIPQSPMHTKSLATLKHQL  375

Query  556   MRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGS-----SPAPVADKELNNLKVAVMKN  720
             +R ++ ++A++ +   A   ++Y  M   Y EM +     +P+ +  KE   LK A ++ 
Sbjct  376   LRNKLASTARKNIDKNANLGQLYRSMQEAYNEMQTPLVYQTPSGLGLKE---LKEATVQR  432

Query  721   DEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTS  873
                 G +         D+ KDID  LPV V EQR+SNLLQ++ VG  + A+P+++ IP+S
Sbjct  433   ASSTGYIDAPVDETVFDVDKDIDELLPVEVKEQRLSNLLQALMVGACVAAMPILKRIPSS  492

Query  874   VLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQ  1053
             VLWGYFA+MA +SLPGNQFWERI+LLF  P RR+KVLE  HAT+VE+VPFK IA FT+FQ
Sbjct  493   VLWGYFAFMAIESLPGNQFWERILLLFTAPGRRYKVLEDNHATFVETVPFKTIAWFTLFQ  552

Query  1054  FVYLLVCFGVTWI  1092
              VYLL+CFG+TWI
Sbjct  553   TVYLLLCFGITWI  565



>ref|XP_008223448.1| PREDICTED: probable boron transporter 2 [Prunus mume]
 ref|XP_008223449.1| PREDICTED: probable boron transporter 2 [Prunus mume]
 ref|XP_008223450.1| PREDICTED: probable boron transporter 2 [Prunus mume]
Length=713

 Score =   454 bits (1169),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 218/376 (58%), Positives = 277/376 (74%), Gaps = 13/376 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++Q  W +ANG+ A++ SFG+LLTSL+SR+ARSW YG+G  R F+ADYGVPLMV++W+AV
Sbjct  191   QFQPSWRFANGMFALVLSFGLLLTSLKSRKARSWRYGSGSLRGFVADYGVPLMVLIWSAV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY     VP  +PRRL  P PW P +  +WTVIKDM  VP  YI+  FIPATMIA LY+F
Sbjct  251   SYIPAGNVPKGIPRRLFSPNPWSPGAYENWTVIKDMLSVPVIYIIGAFIPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KP ++HYD+L+LG M +ICGL+G+PPSNGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPPSFHYDLLLLGFMVIICGLIGIPPSNGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSS---PAPVADKELNNLKVAV  711
             LK QL+R R++A+A+  MK  A+  ++YG M   Y +M +      P A + L  LK + 
Sbjct  371   LKHQLLRNRLVATARRCMKNNASLGQVYGSMQQAYQQMQTPLTYQGPSA-RGLKELKDST  429

Query  712   MKNDEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMI  864
              +     GN+         D+ K+ID  LPV V EQR+SNLLQ+ FVG  + A+P ++MI
Sbjct  430   FQMASSMGNINAPVDETVFDVEKEIDDLLPVEVKEQRLSNLLQATFVGGCVAAMPFLKMI  489

Query  865   PTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFT  1044
             PTSVLWGYFA+MA +SLPGNQ WERI+LLF  P RR+KVLE  HAT+VE+VPFK IA FT
Sbjct  490   PTSVLWGYFAFMAVESLPGNQCWERILLLFTAPTRRYKVLEEYHATFVETVPFKTIAAFT  549

Query  1045  IFQFVYLLVCFGVTWI  1092
             IFQ  YL VCFG+TWI
Sbjct  550   IFQTAYLFVCFGITWI  565



>ref|XP_008390404.1| PREDICTED: probable boron transporter 2 isoform X2 [Malus domestica]
 ref|XP_008351134.1| PREDICTED: probable boron transporter 2 isoform X2 [Malus domestica]
Length=709

 Score =   454 bits (1168),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 216/378 (57%), Positives = 282/378 (75%), Gaps = 17/378 (4%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++Q  W +ANG+ A++ SFG+LLTSLRSR+ARSW YG+G+ R FIADYGVPLMV++W+A+
Sbjct  191   QFQPSWRFANGMFALVLSFGLLLTSLRSRKARSWRYGSGWLRGFIADYGVPLMVLIWSAI  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY     VP  +PRRL  P PW P +  +WTVIKDM  VP  +I   FIPATMIA LY+F
Sbjct  251   SYIPAGNVPKGIPRRLFSPNPWSPGAYENWTVIKDMLNVPVLFIFGAFIPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KP ++HYD+L+LG M +ICGLLG+PPSNGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPPSFHYDLLLLGFMVIICGLLGIPPSNGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKE-----LNNLKV  705
             LK QL+R R++A+A+  ++  A+  ++YG M   Y +M +   P+A +E     LN+LK 
Sbjct  371   LKHQLLRNRLVATARRCIRNNASLEQVYGSMQESYQQMQT---PLAYQEPSARGLNDLKD  427

Query  706   AVMKNDEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIR  858
             + ++     G++         D+ K+ID  LPV V EQR+SNLLQ+ FVG  + A+P ++
Sbjct  428   STVQMASSMGDIDAPVDETVFDVEKEIDDLLPVEVKEQRLSNLLQATFVGGCVAAMPFLK  487

Query  859   MIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAG  1038
             MIPTSVLWGYFA+MA ++LPGNQ WERI+LLF  P RR+KVLE  HAT+VE+VPFK IA 
Sbjct  488   MIPTSVLWGYFAFMAVENLPGNQCWERILLLFTAPTRRYKVLEEYHATFVETVPFKTIAA  547

Query  1039  FTIFQFVYLLVCFGVTWI  1092
              TIFQ  YLLVCFG+TW+
Sbjct  548   LTIFQTAYLLVCFGITWV  565



>ref|XP_009590549.1| PREDICTED: boron transporter 1-like isoform X1 [Nicotiana tomentosiformis]
Length=718

 Score =   454 bits (1169),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 223/376 (59%), Positives = 284/376 (76%), Gaps = 12/376 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+   W +ANG+ A++ SFG+LLT+L+SR+ARSW YG G+ RS IADYGVPLMVV+WTAV
Sbjct  191   EFMPSWRFANGMFALVLSFGLLLTALKSRKARSWRYGAGWLRSLIADYGVPLMVVVWTAV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY   + VP  +PRRLV P PW P +  +WTVIKDM KVP  YIL  FIPATMIA LY+F
Sbjct  251   SYIPSESVPQGIPRRLVSPNPWSPGAFENWTVIKDMLKVPVLYILGAFIPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KP ++HYD+L+LG +TL+CGL+G+PPSNGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPPSFHYDLLLLGFLTLMCGLVGIPPSNGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSS---PAPVADKELNNLKVAV  711
             LK QL+R R++A+A++ M+  ++  ++YG M   Y +M +      P A + L  LK + 
Sbjct  371   LKHQLLRNRLVATARKSMQKNSSLGQLYGNMQEAYQQMQTPLIYQEPSARQGLKELKEST  430

Query  712   MKNDEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMI  864
             ++     GN+         D+ K+ID  LPV V EQRVSNLLQ+  VG  + A+PV+RMI
Sbjct  431   IQLASSMGNIDAPVDETVFDVEKEIDDLLPVEVKEQRVSNLLQATMVGGCVAAMPVLRMI  490

Query  865   PTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFT  1044
             PTSVLWGYFAYMA +SLPGNQFWERI+LLF  P+RR+KVLE  HAT+VE+VPFK I  FT
Sbjct  491   PTSVLWGYFAYMAIESLPGNQFWERILLLFTAPSRRYKVLEDYHATFVETVPFKSIVTFT  550

Query  1045  IFQFVYLLVCFGVTWI  1092
             IFQ +YLL CFG+TW+
Sbjct  551   IFQTLYLLACFGITWV  566



>ref|XP_008390400.1| PREDICTED: probable boron transporter 2 isoform X1 [Malus domestica]
 ref|XP_008390401.1| PREDICTED: probable boron transporter 2 isoform X1 [Malus domestica]
 ref|XP_008390402.1| PREDICTED: probable boron transporter 2 isoform X1 [Malus domestica]
 ref|XP_008390403.1| PREDICTED: probable boron transporter 2 isoform X1 [Malus domestica]
 ref|XP_008351130.1| PREDICTED: probable boron transporter 2 isoform X1 [Malus domestica]
 ref|XP_008351131.1| PREDICTED: probable boron transporter 2 isoform X1 [Malus domestica]
 ref|XP_008351132.1| PREDICTED: probable boron transporter 2 isoform X1 [Malus domestica]
 ref|XP_008351133.1| PREDICTED: probable boron transporter 2 isoform X1 [Malus domestica]
Length=711

 Score =   454 bits (1168),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 216/378 (57%), Positives = 282/378 (75%), Gaps = 17/378 (4%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             ++Q  W +ANG+ A++ SFG+LLTSLRSR+ARSW YG+G+ R FIADYGVPLMV++W+A+
Sbjct  191   QFQPSWRFANGMFALVLSFGLLLTSLRSRKARSWRYGSGWLRGFIADYGVPLMVLIWSAI  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY     VP  +PRRL  P PW P +  +WTVIKDM  VP  +I   FIPATMIA LY+F
Sbjct  251   SYIPAGNVPKGIPRRLFSPNPWSPGAYENWTVIKDMLNVPVLFIFGAFIPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KP ++HYD+L+LG M +ICGLLG+PPSNGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPPSFHYDLLLLGFMVIICGLLGIPPSNGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKE-----LNNLKV  705
             LK QL+R R++A+A+  ++  A+  ++YG M   Y +M +   P+A +E     LN+LK 
Sbjct  371   LKHQLLRNRLVATARRCIRNNASLEQVYGSMQESYQQMQT---PLAYQEPSARGLNDLKD  427

Query  706   AVMKNDEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIR  858
             + ++     G++         D+ K+ID  LPV V EQR+SNLLQ+ FVG  + A+P ++
Sbjct  428   STVQMASSMGDIDAPVDETVFDVEKEIDDLLPVEVKEQRLSNLLQATFVGGCVAAMPFLK  487

Query  859   MIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAG  1038
             MIPTSVLWGYFA+MA ++LPGNQ WERI+LLF  P RR+KVLE  HAT+VE+VPFK IA 
Sbjct  488   MIPTSVLWGYFAFMAVENLPGNQCWERILLLFTAPTRRYKVLEEYHATFVETVPFKTIAA  547

Query  1039  FTIFQFVYLLVCFGVTWI  1092
              TIFQ  YLLVCFG+TW+
Sbjct  548   LTIFQTAYLLVCFGITWV  565



>ref|XP_006841594.1| hypothetical protein AMTR_s00003p00203390 [Amborella trichopoda]
 gb|ERN03269.1| hypothetical protein AMTR_s00003p00203390 [Amborella trichopoda]
Length=722

 Score =   454 bits (1169),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/376 (58%), Positives = 281/376 (75%), Gaps = 13/376 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+   W +ANG+  ++ +FG+LLT+LRSR+ARSW YGTG+ RSFIADYGVPLMV++WTAV
Sbjct  191   EFVPSWRFANGMFGLVLTFGLLLTALRSRKARSWRYGTGWLRSFIADYGVPLMVLVWTAV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY    +VP  +PRRLV P PW P +  +WTVIK M  VP  YIL  FIPATMIA LY+F
Sbjct  251   SYIPSGDVPKGIPRRLVSPNPWSPGAYSNWTVIKQMLDVPVLYILGAFIPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KP ++HYD+L+LG +T+ICGL+G+PPSNGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPPSFHYDLLLLGFLTIICGLVGIPPSNGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP---APVADKELNNLKVAV  711
             LK QL+R R++A+A+  +   ++  ++YG M   Y +M  +P      + + L  LK + 
Sbjct  371   LKHQLLRNRLVATARNCISKNSSLGQLYGNMQEAYQQM-QTPLIYQEQSTRGLRELKEST  429

Query  712   MKNDEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMI  864
             ++     GN+         D+ K+ID  LPV V EQR+SNLLQ+  VG  + A+P I+MI
Sbjct  430   IQLASSMGNIDAPVDESIFDVEKEIDDLLPVEVKEQRLSNLLQAFMVGGCVAAMPFIKMI  489

Query  865   PTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFT  1044
             PTSVLWGYFA+MA +SLPGNQFWERI+LLF  P+RR+KVLE  HAT+VE+VPFK IA FT
Sbjct  490   PTSVLWGYFAFMAIESLPGNQFWERILLLFTAPSRRYKVLEEYHATFVETVPFKAIAFFT  549

Query  1045  IFQFVYLLVCFGVTWI  1092
             IFQ  YLLVCFG+TWI
Sbjct  550   IFQLTYLLVCFGMTWI  565



>ref|XP_010418569.1| PREDICTED: probable boron transporter 2 [Camelina sativa]
Length=633

 Score =   451 bits (1159),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/373 (59%), Positives = 283/373 (76%), Gaps = 9/373 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+   W +ANG+ A++ SFG+L+T+LRSR+ARSW YGTG+ RS +ADYGVPLMV++WT V
Sbjct  121   EFLPSWRFANGMFALVLSFGLLITALRSRKARSWRYGTGWLRSLVADYGVPLMVLVWTGV  180

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY    +VP  +PRRL  P PW P +  +WTV+K+M +VP  YI+  FIPATMIA LY+F
Sbjct  181   SYIPTGDVPKGIPRRLFSPNPWSPGAYENWTVVKEMLQVPVVYIIGAFIPATMIAVLYYF  240

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPS+YHYD+L+LG +TL+CGLLG+PPSNGV+PQ+PMHTKSLA 
Sbjct  241   DHSVASQLAQQKEFNLRKPSSYHYDLLLLGFLTLMCGLLGIPPSNGVIPQSPMHTKSLAT  300

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R R++A+A+  +K  A+  ++YG M  VY +M +       + L  L+ + ++ 
Sbjct  301   LKYQLLRNRLVATARRSIKQNASLGQLYGNMQDVYNQMQTPLVYQQPQGLKELRESTIQA  360

Query  721   DEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTS  873
                 GNL         D+ K+ID  LP+ V EQRVSNLLQ+I VG  + A+P+++MIPTS
Sbjct  361   TTFTGNLDAPVDETLFDIEKEIDDLLPIEVKEQRVSNLLQAIMVGGCVAAMPLLKMIPTS  420

Query  874   VLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQ  1053
             VLWGYFA+MA +SLPGNQFWERI+LLF  P+RRFKVLE  HAT+VE+VPFK IA FTIFQ
Sbjct  421   VLWGYFAFMAIESLPGNQFWERILLLFTAPSRRFKVLEDNHATFVETVPFKTIAMFTIFQ  480

Query  1054  FVYLLVCFGVTWI  1092
               YLL CFG+TWI
Sbjct  481   TTYLLTCFGLTWI  493



>ref|XP_010069747.1| PREDICTED: boron transporter 1-like isoform X2 [Eucalyptus grandis]
 gb|KCW58184.1| hypothetical protein EUGRSUZ_H00896 [Eucalyptus grandis]
Length=716

 Score =   453 bits (1165),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 220/376 (59%), Positives = 287/376 (76%), Gaps = 13/376 (3%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+   W +ANG+ A++ SFG+LLT+L+SR+ARSW YGTG+ RSFIADYGVPLMV++WTAV
Sbjct  191   EFLPSWRFANGMFALVLSFGLLLTALKSRKARSWRYGTGWLRSFIADYGVPLMVLVWTAV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY   K VP  +PRRLV P PW P +  +WTV+KDM  VP FYI+  FIPATMIA LY+F
Sbjct  251   SYIPAKSVPDGIPRRLVSPNPWSPGASENWTVVKDMLNVPFFYIIGAFIPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KP++YHYD+L+LG +TL+CGL+G+PP+NGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPASYHYDLLLLGFLTLMCGLIGVPPANGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSP---APVADKELNNLKVAV  711
             LK QL+R R++ +A+  ++  A+  ++YG M   Y +M  +P      + + LN LK   
Sbjct  371   LKHQLLRNRLVTTARRSIQNNASLGQLYGNMQEAYRQM-QTPLVYQGASSRGLNELKETT  429

Query  712   MKNDEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMI  864
             ++     GNL         D+ K+ID  LPV V EQRVSNLLQS+ VG  + A+P+++MI
Sbjct  430   IQAASSMGNLNAPVDETVFDVDKEIDDLLPVEVKEQRVSNLLQSMMVGGCVAAMPILKMI  489

Query  865   PTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFT  1044
             PTSVLWGYFA+MA +SLPGNQFWERI+LLF  P+RR+KVLE  HAT+VE+VPFK I  FT
Sbjct  490   PTSVLWGYFAFMAIESLPGNQFWERILLLFTAPSRRYKVLEEYHATFVETVPFKAIVTFT  549

Query  1045  IFQFVYLLVCFGVTWI  1092
             +FQ +YLL+CFG+TW+
Sbjct  550   LFQTIYLLICFGLTWV  565



>ref|XP_006337976.1| PREDICTED: boron transporter 1-like isoform X2 [Solanum tuberosum]
Length=712

 Score =   452 bits (1164),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 212/378 (56%), Positives = 282/378 (75%), Gaps = 17/378 (4%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+Q  W +ANG+ A++ SFG+LLT+LRSR+ARSW YG+G+ R FIADYGVPLMV++WTAV
Sbjct  191   EFQSSWRFANGMFALVLSFGLLLTALRSRKARSWRYGSGWLRGFIADYGVPLMVLIWTAV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY   K VP+ +PRRL  P PW P +  +WTVIK+M  VP  +I+  FIPATM+A LY+F
Sbjct  251   SYIPGKNVPTGIPRRLFSPNPWSPGAYENWTVIKEMLDVPVLHIIGAFIPATMVAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPS+YHYD+L+LG M +ICGLLG+PP+NGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPSSYHYDLLLLGFMVIICGLLGIPPANGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKE-----LNNLKV  705
             LK QL+R R++A A++ M      +E+Y  M   Y ++ S   P+  +E     L  LK 
Sbjct  371   LKHQLLRNRLVAKARKCMTENGNLAEVYESMQEAYQQIQS---PLIHQEPSSRGLKELKE  427

Query  706   AVMKNDEKDGN---------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIR  858
             + ++   + GN          D+ K+ID  LPV V EQR+SNLLQS  VG  + A+P+++
Sbjct  428   STIQLASRIGNRDEPVDETIFDVEKEIDDLLPVEVKEQRLSNLLQSAMVGGCVAAMPLLK  487

Query  859   MIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAG  1038
             MIPTSVLWGYF +MA +SLPGNQFWERI+LLF  P+RR+K++E  HA ++E+VP+K +A 
Sbjct  488   MIPTSVLWGYFGFMAIESLPGNQFWERILLLFTAPSRRYKIIEECHAVFIETVPYKTVAF  547

Query  1039  FTIFQFVYLLVCFGVTWI  1092
             FTIFQ +YLL+CFG+TW+
Sbjct  548   FTIFQSIYLLICFGITWV  565



>ref|XP_006337975.1| PREDICTED: boron transporter 1-like isoform X1 [Solanum tuberosum]
Length=713

 Score =   452 bits (1164),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 212/378 (56%), Positives = 282/378 (75%), Gaps = 17/378 (4%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+Q  W +ANG+ A++ SFG+LLT+LRSR+ARSW YG+G+ R FIADYGVPLMV++WTAV
Sbjct  191   EFQSSWRFANGMFALVLSFGLLLTALRSRKARSWRYGSGWLRGFIADYGVPLMVLIWTAV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY   K VP+ +PRRL  P PW P +  +WTVIK+M  VP  +I+  FIPATM+A LY+F
Sbjct  251   SYIPGKNVPTGIPRRLFSPNPWSPGAYENWTVIKEMLDVPVLHIIGAFIPATMVAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPS+YHYD+L+LG M +ICGLLG+PP+NGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPSSYHYDLLLLGFMVIICGLLGIPPANGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKE-----LNNLKV  705
             LK QL+R R++A A++ M      +E+Y  M   Y ++ S   P+  +E     L  LK 
Sbjct  371   LKHQLLRNRLVAKARKCMTENGNLAEVYESMQEAYQQIQS---PLIHQEPSSRGLKELKE  427

Query  706   AVMKNDEKDGN---------LDLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIR  858
             + ++   + GN          D+ K+ID  LPV V EQR+SNLLQS  VG  + A+P+++
Sbjct  428   STIQLASRIGNRDEPVDETIFDVEKEIDDLLPVEVKEQRLSNLLQSAMVGGCVAAMPLLK  487

Query  859   MIPTSVLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAG  1038
             MIPTSVLWGYF +MA +SLPGNQFWERI+LLF  P+RR+K++E  HA ++E+VP+K +A 
Sbjct  488   MIPTSVLWGYFGFMAIESLPGNQFWERILLLFTAPSRRYKIIEECHAVFIETVPYKTVAF  547

Query  1039  FTIFQFVYLLVCFGVTWI  1092
             FTIFQ +YLL+CFG+TW+
Sbjct  548   FTIFQSIYLLICFGITWV  565



>ref|XP_006402392.1| hypothetical protein EUTSA_v10005815mg [Eutrema salsugineum]
 gb|ESQ43845.1| hypothetical protein EUTSA_v10005815mg [Eutrema salsugineum]
Length=705

 Score =   452 bits (1163),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 221/373 (59%), Positives = 284/373 (76%), Gaps = 9/373 (2%)
 Frame = +1

Query  1     EYQFQWLYANGLLAVIFSFGVLLTSLRSREARSWPYGTGFFRSFIADYGVPLMVVLWTAV  180
             E+   W +ANG+ A++ SFG+L+T+LRSR+ARSW YGTG+ RS IADYGVPLMV++WT V
Sbjct  191   EFLPSWRFANGMFALVLSFGLLITALRSRKARSWRYGTGWLRSLIADYGVPLMVLVWTGV  250

Query  181   SYTVPKEVPSSVPRRLVCPLPWEPASMYHWTVIKDMGKVPPFYILAGFIPATMIAGLYFF  360
             SY    +VP  +PRRL  P PW P +  +WTV+K+M +VP  YI+  FIPATMIA LY+F
Sbjct  251   SYIPTGDVPKGIPRRLFSPNPWSPGAYENWTVVKEMLEVPIVYIIGAFIPATMIAVLYYF  310

Query  361   DHSVASQMAQPKEFNLKKPSAYHYDILMLGVMTLICGLLGLPPSNGVLPQAPMHTKSLAE  540
             DHSVASQ+AQ KEFNL+KPS+YHYD+L+LG +TLICGLLG+PPSNGV+PQ+PMHTKSLA 
Sbjct  311   DHSVASQLAQQKEFNLRKPSSYHYDLLLLGFLTLICGLLGIPPSNGVIPQSPMHTKSLAT  370

Query  541   LKTQLMRKRMMASAKEGMKMQATKSEIYGRMHAVYVEMGSSPAPVADKELNNLKVAVMKN  720
             LK QL+R R++A+A+  +K  A+  ++YG M  VY +M +       + L  LK + ++ 
Sbjct  371   LKYQLLRNRLVATARRSIKQNASLGQLYGNMQEVYNQMQTPLVYQQPQGLKELKESTIQA  430

Query  721   DEKDGNL---------DLAKDIDAHLPVGVNEQRVSNLLQSIFVGLSICAVPVIRMIPTS  873
                 GNL         D+ K+ID  LP+ V EQRVSNLLQ++ VG  + A+P+++MIPTS
Sbjct  431   TTFTGNLDAPVDETLFDIEKEIDDLLPIEVKEQRVSNLLQALMVGGCVAAMPLLKMIPTS  490

Query  874   VLWGYFAYMATDSLPGNQFWERIVLLFVPPNRRFKVLEGIHATYVESVPFKYIAGFTIFQ  1053
             VLWGYFA+MA +SLPGNQFWERI+LLF  P+RRFKVLE  HAT+VE+VPFK IA FTIFQ
Sbjct  491   VLWGYFAFMAIESLPGNQFWERILLLFTAPSRRFKVLEDNHATFVETVPFKTIAMFTIFQ  550

Query  1054  FVYLLVCFGVTWI  1092
               YLL+CFG+TWI
Sbjct  551   TTYLLICFGLTWI  563



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2581342896576