BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4472_g2_i1 len=839 path=[673:0-838]

Length=839
                                                                      Score     E

ref|NP_001234271.1|  whitefly-induced gp91-phox                         499   8e-167   
ref|NP_001275453.1|  respiratory burst oxidase homolog protein C        498   1e-166   
dbj|BAC56865.1|  respiratory burst oxidase homolog                      497   4e-166   Nicotiana benthamiana
ref|XP_009775685.1|  PREDICTED: respiratory burst oxidase homolog...    497   4e-166   
ref|XP_009619772.1|  PREDICTED: respiratory burst oxidase homolog...    496   7e-166   
gb|ABG35768.1|  NOX3                                                    481   7e-165   Striga asiatica [witchweed]
emb|CDO98277.1|  unnamed protein product                                493   2e-164   
gb|ADR70882.1|  respiratory burst oxidase D                             490   7e-164   
gb|KDP22507.1|  hypothetical protein JCGZ_26338                         488   3e-163   
gb|ABW87870.1|  NADPH oxidase                                           488   9e-163   Nicotiana attenuata
ref|XP_011003531.1|  PREDICTED: respiratory burst oxidase homolog...    486   3e-162   
ref|XP_011082784.1|  PREDICTED: respiratory burst oxidase homolog...    486   7e-162   
gb|AII25876.1|  NADPH oxidase A                                         485   1e-161   
ref|XP_011015154.1|  PREDICTED: respiratory burst oxidase homolog...    484   2e-161   
ref|XP_002318793.2|  respiratory burst oxidase C family protein         482   1e-160   Populus trichocarpa [western balsam poplar]
emb|CAC84140.1|  NADPH oxidase                                          481   7e-160   Nicotiana tabacum [American tobacco]
gb|KDP23231.1|  hypothetical protein JCGZ_23064                         479   2e-159   
ref|XP_002303736.2|  hypothetical protein POPTR_0003s15810g             479   3e-159   Populus trichocarpa [western balsam poplar]
ref|XP_002322314.2|  respiratory burst oxidase C family protein         478   4e-159   Populus trichocarpa [western balsam poplar]
ref|XP_004309557.1|  PREDICTED: respiratory burst oxidase homolog...    478   7e-159   
ref|XP_011073263.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...    477   2e-158   
ref|XP_008222292.1|  PREDICTED: respiratory burst oxidase homolog...    477   5e-158   
ref|XP_011020924.1|  PREDICTED: respiratory burst oxidase homolog...    475   1e-157   
gb|ADR70892.1|  respiratory burst oxidase C                             473   1e-157   
ref|XP_007017524.1|  Respiratory burst oxidase D                        475   2e-157   
ref|XP_008378424.1|  PREDICTED: respiratory burst oxidase homolog...    475   2e-157   
ref|XP_010249370.1|  PREDICTED: respiratory burst oxidase homolog...    474   2e-157   
gb|KHG00108.1|  Respiratory burst oxidase C                             473   3e-157   
ref|XP_009353482.1|  PREDICTED: respiratory burst oxidase homolog...    474   4e-157   
ref|XP_002511059.1|  respiratory burst oxidase, putative                473   4e-157   Ricinus communis
gb|AFS18256.1|  respiratory burst oxidase protein D                     454   4e-157   
ref|XP_010250429.1|  PREDICTED: respiratory burst oxidase homolog...    473   6e-157   
ref|XP_011040313.1|  PREDICTED: respiratory burst oxidase homolog...    471   2e-156   
gb|ADE76874.1|  unknown                                                 451   5e-156   
ref|XP_008369593.1|  PREDICTED: respiratory burst oxidase homolog...    471   7e-156   
ref|XP_007225362.1|  hypothetical protein PRUPE_ppa000883mg             471   8e-156   
ref|XP_002299364.2|  hypothetical protein POPTR_0001s12650g             469   1e-155   Populus trichocarpa [western balsam poplar]
ref|XP_009359839.1|  PREDICTED: respiratory burst oxidase homolog...    470   2e-155   
ref|XP_009792212.1|  PREDICTED: respiratory burst oxidase homolog...    462   2e-155   
gb|ADR70880.1|  respiratory burst oxidase A                             467   9e-155   
ref|XP_007210905.1|  hypothetical protein PRUPE_ppa000984mg             467   2e-154   
emb|CBI29288.3|  unnamed protein product                                463   2e-154   
ref|XP_010032776.1|  PREDICTED: respiratory burst oxidase homolog...    467   4e-154   
ref|XP_002268641.1|  PREDICTED: respiratory burst oxidase homolog...    465   7e-154   Vitis vinifera
emb|CBI29289.3|  unnamed protein product                                464   9e-154   
ref|XP_009610987.1|  PREDICTED: respiratory burst oxidase homolog...    463   1e-153   
ref|XP_010522982.1|  PREDICTED: respiratory burst oxidase homolog...    464   2e-153   
gb|KHG05306.1|  Respiratory burst oxidase D -like protein               463   4e-153   
ref|XP_009792203.1|  PREDICTED: respiratory burst oxidase homolog...    462   5e-153   
ref|XP_007038195.1|  NADPH/respiratory burst oxidase protein D          462   7e-153   
gb|AEX56133.1|  NADPH oxidase                                           461   2e-152   
ref|XP_007137830.1|  hypothetical protein PHAVU_009G159200g             461   2e-152   
gb|KHG21481.1|  Respiratory burst oxidase D -like protein               451   3e-152   
ref|XP_006395230.1|  hypothetical protein EUTSA_v10003619mg             460   5e-152   
emb|CDY45918.1|  BnaAnng07990D                                          459   8e-152   
gb|ACF05504.2|  respiratory burst oxidase-like protein                  459   1e-151   Citrullus colocynthis [alhandal]
ref|XP_006487656.1|  PREDICTED: respiratory burst oxidase homolog...    458   2e-151   
ref|XP_006279397.1|  hypothetical protein CARUB_v10007974mg             458   2e-151   
ref|XP_004141156.1|  PREDICTED: respiratory burst oxidase homolog...    459   2e-151   
gb|EPS73914.1|  hypothetical protein M569_00842                         457   2e-151   
ref|XP_008465165.1|  PREDICTED: respiratory burst oxidase homolog...    458   2e-151   
ref|XP_004166291.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...    458   2e-151   
ref|XP_004299201.1|  PREDICTED: respiratory burst oxidase homolog...    459   2e-151   
ref|XP_010657584.1|  PREDICTED: respiratory burst oxidase homolog...    458   2e-151   
ref|XP_006423884.1|  hypothetical protein CICLE_v10027774mg             458   3e-151   
ref|XP_004503030.1|  PREDICTED: respiratory burst oxidase homolog...    458   3e-151   
ref|XP_009129697.1|  PREDICTED: respiratory burst oxidase homolog...    458   3e-151   
gb|KHN31235.1|  Respiratory burst oxidase like protein C                458   4e-151   
gb|KHG02500.1|  Respiratory burst oxidase C                             457   4e-151   
ref|XP_003522455.1|  PREDICTED: respiratory burst oxidase homolog...    458   5e-151   
ref|XP_003602726.1|  Respiratory burst oxidase-like protein             457   1e-150   
gb|AGI65628.1|  NADPH oxidase                                           453   2e-150   
ref|XP_008239295.1|  PREDICTED: respiratory burst oxidase homolog...    455   5e-150   
emb|CDY35764.1|  BnaC02g38300D                                          454   8e-150   
ref|XP_010536571.1|  PREDICTED: respiratory burst oxidase homolog...    454   1e-149   
gb|AIT39747.1|  respiratory burst oxidase                               444   1e-149   
gb|KHN16903.1|  Respiratory burst oxidase like protein C                450   2e-149   
ref|XP_008375433.1|  PREDICTED: respiratory burst oxidase homolog...    454   2e-149   
ref|XP_006844712.1|  hypothetical protein AMTR_s00016p00250800          453   2e-149   
gb|KHN09692.1|  Respiratory burst oxidase like protein C                453   4e-149   
ref|XP_003526909.1|  PREDICTED: respiratory burst oxidase homolog...    453   4e-149   
ref|XP_003532261.1|  PREDICTED: respiratory burst oxidase homolog...    451   9e-149   
emb|CDY38845.1|  BnaA03g13340D                                          451   9e-149   
ref|XP_009132634.1|  PREDICTED: respiratory burst oxidase homolog...    451   9e-149   
emb|CDY32647.1|  BnaC03g16150D                                          451   1e-148   
gb|EYU24549.1|  hypothetical protein MIMGU_mgv1a001003mg                451   2e-148   
ref|XP_009360267.1|  PREDICTED: respiratory burst oxidase homolog...    451   4e-148   
gb|AAC39477.1|  respiratory burst oxidase protein C                     448   4e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445756.1|  PREDICTED: respiratory burst oxidase homolog...    443   5e-148   
ref|XP_002865839.1|  hypothetical protein ARALYDRAFT_495172             449   5e-148   
gb|AAS15724.1|  respiratory burst oxidase protein C                     449   6e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663498.1|  PREDICTED: respiratory burst oxidase homolog...    445   6e-148   
ref|NP_199919.1|  Respiratory burst oxidase homolog protein C           449   7e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863831.1|  hypothetical protein ARALYDRAFT_917612             449   7e-148   
gb|KFK36751.1|  hypothetical protein AALP_AA4G165200                    448   1e-147   
ref|XP_006282261.1|  hypothetical protein CARUB_v10028541mg             448   2e-147   
gb|ADQ74913.1|  respiratory burst oxidase protein 1                     449   2e-147   
gb|KHN17442.1|  Respiratory burst oxidase like protein C                447   3e-147   
ref|XP_010442839.1|  PREDICTED: respiratory burst oxidase homolog...    447   3e-147   
ref|XP_010442586.1|  PREDICTED: respiratory burst oxidase homolog...    447   4e-147   
ref|XP_010438870.1|  PREDICTED: respiratory burst oxidase homolog...    447   4e-147   
ref|XP_010482435.1|  PREDICTED: respiratory burst oxidase homolog...    447   4e-147   
gb|AFJ66221.1|  hypothetical protein 34G24.26                           448   4e-147   
ref|XP_003525163.2|  PREDICTED: respiratory burst oxidase homolog...    446   8e-147   
ref|XP_009404193.1|  PREDICTED: respiratory burst oxidase homolog...    447   1e-146   
ref|XP_008807833.1|  PREDICTED: respiratory burst oxidase homolog...    446   1e-146   
gb|ABA94089.2|  respiratory burst oxidase protein D, putative, ex...    446   2e-146   Oryza sativa Japonica Group [Japonica rice]
gb|AAC39479.1|  respiratory burst oxidase protein D                     446   2e-146   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199602.1|  respiratory burst oxidase-D                           445   2e-146   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41837.1|  putative respiratory burst oxidase protein             445   3e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004979405.1|  PREDICTED: respiratory burst oxidase homolog...    446   3e-146   
dbj|BAJ89207.1|  predicted protein                                      439   3e-146   
emb|CDX85316.1|  BnaC07g26270D                                          445   3e-146   
gb|EMT25284.1|  Respiratory burst oxidase-B-like protein                439   3e-146   
dbj|BAJ93971.1|  predicted protein                                      439   3e-146   
ref|XP_008807834.1|  PREDICTED: respiratory burst oxidase homolog...    445   4e-146   
gb|KFK35232.1|  hypothetical protein AALP_AA5G257400                    444   4e-146   
gb|AFJ66196.1|  hypothetical protein 7G9.15                             444   4e-146   
emb|CDX86335.1|  BnaA06g30520D                                          444   5e-146   
ref|XP_009151593.1|  PREDICTED: respiratory burst oxidase homolog...    444   5e-146   
ref|XP_010482026.1|  PREDICTED: respiratory burst oxidase homolog...    444   6e-146   
ref|XP_006402027.1|  hypothetical protein EUTSA_v10012613mg             444   7e-146   
gb|EEC68302.1|  hypothetical protein OsI_36373                          445   1e-145   Oryza sativa Indica Group [Indian rice]
ref|XP_003577502.1|  PREDICTED: respiratory burst oxidase homolog...    443   1e-145   
ref|XP_002450884.1|  hypothetical protein SORBIDRAFT_05g020380          444   1e-145   Sorghum bicolor [broomcorn]
ref|XP_007030987.1|  Respiratory burst oxidase B                        442   2e-145   
ref|XP_009421001.1|  PREDICTED: respiratory burst oxidase homolog...    443   2e-145   
gb|KHN43296.1|  Respiratory burst oxidase like protein B                441   3e-145   
ref|XP_003630437.1|  Respiratory burst oxidase-like protein             441   7e-145   
emb|CAM35833.1|  respiratory burst oxidase homologue                    436   7e-145   Medicago truncatula
gb|KHG19081.1|  Respiratory burst oxidase D -like protein               433   9e-145   
ref|XP_004494602.1|  PREDICTED: respiratory burst oxidase homolog...    440   2e-144   
dbj|BAJ97450.1|  predicted protein                                      441   2e-144   
ref|XP_007144946.1|  hypothetical protein PHAVU_007G196800g             439   2e-144   
ref|XP_006437008.1|  hypothetical protein CICLE_v10030649mg             440   2e-144   
ref|XP_006485050.1|  PREDICTED: respiratory burst oxidase homolog...    440   3e-144   
ref|XP_009404717.1|  PREDICTED: respiratory burst oxidase homolog...    440   3e-144   
ref|XP_003554649.1|  PREDICTED: respiratory burst oxidase homolog...    439   3e-144   
ref|XP_009404716.1|  PREDICTED: respiratory burst oxidase homolog...    440   5e-144   
ref|XP_010442849.1|  PREDICTED: respiratory burst oxidase homolog...    439   6e-144   
dbj|BAK03403.1|  predicted protein                                      439   7e-144   
ref|XP_010942321.1|  PREDICTED: respiratory burst oxidase homolog...    438   1e-143   
ref|XP_003626255.1|  Respiratory burst oxidase-like protein             436   2e-143   
ref|XP_003626253.1|  Respiratory burst oxidase-like protein             436   3e-143   
emb|CAN64415.1|  hypothetical protein VITISV_013316                     436   4e-143   Vitis vinifera
gb|KHN03979.1|  Respiratory burst oxidase like protein B                433   4e-143   
ref|XP_007147029.1|  hypothetical protein PHAVU_006G090200g             436   6e-143   
emb|CBI39505.3|  unnamed protein product                                435   7e-143   
ref|XP_002283888.1|  PREDICTED: respiratory burst oxidase homolog...    436   7e-143   Vitis vinifera
ref|XP_011036858.1|  PREDICTED: respiratory burst oxidase homolog...    435   9e-143   
ref|XP_010259644.1|  PREDICTED: respiratory burst oxidase homolog...    435   1e-142   
ref|XP_003521697.1|  PREDICTED: respiratory burst oxidase homolog...    434   2e-142   
ref|XP_004503856.1|  PREDICTED: respiratory burst oxidase homolog...    436   2e-142   
ref|XP_003591142.1|  Respiratory burst oxidase-like protein             434   3e-142   
gb|KDO56233.1|  hypothetical protein CISIN_1g002711mg                   434   4e-142   
ref|XP_006433403.1|  hypothetical protein CICLE_v10000227mg             433   4e-142   
gb|AEP25512.1|  putative respiratory burst oxidase-like protein A       433   5e-142   
gb|KCW44695.1|  hypothetical protein EUGRSUZ_L017712                    432   6e-142   
ref|XP_010530642.1|  PREDICTED: respiratory burst oxidase homolog...    434   6e-142   
ref|XP_003556516.1|  PREDICTED: respiratory burst oxidase homolog...    433   7e-142   
gb|AEP25514.1|  putative respiratory burst oxidase-like protein B       416   9e-142   
ref|XP_010041041.1|  PREDICTED: respiratory burst oxidase homolog...    432   2e-141   
gb|AFW64933.1|  respiratory burst oxidase protein D variant alpha       432   2e-141   
ref|NP_001157759.1|  LOC100136880 isoform 1                             432   2e-141   Zea mays [maize]
ref|XP_010025215.1|  PREDICTED: respiratory burst oxidase homolog...    431   3e-141   
ref|XP_006382490.1|  respiratory burst oxidase protein B                431   4e-141   
ref|XP_002512422.1|  respiratory burst oxidase, putative                430   9e-141   Ricinus communis
gb|AEX56131.1|  NADPH oxidase                                           429   1e-140   
ref|XP_008797083.1|  PREDICTED: respiratory burst oxidase homolog...    431   1e-140   
gb|KDP23484.1|  hypothetical protein JCGZ_23317                         430   1e-140   
ref|XP_007159934.1|  hypothetical protein PHAVU_002G279700g             430   1e-140   
ref|XP_008807835.1|  PREDICTED: respiratory burst oxidase homolog...    431   1e-140   
ref|XP_003536070.1|  PREDICTED: respiratory burst oxidase homolog...    429   2e-140   
ref|XP_007206556.1|  hypothetical protein PRUPE_ppa019730mg             428   4e-140   
ref|XP_010929525.1|  PREDICTED: respiratory burst oxidase homolog...    428   2e-139   
ref|XP_008450637.1|  PREDICTED: respiratory burst oxidase homolog...    427   2e-139   
ref|XP_008246416.1|  PREDICTED: respiratory burst oxidase homolog...    427   2e-139   
ref|XP_004168501.1|  PREDICTED: respiratory burst oxidase homolog...    425   2e-139   
ref|XP_010523349.1|  PREDICTED: respiratory burst oxidase homolog...    425   4e-139   
ref|XP_004135613.1|  PREDICTED: respiratory burst oxidase homolog...    426   5e-139   
ref|XP_010523340.1|  PREDICTED: respiratory burst oxidase homolog...    425   7e-139   
dbj|BAJ94299.1|  predicted protein                                      426   1e-138   
gb|EYU21750.1|  hypothetical protein MIMGU_mgv1a001620mg                421   2e-138   
ref|XP_010269487.1|  PREDICTED: respiratory burst oxidase homolog...    424   2e-138   
dbj|BAJ86360.1|  predicted protein                                      425   2e-138   
gb|ADR70881.1|  respiratory burst oxidase B                             424   3e-138   
ref|XP_008246413.1|  PREDICTED: respiratory burst oxidase homolog...    423   5e-138   
ref|XP_004241641.1|  PREDICTED: respiratory burst oxidase homolog...    421   1e-137   
ref|NP_001274981.1|  respiratory burst oxidase homolog protein B        421   2e-137   
ref|XP_009778242.1|  PREDICTED: respiratory burst oxidase homolog...    420   5e-137   
ref|XP_004230232.1|  PREDICTED: respiratory burst oxidase homolog...    419   7e-137   
gb|AAW78863.1|  respiratory burst oxidase 1                             420   1e-136   Medicago truncatula
sp|Q2HXK9.2|RBOHD_SOLTU  RecName: Full=Respiratory burst oxidase ...    417   3e-136   Solanum tuberosum [potatoes]
ref|XP_004495711.1|  PREDICTED: respiratory burst oxidase homolog...    418   3e-136   
gb|AFW64932.1|  respiratory burst oxidase protein D variant beta        411   3e-136   
ref|NP_001108123.1|  LOC100136880 isoform 2                             411   3e-136   Zea mays [maize]
emb|CDP15485.1|  unnamed protein product                                418   4e-136   
gb|EYU24552.1|  hypothetical protein MIMGU_mgv1a001077mg                417   1e-135   
ref|XP_009390376.1|  PREDICTED: respiratory burst oxidase homolog...    417   2e-135   
emb|CDY22644.1|  BnaC08g42780D                                          405   6e-135   
gb|EYU26891.1|  hypothetical protein MIMGU_mgv1a001109mg                415   8e-135   
ref|XP_009402525.1|  PREDICTED: respiratory burst oxidase homolog...    412   5e-134   
ref|XP_010112007.1|  Respiratory burst oxidase-like protein D           413   9e-134   
gb|ABG35769.1|  NOX2                                                    401   9e-134   Striga asiatica [witchweed]
ref|XP_006283129.1|  hypothetical protein CARUB_v10004156mg             409   2e-133   
ref|XP_009611315.1|  PREDICTED: respiratory burst oxidase homolog...    410   2e-133   
ref|XP_008800853.1|  PREDICTED: respiratory burst oxidase homolog...    410   5e-133   
ref|XP_008366996.1|  PREDICTED: respiratory burst oxidase homolog...    397   5e-133   
ref|XP_010549734.1|  PREDICTED: respiratory burst oxidase homolog...    410   5e-133   
ref|NP_001190250.1|  Respiratory burst oxidase-A                        409   6e-133   
ref|XP_010931626.1|  PREDICTED: respiratory burst oxidase homolog...    409   1e-132   
gb|EMT31127.1|  Respiratory burst oxidase-F-like protein                404   1e-132   
gb|AAB70398.1|  Strong similarity to Oryza NADPH oxidase (gb|X93301)    399   2e-132   Arabidopsis thaliana [mouse-ear cress]
gb|AAC39475.1|  respiratory burst oxidase protein A                     408   3e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006654681.1|  PREDICTED: respiratory burst oxidase homolog...    403   3e-132   
gb|EYU23415.1|  hypothetical protein MIMGU_mgv1a0020022mg               395   3e-132   
ref|NP_196356.1|  Respiratory burst oxidase-A                           408   4e-132   Arabidopsis thaliana [mouse-ear cress]
gb|ACB56488.1|  respiratory burst oxidase-like protein F2               404   4e-132   Hordeum vulgare subsp. vulgare [barley]
ref|NP_194239.2|  riboflavin synthase-like superfamily protein          406   5e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475733.1|  PREDICTED: respiratory burst oxidase homolog...    406   6e-132   
ref|NP_001190833.1|  riboflavin synthase-like superfamily protein       405   7e-132   
ref|XP_002867627.1|  hypothetical protein ARALYDRAFT_492327             406   7e-132   
ref|XP_009784877.1|  PREDICTED: respiratory burst oxidase homolog...    399   1e-131   
ref|XP_009112796.1|  PREDICTED: respiratory burst oxidase homolog...    407   2e-131   
emb|CDY08347.1|  BnaC09g12490D                                          407   2e-131   
emb|CDY38202.1|  BnaA09g11870D                                          407   2e-131   
ref|XP_002865538.1|  predicted protein                                  398   2e-131   
ref|XP_002873307.1|  respiratory burst oxidase protein A                406   2e-131   
ref|XP_009118326.1|  PREDICTED: respiratory burst oxidase homolog...    404   2e-131   
ref|XP_006399223.1|  hypothetical protein EUTSA_v10012617mg             406   3e-131   
ref|XP_010452698.1|  PREDICTED: respiratory burst oxidase homolog...    405   3e-131   
gb|EEC71441.1|  hypothetical protein OsI_03642                          394   3e-131   Oryza sativa Indica Group [Indian rice]
ref|XP_010533625.1|  PREDICTED: respiratory burst oxidase homolog...    406   5e-131   
gb|KHG03419.1|  Respiratory burst oxidase A                             403   5e-131   
ref|XP_008349116.1|  PREDICTED: respiratory burst oxidase homolog...    395   5e-131   
ref|XP_010674039.1|  PREDICTED: respiratory burst oxidase homolog...    405   5e-131   
ref|XP_010438933.1|  PREDICTED: putative respiratory burst oxidas...    390   8e-131   
emb|CAA63704.1|  NAD(P)H oxidase                                        395   8e-131   Oryza sativa [red rice]
dbj|BAD87798.1|  putative NAD(P)H oxidase                               393   1e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010924767.1|  PREDICTED: respiratory burst oxidase homolog...    405   1e-130   
ref|XP_007040366.1|  Respiratory burst oxidase protein A                405   1e-130   
ref|XP_006301285.1|  hypothetical protein CARUB_v10021686mg             405   1e-130   
gb|ACB56487.1|  respiratory burst oxidase-like protein F1               397   1e-130   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006413344.1|  hypothetical protein EUTSA_v10024426mg             401   2e-130   
ref|XP_006417613.1|  hypothetical protein EUTSA_v10006793mg             402   2e-130   
gb|ACB56485.1|  respiratory burst oxidase-like protein F2               405   2e-130   Hordeum vulgare subsp. vulgare [barley]
emb|CDY06348.1|  BnaA09g48550D                                          400   3e-130   
emb|CAK22348.1|  respiratory burst oxidase homologue A                  404   3e-130   Hordeum vulgare [barley]
gb|EMS62912.1|  Respiratory burst oxidase-like protein F                400   4e-130   
emb|CBI34401.3|  unnamed protein product                                403   4e-130   
ref|NP_973799.1|  Respiratory burst oxidase-B                           401   4e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423214.1|  PREDICTED: respiratory burst oxidase homolog...    402   6e-130   
emb|CDX70035.1|  BnaA10g23840D                                          402   6e-130   
ref|XP_002887923.1|  respiratory burst oxidase                          403   6e-130   
ref|XP_010430522.1|  PREDICTED: respiratory burst oxidase homolog...    403   6e-130   
gb|EAZ13446.1|  hypothetical protein OsJ_03364                          394   6e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010473652.1|  PREDICTED: respiratory burst oxidase homolog...    403   8e-130   
ref|XP_009610988.1|  PREDICTED: respiratory burst oxidase homolog...    400   9e-130   
ref|XP_002441420.1|  hypothetical protein SORBIDRAFT_09g026320          403   9e-130   Sorghum bicolor [broomcorn]
ref|XP_002277529.1|  PREDICTED: respiratory burst oxidase homolog...    403   9e-130   Vitis vinifera
gb|EMT13143.1|  Respiratory burst oxidase-F-like protein                397   9e-130   
gb|AFW78790.1|  hypothetical protein ZEAMMB73_226784                    402   1e-129   
gb|KFK40474.1|  hypothetical protein AALP_AA2G000500                    402   1e-129   
gb|AAB87790.1|  RbohAOsp                                                397   1e-129   Oryza sativa [red rice]
ref|XP_010491345.1|  PREDICTED: respiratory burst oxidase homolog...    401   2e-129   
ref|NP_001106018.1|  respiratory burst oxidase-like protein C           402   2e-129   Zea mays [maize]
ref|NP_001056115.1|  Os05g0528000                                       402   2e-129   Oryza sativa Japonica Group [Japonica rice]
gb|KHF98208.1|  Respiratory burst oxidase A                             402   2e-129   
dbj|BAA28953.1|  Atrboh F                                               402   2e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968726.1|  PREDICTED: respiratory burst oxidase homolog...    401   2e-129   
ref|NP_564821.1|  respiratory burst oxidase                             402   2e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416413.1|  PREDICTED: respiratory burst oxidase homolog...    402   2e-129   
ref|XP_006391675.1|  hypothetical protein EUTSA_v10023240mg             402   2e-129   
gb|AFW78791.1|  respiratory burst oxidase-like protein                  402   2e-129   
ref|XP_009122345.1|  PREDICTED: respiratory burst oxidase homolog...    400   2e-129   
ref|XP_006306752.1|  hypothetical protein CARUB_v10008289mg             399   2e-129   
dbj|BAJ33963.1|  unnamed protein product                                402   3e-129   
gb|KEH21155.1|  respiratory burst oxidase-like protein                  402   3e-129   
gb|KDP25371.1|  hypothetical protein JCGZ_20527                         402   3e-129   
ref|XP_011080899.1|  PREDICTED: respiratory burst oxidase homolog...    401   4e-129   
gb|KHN16780.1|  Respiratory burst oxidase like protein F                399   5e-129   
ref|XP_009350322.1|  PREDICTED: respiratory burst oxidase homolog...    401   5e-129   
dbj|BAC06825.1|  respiratory burst oxydase                              402   6e-129   
ref|NP_001044165.1|  Os01g0734200                                       395   6e-129   
ref|XP_003532995.1|  PREDICTED: respiratory burst oxidase homolog...    400   7e-129   
emb|CDP12086.1|  unnamed protein product                                401   8e-129   
ref|XP_006476481.1|  PREDICTED: respiratory burst oxidase homolog...    400   9e-129   
ref|XP_006439453.1|  hypothetical protein CICLE_v10018741mg             400   9e-129   
gb|KDO76360.1|  hypothetical protein CISIN_1g002259mg                   400   9e-129   
ref|XP_009137494.1|  PREDICTED: putative respiratory burst oxidas...    393   9e-129   
ref|XP_003568053.1|  PREDICTED: respiratory burst oxidase homolog...    401   9e-129   
ref|XP_004304974.1|  PREDICTED: respiratory burst oxidase homolog...    399   9e-129   
ref|XP_010458177.1|  PREDICTED: respiratory burst oxidase homolog...    397   1e-128   
ref|XP_002457825.1|  hypothetical protein SORBIDRAFT_03g014430          399   1e-128   
ref|NP_001234126.1|  NADPH oxidase                                      401   1e-128   
ref|XP_006385777.1|  NADPH oxidase family protein                       400   1e-128   
ref|XP_010489693.1|  PREDICTED: respiratory burst oxidase homolog...    397   1e-128   
dbj|BAC56864.1|  respiratory burst oxidase homolog                      400   1e-128   
ref|NP_001275304.1|  respiratory burst oxidase homolog protein A        400   1e-128   
ref|XP_004300824.1|  PREDICTED: respiratory burst oxidase homolog...    400   1e-128   
ref|XP_011022605.1|  PREDICTED: respiratory burst oxidase homolog...    396   2e-128   
emb|CAC87256.1|  NADPH oxidase                                          400   2e-128   
ref|XP_008792374.1|  PREDICTED: respiratory burst oxidase homolog...    399   3e-128   
emb|CAB36751.1|  respiratory burst oxidase-like protein                 397   3e-128   
ref|XP_004143967.1|  PREDICTED: respiratory burst oxidase homolog...    398   3e-128   
ref|XP_009631606.1|  PREDICTED: respiratory burst oxidase homolog...    399   3e-128   
ref|XP_006285093.1|  hypothetical protein CARUB_v10006425mg             397   4e-128   
ref|XP_010448480.1|  PREDICTED: putative respiratory burst oxidas...    396   4e-128   
ref|XP_007210398.1|  hypothetical protein PRUPE_ppa000913mg             399   4e-128   
ref|XP_006646295.1|  PREDICTED: respiratory burst oxidase homolog...    393   5e-128   
ref|XP_008437348.1|  PREDICTED: respiratory burst oxidase homolog...    398   5e-128   
ref|XP_010418449.1|  PREDICTED: respiratory burst oxidase homolog...    398   6e-128   
ref|XP_006413343.1|  hypothetical protein EUTSA_v10024427mg             395   7e-128   
ref|XP_004166269.1|  PREDICTED: respiratory burst oxidase homolog...    397   8e-128   
ref|XP_002456307.1|  hypothetical protein SORBIDRAFT_03g033800          397   8e-128   
gb|KHM99939.1|  Respiratory burst oxidase like protein F                397   9e-128   
gb|ACB56484.1|  respiratory burst oxidase-like protein F1               397   1e-127   
ref|XP_004961425.1|  PREDICTED: respiratory burst oxidase homolog...    398   1e-127   
gb|AFS18257.1|  respiratory burst oxidase protein F                     397   1e-127   
gb|ADR70890.1|  respiratory burst oxidase G                             397   1e-127   
ref|XP_003525369.1|  PREDICTED: respiratory burst oxidase homolog...    397   1e-127   
dbj|BAK02169.1|  predicted protein                                      397   1e-127   
dbj|BAJ94661.1|  predicted protein                                      397   1e-127   
gb|AEP25513.1|  putative respiratory burst oxidase-like protein C       397   1e-127   
ref|XP_002509871.1|  respiratory burst oxidase, putative                397   1e-127   
ref|XP_010433689.1|  PREDICTED: putative respiratory burst oxidas...    395   2e-127   
ref|XP_010433690.1|  PREDICTED: putative respiratory burst oxidas...    394   2e-127   
ref|XP_008238986.1|  PREDICTED: respiratory burst oxidase homolog...    397   3e-127   
ref|XP_010055795.1|  PREDICTED: respiratory burst oxidase homolog...    397   3e-127   
ref|XP_007160115.1|  hypothetical protein PHAVU_002G293700g             396   4e-127   
emb|CDY11053.1|  BnaA03g47120D                                          393   5e-127   
ref|XP_009137493.1|  PREDICTED: putative respiratory burst oxidas...    393   5e-127   
emb|CDM84067.1|  unnamed protein product                                395   5e-127   
ref|XP_011022604.1|  PREDICTED: respiratory burst oxidase homolog...    396   5e-127   
ref|XP_008673282.1|  PREDICTED: uncharacterized protein LOC100384...    394   5e-127   
ref|XP_004503663.1|  PREDICTED: respiratory burst oxidase homolog...    395   6e-127   
ref|XP_003569742.1|  PREDICTED: respiratory burst oxidase homolog...    395   6e-127   
ref|NP_001105965.1|  LOC100037794                                       395   8e-127   
ref|XP_010112614.1|  Respiratory burst oxidase-like protein F           400   9e-127   
tpg|DAA57760.1|  TPA: respiratory burst oxidase protein B               395   1e-126   
tpg|DAA54556.1|  TPA: hypothetical protein ZEAMMB73_247137              394   1e-126   
ref|XP_003538264.1|  PREDICTED: respiratory burst oxidase homolog...    394   1e-126   
gb|KHN35050.1|  Respiratory burst oxidase like protein F                394   2e-126   
ref|XP_003517484.1|  PREDICTED: respiratory burst oxidase homolog...    394   2e-126   
emb|CDX98976.1|  BnaC09g48590D                                          393   3e-126   
ref|XP_004969859.1|  PREDICTED: respiratory burst oxidase homolog...    394   4e-126   
gb|ABS85195.1|  RbohF                                                   393   7e-126   
emb|CDX92671.1|  BnaC07g39290D                                          388   8e-126   
gb|ADR70884.1|  respiratory burst oxidase F                             393   8e-126   
ref|XP_006368770.1|  hypothetical protein POPTR_0001s09970g             392   2e-125   
ref|XP_008670768.1|  PREDICTED: respiratory burst oxidase homolog...    390   3e-125   
ref|XP_002966462.1|  hypothetical protein SELMODRAFT_168047             389   3e-125   
ref|XP_009406782.1|  PREDICTED: respiratory burst oxidase homolog...    391   3e-125   
ref|XP_002982059.1|  hypothetical protein SELMODRAFT_115913             389   4e-125   
ref|NP_001167766.1|  uncharacterized protein LOC100381459               374   4e-125   
tpg|DAA42070.1|  TPA: hypothetical protein ZEAMMB73_604696              391   4e-125   
gb|AFS18255.1|  respiratory burst oxidase protein B                     387   5e-125   
ref|XP_007158539.1|  hypothetical protein PHAVU_002G160700g             390   5e-125   
ref|XP_002972507.1|  hypothetical protein SELMODRAFT_97417              389   8e-125   
ref|XP_008655905.1|  PREDICTED: respiratory burst oxidase homolog...    389   8e-125   
ref|XP_010261399.1|  PREDICTED: respiratory burst oxidase homolog...    389   1e-124   
ref|XP_002992564.1|  hypothetical protein SELMODRAFT_135543             389   1e-124   
emb|CDM82708.1|  unnamed protein product                                388   2e-124   
ref|XP_010533624.1|  PREDICTED: respiratory burst oxidase homolog...    390   2e-124   
ref|XP_010644201.1|  PREDICTED: respiratory burst oxidase homolog...    386   2e-124   
gb|EMT32939.1|  Respiratory burst oxidase-B-like protein                388   5e-124   
ref|XP_003567677.1|  PREDICTED: respiratory burst oxidase homolog...    387   5e-124   
ref|XP_011026969.1|  PREDICTED: respiratory burst oxidase homolog...    388   6e-124   
ref|XP_004980724.1|  PREDICTED: respiratory burst oxidase homolog...    385   7e-124   
ref|XP_010251608.1|  PREDICTED: respiratory burst oxidase homolog...    387   8e-124   
gb|ACB56481.1|  respiratory burst oxidase-like protein B1               384   1e-123   
ref|NP_001043020.1|  Os01g0360200                                       385   3e-123   
gb|EMS46678.1|  Respiratory burst oxidase-like protein B                383   5e-123   
gb|AAF24574.1|AC007764_16  F22C12.18                                    386   7e-123   
emb|CDX81047.1|  BnaC03g03010D                                          382   7e-123   
ref|XP_003602723.1|  Respiratory burst oxidase-like protein             383   2e-122   
ref|XP_006664613.1|  PREDICTED: respiratory burst oxidase homolog...    380   4e-122   
gb|ACB56482.1|  respiratory burst oxidase-like protein B2               382   5e-122   
gb|KGN53361.1|  hypothetical protein Csa_4G050170                       382   6e-122   
ref|XP_004165299.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...    382   6e-122   
ref|XP_004146573.1|  PREDICTED: respiratory burst oxidase homolog...    382   6e-122   
ref|XP_006644164.1|  PREDICTED: respiratory burst oxidase homolog...    381   1e-121   
ref|XP_008451998.1|  PREDICTED: respiratory burst oxidase homolog...    381   3e-121   
ref|XP_010676396.1|  PREDICTED: respiratory burst oxidase homolog...    378   2e-120   
ref|XP_008662098.1|  PREDICTED: uncharacterized protein LOC100381...    377   3e-120   
gb|ABA99453.1|  respiratory burst oxidase, putative, expressed          377   4e-120   
dbj|BAB84124.1|  respiratory burst oxidase protein F                    377   4e-120   
gb|AFW56509.1|  hypothetical protein ZEAMMB73_659141                    377   5e-120   
ref|XP_008670771.1|  PREDICTED: respiratory burst oxidase homolog...    372   1e-119   
ref|XP_002442264.1|  hypothetical protein SORBIDRAFT_08g017240          374   6e-119   
ref|XP_004962826.1|  PREDICTED: respiratory burst oxidase homolog...    373   7e-119   
emb|CDX81049.1|  BnaC03g03030D                                          370   3e-118   
tpg|DAA42075.1|  TPA: hypothetical protein ZEAMMB73_871898              369   2e-117   
ref|XP_002987538.1|  hypothetical protein SELMODRAFT_183259             366   1e-116   
gb|EEE68800.1|  hypothetical protein OsJ_27546                          353   1e-116   
ref|XP_009137496.1|  PREDICTED: putative respiratory burst oxidas...    365   2e-116   
ref|XP_002987726.1|  hypothetical protein SELMODRAFT_183352             365   3e-116   
gb|EPS63617.1|  hypothetical protein M569_11166                         358   9e-116   
ref|XP_010237191.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...    362   2e-115   
emb|CDX78290.1|  BnaA03g02020D                                          362   8e-115   
ref|XP_002974429.1|  hypothetical protein SELMODRAFT_101139             362   1e-114   
ref|XP_006661273.1|  PREDICTED: respiratory burst oxidase homolog...    352   2e-114   
ref|XP_006396931.1|  hypothetical protein EUTSA_v10028400mg             362   3e-114   
ref|XP_010422071.1|  PREDICTED: probable respiratory burst oxidas...    362   4e-114   
ref|XP_010422069.1|  PREDICTED: probable respiratory burst oxidas...    362   5e-114   
ref|XP_006843850.1|  hypothetical protein AMTR_s00007p00262640          361   6e-114   
ref|XP_002985727.1|  hypothetical protein SELMODRAFT_122844             360   8e-114   
ref|XP_004980720.1|  PREDICTED: respiratory burst oxidase homolog...    358   1e-113   
ref|XP_010455529.1|  PREDICTED: probable respiratory burst oxidas...    360   1e-113   
ref|XP_010455530.1|  PREDICTED: probable respiratory burst oxidas...    360   1e-113   
tpg|DAA42073.1|  TPA: hypothetical protein ZEAMMB73_696625              361   2e-113   
ref|XP_010435248.1|  PREDICTED: probable respiratory burst oxidas...    359   3e-113   
gb|KFK31903.1|  hypothetical protein AALP_AA6G173900                    357   4e-113   
ref|XP_010435241.1|  PREDICTED: probable respiratory burst oxidas...    359   4e-113   
gb|EMS60214.1|  Respiratory burst oxidase-like protein B                353   5e-113   
ref|XP_009128678.1|  PREDICTED: probable respiratory burst oxidas...    358   1e-112   
dbj|BAJ87852.1|  predicted protein                                      343   1e-112   
ref|XP_006289909.1|  hypothetical protein CARUB_v10003524mg             357   2e-112   
ref|XP_006828231.1|  hypothetical protein AMTR_s00023p00181580          355   2e-112   
tpg|DAA61634.1|  TPA: hypothetical protein ZEAMMB73_547100              340   3e-112   
gb|KEH35678.1|  respiratory burst oxidase-like protein D                356   3e-112   
ref|XP_008670770.1|  PREDICTED: respiratory burst oxidase homolog...    357   3e-112   
emb|CAB51407.1|  respiratory burst oxidase homolog F-like protein       357   4e-112   
gb|AES72972.2|  respiratory burst oxidase-like protein D                356   4e-112   
ref|NP_192862.2|  putative respiratory burst oxidase-I                  357   5e-112   
ref|XP_010917407.1|  PREDICTED: respiratory burst oxidase homolog...    352   1e-111   
ref|XP_010033187.1|  PREDICTED: putative respiratory burst oxidas...    353   1e-111   
emb|CDY25278.1|  BnaA02g21780D                                          355   1e-111   
ref|XP_010253837.1|  PREDICTED: putative respiratory burst oxidas...    353   2e-111   
gb|KCW52756.1|  hypothetical protein EUGRSUZ_J02107                     351   8e-111   
ref|XP_002460265.1|  hypothetical protein SORBIDRAFT_02g025660          348   1e-110   
ref|XP_002874679.1|  hypothetical protein ARALYDRAFT_489958             352   1e-110   
dbj|BAJ95243.1|  predicted protein                                      337   2e-110   
ref|XP_008797383.1|  PREDICTED: respiratory burst oxidase homolog...    352   2e-110   
gb|ACB56483.1|  respiratory burst oxidase-like protein E                353   2e-110   
dbj|BAJ89716.1|  predicted protein                                      353   2e-110   
ref|XP_004956897.1|  PREDICTED: respiratory burst oxidase homolog...    353   2e-110   
emb|CDY63433.1|  BnaCnng42100D                                          352   2e-110   
gb|EEC83672.1|  hypothetical protein OsI_29451                          353   3e-110   
ref|NP_001170285.1|  uncharacterized protein LOC100384248               333   3e-110   
ref|XP_010917405.1|  PREDICTED: respiratory burst oxidase homolog...    351   3e-110   
gb|EEC84635.1|  hypothetical protein OsI_31509                          350   4e-110   
ref|XP_008651819.1|  PREDICTED: uncharacterized protein LOC100502...    352   5e-110   
gb|EMS51619.1|  Respiratory burst oxidase-like protein E                342   8e-110   
ref|XP_009384814.1|  PREDICTED: putative respiratory burst oxidas...    348   8e-110   
ref|XP_010529624.1|  PREDICTED: probable respiratory burst oxidas...    350   1e-109   
ref|XP_004973608.1|  PREDICTED: respiratory burst oxidase homolog...    352   1e-109   
ref|NP_001061956.1|  Os08g0453700                                       352   1e-109   
gb|KFK33950.1|  hypothetical protein AALP_AA5G082900                    348   2e-109   
gb|KEH37648.1|  respiratory burst oxidase-like protein                  348   2e-109   
ref|XP_006844082.1|  hypothetical protein AMTR_s00006p00251470          348   3e-109   
ref|XP_010483647.1|  PREDICTED: putative respiratory burst oxidas...    335   3e-109   
gb|KEH22869.1|  respiratory burst oxidase-like protein                  340   3e-109   
gb|KEH37646.1|  respiratory burst oxidase-like protein                  348   5e-109   
ref|XP_003574580.1|  PREDICTED: respiratory burst oxidase homolog...    349   6e-109   
ref|NP_001063267.1|  Os09g0438000                                       349   7e-109   
ref|XP_008651821.1|  PREDICTED: uncharacterized protein LOC100502...    346   8e-109   
gb|KEH22867.1|  respiratory burst oxidase-like protein                  340   1e-108   
gb|AAZ79664.1|  putative respiratory burst oxidase                      327   1e-108   
ref|XP_002988802.1|  hypothetical protein SELMODRAFT_128789             342   2e-108   
ref|XP_004980520.1|  PREDICTED: respiratory burst oxidase homolog...    348   2e-108   
gb|AES79267.2|  respiratory burst oxidase-like protein                  345   2e-108   
gb|KHN49078.1|  Respiratory burst oxidase like protein E                339   2e-108   
ref|XP_011078139.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...    346   2e-108   
ref|XP_001753615.1|  predicted protein                                  340   4e-108   
ref|XP_002969827.1|  hypothetical protein SELMODRAFT_92462              345   4e-108   
ref|XP_003578168.1|  PREDICTED: respiratory burst oxidase homolog...    347   5e-108   
gb|EYU36233.1|  hypothetical protein MIMGU_mgv1a023588mg                343   6e-108   
ref|XP_009803142.1|  PREDICTED: putative respiratory burst oxidas...    338   7e-108   
ref|XP_009618155.1|  PREDICTED: putative respiratory burst oxidas...    338   7e-108   
dbj|BAD73393.1|  putative respiratory burst oxidase                     337   8e-108   
ref|XP_002964593.1|  hypothetical protein SELMODRAFT_81185              340   8e-108   
ref|XP_004488138.1|  PREDICTED: respiratory burst oxidase homolog...    345   1e-107   
ref|XP_004488139.1|  PREDICTED: respiratory burst oxidase homolog...    344   1e-107   
dbj|BAJ91445.1|  predicted protein                                      337   2e-107   
gb|EMS59216.1|  Respiratory burst oxidase-like protein E                336   2e-107   
gb|KEH22868.1|  respiratory burst oxidase-like protein                  341   2e-107   
gb|KHN40314.1|  Putative respiratory burst oxidase like protein H       340   2e-107   
gb|EMT26537.1|  Respiratory burst oxidase-B-like protein                338   2e-107   
gb|ABF50963.1|  NADPH oxidase                                           322   2e-107   
ref|XP_006597890.1|  PREDICTED: respiratory burst oxidase homolog...    340   3e-107   
ref|XP_002985163.1|  hypothetical protein SELMODRAFT_121926             340   3e-107   
dbj|BAK05237.1|  predicted protein                                      344   3e-107   
gb|KHN47615.1|  Respiratory burst oxidase like protein E                340   3e-107   
ref|XP_004492338.1|  PREDICTED: putative respiratory burst oxidas...    341   4e-107   
gb|EYU21772.1|  hypothetical protein MIMGU_mgv1a011557mg                324   4e-107   
dbj|BAD73392.1|  putative respiratory burst oxidase                     338   4e-107   
ref|XP_007138622.1|  hypothetical protein PHAVU_009G224100g             343   5e-107   
dbj|BAK03598.1|  predicted protein                                      340   6e-107   
ref|XP_009414001.1|  PREDICTED: respiratory burst oxidase homolog...    343   9e-107   
ref|XP_006583585.1|  PREDICTED: putative respiratory burst oxidas...    340   1e-106   
ref|XP_009803141.1|  PREDICTED: putative respiratory burst oxidas...    338   1e-106   
ref|XP_009618153.1|  PREDICTED: putative respiratory burst oxidas...    338   1e-106   
ref|XP_009618154.1|  PREDICTED: putative respiratory burst oxidas...    338   1e-106   
ref|XP_010047445.1|  PREDICTED: respiratory burst oxidase homolog...    342   2e-106   
gb|KDO57672.1|  hypothetical protein CISIN_1g003558mg                   331   2e-106   
ref|XP_003567250.1|  PREDICTED: putative respiratory burst oxidas...    339   3e-106   
gb|KCW79354.1|  hypothetical protein EUGRSUZ_C00773                     341   3e-106   
ref|XP_006587062.1|  PREDICTED: respiratory burst oxidase homolog...    341   3e-106   
ref|XP_010313535.1|  PREDICTED: putative respiratory burst oxidas...    333   4e-106   



>ref|NP_001234271.1| whitefly-induced gp91-phox [Solanum lycopersicum]
 gb|AAF73104.1|AF147783_1 whitefly-induced gp91-phox [Solanum lycopersicum]
 gb|AAF73124.1|AF148534_1 whitefly-induced gp91-phox [Solanum lycopersicum]
Length=938

 Score =   499 bits (1284),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 242/297 (81%), Positives = 256/297 (86%), Gaps = 18/297 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYL +PL LY GERL+RAFRSSIK VKILKVAVY GNVL L MSKPQG++YKSG
Sbjct  578  YKRTTWMYLTVPLALYAGERLLRAFRSSIKAVKILKVAVYPGNVLALHMSKPQGYKYKSG  637

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG
Sbjct  638  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  697

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG+NNPNFPRVLIDGPYGAPAQDYK+YEVVLLVGLGIGATPMISIVKDIV+NM
Sbjct  698  LLRADYLQGENNPNFPRVLIDGPYGAPAQDYKQYEVVLLVGLGIGATPMISIVKDIVNNM  757

Query  299  KAM---ENSEEEGGGITTGRSN---------------NNVNNFKTRRAYFYWVTREQGSF  174
            KAM   ENS E G G++    N               +  N+F TRRAYFYWVTREQGSF
Sbjct  758  KAMDEEENSLENGHGMSNAAQNASPNMAQKRGKSGSASGRNSFNTRRAYFYWVTREQGSF  817

Query  173  DWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            DWFKGIM+E AEMD K VIEMHNYCTSVYEEGDARSALI MLQSLH AK+GVDIVSG
Sbjct  818  DWFKGIMNEAAEMDHKGVIEMHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSG  874



>ref|NP_001275453.1| respiratory burst oxidase homolog protein C [Solanum tuberosum]
 sp|Q2HXL0.2|RBOHC_SOLTU RecName: Full=Respiratory burst oxidase homolog protein C; AltName: 
Full=NADPH oxidase RBOHC; AltName: Full=StRBOHC [Solanum 
tuberosum]
 dbj|BAE79344.2| NADPH oxidase [Solanum tuberosum]
Length=938

 Score =   498 bits (1283),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 241/297 (81%), Positives = 257/297 (87%), Gaps = 18/297 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK++TWMYL +PL+LY GERL+RAFRSSIK VKILKVAVY GNVL L MSKPQG++YKSG
Sbjct  578  YKRSTWMYLTVPLVLYAGERLLRAFRSSIKAVKILKVAVYPGNVLALHMSKPQGYKYKSG  637

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDD+LSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG
Sbjct  638  QYMFVNCAAVSPFEWHPFSITSAPGDDHLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  697

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG+NNPNFPRVLIDGPYGAPAQDYK+YEVVLLVGLGIGATPMISIVKDIV+NM
Sbjct  698  LLRADYLQGENNPNFPRVLIDGPYGAPAQDYKQYEVVLLVGLGIGATPMISIVKDIVNNM  757

Query  299  KAM---ENSEEEGGGITTGRSN---------------NNVNNFKTRRAYFYWVTREQGSF  174
            KAM   ENS E G G++    N               +  N+F TRRAYFYWVTREQGSF
Sbjct  758  KAMDEEENSLENGNGMSNAAQNASPNMAQKRGKSSSASGGNSFNTRRAYFYWVTREQGSF  817

Query  173  DWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            DWFKGIM+E AEMD K VIEMHNYCTSVYEEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  818  DWFKGIMNEAAEMDHKGVIEMHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSG  874



>dbj|BAC56865.1| respiratory burst oxidase homolog [Nicotiana benthamiana]
Length=939

 Score =   497 bits (1280),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 244/297 (82%), Positives = 256/297 (86%), Gaps = 18/297 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYL IP++LY  ERLIRAFRSSIK VKILKVAVY GNVL L MSKPQG++YKSG
Sbjct  579  YKRTTWMYLTIPIILYASERLIRAFRSSIKAVKILKVAVYPGNVLALHMSKPQGYKYKSG  638

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG
Sbjct  639  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  698

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG+NNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+NM
Sbjct  699  LLRADYLQGENNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNM  758

Query  299  KAM---ENSEEEGG----------GITTGRSNNN-----VNNFKTRRAYFYWVTREQGSF  174
            KAM   ENS E+G            I   + N +      NNF TRRAYFYWVTREQGSF
Sbjct  759  KAMDEEENSLEDGHNNNMAPNSSPNIAKNKGNKSGSASGRNNFNTRRAYFYWVTREQGSF  818

Query  173  DWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            DWFKGIM+E AEMD K VIEMHNYCTSVYEEGDARSALI MLQSLH AK+GVDIVSG
Sbjct  819  DWFKGIMNEAAEMDHKGVIEMHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSG  875



>ref|XP_009775685.1| PREDICTED: respiratory burst oxidase homolog protein C [Nicotiana 
sylvestris]
 gb|AAM28891.1| NADPH oxidase [Nicotiana tabacum]
 gb|ABN58915.1| rbohD [Nicotiana tabacum]
Length=938

 Score =   497 bits (1279),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 243/300 (81%), Positives = 256/300 (85%), Gaps = 24/300 (8%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYL IP++LY  ERLIRAFRSSIK VKILKVAVY GNVL L MSKPQG++YKSG
Sbjct  578  YKRTTWMYLTIPIILYASERLIRAFRSSIKAVKILKVAVYPGNVLALHMSKPQGYKYKSG  637

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG
Sbjct  638  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  697

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG+NNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+NM
Sbjct  698  LLRADYLQGENNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNM  757

Query  299  KAMENSEEEGGGITTGRSNN-------NV--------------NNFKTRRAYFYWVTREQ  183
            KAM   +EE   +  G +NN       N+              NNF TRRAYFYWVTREQ
Sbjct  758  KAM---DEEENSLEDGHNNNMAPNSSPNIAKNKGNKSGSASGGNNFNTRRAYFYWVTREQ  814

Query  182  GSFDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            GSFDWFKGIM+E AEMD K VIEMHNYCTSVYEEGDARSALI MLQSLH AK+GVDIVSG
Sbjct  815  GSFDWFKGIMNEAAEMDHKGVIEMHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSG  874



>ref|XP_009619772.1| PREDICTED: respiratory burst oxidase homolog protein C [Nicotiana 
tomentosiformis]
Length=938

 Score =   496 bits (1277),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 244/297 (82%), Positives = 254/297 (86%), Gaps = 18/297 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYL IP++LY  ERLIRA RSSIK VKILKVAVY GNVL L MSKPQG++YKSG
Sbjct  578  YKRTTWMYLTIPIILYASERLIRALRSSIKAVKILKVAVYPGNVLALHMSKPQGYKYKSG  637

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG
Sbjct  638  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  697

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG+NNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+NM
Sbjct  698  LLRADYLQGENNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNM  757

Query  299  KAM---ENSEEEGG----------GITTGRSNNN-----VNNFKTRRAYFYWVTREQGSF  174
            KAM   ENS E G            I   R N +      NNF TRRAYFYWVTREQGSF
Sbjct  758  KAMDEEENSLENGDNNNMAQNSSPNIAQKRGNKSDSASGRNNFNTRRAYFYWVTREQGSF  817

Query  173  DWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            DWFKGIM+E AEMD K VIEMHNYCTSVYEEGDARSALI MLQSLH AK+GVDIVSG
Sbjct  818  DWFKGIMNEAAEMDHKGVIEMHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSG  874



>gb|ABG35768.1| NOX3 [Striga asiatica]
Length=542

 Score =   481 bits (1237),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 231/291 (79%), Positives = 256/291 (88%), Gaps = 14/291 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL +P++LY GERLIRAFRSSIK VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  173  YKKTTWMYLTVPIMLYAGERLIRAFRSSIKAVKILKVAVYPGNVLALHMSKPQGFKYKSG  232

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPFEWHPFSITSAP DDY+SVHIRTLGDWTRQLK VF+EVCQPPP GKSG
Sbjct  233  QYIFVNCAAVSPFEWHPFSITSAPRDDYVSVHIRTLGDWTRQLKAVFAEVCQPPPTGKSG  292

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG+NNPNFPRVLIDGPYGAP QDYK Y+VVLLVGLGIGATPMIS+VKDIV+N+
Sbjct  293  LLRADFMQGENNPNFPRVLIDGPYGAPTQDYKDYDVVLLVGLGIGATPMISVVKDIVNNI  352

Query  299  KAMENSEEEGGG----------ITTGR--SNNNVNNFKTRRAYFYWVTREQGSFDWFKGI  156
            KAM+  EEEGG           ++T R  S ++  +FKTRRAYFYWVTREQGSFDWFKG+
Sbjct  353  KAMD--EEEGGATRGSTPNASPLSTPRRKSGSDRRDFKTRRAYFYWVTREQGSFDWFKGV  410

Query  155  MDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            M+EV+EMD K VIEMHNYCTSVYEEGDARSALI MLQSL+ AK+GVD+VSG
Sbjct  411  MNEVSEMDHKGVIEMHNYCTSVYEEGDARSALITMLQSLNHAKNGVDVVSG  461



>emb|CDO98277.1| unnamed protein product [Coffea canephora]
Length=933

 Score =   493 bits (1268),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 239/298 (80%), Positives = 256/298 (86%), Gaps = 19/298 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY GERLIRAFRSSIK VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  572  YKKTTWMYLAVPIALYAGERLIRAFRSSIKAVKILKVAVYPGNVLALHMSKPQGFKYKSG  631

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIRTLGDWTRQL+TVFSEVCQPPP GKSG
Sbjct  632  QYMFVNCAAVSPFEWHPFSITSAPRDDYLSVHIRTLGDWTRQLRTVFSEVCQPPPTGKSG  691

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRADCLQG+NNPNFPRVLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIV+NM
Sbjct  692  LLRADCLQGENNPNFPRVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM  751

Query  299  KAMENSE----------EEGGGITTGRSN---------NNVNNFKTRRAYFYWVTREQGS  177
            KA+E  E          E+GG +    S+          +  +FKT+RAYFYWVTREQGS
Sbjct  752  KAIEAEESSLEDGTRAAEDGGPVAPNSSSLTQKRKSGSGSGGSFKTKRAYFYWVTREQGS  811

Query  176  FDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            FDWFKGIM+E AEMD+K VIEMHNYCTSVYEEGDARSALI MLQSL+ AK GVDIVSG
Sbjct  812  FDWFKGIMNEAAEMDKKGVIEMHNYCTSVYEEGDARSALITMLQSLNHAKHGVDIVSG  869



>gb|ADR70882.1| respiratory burst oxidase D [Manihot esculenta]
Length=914

 Score =   490 bits (1262),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 232/283 (82%), Positives = 257/283 (91%), Gaps = 4/283 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P++LY  ERLIRAFRSSIK VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  568  YQKTTWMYLAVPIILYACERLIRAFRSSIKSVKILKVAVYPGNVLALHMSKPQGFKYKSG  627

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPP GKSG
Sbjct  628  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPAGKSG  687

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRA+ +QG NNP+FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  688  LLRAEGMQGGNNPSFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNM  747

Query  299  KAMENSEE--EGGGITTGRSNNNVNN--FKTRRAYFYWVTREQGSFDWFKGIMDEVAEMD  132
            K  ++ E   E G    G SNNN++   FKTR+AYFYWVTREQGSF+WFKGIM+EVAEMD
Sbjct  748  KEEDDEETALEAGRAAQGNSNNNISKKGFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMD  807

Query  131  EKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +K +IE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVD+VSG
Sbjct  808  DKGLIELHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDVVSG  850



>gb|KDP22507.1| hypothetical protein JCGZ_26338 [Jatropha curcas]
Length=904

 Score =   488 bits (1257),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 233/285 (82%), Positives = 250/285 (88%), Gaps = 6/285 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LY  ERL RA RSSIKPV I KVA+Y GNVL L MSKPQGF+YKSG
Sbjct  556  YKKTTWMYLAVPVILYASERLTRALRSSIKPVTIKKVAIYPGNVLALHMSKPQGFKYKSG  615

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQL+TVFS+VCQPP  GKSG
Sbjct  616  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLRTVFSQVCQPPDTGKSG  675

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  QG NNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN+
Sbjct  676  LLRADGFQGNNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNI  735

Query  299  KAMENSEE---EGGGITTGRSNNNVN---NFKTRRAYFYWVTREQGSFDWFKGIMDEVAE  138
            +A +  EE   E G +    S N      NFKTRRAYFYWVTREQGSFDWFKGIM+EVAE
Sbjct  736  RATDEEEENAIENGTLPKTPSPNTFKRKENFKTRRAYFYWVTREQGSFDWFKGIMNEVAE  795

Query  137  MDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +D+ HVIE+HNYCTSVYEEGDARSALIAMLQS+H AK+GVDIVSG
Sbjct  796  LDDNHVIELHNYCTSVYEEGDARSALIAMLQSIHHAKNGVDIVSG  840



>gb|ABW87870.1| NADPH oxidase [Nicotiana attenuata]
Length=937

 Score =   488 bits (1257),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 239/296 (81%), Positives = 253/296 (85%), Gaps = 17/296 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYL IP++LY  ERLIRAFRSSIK VKILKVAVY GNVL L +SKP+G++YKSG
Sbjct  578  YKRTTWMYLTIPIILYASERLIRAFRSSIKDVKILKVAVYPGNVLALHVSKPRGYKYKSG  637

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG
Sbjct  638  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  697

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
             LRAD  QG+NNPNFP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+NM
Sbjct  698  PLRADNSQGENNPNFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNM  757

Query  299  KAM---ENSEEEGGGITTGRSNNNV--------------NNFKTRRAYFYWVTREQGSFD  171
            KAM   ENS E G       S+ N+              NNF TRRAYFYWVTREQGSFD
Sbjct  758  KAMDEEENSLENGHNNMAPNSSPNIAQKKGNKSGSASGRNNFNTRRAYFYWVTREQGSFD  817

Query  170  WFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            WFKGIM+E AEMD K VIEMHNYCTSVYEEGDARSALI MLQSLH AK+GVDIVSG
Sbjct  818  WFKGIMNEAAEMDHKGVIEMHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSG  873



>ref|XP_011003531.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Populus 
euphratica]
Length=909

 Score =   486 bits (1251),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 234/291 (80%), Positives = 253/291 (87%), Gaps = 13/291 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LYG ERLIRA RSSIK V I KVA+Y GNVL L MSKPQGFRYKSG
Sbjct  556  YKKTTWMYLAVPVILYGSERLIRALRSSIKAVTIQKVAIYPGNVLALHMSKPQGFRYKSG  615

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQL+TVFSEVCQPPP+GKSG
Sbjct  616  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLRTVFSEVCQPPPDGKSG  675

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRADC+QG +NPN PRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN+
Sbjct  676  LLRADCIQG-HNPNLPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNI  734

Query  299  KAMENSE---EEGGG---------ITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGI  156
            +A+E  E   E G G         I +  +     NFKTRRAYFYWVTREQGSFDWFKG+
Sbjct  735  RAIEEEENAVENGTGGLGNSPSTKIPSPNTQKRKENFKTRRAYFYWVTREQGSFDWFKGV  794

Query  155  MDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            M+EVAE D  HVIE+HNYCTSVYEEGDARSALIAMLQS++ AK+GVDIVSG
Sbjct  795  MNEVAEQDHNHVIELHNYCTSVYEEGDARSALIAMLQSINHAKNGVDIVSG  845



>ref|XP_011082784.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Sesamum 
indicum]
Length=921

 Score =   486 bits (1250),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 236/293 (81%), Positives = 256/293 (87%), Gaps = 14/293 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+LLY GERLIRAFRSSIKPVKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  565  YKKTTWMYLAIPILLYAGERLIRAFRSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSG  624

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPFEWHPFSITSAP DDY+SVHIRTLGDWTRQLK VFS+VCQPPP GKSG
Sbjct  625  QYIFVNCAAVSPFEWHPFSITSAPMDDYVSVHIRTLGDWTRQLKLVFSQVCQPPPTGKSG  684

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRADCLQ +NNPNFPRVLIDGPYGAP QDYK Y+VVLLVGLGIGATPMIS+VKDIV+N+
Sbjct  685  LLRADCLQEENNPNFPRVLIDGPYGAPTQDYKDYDVVLLVGLGIGATPMISVVKDIVNNI  744

Query  299  KAMENSEEE----GGG-------ITTGR---SNNNVNNFKTRRAYFYWVTREQGSFDWFK  162
            KAME  E      GGG       +T  R   S +   +F+TRRAYFYWVTREQGSF+WFK
Sbjct  745  KAMEEDENAVEGVGGGNGPPSTHLTPKRKTGSGSGRQDFRTRRAYFYWVTREQGSFEWFK  804

Query  161  GIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            G+M+EVAEMD K VIEMHNYCTSVYEEGDARSALIAMLQS++ AK+GVDIVSG
Sbjct  805  GVMNEVAEMDHKRVIEMHNYCTSVYEEGDARSALIAMLQSINHAKNGVDIVSG  857



>gb|AII25876.1| NADPH oxidase A [Camellia sinensis]
Length=922

 Score =   485 bits (1249),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 234/282 (83%), Positives = 250/282 (89%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKT WMYLA+P++LY  ERLIR FRSSIKPVKILKVAVY GNVL + MSKPQGF+YKSG
Sbjct  579  YKKTVWMYLAVPIILYACERLIRLFRSSIKPVKILKVAVYPGNVLAIHMSKPQGFKYKSG  638

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPP GKSG
Sbjct  639  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPTGKSG  698

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG+NNPNFPRVLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIV NM
Sbjct  699  LLRADYMQGENNPNFPRVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVDNM  758

Query  299  KA---MENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA    EN+ E G G T  + +   N+FKT RAYFYWV REQGSFDWFKGIM+EVAE D+
Sbjct  759  KANDEEENALEGGDGATATKRSG--NSFKTTRAYFYWVPREQGSFDWFKGIMNEVAETDK  816

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIEMHNYCTSVYEEGDARSALI MLQSL+ AK GVD+VSG
Sbjct  817  NGVIEMHNYCTSVYEEGDARSALITMLQSLNHAKHGVDVVSG  858



>ref|XP_011015154.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Populus 
euphratica]
Length=909

 Score =   484 bits (1246),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 233/291 (80%), Positives = 252/291 (87%), Gaps = 13/291 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL +P++LYG ERLIRA RSSIK V I KVA+Y GNVL L MSKPQGFRYKSG
Sbjct  556  YKKTTWMYLEVPVILYGSERLIRALRSSIKAVTIQKVAIYPGNVLALHMSKPQGFRYKSG  615

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQL+TVFSEVCQPPP+GKSG
Sbjct  616  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLRTVFSEVCQPPPDGKSG  675

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRADC+QG +NPN PRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN+
Sbjct  676  LLRADCIQG-HNPNLPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNI  734

Query  299  KAMENSE---EEGGG---------ITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGI  156
            +A+E  E   E G G         I +  +     NFKTRRAYFYWVTREQGSFDWFKG+
Sbjct  735  RAIEEEENAVENGTGGLGNSPSTKIPSPNTQKRKENFKTRRAYFYWVTREQGSFDWFKGV  794

Query  155  MDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            M+EVAE D  HVIE+HNYCTSVYEEGDARSALIAMLQS++ AK+GVDIVSG
Sbjct  795  MNEVAEQDHNHVIELHNYCTSVYEEGDARSALIAMLQSINHAKNGVDIVSG  845



>ref|XP_002318793.2| respiratory burst oxidase C family protein [Populus trichocarpa]
 gb|EEE97013.2| respiratory burst oxidase C family protein [Populus trichocarpa]
Length=909

 Score =   482 bits (1240),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 232/291 (80%), Positives = 251/291 (86%), Gaps = 13/291 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LYG ERLIRA RSSIK V I KVA+Y GNVL L MSKPQGFRYKSG
Sbjct  556  YKKTTWMYLAVPVILYGSERLIRALRSSIKAVTIQKVAIYPGNVLALHMSKPQGFRYKSG  615

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQL+TVFSEVCQPPP+GKSG
Sbjct  616  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLRTVFSEVCQPPPDGKSG  675

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLR+DC QG N+ N PRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN+
Sbjct  676  LLRSDCFQGHNS-NLPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNI  734

Query  299  KAMENSE---EEGGG---------ITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGI  156
            + ME  E   E G G         I +  +     NFKTRRAYFYWVTREQGSFDWFKG+
Sbjct  735  RTMEEEENAVENGAGGIGNSPSTKIPSPYTQKRKENFKTRRAYFYWVTREQGSFDWFKGV  794

Query  155  MDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            M+EVAE+D  HVIE+HNYCTSVYEEGDARSALIAMLQS++ AK+GVDIVSG
Sbjct  795  MNEVAEIDHNHVIELHNYCTSVYEEGDARSALIAMLQSINHAKNGVDIVSG  845



>emb|CAC84140.1| NADPH oxidase [Nicotiana tabacum]
Length=939

 Score =   481 bits (1237),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 239/301 (79%), Positives = 253/301 (84%), Gaps = 25/301 (8%)
 Frame = -1

Query  839  YKKTTW-MYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKS  663
            YK+T   + L IP++LY  ERLIRAFRSSIK VKILKVAVY GNVL L MSKPQG++YKS
Sbjct  578  YKRTDMDVLLTIPIILYASERLIRAFRSSIKAVKILKVAVYPGNVLALHMSKPQGYKYKS  637

Query  662  GQYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKS  483
            GQYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKS
Sbjct  638  GQYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKS  697

Query  482  GLLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            GLLRAD LQG+NNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N
Sbjct  698  GLLRADYLQGENNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNN  757

Query  302  MKAMENSEEEGGGITTGRSNN-------NV--------------NNFKTRRAYFYWVTRE  186
            MKAM   +EE   +  G +NN       N+              NNF TRRAYFYWVTRE
Sbjct  758  MKAM---DEEENSLEDGHNNNMAPNSSPNIAKNKGNKSGSASGGNNFNTRRAYFYWVTRE  814

Query  185  QGSFDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVS  6
            QGSFDWFKGIM+E AEMD K VIEMHNYCTSVYEEGDARSALI MLQSLH AK+GVDIVS
Sbjct  815  QGSFDWFKGIMNEAAEMDHKGVIEMHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVS  874

Query  5    G  3
            G
Sbjct  875  G  875



>gb|KDP23231.1| hypothetical protein JCGZ_23064 [Jatropha curcas]
Length=923

 Score =   479 bits (1233),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 225/281 (80%), Positives = 252/281 (90%), Gaps = 2/281 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P++LY  ERLIRAFRSSIK VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  579  YQKTTWMYLAVPIILYACERLIRAFRSSIKSVKILKVAVYPGNVLALHMSKPQGFKYKSG  638

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLK VFSEVCQP P GKSG
Sbjct  639  QYMFVNCSAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKAVFSEVCQPAPAGKSG  698

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRA+ ++G NNP+FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  699  LLRAEGVEGGNNPSFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNM  758

Query  299  KAMENSEE--EGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEK  126
            +  ++ E   E G  T+  + NN   FKT +AYFYWVTREQGSF+WFKGIM+EVAEMD+K
Sbjct  759  QEEDDRENSLEAGKATSAPNYNNKKGFKTTKAYFYWVTREQGSFEWFKGIMNEVAEMDDK  818

Query  125  HVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             VIE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVD+VSG
Sbjct  819  AVIELHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDVVSG  859



>ref|XP_002303736.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa]
 gb|EEE78715.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa]
Length=926

 Score =   479 bits (1232),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 229/288 (80%), Positives = 253/288 (88%), Gaps = 10/288 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P++LY  ERLIRAFRSSI+ VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  576  YHKTTWMYLAVPVILYACERLIRAFRSSIRAVKILKVAVYPGNVLALHMSKPQGFKYKSG  635

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPP  GKSG
Sbjct  636  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPTAGKSG  695

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG NNP+ P++L+DGP+GAPAQDYKKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  696  LLRAD-MQGGNNPSIPKILVDGPFGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNM  754

Query  299  KAMENSEEEGG---GITTGRSNNNVNN------FKTRRAYFYWVTREQGSFDWFKGIMDE  147
            K  +  E   G    + +GR+  N NN      FKTR+AYFYWVTREQGSF+WFKGIM+E
Sbjct  755  KIKDKDEGNNGALDALESGRATPNKNNKINSKSFKTRKAYFYWVTREQGSFEWFKGIMNE  814

Query  146  VAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VAEMD+K VIE+HNYCTSVYEEGDARSALIAMLQSLH AKSGVD+VSG
Sbjct  815  VAEMDDKQVIELHNYCTSVYEEGDARSALIAMLQSLHHAKSGVDVVSG  862



>ref|XP_002322314.2| respiratory burst oxidase C family protein [Populus trichocarpa]
 gb|EEF06441.2| respiratory burst oxidase C family protein [Populus trichocarpa]
Length=915

 Score =   478 bits (1231),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 228/291 (78%), Positives = 250/291 (86%), Gaps = 13/291 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL +P++LYGGER IRA RSSIK V I KVA+Y GNVL L MSKPQGFRYKSG
Sbjct  562  YKKTTWMYLTVPVMLYGGERFIRALRSSIKAVTIQKVAIYPGNVLALHMSKPQGFRYKSG  621

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWT QL+TVFSE CQPPPNGKSG
Sbjct  622  QYMFVNCSAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTLQLRTVFSEACQPPPNGKSG  681

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRADC QG ++PNFPRVLIDGPYGAPAQDYKKYEV+LLVGLGIGATPMISIVKDI SN+
Sbjct  682  LLRADCFQG-HSPNFPRVLIDGPYGAPAQDYKKYEVLLLVGLGIGATPMISIVKDIASNI  740

Query  299  KAMENSEEEGGGITTGRSNNNVN------------NFKTRRAYFYWVTREQGSFDWFKGI  156
            +AME  E+     T G  N+ +             +FKTRRAYFYWVTREQGSFDWFKG+
Sbjct  741  RAMEEEEKALENGTDGAGNSPLTRTPSPNAHKRKESFKTRRAYFYWVTREQGSFDWFKGV  800

Query  155  MDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            M+EVAE+D  HVIE+HNYCTSVYEEGDARSALIAMLQS++ AK+GVDIVSG
Sbjct  801  MNEVAELDHNHVIELHNYCTSVYEEGDARSALIAMLQSINHAKNGVDIVSG  851



>ref|XP_004309557.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Fragaria 
vesca subsp. vesca]
Length=917

 Score =   478 bits (1229),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 229/282 (81%), Positives = 252/282 (89%), Gaps = 4/282 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+PLLLYGGERL+RA RSSIKPVKI+KVA+Y GNVL L MSKPQGFRY SG
Sbjct  573  YKKTTWMYLAVPLLLYGGERLVRALRSSIKPVKIVKVALYPGNVLALFMSKPQGFRYHSG  632

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDD+LSVHIRTLGDWTRQLKTVFS+VCQPPP+G SG
Sbjct  633  QYMFVNCAAVSPFEWHPFSITSAPGDDHLSVHIRTLGDWTRQLKTVFSQVCQPPPSGNSG  692

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRADC+Q  N+ NFPRVLIDGPYGAPAQDYK YEVVLLVGLGIGATPMISI+KDIV+N+
Sbjct  693  LLRADCMQS-NDLNFPRVLIDGPYGAPAQDYKNYEVVLLVGLGIGATPMISILKDIVNNI  751

Query  299  KAMENSEE---EGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA+E+  +   E G   +G   +  +NFKT+RAYFYWVTREQGSFDWFKG M+EVAE+D 
Sbjct  752  KAIEDESQNALESGTAGSGSPVSLHSNFKTKRAYFYWVTREQGSFDWFKGAMNEVAELDH  811

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIE HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  812  NRVIEFHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  853



>ref|XP_011073263.1| PREDICTED: LOW QUALITY PROTEIN: respiratory burst oxidase homolog 
protein C-like [Sesamum indicum]
Length=918

 Score =   477 bits (1227),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 232/293 (79%), Positives = 252/293 (86%), Gaps = 14/293 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL +P++LY GERLIRAFRSSIK VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  562  YKKTTWMYLTVPIILYAGERLIRAFRSSIKAVKILKVAVYPGNVLALHMSKPQGFKYKSG  621

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPFEWHPFSITSAP DDY+SVHIRTLGDWTRQLK VFSEVCQPPP GKSG
Sbjct  622  QYIFVNCAAVSPFEWHPFSITSAPRDDYVSVHIRTLGDWTRQLKAVFSEVCQPPPTGKSG  681

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG NNPNFP+VLIDGPYGAP QDYK Y+VVLLVGLGIGATPMIS+VKDIV+N+
Sbjct  682  LLRADFMQGDNNPNFPKVLIDGPYGAPTQDYKDYDVVLLVGLGIGATPMISVVKDIVNNI  741

Query  299  KAMENSE---EEG-------GGITTGR----SNNNVNNFKTRRAYFYWVTREQGSFDWFK  162
            K ME  E   E+G         +TT R    S +  +NFKTRRAYFYWVTREQGSFDWFK
Sbjct  742  KEMEEDENALEDGTTPPHNPSPLTTPRRKSGSASGRHNFKTRRAYFYWVTREQGSFDWFK  801

Query  161  GIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            G+M+EVAE D K VIEMHNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  802  GVMNEVAETDHKGVIEMHNYCTSVYEEGDARSALITMLQSLNHAKNGVDIVSG  854



>ref|XP_008222292.1| PREDICTED: respiratory burst oxidase homolog protein D [Prunus 
mume]
Length=971

 Score =   477 bits (1228),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 233/296 (79%), Positives = 258/296 (87%), Gaps = 17/296 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P++LY  ERLIRAFRSSIKPVKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  612  YHKTTWMYLAVPVVLYACERLIRAFRSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSG  671

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPP  GKSG
Sbjct  672  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPTGGKSG  731

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG NNP+FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPM+SIVKDI++NM
Sbjct  732  LLRADNMQGGNNPSFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNM  791

Query  299  KA---------MENSEEEG---GGITT---GRSNNNVNN--FKTRRAYFYWVTREQGSFD  171
            K          +E+S E G   G  +T   G S  N +N  FKTR+AY+YWVTREQGSF+
Sbjct  792  KMKGKDDDDSILESSLEMGRVSGNSSTPNHGSSGKNKSNKGFKTRKAYYYWVTREQGSFE  851

Query  170  WFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            WFKGI++EVA+MDEK VIE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVD+VSG
Sbjct  852  WFKGILNEVADMDEKGVIEIHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDVVSG  907



>ref|XP_011020924.1| PREDICTED: respiratory burst oxidase homolog protein D [Populus 
euphratica]
Length=926

 Score =   475 bits (1222),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 228/288 (79%), Positives = 253/288 (88%), Gaps = 10/288 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMY+A+P++LY  ERLIRAFRSSI+ VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  576  YQKTTWMYIAVPVILYACERLIRAFRSSIRAVKILKVAVYPGNVLALHMSKPQGFKYKSG  635

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPP  GKSG
Sbjct  636  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPTAGKSG  695

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG NN + P++L+DGP+GAPAQDYKKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  696  LLRAD-MQGGNNRSIPKILVDGPFGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNM  754

Query  299  KAMENSEEEGG-------GITTGRSNNNVN--NFKTRRAYFYWVTREQGSFDWFKGIMDE  147
            K  +  E   G       G TT   NN +N  +FKTR+AYFYWVTREQGSF+WFKGIM+E
Sbjct  755  KIKDKDEGNNGALDALESGRTTPNKNNKINSKSFKTRKAYFYWVTREQGSFEWFKGIMNE  814

Query  146  VAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VAEMD+K VIE+HNYCTSVYEEGDARSALIAMLQSLH AKSGVD+VSG
Sbjct  815  VAEMDDKQVIELHNYCTSVYEEGDARSALIAMLQSLHHAKSGVDVVSG  862



>gb|ADR70892.1| respiratory burst oxidase C [Manihot esculenta]
Length=882

 Score =   473 bits (1218),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 230/287 (80%), Positives = 245/287 (85%), Gaps = 8/287 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LY  ERL RA RSSIKPV I KVA+Y GNVL L MSKP GFRYKSG
Sbjct  532  YKKTTWMYLAVPVILYASERLTRALRSSIKPVTIKKVAIYPGNVLALHMSKPPGFRYKSG  591

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFS+VCQPP  GKSG
Sbjct  592  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSQVCQPPDTGKSG  651

Query  479  LLRADCLQGQNNP-NFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRAD  QG NNP  FPRVLIDGPYGAPAQDYK+YEV+LLVGLGIGATPMISIVKDIVSN
Sbjct  652  LLRADGFQGNNNPICFPRVLIDGPYGAPAQDYKEYEVLLLVGLGIGATPMISIVKDIVSN  711

Query  302  MKAMENSEE---EGGGITTGRSNNNV----NNFKTRRAYFYWVTREQGSFDWFKGIMDEV  144
            ++AME   E   E G      S +N       FKT RAYFYWVTREQGSFDWFKG+M+EV
Sbjct  712  IRAMEEEAEGSIENGTFAKTPSPSNALRRREEFKTSRAYFYWVTREQGSFDWFKGVMNEV  771

Query  143  AEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            AE+D  HVIE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVDIVSG
Sbjct  772  AELDHNHVIELHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDIVSG  818



>ref|XP_007017524.1| Respiratory burst oxidase D [Theobroma cacao]
 gb|EOY14749.1| Respiratory burst oxidase D [Theobroma cacao]
Length=961

 Score =   475 bits (1223),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 228/281 (81%), Positives = 250/281 (89%), Gaps = 6/281 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P++LY  ERLIRA RSSIK VKILKVAVY GNVL+L MSKPQGF+YKSG
Sbjct  621  YQKTTWMYLAVPIILYACERLIRALRSSIKAVKILKVAVYPGNVLSLHMSKPQGFKYKSG  680

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPP GKSG
Sbjct  681  QYMFVNCSAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPAGKSG  740

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRA   +G NN +FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  741  LLRA---EGGNNTSFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNM  797

Query  299  KAMENSEEEGGGITTGRSNNNVNN--FKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEK  126
            K ME     G  +  G  + N NN  FKTR+AYFYWVTREQGSF+WFKGIM+EVAEMDEK
Sbjct  798  K-MEEDSVPGPALENGNYSKNKNNKGFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMDEK  856

Query  125  HVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             VIE+HNYCTSVYEEGDARSALI MLQSLH AK+GVD+VSG
Sbjct  857  RVIELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDVVSG  897



>ref|XP_008378424.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Malus 
domestica]
Length=962

 Score =   475 bits (1223),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 228/294 (78%), Positives = 253/294 (86%), Gaps = 16/294 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P+ LY  ERLIRAFRSSIKPVKI+KVAVY GNVL L MSKPQGF+YKSG
Sbjct  606  YNKTTWMYLAVPVTLYACERLIRAFRSSIKPVKIIKVAVYPGNVLALHMSKPQGFKYKSG  665

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSE+CQPP  G+SG
Sbjct  666  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEICQPPTGGRSG  725

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG NNP+FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPM+SIVKDI++NM
Sbjct  726  LLRAD-MQGGNNPSFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNM  784

Query  299  KAM-------ENSEEEGGGITTGRSNNNVNN--------FKTRRAYFYWVTREQGSFDWF  165
            K         E++ E G       S+NN N         FKTR+AY+YWVTREQGSF+WF
Sbjct  785  KMKGKEDDDSESALESGRATPNASSHNNSNTGKNKSNKGFKTRKAYYYWVTREQGSFEWF  844

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KGI++EVA+MDEK VIEMHNYCTSVYEEGDARSALIAMLQSLH AK+GVD+VSG
Sbjct  845  KGILNEVADMDEKGVIEMHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDVVSG  898



>ref|XP_010249370.1| PREDICTED: respiratory burst oxidase homolog protein C [Nelumbo 
nucifera]
Length=926

 Score =   474 bits (1220),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 232/279 (83%), Positives = 249/279 (89%), Gaps = 1/279 (0%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KKTTWMYLA+P++LY  ERLIRAFRSSIKPVKILKVAVY GNVL L MS+PQGF+YKSGQ
Sbjct  584  KKTTWMYLAVPVILYVCERLIRAFRSSIKPVKILKVAVYPGNVLALHMSRPQGFKYKSGQ  643

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFS+VCQPP   KSGL
Sbjct  644  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSQVCQPPTGDKSGL  703

Query  476  LRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMK  297
            LRAD +QG N PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+NMK
Sbjct  704  LRADHMQGGNAPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNMK  763

Query  296  AMENSEEEGGGITTG-RSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            AME  E      T      N+  +FKT RAYFYWVTREQGSFDWFKG+M+EVAEMD+K V
Sbjct  764  AMEEEESALEAATHNPNKKNSKASFKTTRAYFYWVTREQGSFDWFKGVMNEVAEMDQKGV  823

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVD+VSG
Sbjct  824  IELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSG  862



>gb|KHG00108.1| Respiratory burst oxidase C [Gossypium arboreum]
Length=915

 Score =   473 bits (1218),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 231/291 (79%), Positives = 249/291 (86%), Gaps = 12/291 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LY  ERL R  RSSIK V I KVAVY GNVL LQMS+P GFRYKSG
Sbjct  561  YKKTTWMYLAVPIILYSCERLTRLLRSSIKAVTIQKVAVYPGNVLALQMSRPHGFRYKSG  620

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQL+TVFSEVCQ P NGKSG
Sbjct  621  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLRTVFSEVCQQPTNGKSG  680

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD + G N P+FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  681  LLRADSVHGTNIPDFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  740

Query  299  KAMENSE--------EEGGGI----TTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGI  156
            +AME  E        E+G G+    +T  S+    NFKTRRAYFYWVTREQGSFDWFKGI
Sbjct  741  RAMEEEEEEEKSSGIEKGNGVNKTNSTSPSSKRKENFKTRRAYFYWVTREQGSFDWFKGI  800

Query  155  MDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            M+EVAEMD  HVIE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  801  MNEVAEMDRNHVIELHNYCTSVYEEGDARSALITMLQSLNHAKNGVDIVSG  851



>ref|XP_009353482.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Pyrus 
x bretschneideri]
Length=962

 Score =   474 bits (1221),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 226/294 (77%), Positives = 254/294 (86%), Gaps = 16/294 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P+ LY  ERLIRAFRSSIKPVKI+KVAVY GNVL L MSKPQGF+YKSG
Sbjct  606  YNKTTWMYLAVPVTLYACERLIRAFRSSIKPVKIMKVAVYPGNVLALHMSKPQGFKYKSG  665

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPP  GKSG
Sbjct  666  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPTGGKSG  725

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG NNP+FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPM+SIVKDI++NM
Sbjct  726  LLRAD-MQGGNNPSFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNM  784

Query  299  KAMENSEEEG-GGITTGRSNNNVNN--------------FKTRRAYFYWVTREQGSFDWF  165
            K     +++    + +GR+  N ++              FKTR+AY+YWVTREQGSF+WF
Sbjct  785  KMKSKEDDDSESALESGRATPNASSHDNSDSGKNKSNKGFKTRKAYYYWVTREQGSFEWF  844

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KGI++EVA+MDEK VIEMHNYCTSVYEEGDARSALIAMLQSLH AK+GVD+VSG
Sbjct  845  KGILNEVADMDEKGVIEMHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDVVSG  898



>ref|XP_002511059.1| respiratory burst oxidase, putative [Ricinus communis]
 gb|EEF51661.1| respiratory burst oxidase, putative [Ricinus communis]
Length=910

 Score =   473 bits (1217),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 229/286 (80%), Positives = 246/286 (86%), Gaps = 7/286 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+++Y  ERL RA RSSIKPV I KVA+Y GNVL L MSKPQGFRYKSG
Sbjct  561  YKKTTWMYLAVPIIIYASERLTRALRSSIKPVTIKKVAIYPGNVLALHMSKPQGFRYKSG  620

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFS+VCQPP  GKSG
Sbjct  621  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSQVCQPPDTGKSG  680

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  QG N P+FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  681  LLRADGFQGNNCPSFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  740

Query  299  KA-----MENSEEEGGGITTGR--SNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVA  141
            +A      EN+ E G    T    +     NFKTRRAYFYWVTREQGSFDWFKG+M+EVA
Sbjct  741  RAREDEEEENALENGTLPKTPSPDAQKRRENFKTRRAYFYWVTREQGSFDWFKGVMNEVA  800

Query  140  EMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            E+D  HVIE+HNYCTSVYEEGDARSALI MLQSLH AK+GVDIVSG
Sbjct  801  ELDHNHVIELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSG  846



>gb|AFS18256.1| respiratory burst oxidase protein D, partial [Lepidium sativum]
Length=356

 Score =   454 bits (1168),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 219/279 (78%), Positives = 244/279 (87%), Gaps = 7/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLYG ERLIRAFRSSIKPVKILKVAVY GNVL L M+KPQGF+YKSG
Sbjct  21   YQKTTWMYLAVPILLYGTERLIRAFRSSIKPVKILKVAVYPGNVLALHMTKPQGFKYKSG  80

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  81   QYMFVNCRAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRKLRTVFSEVCKPPTAGKSG  140

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G  N  FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  141  LLRAD--GGDGNLPFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNM  198

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K+ ++  +         SN +   FKT +AYFYWVTREQGSF+WFKGIMDEV+EMDE+ V
Sbjct  199  KSPDSDSD-----IENNSNGHNKGFKTTKAYFYWVTREQGSFEWFKGIMDEVSEMDEEGV  253

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  254  IELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  292



>ref|XP_010250429.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Nelumbo 
nucifera]
Length=924

 Score =   473 bits (1217),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 229/281 (81%), Positives = 245/281 (87%), Gaps = 3/281 (1%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KKTTWMYLAIP+ LY  ERLIRAFRSSIKPVKILKVAVY GNVL L MSKPQGF+YKSGQ
Sbjct  580  KKTTWMYLAIPVTLYTCERLIRAFRSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSGQ  639

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFS+VCQPP   KSGL
Sbjct  640  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSQVCQPPTGDKSGL  699

Query  476  LRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMK  297
            LRAD +Q    PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+++K
Sbjct  700  LRADYMQRLGTPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNDIK  759

Query  296  AMENSEEEGGGI---TTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEK  126
            AME  E     +    T       N+FKT RAYFYWVTREQGSFDWFKG+M+EVAEMD +
Sbjct  760  AMEEEEASTALVLEAATPPQKRKGNSFKTSRAYFYWVTREQGSFDWFKGVMNEVAEMDHE  819

Query  125  HVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVD+VSG
Sbjct  820  GVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSG  860



>ref|XP_011040313.1| PREDICTED: respiratory burst oxidase homolog protein C [Populus 
euphratica]
Length=909

 Score =   471 bits (1212),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 225/291 (77%), Positives = 249/291 (86%), Gaps = 13/291 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL +P++LYG ER IRA RSSIK V I KVA+Y GNVL L MSKPQGFRYKSG
Sbjct  556  YKKTTWMYLTVPVMLYGSERFIRALRSSIKAVTIQKVAIYPGNVLALHMSKPQGFRYKSG  615

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWT QL+TVFSE C P PNGKSG
Sbjct  616  QYMFVNCSAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTLQLRTVFSEACHPSPNGKSG  675

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRADC QG ++PNFP+VLIDGPYGAPAQDYKKYEV+LLVGLGIGATPMISIVKDI SN+
Sbjct  676  LLRADCFQG-HSPNFPKVLIDGPYGAPAQDYKKYEVLLLVGLGIGATPMISIVKDIASNI  734

Query  299  KAMENSEE------EGGGITTGRSNNNVN------NFKTRRAYFYWVTREQGSFDWFKGI  156
            +AME  E+      +G G +    N + N      +FKTRRAYFYWVTREQGSFDWFKG+
Sbjct  735  RAMEEEEKALEDGTDGAGNSPLTKNQSPNAQRRKESFKTRRAYFYWVTREQGSFDWFKGV  794

Query  155  MDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            M+EVAE+D  HVIE+HNYCTSVYEEGDARSALIAMLQS++ AK+GVDIVSG
Sbjct  795  MNEVAELDHNHVIELHNYCTSVYEEGDARSALIAMLQSINHAKNGVDIVSG  845



>gb|ADE76874.1| unknown [Picea sitchensis]
Length=358

 Score =   451 bits (1161),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 215/279 (77%), Positives = 244/279 (87%), Gaps = 5/279 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLYGGER++RAFRS  KPV+ILKVA+Y GNVLTL MSKPQGFRYKSG
Sbjct  21   YKKTTWMYLAVPVLLYGGERILRAFRSGSKPVQILKVAIYPGNVLTLHMSKPQGFRYKSG  80

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVS FEWHPFSITSAPGD+YLSVHIRTLGDWTR+LK  F+EVC+PP  GKSG
Sbjct  81   QYMFVNCPAVSSFEWHPFSITSAPGDNYLSVHIRTLGDWTRELKNSFAEVCEPPMGGKSG  140

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG+NNP FPR+LIDGPYGAPAQDYKKY+V+LLVGLGIGATP ISI+KDIV++M
Sbjct  141  LLRADYMQGKNNPRFPRLLIDGPYGAPAQDYKKYDVLLLVGLGIGATPFISILKDIVNHM  200

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K    SEEE      G+       F T RA+FYWVTRE+GSFDWFKG+M+EVAE+D+K +
Sbjct  201  KV---SEEERNIENVGKQKK--KTFNTVRAFFYWVTREEGSFDWFKGVMNEVAEIDQKGI  255

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALIAMLQ+L+ AK GVDIVSG
Sbjct  256  IELHNYCTSVYEEGDARSALIAMLQALNHAKHGVDIVSG  294



>ref|XP_008369593.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Malus 
domestica]
Length=965

 Score =   471 bits (1212),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 229/295 (78%), Positives = 257/295 (87%), Gaps = 18/295 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P++LY  ERLIRAFRSSIKPVKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  609  YHKTTWMYLAVPVVLYACERLIRAFRSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSG  668

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITS+PGDDYLSVHIRTLGDWTRQLKTVFSEVCQPP  GKSG
Sbjct  669  QYMFVNCAAVSPFEWHPFSITSSPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPTGGKSG  728

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN-  303
            LLRAD +QG NNP+FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPM+SIVKDI++N 
Sbjct  729  LLRAD-MQGGNNPSFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNI  787

Query  302  -MKAMENSEEEGGGITTGRSNNNV---NN-----------FKTRRAYFYWVTREQGSFDW  168
             MK+ E+ + E   + +GR+  N    NN           FKTR+AY+YWVTREQGSF+W
Sbjct  788  KMKSREDDDSE-SALESGRATPNAPSHNNSSSGKNKSNKGFKTRKAYYYWVTREQGSFEW  846

Query  167  FKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            FKGI++EVA+MDEK VIE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVD+VSG
Sbjct  847  FKGILNEVADMDEKGVIEIHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDVVSG  901



>ref|XP_007225362.1| hypothetical protein PRUPE_ppa000883mg [Prunus persica]
 gb|EMJ26561.1| hypothetical protein PRUPE_ppa000883mg [Prunus persica]
Length=971

 Score =   471 bits (1213),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 228/297 (77%), Positives = 256/297 (86%), Gaps = 19/297 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P++LY  ERLIRAFRSSIKPVKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  612  YHKTTWMYLAVPVVLYACERLIRAFRSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSG  671

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPP  GKSG
Sbjct  672  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPTGGKSG  731

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG NNP+FP++LIDG YGAPAQDYKKY+VVLLVGLGIGATPM+SIVKDI++NM
Sbjct  732  LLRADNMQGGNNPSFPKILIDGAYGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNM  791

Query  299  KA---------MENSEEEG---------GGITTGRSNNNVNNFKTRRAYFYWVTREQGSF  174
            K          +E+S E G            ++G++ +N   FKTR+AY+YWVTREQGSF
Sbjct  792  KMKGKEDDDSILESSLEMGRVSGNPSTPNHSSSGKNKSN-KGFKTRKAYYYWVTREQGSF  850

Query  173  DWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +WFKGI++EVA+MDEK VIE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVD+VSG
Sbjct  851  EWFKGILNEVADMDEKGVIEIHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDVVSG  907



>ref|XP_002299364.2| hypothetical protein POPTR_0001s12650g [Populus trichocarpa]
 gb|EEE84169.2| hypothetical protein POPTR_0001s12650g [Populus trichocarpa]
Length=926

 Score =   469 bits (1208),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 223/288 (77%), Positives = 255/288 (89%), Gaps = 10/288 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTW+YLA+P++LY  ERLIRAFRSS + VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  576  YKKTTWIYLAVPVILYACERLIRAFRSSTRAVKILKVAVYPGNVLALHMSKPQGFKYKSG  635

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPF+WHPFSITS+PGDDYLSVHIRTLGDWTRQL+TVFSEVCQPPP GKSG
Sbjct  636  QYMFVNCAAVSPFQWHPFSITSSPGDDYLSVHIRTLGDWTRQLQTVFSEVCQPPPAGKSG  695

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG+NNP+FP++LIDGP+GAPAQ+YKKY+VVLLVGLGIGATPM+SIVKDI++N 
Sbjct  696  LLRAD-MQGENNPSFPKILIDGPFGAPAQEYKKYDVVLLVGLGIGATPMVSIVKDIINNK  754

Query  299  KAMENSEEEGG---GITTGRSNNNVN------NFKTRRAYFYWVTREQGSFDWFKGIMDE  147
            K  +   E+ G   G+ +GR   N N      +FKTR+AYFYWVTREQGSF+WFK IM+E
Sbjct  755  KLKDKDGEDNGALEGLESGRGPPNKNKISTSRSFKTRKAYFYWVTREQGSFEWFKEIMNE  814

Query  146  VAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VAEMD+K VIEMHNYCTSVYEEGDARSALIAMLQSL+ AK+GVD+VSG
Sbjct  815  VAEMDDKQVIEMHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSG  862



>ref|XP_009359839.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Pyrus 
x bretschneideri]
Length=964

 Score =   470 bits (1209),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 227/295 (77%), Positives = 256/295 (87%), Gaps = 18/295 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P++LY  ERLIRAFRSSIKPVKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  608  YHKTTWMYLAVPVVLYACERLIRAFRSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSG  667

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITS+PGDDYLSVHIRTLGDWTRQLKTVFSEVCQPP  GKSG
Sbjct  668  QYMFVNCAAVSPFEWHPFSITSSPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPTGGKSG  727

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN-  303
            LLRAD +QG NNP+FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPM+SIVKDI++N 
Sbjct  728  LLRAD-MQGGNNPSFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNI  786

Query  302  -MKAMENSEEEGGGITTGRS--------------NNNVNNFKTRRAYFYWVTREQGSFDW  168
             MK+ E+ + E   + +GR+              N +   FKTR+AY+YWVTREQGSF+W
Sbjct  787  KMKSREDDDSE-SALESGRATPNASSHNNSSSGKNRSNKGFKTRKAYYYWVTREQGSFEW  845

Query  167  FKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            FKGI++EVA+MDEK VIE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVD+VSG
Sbjct  846  FKGILNEVADMDEKGVIEIHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDVVSG  900



>ref|XP_009792212.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X2 [Nicotiana sylvestris]
Length=711

 Score =   462 bits (1189),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 221/283 (78%), Positives = 244/283 (86%), Gaps = 5/283 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLAIP++LY GERL+RAFRSSIK VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  366  YMKTTWMYLAIPIILYSGERLLRAFRSSIKDVKILKVAVYPGNVLALHMSKPQGFKYKSG  425

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGD+Y+S+HIRTLGDWT +L+ VFSEVCQP P GKSG
Sbjct  426  QYMFVNCAAVSPFEWHPFSITSAPGDNYVSIHIRTLGDWTSKLRAVFSEVCQPLPTGKSG  485

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
             L A+CLQG+N  N P+VLIDGPYGAPAQDYKKYEV+LLVGLGIGATPMISI KDIV+NM
Sbjct  486  HLVAECLQGENK-NLPKVLIDGPYGAPAQDYKKYEVLLLVGLGIGATPMISIAKDIVNNM  544

Query  299  KAMENSE----EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMD  132
            KA+E  E    E         ++    NFK++RAYFYWVTREQGSFDWFKGIM+E+AEMD
Sbjct  545  KAIEKEENNDLENRHEYIPSATSQKKRNFKSKRAYFYWVTREQGSFDWFKGIMNEIAEMD  604

Query  131  EKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             K VIEMHNYCTSVYEEGDARSALIAM+QSL  AK+GVDIVSG
Sbjct  605  PKGVIEMHNYCTSVYEEGDARSALIAMIQSLQHAKNGVDIVSG  647



>gb|ADR70880.1| respiratory burst oxidase A [Manihot esculenta]
Length=908

 Score =   467 bits (1201),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 227/286 (79%), Positives = 245/286 (86%), Gaps = 7/286 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            +KKTTWMYLAIP++LY  ERL RA RSSIKPV I KVA+Y GNVL L MSKPQGFRYKSG
Sbjct  559  HKKTTWMYLAIPIILYASERLTRALRSSIKPVTIKKVAIYPGNVLALHMSKPQGFRYKSG  618

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDY+SVHIRTLGDWTRQLKTVFS+VC+PP  GKSG
Sbjct  619  QYMFVNCAAVSPFEWHPFSITSAPGDDYISVHIRTLGDWTRQLKTVFSQVCRPPDTGKSG  678

Query  479  LLRADCLQGQNNP-NFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRAD  QG NN   FPRVLIDGPYGAPAQDY  Y+VVLLVGLGIGATPMISIVKDIVSN
Sbjct  679  LLRADDFQGNNNQIGFPRVLIDGPYGAPAQDYHNYDVVLLVGLGIGATPMISIVKDIVSN  738

Query  302  MKAMENSEE---EGGGITTGRSNNNVN---NFKTRRAYFYWVTREQGSFDWFKGIMDEVA  141
            ++AME   E   E G +    S N +    NFKT RAYFYWVTREQGSFDWFKG+M+EVA
Sbjct  739  IRAMEEEGESSLENGTVPRTPSPNTLKRKENFKTTRAYFYWVTREQGSFDWFKGVMNEVA  798

Query  140  EMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            E+D  +VIE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVDIVSG
Sbjct  799  ELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDIVSG  844



>ref|XP_007210905.1| hypothetical protein PRUPE_ppa000984mg [Prunus persica]
 gb|EMJ12104.1| hypothetical protein PRUPE_ppa000984mg [Prunus persica]
Length=941

 Score =   467 bits (1201),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/290 (77%), Positives = 247/290 (85%), Gaps = 11/290 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+PL LY GERL+RA RSSIKPVKILKVA+Y GNVL L +SKPQGFRY SG
Sbjct  588  YKKTTWMYLAVPLTLYAGERLVRALRSSIKPVKILKVALYPGNVLALHLSKPQGFRYHSG  647

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV CAAVSPFEWHPFSITSAPGD++LSVHIR +GDWTRQLKTVFS+VCQPPP+GKSG
Sbjct  648  QYMFVKCAAVSPFEWHPFSITSAPGDNHLSVHIRIVGDWTRQLKTVFSQVCQPPPSGKSG  707

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG +N  FP+VLIDGPYGAPAQDYK YEVVLLVGLGIGATPMISI+KD+V+N+
Sbjct  708  LLRADHMQGDDNLIFPKVLIDGPYGAPAQDYKNYEVVLLVGLGIGATPMISILKDVVNNI  767

Query  299  KAMENSEEEGGGIT-----------TGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIM  153
            KAME   E+ G +            +G S   ++NFKT+RAYFYWVTREQGSFDWFKG M
Sbjct  768  KAMEEEGEDMGALENGAPSRISKVGSGSSQLGLHNFKTKRAYFYWVTREQGSFDWFKGAM  827

Query  152  DEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +EVAE+D   VIE HNYCTSVYEEGDARSALI MLQSL  AK+GVDIVSG
Sbjct  828  NEVAELDHNRVIEFHNYCTSVYEEGDARSALIHMLQSLSHAKNGVDIVSG  877



>emb|CBI29288.3| unnamed protein product [Vitis vinifera]
Length=827

 Score =   463 bits (1192),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 221/279 (79%), Positives = 244/279 (87%), Gaps = 13/279 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMY+A+P+ LY  ERLIRAFRS+IKPVKILKVAVY GNVLTL M+KPQGF+Y+SG
Sbjct  498  YNKTTWMYIAVPVALYACERLIRAFRSTIKPVKILKVAVYPGNVLTLHMTKPQGFKYRSG  557

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVC PP  GKSG
Sbjct  558  QYMFVNCSAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCLPPTGGKSG  617

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRADC Q  + PNFP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI+SNM
Sbjct  618  LLRADCSQEGDGPNFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIISNM  677

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ E E   IT            T+RAY+YWVTREQGSF+WFKGIM+EVAEMDEK V
Sbjct  678  KT-KDQETEDIQIT------------TKRAYYYWVTREQGSFEWFKGIMNEVAEMDEKGV  724

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSV+EEGDARSALI MLQSLH AK+GVD+VSG
Sbjct  725  IELHNYCTSVFEEGDARSALITMLQSLHHAKNGVDVVSG  763



>ref|XP_010032776.1| PREDICTED: respiratory burst oxidase homolog protein D [Eucalyptus 
grandis]
 gb|KCW52247.1| hypothetical protein EUGRSUZ_J01662 [Eucalyptus grandis]
Length=967

 Score =   467 bits (1201),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 221/300 (74%), Positives = 251/300 (84%), Gaps = 21/300 (7%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY  ERLIRAFRSSIKPVKILKVAVY GNVL L MSKP GF+Y+SG
Sbjct  604  YKKTTWMYLAVPVTLYACERLIRAFRSSIKPVKILKVAVYPGNVLALHMSKPHGFKYRSG  663

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVSPFEWHPFSITS+PGDDYLSVHIRTLGDWTRQLK+VFSEVCQPP  GKSG
Sbjct  664  QYMFVNCSAVSPFEWHPFSITSSPGDDYLSVHIRTLGDWTRQLKSVFSEVCQPPSVGKSG  723

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRADC+ G + P FP++LIDGPYGAPAQDY+KYEVVLLVGLGIGATPM+SIVKDI++N+
Sbjct  724  LLRADCVPGGSIPRFPKILIDGPYGAPAQDYQKYEVVLLVGLGIGATPMVSIVKDIINNI  783

Query  299  KAMENSEEEGGGITTG---------------------RSNNNVNNFKTRRAYFYWVTREQ  183
            K  EN ++  G + +G                     RS++    FKTR+AYFYWVTREQ
Sbjct  784  KVKENEQDHMGSLESGGRPVSPLTPDDSNSHYPKAGHRSSHGRGAFKTRKAYFYWVTREQ  843

Query  182  GSFDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            GSF+WFKGIMDEVA MDE+ VIE+HNYCTSV+EEGDARSALIAMLQ+L+ AK GVD+VSG
Sbjct  844  GSFEWFKGIMDEVAGMDERQVIELHNYCTSVFEEGDARSALIAMLQTLNHAKHGVDVVSG  903



>ref|XP_002268641.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis 
vinifera]
Length=922

 Score =   465 bits (1196),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 217/287 (76%), Positives = 247/287 (86%), Gaps = 8/287 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMY+A+PL+LY  ERLIR+FRS+IKPV+ILKVAVY GNVLTL M+KPQGF+Y+SG
Sbjct  572  YNKTTWMYIAVPLVLYACERLIRSFRSTIKPVRILKVAVYPGNVLTLHMTKPQGFKYRSG  631

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC++VSPFEWHPFS+TSAPGDDYLSVHIRTLGDWTRQLKTVF EVCQPP  GKSG
Sbjct  632  QYMFVNCSSVSPFEWHPFSLTSAPGDDYLSVHIRTLGDWTRQLKTVFREVCQPPTGGKSG  691

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
             LRADC   +N PNFP++LIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDI++NM
Sbjct  692  QLRADCSLERNGPNFPKILIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIINNM  751

Query  299  KAMENSEEE--------GGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEV  144
            KA E  +E+               R   N   FKT+RAY+YWVTREQGSF+WFKGIM+EV
Sbjct  752  KAKEEDKEDIQIRVETIPDHDNGDRKKKNKRTFKTKRAYYYWVTREQGSFEWFKGIMNEV  811

Query  143  AEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            AEMDEK V+E+HNYCTSV+EEGDARSALI MLQ+L+ AK+GVD+VSG
Sbjct  812  AEMDEKGVVELHNYCTSVFEEGDARSALITMLQTLYHAKNGVDVVSG  858



>emb|CBI29289.3| unnamed protein product [Vitis vinifera]
Length=906

 Score =   464 bits (1194),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 217/279 (78%), Positives = 248/279 (89%), Gaps = 9/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMY+A+PL+LY  ERLIR+FRS+IKPV+ILKVAVY GNVLTL M+KPQGF+Y+SG
Sbjct  573  YNKTTWMYIAVPLVLYACERLIRSFRSTIKPVRILKVAVYPGNVLTLHMTKPQGFKYRSG  632

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC++VSPFEWHPFS+TSAPGDDYLSVHIRTLGDWTRQLKTVF EVCQPP  GKSG
Sbjct  633  QYMFVNCSSVSPFEWHPFSLTSAPGDDYLSVHIRTLGDWTRQLKTVFREVCQPPTGGKSG  692

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
             LRADC   +N PNFP++LIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDI++NM
Sbjct  693  QLRADCSLERNGPNFPKILIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIINNM  752

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            KA E  +E+   I   R+      FKT+RAY+YWVTREQGSF+WFKGIM+EVAEMDEK V
Sbjct  753  KAKEEDKED---IQIRRT------FKTKRAYYYWVTREQGSFEWFKGIMNEVAEMDEKGV  803

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +E+HNYCTSV+EEGDARSALI MLQ+L+ AK+GVD+VSG
Sbjct  804  VELHNYCTSVFEEGDARSALITMLQTLYHAKNGVDVVSG  842



>ref|XP_009610987.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X1 [Nicotiana tomentosiformis]
Length=882

 Score =   463 bits (1192),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 220/279 (79%), Positives = 243/279 (87%), Gaps = 1/279 (0%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP++LY GERL+RA RSSIK VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  541  YKKTTWMYLAIPIILYSGERLLRALRSSIKDVKILKVAVYPGNVLALHMSKPQGFKYKSG  600

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVSPFEWHPFSITSAPGDDY+S+HIRTLGDWT +L+ VFSEVCQP P GKSG
Sbjct  601  QYMFVNCSAVSPFEWHPFSITSAPGDDYVSIHIRTLGDWTSKLRAVFSEVCQPLPIGKSG  660

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
             L A+CLQG+N  N P+VLIDGPYGAPAQDYKKYEV+LLVGLGIGATPMISI KDIV+NM
Sbjct  661  QLVAECLQGENK-NLPKVLIDGPYGAPAQDYKKYEVLLLVGLGIGATPMISIAKDIVNNM  719

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            KA E  + E        ++    NFK++RAYFYWVTREQGSFDWFKGIM+E+AEMD K V
Sbjct  720  KAKEEDDLENRHENPNPTSQKKRNFKSKRAYFYWVTREQGSFDWFKGIMNEIAEMDPKGV  779

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IEMHNYCTSVYEEGDARSALIAM+QSL  AK+GVDIVSG
Sbjct  780  IEMHNYCTSVYEEGDARSALIAMIQSLQHAKNGVDIVSG  818



>ref|XP_010522982.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Tarenaya 
hassleriana]
Length=945

 Score =   464 bits (1195),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 223/288 (77%), Positives = 248/288 (86%), Gaps = 12/288 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLAIP++LY  ERLIRAFRSS+KPVKILKVAVY GNVL L M+KP GF+YKSG
Sbjct  597  YQKTTWMYLAIPIVLYSCERLIRAFRSSVKPVKILKVAVYPGNVLALHMTKPNGFKYKSG  656

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGD+YLSVHIRTLGDWTRQL+TVF+EVCQPPP GKSG
Sbjct  657  QYMFVNCRAVSPFEWHPFSITSAPGDNYLSVHIRTLGDWTRQLRTVFAEVCQPPPAGKSG  716

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRA   +G +N  FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  717  LLRA---EGTSNVAFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNM  773

Query  299  KAMENSEEE-GGGITTGRSNNNVNN--------FKTRRAYFYWVTREQGSFDWFKGIMDE  147
            K     E+E    I  G + NN  N        F+TR+AYFYWVTREQGSF+WFKGIMDE
Sbjct  774  KTSSTEEDEMMDHIENGSNQNNSKNSKADKEKGFRTRKAYFYWVTREQGSFEWFKGIMDE  833

Query  146  VAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VAEMDE+ VIE+HNYCTSVYEEGDARSALIAMLQSL  AK+GVD+VSG
Sbjct  834  VAEMDEEGVIELHNYCTSVYEEGDARSALIAMLQSLQHAKNGVDVVSG  881



>gb|KHG05306.1| Respiratory burst oxidase D -like protein [Gossypium arboreum]
Length=916

 Score =   463 bits (1191),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 222/280 (79%), Positives = 246/280 (88%), Gaps = 5/280 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+ LY  ERLIRAFRSSIK VKILKVAVY GNVL+L MSKPQGF+YKSG
Sbjct  577  YQKTTWMYLAVPITLYACERLIRAFRSSIKAVKILKVAVYPGNVLSLHMSKPQGFKYKSG  636

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVN +AVSPFEWHPFSITS+ GDDYLSVHIRTLGDWTRQLKTVFS+VCQPP  GKSG
Sbjct  637  QYMFVNYSAVSPFEWHPFSITSSTGDDYLSVHIRTLGDWTRQLKTVFSQVCQPPAAGKSG  696

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRA+      N +FP++LIDGPYGAPAQD+KKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  697  LLRAEG----TNTSFPKILIDGPYGAPAQDHKKYDVVLLVGLGIGATPMISIVKDIINNM  752

Query  299  KAMENSEEEGGGITTGR-SNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            K  E+S  EG  +  G  SN N   FKTR+AYFYWVTREQGSF+WFKGIM+EVAEMDEK 
Sbjct  753  KMEEDSTPEGSAMENGNYSNKNNKGFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMDEKK  812

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+HNYCTSVYEEGDARSALI MLQSLH AK+GVD+VSG
Sbjct  813  VIELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDVVSG  852



>ref|XP_009792203.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X1 [Nicotiana sylvestris]
Length=892

 Score =   462 bits (1188),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 221/283 (78%), Positives = 244/283 (86%), Gaps = 5/283 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLAIP++LY GERL+RAFRSSIK VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  547  YMKTTWMYLAIPIILYSGERLLRAFRSSIKDVKILKVAVYPGNVLALHMSKPQGFKYKSG  606

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGD+Y+S+HIRTLGDWT +L+ VFSEVCQP P GKSG
Sbjct  607  QYMFVNCAAVSPFEWHPFSITSAPGDNYVSIHIRTLGDWTSKLRAVFSEVCQPLPTGKSG  666

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
             L A+CLQG+N  N P+VLIDGPYGAPAQDYKKYEV+LLVGLGIGATPMISI KDIV+NM
Sbjct  667  HLVAECLQGENK-NLPKVLIDGPYGAPAQDYKKYEVLLLVGLGIGATPMISIAKDIVNNM  725

Query  299  KAMENSE----EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMD  132
            KA+E  E    E         ++    NFK++RAYFYWVTREQGSFDWFKGIM+E+AEMD
Sbjct  726  KAIEKEENNDLENRHEYIPSATSQKKRNFKSKRAYFYWVTREQGSFDWFKGIMNEIAEMD  785

Query  131  EKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             K VIEMHNYCTSVYEEGDARSALIAM+QSL  AK+GVDIVSG
Sbjct  786  PKGVIEMHNYCTSVYEEGDARSALIAMIQSLQHAKNGVDIVSG  828



>ref|XP_007038195.1| NADPH/respiratory burst oxidase protein D [Theobroma cacao]
 gb|EOY22696.1| NADPH/respiratory burst oxidase protein D [Theobroma cacao]
Length=910

 Score =   462 bits (1189),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 225/286 (79%), Positives = 244/286 (85%), Gaps = 12/286 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY  ERL R  RSSIKPV I KVAVY GNVL L MS+P GFRYKSG
Sbjct  566  YKKTTWMYLAVPVTLYLCERLTRLLRSSIKPVIIQKVAVYPGNVLALHMSRPNGFRYKSG  625

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQL+TVFSEVCQ P NGKSG
Sbjct  626  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLRTVFSEVCQQPTNGKSG  685

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD     N P+FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  686  LLRAD-----NKPDFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  740

Query  299  K-------AMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVA  141
            +       A+EN   +G   T+  ++    +FKTRRAYFYWVTREQGSFDWFKGIM+EVA
Sbjct  741  RAREEEESALENGNADGVNKTSPPNSKRKESFKTRRAYFYWVTREQGSFDWFKGIMNEVA  800

Query  140  EMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            EMD  HVIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVD+VSG
Sbjct  801  EMDHNHVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSG  846



>gb|AEX56133.1| NADPH oxidase [Phaseolus vulgaris]
Length=930

 Score =   461 bits (1187),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 228/288 (79%), Positives = 246/288 (85%), Gaps = 9/288 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+++Y  ERL RA RSSIKPV+ILKVAVY GNVLTL MSKPQGFRY+SG
Sbjct  579  YKKTTWMYLAIPIIIYFLERLTRALRSSIKPVRILKVAVYPGNVLTLHMSKPQGFRYRSG  638

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMF+NCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR LK  FSE CQPP NGKSG
Sbjct  639  QYMFLNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRSLKVKFSECCQPPDNGKSG  698

Query  479  LLRADCLQGQNNPN-FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRAD LQG  +P+  P+V+IDGPYGAPAQDYK+YEVVLLVGLGIGATPMISIVKDIV+N
Sbjct  699  LLRADNLQGDGSPSALPKVMIDGPYGAPAQDYKQYEVVLLVGLGIGATPMISIVKDIVNN  758

Query  302  MKAMENSEEEG--------GGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDE  147
            MKAME  E              TT +  N VN F TRRAYFYWVTREQGSFDWFKG+M+E
Sbjct  759  MKAMEEEEGRNMEEGESGKSARTTPQKKNGVNKFNTRRAYFYWVTREQGSFDWFKGVMNE  818

Query  146  VAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VAE D K VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  819  VAEEDHKGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  866



>ref|XP_007137830.1| hypothetical protein PHAVU_009G159200g [Phaseolus vulgaris]
 gb|ESW09824.1| hypothetical protein PHAVU_009G159200g [Phaseolus vulgaris]
Length=930

 Score =   461 bits (1187),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 228/288 (79%), Positives = 246/288 (85%), Gaps = 9/288 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+++Y  ERL RA RSSIKPV+ILKVAVY GNVLTL MSKPQGFRY+SG
Sbjct  579  YKKTTWMYLAIPIVIYFLERLTRALRSSIKPVRILKVAVYPGNVLTLHMSKPQGFRYRSG  638

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMF+NCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR LK  FSE CQPP NGKSG
Sbjct  639  QYMFLNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRSLKVKFSECCQPPDNGKSG  698

Query  479  LLRADCLQGQNNPN-FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRAD LQG  +P+  P+V+IDGPYGAPAQDYK+YEVVLLVGLGIGATPMISIVKDIV+N
Sbjct  699  LLRADNLQGDGSPSALPKVMIDGPYGAPAQDYKQYEVVLLVGLGIGATPMISIVKDIVNN  758

Query  302  MKAMENSEEEG--------GGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDE  147
            MKAME  E              TT +  N VN F TRRAYFYWVTREQGSFDWFKG+M+E
Sbjct  759  MKAMEEEEGRNMEEGESGKSARTTPQKKNGVNKFNTRRAYFYWVTREQGSFDWFKGVMNE  818

Query  146  VAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VAE D K VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  819  VAEEDHKGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  866



>gb|KHG21481.1| Respiratory burst oxidase D -like protein [Gossypium arboreum]
Length=622

 Score =   451 bits (1161),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 221/283 (78%), Positives = 247/283 (87%), Gaps = 9/283 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMY+A+P++LY  ERL RAFRSSIK VKILKVAVY GNVL+L MSKPQGF+YKSG
Sbjct  281  YQKTTWMYVAVPVILYACERLTRAFRSSIKAVKILKVAVYPGNVLSLHMSKPQGFKYKSG  340

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVS FEWHPFSITSAPGDDY+SVHIRTLGDWTRQLKTVFSEVCQPP  GKSG
Sbjct  341  QYMFVNCSAVSQFEWHPFSITSAPGDDYVSVHIRTLGDWTRQLKTVFSEVCQPPAAGKSG  400

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRA+     NN +FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  401  LLRAE----GNNTSFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNM  456

Query  299  KAMENSEEEGGGI----TTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMD  132
            + ME+    G G+        +NN    FKTR+AYFYWVTREQGSF+WFKGIM+EVAEMD
Sbjct  457  R-MEDDSFPGSGLENGNYNNNNNNKSKGFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMD  515

Query  131  EKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            EK VIE+HNYCTSVYEEGDARSALI MLQSLH AK+GVD+VSG
Sbjct  516  EKRVIELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDVVSG  558



>ref|XP_006395230.1| hypothetical protein EUTSA_v10003619mg [Eutrema salsugineum]
 gb|ESQ32516.1| hypothetical protein EUTSA_v10003619mg [Eutrema salsugineum]
Length=928

 Score =   460 bits (1184),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 219/279 (78%), Positives = 247/279 (89%), Gaps = 8/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY  ERLIRAFRSSIKPVK+LKVAVY GNVL+L M+KPQGF+YKSG
Sbjct  594  YQKTTWMYLAVPILLYASERLIRAFRSSIKPVKMLKVAVYPGNVLSLHMTKPQGFKYKSG  653

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  654  QYMFVNCRAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRKLRTVFSEVCKPPMAGKSG  713

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G++N  FP+VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  714  LLRAD---GEDNIAFPKVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNM  770

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K+ ++  E     +   SN N   FKT +AYFYWVTREQGSF+WFKGIMDEV+E+DE+ V
Sbjct  771  KSHDSDIE-----SNTNSNGNSKGFKTTKAYFYWVTREQGSFEWFKGIMDEVSELDEEGV  825

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  826  IELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  864



>emb|CDY45918.1| BnaAnng07990D [Brassica napus]
Length=921

 Score =   459 bits (1182),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 217/279 (78%), Positives = 246/279 (88%), Gaps = 7/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLYG ERLIRAFRSSIKPVKI+KVAVY GNVL+L M+KPQGF+YKSG
Sbjct  586  YKKTTWMYLAVPILLYGSERLIRAFRSSIKPVKIVKVAVYPGNVLSLHMTKPQGFKYKSG  645

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGDDY+SVHIRTLGDWTR+LKTVFSEVC+PP  GKSG
Sbjct  646  QYMFVNCRAVSPFEWHPFSITSAPGDDYVSVHIRTLGDWTRKLKTVFSEVCKPPTAGKSG  705

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G ++  FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NM
Sbjct  706  LLRAD---GGDSIAFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNM  762

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K    S +    I    SN N   F+TR+AYFYWVTREQGSF+WFKGIMDEV+E+D++ +
Sbjct  763  K----SRDRDSDIENNSSNGNSKGFRTRKAYFYWVTREQGSFEWFKGIMDEVSELDDEGI  818

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  819  IELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  857



>gb|ACF05504.2| respiratory burst oxidase-like protein [Citrullus colocynthis]
Length=926

 Score =   459 bits (1181),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 220/283 (78%), Positives = 246/283 (87%), Gaps = 4/283 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LY  ERLIRAFRS IKPVKILKVAVY GNVL L MSKP GF+YKSG
Sbjct  580  YKKTTWMYLAVPVVLYACERLIRAFRSGIKPVKILKVAVYPGNVLALHMSKPHGFKYKSG  639

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC  VSPFEWHPFSITSAP D+YLSVHIRTLGDWTRQLKTVFSEVCQPP  GKSG
Sbjct  640  QYMFVNCRDVSPFEWHPFSITSAPEDNYLSVHIRTLGDWTRQLKTVFSEVCQPPQAGKSG  699

Query  479  LLRADCLQ-GQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+ +Q G  NP FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPM+SIVKDI+ N
Sbjct  700  LLRAEFVQGGAPNPKFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIIDN  759

Query  302  MKAME---NSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMD  132
            ++  E   N+ E G G ++   + +   F+TR+AYFYWVTREQGSF+WFKGIM+EVAEMD
Sbjct  760  IEGKEAEANAVENGQGHSSRGGSKHGKGFRTRKAYFYWVTREQGSFEWFKGIMNEVAEMD  819

Query  131  EKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            E+ VIE+HNYCTSVYEEGDARSALIAMLQSL  AKSGVD+VSG
Sbjct  820  ERGVIELHNYCTSVYEEGDARSALIAMLQSLQHAKSGVDVVSG  862



>ref|XP_006487656.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Citrus 
sinensis]
Length=915

 Score =   458 bits (1179),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 223/279 (80%), Positives = 250/279 (90%), Gaps = 5/279 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P++LY  ERL RA RSSI+PVKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  578  YQKTTWMYLAVPMVLYACERLTRALRSSIEPVKILKVAVYPGNVLALHMSKPQGFKYKSG  637

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITS+PGDDYLSVHIRTLGDWTRQLKTVFSEVCQP P GKSG
Sbjct  638  QYMFVNCAAVSPFEWHPFSITSSPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPAPAGKSG  697

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRA+  +  N+  FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  698  LLRAE--RENNSRGFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNM  755

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K+ +N+ E G    T  +NN  ++F TR+AYFYWVTREQGSF+WFKGIM+EVAEMDEK V
Sbjct  756  KSEDNNLESG---LTVNNNNKNSSFNTRKAYFYWVTREQGSFEWFKGIMNEVAEMDEKRV  812

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVD+VSG
Sbjct  813  IELHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDVVSG  851



>ref|XP_006279397.1| hypothetical protein CARUB_v10007974mg [Capsella rubella]
 gb|EOA12295.1| hypothetical protein CARUB_v10007974mg [Capsella rubella]
Length=921

 Score =   458 bits (1179),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 218/279 (78%), Positives = 245/279 (88%), Gaps = 6/279 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY  ERLIRAFRSSIKPVK+LKVAVY GNVL+L M+KPQGF+YKSG
Sbjct  585  YQKTTWMYLAVPILLYASERLIRAFRSSIKPVKMLKVAVYPGNVLSLHMTKPQGFKYKSG  644

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGD+YLSVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  645  QYMFVNCRAVSPFEWHPFSITSAPGDEYLSVHIRTLGDWTRKLRTVFSEVCKPPTAGKSG  704

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G  N  FP+VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NM
Sbjct  705  LLRADG--GDGNLPFPKVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNM  762

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K    S +    I    +N+N   FKTR+AYFYWVTREQGSF+WFKGIMDEVAE+DE+ +
Sbjct  763  K----SPDRDTDIENNNTNSNSKGFKTRKAYFYWVTREQGSFEWFKGIMDEVAELDEEGI  818

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  819  IELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  857



>ref|XP_004141156.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cucumis 
sativus]
 gb|KGN59783.1| hypothetical protein Csa_3G845500 [Cucumis sativus]
Length=926

 Score =   459 bits (1180),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 246/283 (87%), Gaps = 4/283 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLYG ERLIRAFRS IKPVKILKVAVY GNVL L MSKP GF+YKSG
Sbjct  580  YKKTTWMYLAVPVLLYGCERLIRAFRSGIKPVKILKVAVYPGNVLALHMSKPHGFKYKSG  639

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC  VSPFEWHPFSITSAP D+YLSVHIRTLGDWTR+LK VFSEVCQPP  GKSG
Sbjct  640  QYMFVNCRDVSPFEWHPFSITSAPEDNYLSVHIRTLGDWTRKLKDVFSEVCQPPQAGKSG  699

Query  479  LLRADCLQ-GQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+ LQ G  NP FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPM+SIVKDI+ N
Sbjct  700  LLRAEFLQGGAPNPKFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIIDN  759

Query  302  MKAME---NSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMD  132
            ++  E   N+ E G G ++   + +   F+T++AYFYWVTREQGSF+WFKGIM+EVAEMD
Sbjct  760  IEEKESEANAVENGQGHSSRGGSKHGKGFRTKKAYFYWVTREQGSFEWFKGIMNEVAEMD  819

Query  131  EKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            E+ VIE+HNYCTSVYEEGDARSALI MLQSLH AK+GVD+VSG
Sbjct  820  ERGVIELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDVVSG  862



>gb|EPS73914.1| hypothetical protein M569_00842 [Genlisea aurea]
Length=887

 Score =   457 bits (1177),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 217/279 (78%), Positives = 244/279 (87%), Gaps = 6/279 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLY GERLIRAFRSS+KPVKILKVAVY GNV++L M+KPQGFRYKSG
Sbjct  551  YKKTTWMYLAVPVLLYAGERLIRAFRSSVKPVKILKVAVYPGNVMSLHMAKPQGFRYKSG  610

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTRQLKTVFSE+CQPPP GKSG
Sbjct  611  QYIFVNCAAVSPFQWHPFSITSAPRDDYVSVHIRTLGDWTRQLKTVFSEICQPPPTGKSG  670

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRA+CL  +NNPNFP++LIDGPYGAP QDYK+YEVVLLVGLGIGATPMIS+VKDIV+  
Sbjct  671  LLRAECLSDENNPNFPKLLIDGPYGAPTQDYKEYEVVLLVGLGIGATPMISVVKDIVNRS  730

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
             + ++S        +GR     + FKTRRAYFYWVTREQGSFDWFK +M+EV+E D    
Sbjct  731  LSEDSSSNSA---ESGRGG---SRFKTRRAYFYWVTREQGSFDWFKSVMNEVSETDRGGA  784

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IEMHNYCTSVYEEGDARSALI MLQ L+ AK+GVDIVSG
Sbjct  785  IEMHNYCTSVYEEGDARSALITMLQQLNHAKNGVDIVSG  823



>ref|XP_008465165.1| PREDICTED: respiratory burst oxidase homolog protein C [Cucumis 
melo]
 ref|XP_008465166.1| PREDICTED: respiratory burst oxidase homolog protein C [Cucumis 
melo]
Length=924

 Score =   458 bits (1179),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 246/283 (87%), Gaps = 4/283 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLYG ERLIRAFRS IKPVKILKVAVY GNVL L MSKP GF+YKSG
Sbjct  578  YKKTTWMYLAVPVLLYGCERLIRAFRSGIKPVKILKVAVYPGNVLALHMSKPHGFKYKSG  637

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC  VSPFEWHPFSITSAP D+YLSVHIRTLGDWTR+LK VFSEVCQPP  GKSG
Sbjct  638  QYMFVNCRDVSPFEWHPFSITSAPEDNYLSVHIRTLGDWTRKLKDVFSEVCQPPQAGKSG  697

Query  479  LLRADCLQ-GQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+ LQ G  NP FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPM+SIVKDI+ N
Sbjct  698  LLRAEFLQGGAPNPKFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIIDN  757

Query  302  MKAME---NSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMD  132
            ++  E   N+ E G G ++   + +   F+T++AYFYWVTREQGSF+WFKGIM+EVAEMD
Sbjct  758  IEEKESEANAVENGQGHSSRGGSKHGKGFRTKKAYFYWVTREQGSFEWFKGIMNEVAEMD  817

Query  131  EKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            E+ VIE+HNYCTSVYEEGDARSALI MLQSLH AK+GVD+VSG
Sbjct  818  ERGVIELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDVVSG  860



>ref|XP_004166291.1| PREDICTED: LOW QUALITY PROTEIN: respiratory burst oxidase homolog 
protein C-like [Cucumis sativus]
Length=926

 Score =   458 bits (1179),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 246/283 (87%), Gaps = 4/283 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLYG ERLIRAFRS IKPVKILKVAVY GNVL L MSKP GF+YKSG
Sbjct  580  YKKTTWMYLAVPVLLYGCERLIRAFRSGIKPVKILKVAVYPGNVLALHMSKPHGFKYKSG  639

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC  VSPFEWHPFSITSAP D+YLSVHIRTLGDWTR+LK VFSEVCQPP  GKSG
Sbjct  640  QYMFVNCRDVSPFEWHPFSITSAPEDNYLSVHIRTLGDWTRKLKDVFSEVCQPPQAGKSG  699

Query  479  LLRADCLQ-GQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+ LQ G  NP FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPM+SIVKDI+ N
Sbjct  700  LLRAEFLQGGAPNPKFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIIDN  759

Query  302  MKAME---NSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMD  132
            ++  E   N+ E G G ++   + +   F+T++AYFYWVTREQGSF+WFKGIM+EVAEMD
Sbjct  760  IEEKESEANAVENGQGHSSRGGSKHGKGFRTKKAYFYWVTREQGSFEWFKGIMNEVAEMD  819

Query  131  EKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            E+ VIE+HNYCTSVYEEGDARSALI MLQSLH AK+GVD+VSG
Sbjct  820  ERGVIELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDVVSG  862



>ref|XP_004299201.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Fragaria 
vesca subsp. vesca]
Length=935

 Score =   459 bits (1180),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 221/298 (74%), Positives = 252/298 (85%), Gaps = 20/298 (7%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P+ LY  ERLIR FRSSIKPVKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  575  YYKTTWMYLAVPVFLYACERLIRFFRSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSG  634

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFS VCQP   GKSG
Sbjct  635  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSSVCQPSAAGKSG  694

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +Q +NNP+FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPM+SIVKDI++NM
Sbjct  695  LLRAD-MQEENNPSFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNM  753

Query  299  KAMENSEEEGGGI-----TTGRS--------------NNNVNNFKTRRAYFYWVTREQGS  177
             +++N E +   +      +GR+              N +   F+T++AY+YWVTREQGS
Sbjct  754  NSLKNKELDEYAVLDDVLESGRAGNNTNNSSSSNGKSNKSNKGFRTQKAYYYWVTREQGS  813

Query  176  FDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            F+WFKGI++EVAEMDEK VIE+HNYCTSVYEEGDARSALIAMLQ+LH AK+GVD+VSG
Sbjct  814  FEWFKGILNEVAEMDEKGVIELHNYCTSVYEEGDARSALIAMLQNLHHAKNGVDVVSG  871



>ref|XP_010657584.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis 
vinifera]
 ref|XP_010657595.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis 
vinifera]
Length=923

 Score =   458 bits (1179),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 224/288 (78%), Positives = 250/288 (87%), Gaps = 10/288 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMY+A+P+ LY  ERLIRAFRS+IKPVKILKVAVY GNVLTL M+KPQGF+Y+SG
Sbjct  573  YNKTTWMYIAVPVALYACERLIRAFRSTIKPVKILKVAVYPGNVLTLHMTKPQGFKYRSG  632

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVC PP  GKSG
Sbjct  633  QYMFVNCSAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCLPPTGGKSG  692

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRADC Q  + PNFP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI+SNM
Sbjct  693  LLRADCSQEGDGPNFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIISNM  752

Query  299  KAMENSEEEGGGITTGRSNNNVNN---------FKTRRAYFYWVTREQGSFDWFKGIMDE  147
            K  ++ E E   IT   + ++ N          FKT+RAY+YWVTREQGSF+WFKGIM+E
Sbjct  753  KT-KDQETEDIQITVETTPDHDNGNRKKKNKKTFKTKRAYYYWVTREQGSFEWFKGIMNE  811

Query  146  VAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VAEMDEK VIE+HNYCTSV+EEGDARSALI MLQSLH AK+GVD+VSG
Sbjct  812  VAEMDEKGVIELHNYCTSVFEEGDARSALITMLQSLHHAKNGVDVVSG  859



>ref|XP_006423884.1| hypothetical protein CICLE_v10027774mg [Citrus clementina]
 gb|ESR37124.1| hypothetical protein CICLE_v10027774mg [Citrus clementina]
 gb|KDO45136.1| hypothetical protein CISIN_1g002525mg [Citrus sinensis]
Length=912

 Score =   458 bits (1178),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 223/279 (80%), Positives = 250/279 (90%), Gaps = 5/279 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P++LY  ERL RA RSSI+PVKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  575  YQKTTWMYLAVPMVLYACERLTRALRSSIEPVKILKVAVYPGNVLALHMSKPQGFKYKSG  634

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITS+PGDDYLSVHIRTLGDWTRQLKTVFSEVCQP P GKSG
Sbjct  635  QYMFVNCAAVSPFEWHPFSITSSPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPAPAGKSG  694

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRA+  +  N+  FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  695  LLRAE--RENNSRGFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNM  752

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K+ +N+ E G    T  +NN  ++F TR+AYFYWVTREQGSF+WFKGIM+EVAEMDEK V
Sbjct  753  KSEDNNLESG---LTVNNNNKNSSFNTRKAYFYWVTREQGSFEWFKGIMNEVAEMDEKRV  809

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVD+VSG
Sbjct  810  IELHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDVVSG  848



>ref|XP_004503030.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cicer 
arietinum]
Length=927

 Score =   458 bits (1179),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 216/280 (77%), Positives = 245/280 (88%), Gaps = 4/280 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL IP+++Y  ERL RA RSSIKPV+ILKVA+Y GNVL L MSKPQGFRYKSG
Sbjct  587  YKKTTWMYLVIPIIIYALERLTRALRSSIKPVRILKVALYPGNVLALHMSKPQGFRYKSG  646

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR L+  FSE C PP +GKSG
Sbjct  647  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRSLRVKFSESCLPPTHGKSG  706

Query  479  LLRADCLQGQNNPN-FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLR +CLQG ++P+  P+VLIDGPYGAPAQDYK+YEVVLLVGLGIGATPMISI+KDIV+N
Sbjct  707  LLRVECLQGDSSPSTLPKVLIDGPYGAPAQDYKQYEVVLLVGLGIGATPMISILKDIVNN  766

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
             KA+E+ E   G   +    N ++NFKT+RAYFYWVT+EQGSF+WFKG+M+EVAE D + 
Sbjct  767  FKAIEDEE---GSRASQHKKNGLSNFKTKRAYFYWVTKEQGSFEWFKGVMNEVAEEDHRG  823

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  824  VIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  863



>ref|XP_009129697.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Brassica 
rapa]
Length=921

 Score =   458 bits (1178),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 216/279 (77%), Positives = 245/279 (88%), Gaps = 7/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLYG ERLIRAFRSSIKPVKI+KVAVY GN L+L M+KPQGF+YKSG
Sbjct  586  YKKTTWMYLAVPILLYGSERLIRAFRSSIKPVKIVKVAVYPGNALSLHMTKPQGFKYKSG  645

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGDDY+SVHIRTLGDWTR+LKTVFSEVC+PP  GKSG
Sbjct  646  QYMFVNCRAVSPFEWHPFSITSAPGDDYVSVHIRTLGDWTRKLKTVFSEVCKPPTAGKSG  705

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G ++  FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NM
Sbjct  706  LLRAD---GGDSIAFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNM  762

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K    S +    I    SN N   F+TR+AYFYWVTREQGSF+WFKGIMDEV+E+D++ +
Sbjct  763  K----SRDRDSDIENNSSNGNSKGFRTRKAYFYWVTREQGSFEWFKGIMDEVSELDDEGI  818

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  819  IELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  857



>gb|KHN31235.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=928

 Score =   458 bits (1178),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 226/293 (77%), Positives = 247/293 (84%), Gaps = 14/293 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+++Y  ERL RA RSSIKPV+ILKVAVY GNVL+L MSKPQGFRYKSG
Sbjct  572  YKKTTWMYLAIPIIIYLSERLTRALRSSIKPVRILKVAVYPGNVLSLHMSKPQGFRYKSG  631

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMF+NCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR LK  FSE CQPP NGKSG
Sbjct  632  QYMFLNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRSLKVKFSECCQPPDNGKSG  691

Query  479  LLRADCLQGQNNPN-FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+ LQG  +P+  P+VLIDGPYGAPAQDYK+YEVVLLVGLGIGATPMISI+KDIV+N
Sbjct  692  LLRAEYLQGDRSPSALPKVLIDGPYGAPAQDYKQYEVVLLVGLGIGATPMISILKDIVNN  751

Query  302  MKAM--ENSEEEGGGITTGRSN-----------NNVNNFKTRRAYFYWVTREQGSFDWFK  162
            MKAM  E       G  +G  N           N+ +NF TRRAYFYWVTREQGSFDWFK
Sbjct  752  MKAMEEEEETNIEEGTNSGFGNKSPRGSSPHKKNSSSNFNTRRAYFYWVTREQGSFDWFK  811

Query  161  GIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            G+M+EVAE D K VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  812  GVMNEVAEEDHKGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  864



>gb|KHG02500.1| Respiratory burst oxidase C [Gossypium arboreum]
Length=919

 Score =   457 bits (1177),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 221/293 (75%), Positives = 242/293 (83%), Gaps = 14/293 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+ LY  ERL R  RSSI+ V I KVAVY GNVL L MS+P+GFRYKSG
Sbjct  563  YKKTTWMYLAIPVFLYICERLTRLLRSSIEAVTIQKVAVYPGNVLALHMSRPRGFRYKSG  622

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC  VSPFEWHPFSITSAPGDDY+SVHIRTLGDWT QL+TVFS+VC+ P NGKSG
Sbjct  623  QYIFVNCDVVSPFEWHPFSITSAPGDDYVSVHIRTLGDWTGQLRTVFSKVCKQPTNGKSG  682

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRADCLQ  NNP FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV N+
Sbjct  683  LLRADCLQENNNPEFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVHNI  742

Query  299  KAMENSEEE--GGGITTGRSNNNVN------------NFKTRRAYFYWVTREQGSFDWFK  162
            ++M   E+E     +  G + NN              NFKT+RAYFYWVTREQGSFDWFK
Sbjct  743  RSMAEDEDEELSSALENGATINNKTSSPSPPNPKRRENFKTKRAYFYWVTREQGSFDWFK  802

Query  161  GIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            GIM+EVAEMD  HVIE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVD+VSG
Sbjct  803  GIMNEVAEMDHDHVIELHNYCTSVYEEGDARSALITMLQSLNHAKNGVDVVSG  855



>ref|XP_003522455.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Glycine 
max]
Length=928

 Score =   458 bits (1178),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 226/293 (77%), Positives = 247/293 (84%), Gaps = 14/293 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+++Y  ERL RA RSSIKPV+ILKVAVY GNVL+L MSKPQGFRYKSG
Sbjct  572  YKKTTWMYLAIPIIIYLSERLTRALRSSIKPVRILKVAVYPGNVLSLHMSKPQGFRYKSG  631

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMF+NCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR LK  FSE CQPP NGKSG
Sbjct  632  QYMFLNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRSLKVKFSECCQPPDNGKSG  691

Query  479  LLRADCLQGQNNPN-FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+ LQG  +P+  P+VLIDGPYGAPAQDYK+YEVVLLVGLGIGATPMISI+KDIV+N
Sbjct  692  LLRAEYLQGDRSPSTLPKVLIDGPYGAPAQDYKQYEVVLLVGLGIGATPMISILKDIVNN  751

Query  302  MKAM--ENSEEEGGGITTGRSN-----------NNVNNFKTRRAYFYWVTREQGSFDWFK  162
            MKAM  E       G  +G  N           N+ +NF TRRAYFYWVTREQGSFDWFK
Sbjct  752  MKAMEEEEETNIEEGTNSGFGNKSPRGSSPHKKNSSSNFNTRRAYFYWVTREQGSFDWFK  811

Query  161  GIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            G+M+EVAE D K VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  812  GVMNEVAEEDHKGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  864



>ref|XP_003602726.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES72977.1| respiratory burst oxidase-like protein D [Medicago truncatula]
Length=923

 Score =   457 bits (1175),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 220/290 (76%), Positives = 250/290 (86%), Gaps = 13/290 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            +KKTTWMYL IP+++Y  ERL RA RSSIKPV+ILKVAVY GNVL L MSKPQGFRYKSG
Sbjct  572  HKKTTWMYLVIPIIIYALERLTRALRSSIKPVRILKVAVYPGNVLALHMSKPQGFRYKSG  631

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITS+PGDDYLSVHIRTLGDWTR L+  FSE C PP +GKSG
Sbjct  632  QYMFVNCAAVSPFEWHPFSITSSPGDDYLSVHIRTLGDWTRSLRVKFSESCLPPTHGKSG  691

Query  479  LLRADCLQGQNNPN-FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+C+QG ++P+  P+VLIDGPYGAPAQDYK+Y+VVLLVGLGIGATPMISI+KDIV+N
Sbjct  692  LLRAECMQGDSSPSTLPKVLIDGPYGAPAQDYKQYDVVLLVGLGIGATPMISILKDIVNN  751

Query  302  MKAMENSEEEGGGITTGRSNNN----------VNNFKTRRAYFYWVTREQGSFDWFKGIM  153
             KAME  E+EG  I  G S+ +          +N+FKT+RAYFYWVTREQGSFDWFKG+M
Sbjct  752  FKAME--EDEGTTIEEGTSSKSPRPSQHKRTGLNSFKTKRAYFYWVTREQGSFDWFKGVM  809

Query  152  DEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +EVAE D + VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  810  NEVAEDDHRGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  859



>gb|AGI65628.1| NADPH oxidase, partial [Fragaria x ananassa]
Length=817

 Score =   453 bits (1166),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 220/298 (74%), Positives = 250/298 (84%), Gaps = 20/298 (7%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P+ LY  ERLIR FRSSIKPVKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  520  YYKTTWMYLAVPVFLYACERLIRFFRSSIKPVKILKVAVYPGNVLALHMSKPQGFKYKSG  579

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFS VCQP   GKSG
Sbjct  580  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSSVCQPSAAGKSG  639

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +Q +NNP+FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPM+SIVKDI++NM
Sbjct  640  LLRAD-MQEENNPSFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNM  698

Query  299  KAMENSEEEGGGI-----TTGRS--------------NNNVNNFKTRRAYFYWVTREQGS  177
              ++N   +   +      +GR+              N +   F+T++AY+YWVTREQGS
Sbjct  699  NFLKNKLLDEYAVLDDVLESGRAGNNTNNNSSSNGKSNKSNKGFRTQKAYYYWVTREQGS  758

Query  176  FDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            F+WFKGI++EVAEMDEK VIE+HNYCTSVYEEGDARSALIAMLQ+LH AK+GVD+VSG
Sbjct  759  FEWFKGILNEVAEMDEKGVIELHNYCTSVYEEGDARSALIAMLQNLHHAKNGVDVVSG  816



>ref|XP_008239295.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Prunus 
mume]
Length=940

 Score =   455 bits (1171),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 221/290 (76%), Positives = 246/290 (85%), Gaps = 12/290 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+PL LY GERL+RA RSSIKPVKILKVA Y GNVL L +SKPQGFRY SG
Sbjct  588  YKKTTWMYLAVPLTLYAGERLVRALRSSIKPVKILKVA-YPGNVLALHLSKPQGFRYHSG  646

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV CAAVSPFEWHPFSITSAPGD++LSVHIR +GDWT+QLKTVFS+VCQPPP+GKSG
Sbjct  647  QYMFVKCAAVSPFEWHPFSITSAPGDNHLSVHIRIVGDWTQQLKTVFSQVCQPPPSGKSG  706

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG +N  FP+VLIDGPYGAPAQDYK YEVVLLVGLGIGATPMISI+KDIV+N+
Sbjct  707  LLRADHMQGADNLIFPKVLIDGPYGAPAQDYKNYEVVLLVGLGIGATPMISILKDIVNNI  766

Query  299  KAMENSEE-----EGGG------ITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIM  153
            KA+E   E     E G       + +G S   ++NFKT+RAYFYWVTREQGSFDWFKG M
Sbjct  767  KAIEEEGEDMDALENGAPSRISKVGSGSSQLGLHNFKTKRAYFYWVTREQGSFDWFKGAM  826

Query  152  DEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +EVAE+D   VIE HNYCTSVYEEGDARSALI MLQ+L  AK+GVDIVSG
Sbjct  827  NEVAELDHNRVIEFHNYCTSVYEEGDARSALIHMLQTLSHAKNGVDIVSG  876



>emb|CDY35764.1| BnaC02g38300D [Brassica napus]
Length=899

 Score =   454 bits (1167),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 215/278 (77%), Positives = 244/278 (88%), Gaps = 7/278 (3%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KKTTWMYLA+P+LLYG ERLIRA RSSIKPVKI+KVAVY GNVL+L M+KPQGF+YKSGQ
Sbjct  565  KKTTWMYLAVPILLYGSERLIRASRSSIKPVKIVKVAVYPGNVLSLHMTKPQGFKYKSGQ  624

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            YMFVNC AVSPFEWHPFSITSAPGDDY+SVHIRTLGDWTR+LKTVFSEVC+PP  GKSGL
Sbjct  625  YMFVNCRAVSPFEWHPFSITSAPGDDYVSVHIRTLGDWTRKLKTVFSEVCKPPTAGKSGL  684

Query  476  LRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMK  297
            LRAD   G ++  FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NMK
Sbjct  685  LRAD---GGDSIAFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMK  741

Query  296  AMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHVI  117
                S +    I    SN N   F+TR+AYFYWVTREQGSF+WFKGIMDEV+E+D++ +I
Sbjct  742  ----SRDRDSDIENNSSNGNSKGFRTRKAYFYWVTREQGSFEWFKGIMDEVSELDDEGII  797

Query  116  EMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            E+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  798  ELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  835



>ref|XP_010536571.1| PREDICTED: respiratory burst oxidase homolog protein C [Tarenaya 
hassleriana]
Length=911

 Score =   454 bits (1167),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 218/282 (77%), Positives = 241/282 (85%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA P++LY  ER+IRAFRSSIK V I KVAVY GNVL L MS+P  FRYKSG
Sbjct  568  YKKTTWMYLAAPVMLYACERMIRAFRSSIKAVTIRKVAVYPGNVLALHMSRPDNFRYKSG  627

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHI+ LGDWTR LK VFSEVC+PPP G SG
Sbjct  628  QYMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIKCLGDWTRALKGVFSEVCRPPPAGVSG  687

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            +LRAD + G NNP+FP+V+IDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  688  ILRADMMHGANNPDFPKVMIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  747

Query  299  KAMENSEEEG---GGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA E ++  G   G  + GR      +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D 
Sbjct  748  KAKEQADLNGLESGSHSNGRGKK--ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDN  805

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             +VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  806  NNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  847



>gb|AIT39747.1| respiratory burst oxidase, partial [Chrysanthemum boreale]
Length=617

 Score =   444 bits (1143),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 219/287 (76%), Positives = 244/287 (85%), Gaps = 13/287 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLY  ERL RA RS++KPV ILKVAVY GNVL L MSKP GF+YKSG
Sbjct  273  YKKTTWMYLAVPMLLYACERLTRALRSTVKPVSILKVAVYPGNVLALHMSKPAGFKYKSG  332

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITS+PGDDYLSVHIRTLGDWTRQLKTVFSEVC+PP NGKSG
Sbjct  333  QYMFVNCKAVSPFEWHPFSITSSPGDDYLSVHIRTLGDWTRQLKTVFSEVCRPPANGKSG  392

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  QG NN +FP VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDIV+NM
Sbjct  393  LLRADN-QG-NNLDFPTVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIVNNM  450

Query  299  KAMENSEEEGGGITTGRSNNNV--------NNFKTRRAYFYWVTREQGSFDWFKGIMDEV  144
            K     +EE   + +G +++          + FKT +AYFYWVTREQGSFDWFKG+M+EV
Sbjct  451  K---TKQEEEAALESGVNSSVPPPSPLSKKSTFKTTQAYFYWVTREQGSFDWFKGVMNEV  507

Query  143  AEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            AE D  +VIEMHNYCTSVYEEGDARSALI MLQSL+ AK+GVD+VSG
Sbjct  508  AETDHDNVIEMHNYCTSVYEEGDARSALITMLQSLNHAKNGVDVVSG  554



>gb|KHN16903.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=816

 Score =   450 bits (1158),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 215/280 (77%), Positives = 245/280 (88%), Gaps = 10/280 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+ +Y  ERL+RAFRSSIK VKILKV +Y GNVL+L+MSKPQGF YKSG
Sbjct  482  YKKTTWMYLAIPIAIYALERLVRAFRSSIKSVKILKVTLYPGNVLSLKMSKPQGFSYKSG  541

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHI+ LGDWTR LK  F++ CQ P NG+SG
Sbjct  542  QYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIKILGDWTRSLKAKFTQACQQPLNGQSG  601

Query  479  LLRADCLQGQNNP-NFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+CL+G N+P +FP+VL+DGPYGAPAQDY++YEVVLLVGLGIGATPMISI+KD+V+N
Sbjct  602  LLRAECLKGDNSPSSFPKVLVDGPYGAPAQDYREYEVVLLVGLGIGATPMISILKDMVNN  661

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
             KA  N EEEGG          V++FKTRRAYFYWVTREQGSFDWFKG+M+EVAE D + 
Sbjct  662  FKA--NDEEEGG-------QERVSDFKTRRAYFYWVTREQGSFDWFKGVMNEVAEEDRRK  712

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+H+YCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  713  VIELHSYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  752



>ref|XP_008375433.1| PREDICTED: respiratory burst oxidase homolog protein C [Malus 
domestica]
Length=941

 Score =   454 bits (1167),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 221/297 (74%), Positives = 246/297 (83%), Gaps = 18/297 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+PL LY GERL+RA RSSIKPV+ILKVA+Y GNVL L +SKPQGFRY SG
Sbjct  581  YQKTTWMYLAVPLTLYAGERLVRALRSSIKPVQILKVALYPGNVLALHLSKPQGFRYHSG  640

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDD+LSVHIR +GDWTRQLKTVFS+VCQPPP+GKSG
Sbjct  641  QYMFVNCAAVSPFEWHPFSITSAPGDDHLSVHIRIVGDWTRQLKTVFSKVCQPPPSGKSG  700

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LL AD +QG  N  FPRVLIDGPYGAPAQ+YK YEVVLLVGLGIGATPMISI+KDIV+N+
Sbjct  701  LLTADHMQGAENLIFPRVLIDGPYGAPAQEYKTYEVVLLVGLGIGATPMISILKDIVNNI  760

Query  299  KAM-----ENSEE-------------EGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSF  174
            KAM     +N+ E             +      G ++   +NFKT+RAYFYWVTREQGSF
Sbjct  761  KAMEEEEEDNALENGGGGGGGTKLPHKSSKTHAGSTSVGHHNFKTKRAYFYWVTREQGSF  820

Query  173  DWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            DWFKG M+EVAE+D   VIE HNYCTSVYEEGDARSALIAMLQSL  AK+GVDIVSG
Sbjct  821  DWFKGAMNEVAELDHNRVIEFHNYCTSVYEEGDARSALIAMLQSLSHAKNGVDIVSG  877



>ref|XP_006844712.1| hypothetical protein AMTR_s00016p00250800 [Amborella trichopoda]
 gb|ERN06387.1| hypothetical protein AMTR_s00016p00250800 [Amborella trichopoda]
Length=917

 Score =   453 bits (1165),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 218/284 (77%), Positives = 242/284 (85%), Gaps = 5/284 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLY  ERL+RAFRSS +PVKILKVAVY GNVL L MSKPQGF+Y+SG
Sbjct  570  YKKTTWMYLAVPVLLYACERLVRAFRSSSQPVKILKVAVYPGNVLALHMSKPQGFKYRSG  629

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+ VNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWT QLK VFSEVCQP   GKSG
Sbjct  630  QYLLVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTGQLKAVFSEVCQPSTGGKSG  689

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +Q + NP+FPRVLIDGPYGAP+QDYKKY+VVLLVGLGIGATP +SIVKDI++N+
Sbjct  690  LLRADYMQEEGNPSFPRVLIDGPYGAPSQDYKKYDVVLLVGLGIGATPCVSIVKDIMNNI  749

Query  299  KA-----MENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEM  135
            +A      E  + E GG     +      FKT+RAYFYWVTREQGSF+WFKG+M+EVAE 
Sbjct  750  RASEEEEREEKDLERGGALRTTATPTKKKFKTQRAYFYWVTREQGSFEWFKGVMNEVAEA  809

Query  134  DEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            D+  VIE HNYCTSVYEEGDARSALIAMLQSLH AKSGVDIVSG
Sbjct  810  DQNGVIEFHNYCTSVYEEGDARSALIAMLQSLHHAKSGVDIVSG  853



>gb|KHN09692.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=939

 Score =   453 bits (1165),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 224/294 (76%), Positives = 247/294 (84%), Gaps = 15/294 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+++Y  ERL RA RSSIKPV+ILKVAVY GNVL+L MSKPQGFRYKSG
Sbjct  582  YKKTTWMYLAIPIIIYVSERLTRALRSSIKPVRILKVAVYPGNVLSLHMSKPQGFRYKSG  641

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMF+NCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR LK  FSE CQPP NGKSG
Sbjct  642  QYMFLNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRSLKVKFSECCQPPDNGKSG  701

Query  479  LLRADCLQGQNNPN-FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+ LQG  +P+  P+VLIDGPYGAPAQDYK+YEVVLLVGLGIGATPMISI+KDIV+N
Sbjct  702  LLRAEYLQGDRSPSALPKVLIDGPYGAPAQDYKQYEVVLLVGLGIGATPMISILKDIVNN  761

Query  302  MKAM---------ENSEEEGGGITTGRSN-----NNVNNFKTRRAYFYWVTREQGSFDWF  165
            MKAM         E     G G  + R +     +  +NF TRRAYFYWVTREQGSFDWF
Sbjct  762  MKAMEEEEGSNIEEGGASSGFGNKSPRGSSPHKKSGSSNFNTRRAYFYWVTREQGSFDWF  821

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KG+M+EVAE D + VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  822  KGVMNEVAEEDHRGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  875



>ref|XP_003526909.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
1 [Glycine max]
Length=941

 Score =   453 bits (1165),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 224/294 (76%), Positives = 247/294 (84%), Gaps = 15/294 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+++Y  ERL RA RSSIKPV+ILKVAVY GNVL+L MSKPQGFRYKSG
Sbjct  584  YKKTTWMYLAIPIIIYVSERLTRALRSSIKPVRILKVAVYPGNVLSLHMSKPQGFRYKSG  643

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMF+NCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR LK  FSE CQPP NGKSG
Sbjct  644  QYMFLNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRSLKVKFSECCQPPDNGKSG  703

Query  479  LLRADCLQGQNNPN-FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+ LQG  +P+  P+VLIDGPYGAPAQDYK+YEVVLLVGLGIGATPMISI+KDIV+N
Sbjct  704  LLRAEYLQGDRSPSALPKVLIDGPYGAPAQDYKQYEVVLLVGLGIGATPMISILKDIVNN  763

Query  302  MKAM---------ENSEEEGGGITTGRSN-----NNVNNFKTRRAYFYWVTREQGSFDWF  165
            MKAM         E     G G  + R +     +  +NF TRRAYFYWVTREQGSFDWF
Sbjct  764  MKAMEEEEGSNIEEGGASSGFGNKSPRGSSPHKKSGSSNFNTRRAYFYWVTREQGSFDWF  823

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KG+M+EVAE D + VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  824  KGVMNEVAEEDHRGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  877



>ref|XP_003532261.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
1 [Glycine max]
Length=888

 Score =   451 bits (1159),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 215/280 (77%), Positives = 245/280 (88%), Gaps = 10/280 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+ +Y  ERL+RAFRSSIK VKILKV +Y GNVL+L+MSKPQGF YKSG
Sbjct  554  YKKTTWMYLAIPITIYALERLVRAFRSSIKSVKILKVTLYPGNVLSLKMSKPQGFSYKSG  613

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHI+ LGDWTR LK  F++ CQ P NG+SG
Sbjct  614  QYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIKILGDWTRSLKAKFTQACQQPLNGQSG  673

Query  479  LLRADCLQGQNNP-NFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+CL+G N+P +FP+VL+DGPYGAPAQDY++YEVVLLVGLGIGATPMISI+KD+V+N
Sbjct  674  LLRAECLKGDNSPSSFPKVLVDGPYGAPAQDYREYEVVLLVGLGIGATPMISILKDMVNN  733

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
             KA  N EEEGG          V++FKTRRAYFYWVTREQGSFDWFKG+M+EVAE D + 
Sbjct  734  FKA--NDEEEGG-------QERVSDFKTRRAYFYWVTREQGSFDWFKGVMNEVAEEDRRK  784

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+H+YCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  785  VIELHSYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  824



>emb|CDY38845.1| BnaA03g13340D [Brassica napus]
Length=910

 Score =   451 bits (1161),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 214/280 (76%), Positives = 239/280 (85%), Gaps = 2/280 (1%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            +KTTWMYL +P++LYG ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSGQ
Sbjct  567  QKTTWMYLVVPVVLYGCERLIRAFRSSIKAVTIRKVAVYPGNVLAIHLSRPQNFKYKSGQ  626

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            YMFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SGL
Sbjct  627  YMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSGL  686

Query  476  LRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMK  297
            LRAD + G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N++
Sbjct  687  LRADMMHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIR  746

Query  296  AMENSE--EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            A E +E      G +  +  N   +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D   
Sbjct  747  AKEQAELNRMEHGTSEPQQRNKKESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNR  806

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +IE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  807  IIELHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  846



>ref|XP_009132634.1| PREDICTED: respiratory burst oxidase homolog protein C [Brassica 
rapa]
Length=910

 Score =   451 bits (1161),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 214/280 (76%), Positives = 239/280 (85%), Gaps = 2/280 (1%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            +KTTWMYL +P++LYG ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSGQ
Sbjct  567  QKTTWMYLVVPVVLYGCERLIRAFRSSIKAVTIRKVAVYPGNVLAIHLSRPQNFKYKSGQ  626

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            YMFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SGL
Sbjct  627  YMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSGL  686

Query  476  LRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMK  297
            LRAD + G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N++
Sbjct  687  LRADMMHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIR  746

Query  296  AMENSE--EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            A E +E      G +  +  N   +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D   
Sbjct  747  AKEQAELNRMEHGTSEPQQRNKKESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNR  806

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +IE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  807  IIELHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  846



>emb|CDY32647.1| BnaC03g16150D [Brassica napus]
Length=910

 Score =   451 bits (1160),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 214/280 (76%), Positives = 239/280 (85%), Gaps = 2/280 (1%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            +KTTWMYL +P++LYG ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSGQ
Sbjct  567  QKTTWMYLVVPVVLYGCERLIRAFRSSIKAVTIRKVAVYPGNVLAIHLSRPQNFKYKSGQ  626

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            YMFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SGL
Sbjct  627  YMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSGL  686

Query  476  LRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMK  297
            LRAD + G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N++
Sbjct  687  LRADMMHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIR  746

Query  296  AMENSE--EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            A E +E      G +  +  N   +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D   
Sbjct  747  AKEQAELNRMEHGTSEPQQRNKKESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNR  806

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +IE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  807  IIELHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  846



>gb|EYU24549.1| hypothetical protein MIMGU_mgv1a001003mg [Erythranthe guttata]
Length=916

 Score =   451 bits (1159),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 215/289 (74%), Positives = 245/289 (85%), Gaps = 10/289 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LYGGERL +AFRS +K VKILKVAV+ GNVL+L MSKP GF YKSG
Sbjct  564  YKKTTWMYLAVPVALYGGERLFKAFRSRVKAVKILKVAVFPGNVLSLHMSKPHGFEYKSG  623

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPFEWHPFSITSAP D Y+SVHIRTLGDWT+QLKT F++VCQP P GKSG
Sbjct  624  QYIFVNCAAVSPFEWHPFSITSAPSDGYVSVHIRTLGDWTKQLKTTFTKVCQPSPTGKSG  683

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            +   D L+G++N N P+VLIDGPYGAP QDYK Y+VVLLVGLGIGATPMIS+VKDIV+NM
Sbjct  684  IRSVDYLEGEDNHNCPKVLIDGPYGAPTQDYKDYDVVLLVGLGIGATPMISVVKDIVNNM  743

Query  299  KAM------ENSEEEGG----GITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMD  150
            KA+      EN+  EGG      T   S ++  +FKTRRAYFYWVTREQGSFDWFKG+M+
Sbjct  744  KALDEAGENENAALEGGTHKRKKTVSNSPSDKQDFKTRRAYFYWVTREQGSFDWFKGVMN  803

Query  149  EVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            EVAEMD K VIEMHNYCTSVYEEGDARSALIAMLQS++ AK+GVD+VSG
Sbjct  804  EVAEMDHKGVIEMHNYCTSVYEEGDARSALIAMLQSINHAKNGVDVVSG  852



>ref|XP_009360267.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Pyrus 
x bretschneideri]
 ref|XP_009360299.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Pyrus 
x bretschneideri]
Length=947

 Score =   451 bits (1159),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 219/298 (73%), Positives = 245/298 (82%), Gaps = 19/298 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+PL LY GERL+RA RSSIKPV+ILKVA+Y GNVL L +SKPQGFRY SG
Sbjct  586  YQKTTWMYLAVPLTLYAGERLVRALRSSIKPVQILKVALYPGNVLALHLSKPQGFRYHSG  645

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGDD+LSVHIR +GDWTRQLKTVFS+VCQPPP+GKSG
Sbjct  646  QYMFVNCAAVSPFEWHPFSITSAPGDDHLSVHIRIVGDWTRQLKTVFSQVCQPPPSGKSG  705

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LL AD +QG +N  FPRVLIDGPYGAPAQ+YK YEVVLLVGLGIGATPMISI+KDIV+N+
Sbjct  706  LLTADHMQGADNLIFPRVLIDGPYGAPAQEYKTYEVVLLVGLGIGATPMISILKDIVNNI  765

Query  299  KAM-----ENSEE--------------EGGGITTGRSNNNVNNFKTRRAYFYWVTREQGS  177
            KAM     +N+ E              +     TG +    +NF+ +RAYFYWVTREQ S
Sbjct  766  KAMEEEEEDNALENDGGGGDGGTKLPHKSSKTHTGSAFTRHHNFQIKRAYFYWVTREQDS  825

Query  176  FDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            FDWFKG M+EVAE+D   VIE HNYCTSVYEEGDARSALIAMLQSL  AK+GVDIVSG
Sbjct  826  FDWFKGAMNEVAELDHNRVIEFHNYCTSVYEEGDARSALIAMLQSLSHAKNGVDIVSG  883



>gb|AAC39477.1| respiratory burst oxidase protein C [Arabidopsis thaliana]
Length=867

 Score =   448 bits (1153),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 218/282 (77%), Positives = 238/282 (84%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL +P++LY  ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSG
Sbjct  524  HNKTTWMYLVVPVVLYACERLIRAFRSSIKAVTIRKVAVYPGNVLAIHLSRPQNFKYKSG  583

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SG
Sbjct  584  QYMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSG  643

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD L G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  644  LLRADMLHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  703

Query  299  KAMENSE---EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA E ++    E G     RS     +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D 
Sbjct  704  KAKEQAQLNRMENGTSEPQRSKK--ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDA  761

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIEMHNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  762  NRVIEMHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  803



>ref|XP_010445756.1| PREDICTED: respiratory burst oxidase homolog protein D-like, 
partial [Camelina sativa]
Length=701

 Score =   443 bits (1140),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 217/280 (78%), Positives = 248/280 (89%), Gaps = 6/280 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY  ERLIRAFRSSIKPVK+LKVAVY GNVL+L M+KPQGF+YKSG
Sbjct  363  YQKTTWMYLAVPILLYASERLIRAFRSSIKPVKMLKVAVYPGNVLSLHMTKPQGFKYKSG  422

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGD+YLSVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  423  QYMFVNCRAVSPFEWHPFSITSAPGDEYLSVHIRTLGDWTRKLRTVFSEVCKPPTAGKSG  482

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G  N  FP+VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NM
Sbjct  483  LLRAD--GGDGNLPFPKVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNM  540

Query  299  KAME-NSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            K+ + +S+ E        +NNN   FKTR+AYFYWVTREQGSF+WFKGIMDEV+E+D++ 
Sbjct  541  KSPDRDSDIE---NNNSNNNNNSKGFKTRKAYFYWVTREQGSFEWFKGIMDEVSELDDEG  597

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +IE+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  598  IIELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  637



>ref|XP_002865839.1| hypothetical protein ARALYDRAFT_495172 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42098.1| hypothetical protein ARALYDRAFT_495172 [Arabidopsis lyrata subsp. 
lyrata]
Length=906

 Score =   449 bits (1155),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 217/282 (77%), Positives = 238/282 (84%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL  P++LY  ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSG
Sbjct  563  HNKTTWMYLVAPVILYACERLIRAFRSSIKAVTIRKVAVYPGNVLAIHLSRPQNFKYKSG  622

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SG
Sbjct  623  QYMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSG  682

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD L G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  683  LLRADMLHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  742

Query  299  KAMENSE---EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA E ++    E G  T+    N   +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D 
Sbjct  743  KAKEQAQLNRMENG--TSEPQRNKKESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDT  800

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              +IEMHNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  801  NRIIEMHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  842



>gb|AAS15724.1| respiratory burst oxidase protein C [Arabidopsis thaliana]
Length=905

 Score =   449 bits (1155),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 218/282 (77%), Positives = 238/282 (84%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL +P++LY  ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSG
Sbjct  562  HNKTTWMYLVVPVVLYACERLIRAFRSSIKAVTIRKVAVYPGNVLAIHLSRPQNFKYKSG  621

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SG
Sbjct  622  QYMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSG  681

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD L G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  682  LLRADMLHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  741

Query  299  KAMENSE---EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA E ++    E G     RS     +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D 
Sbjct  742  KAKEQAQLNRMENGTSEPQRSKK--ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDA  799

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIEMHNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  800  NRVIEMHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  841



>ref|XP_006663498.1| PREDICTED: respiratory burst oxidase homolog protein C-like, 
partial [Oryza brachyantha]
Length=769

 Score =   445 bits (1144),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 211/281 (75%), Positives = 242/281 (86%), Gaps = 7/281 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY  ERL RA RSS++PVKILKVAVY GNVL+L  SKPQGFRYKSG
Sbjct  430  YKKTTWMYLAVPMCLYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFRYKSG  489

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS VC+PP  GKSG
Sbjct  490  QYIFVNCAAVSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSRVCRPPTEGKSG  549

Query  479  LLRA--DCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVS  306
            LLRA  D      NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMISI+KDI++
Sbjct  550  LLRAEYDRDGAMTNPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIIN  609

Query  305  NMKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEK  126
            NM+ ++   E GGG  +  S     +F+TRRAYFYWVTREQGSF+WF+G+MDEVAE D+K
Sbjct  610  NMRQLDGDLENGGGDASVPS-----SFRTRRAYFYWVTREQGSFEWFRGVMDEVAETDKK  664

Query  125  HVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  665  GVIELHNYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  705



>ref|NP_199919.1| Respiratory burst oxidase homolog protein C [Arabidopsis thaliana]
 sp|O81210.2|RBOHC_ARATH RecName: Full=Respiratory burst oxidase homolog protein C; AltName: 
Full=NADPH oxidase RBOHC; Short=AtRBOHC; AltName: Full=Protein 
ROOT HAIR DEFECTIVE 2 [Arabidopsis thaliana]
 dbj|BAB08752.1| respiratory burst oxidase protein [Arabidopsis thaliana]
 gb|AED96028.1| Respiratory burst oxidase homolog protein C [Arabidopsis thaliana]
Length=905

 Score =   449 bits (1154),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 218/282 (77%), Positives = 238/282 (84%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL +P++LY  ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSG
Sbjct  562  HNKTTWMYLVVPVVLYACERLIRAFRSSIKAVTIRKVAVYPGNVLAIHLSRPQNFKYKSG  621

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SG
Sbjct  622  QYMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSG  681

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD L G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  682  LLRADMLHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  741

Query  299  KAMENSE---EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA E ++    E G     RS     +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D 
Sbjct  742  KAKEQAQLNRMENGTSEPQRSKK--ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDA  799

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIEMHNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  800  NRVIEMHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  841



>ref|XP_002863831.1| hypothetical protein ARALYDRAFT_917612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40090.1| hypothetical protein ARALYDRAFT_917612 [Arabidopsis lyrata subsp. 
lyrata]
Length=920

 Score =   449 bits (1155),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 218/279 (78%), Positives = 245/279 (88%), Gaps = 8/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P+LLY  ERL+RAFRSSIKPVK+LKVAVY GNVL+L M+KPQGF+YKSG
Sbjct  586  YHKTTWMYLAVPILLYASERLLRAFRSSIKPVKMLKVAVYPGNVLSLHMTKPQGFKYKSG  645

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  646  QYMFVNCRAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRKLRTVFSEVCKPPTAGKSG  705

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G  N  FP+VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NM
Sbjct  706  LLRADG--GDGNLPFPKVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNM  763

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K+ ++       I    SNNN   FKTR+AYFYWVTREQGSF+WFKGIMDEV+E+DE+ +
Sbjct  764  KSPDSD------IENNNSNNNSKGFKTRKAYFYWVTREQGSFEWFKGIMDEVSELDEEGI  817

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  818  IELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  856



>gb|KFK36751.1| hypothetical protein AALP_AA4G165200 [Arabis alpina]
Length=900

 Score =   448 bits (1153),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 215/283 (76%), Positives = 239/283 (84%), Gaps = 6/283 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL +P++LY  ERLIRAFRSSIK V I KVAVY GNVL L +++PQ F+YKSG
Sbjct  556  HNKTTWMYLVVPVVLYACERLIRAFRSSIKAVTIRKVAVYPGNVLALHLTRPQNFKYKSG  615

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SG
Sbjct  616  QYMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSG  675

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD + G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  676  LLRADMMHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNL  735

Query  299  KAMENSE----EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMD  132
            +A E +E    E G  +   R  N   +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D
Sbjct  736  RAKEQAELNRMEHGTSVPQPR--NKKESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERD  793

Query  131  EKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
               VI++HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  794  TNRVIDLHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  836



>ref|XP_006282261.1| hypothetical protein CARUB_v10028541mg [Capsella rubella]
 gb|EOA15159.1| hypothetical protein CARUB_v10028541mg [Capsella rubella]
Length=916

 Score =   448 bits (1153),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/282 (77%), Positives = 238/282 (84%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL  P++LY  ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSG
Sbjct  573  HNKTTWMYLVAPVVLYACERLIRAFRSSIKAVTIRKVAVYPGNVLAMHISRPQNFKYKSG  632

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SG
Sbjct  633  QYMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSG  692

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD + G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  693  LLRADMMHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  752

Query  299  KAMENSE---EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA E ++    E G  T+    N   +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D 
Sbjct  753  KAKEQAQLNRMENG--TSEPQRNKKESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDT  810

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIEMHNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  811  NRVIEMHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  852



>gb|ADQ74913.1| respiratory burst oxidase protein 1 [Picea abies]
Length=954

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 212/281 (75%), Positives = 243/281 (86%), Gaps = 5/281 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+L YGGER +RA RS  K VKI KVA+Y GNVL L +SKPQGF+YKSG
Sbjct  613  YKKTTWMYLAVPMLFYGGERSLRALRSGYKSVKIQKVAIYPGNVLALHVSKPQGFKYKSG  672

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVS FEWHPFSITS+PGDD+LSVHIRTLGDWTR+LKTVFS+VC+PP  GKSG
Sbjct  673  QYMFVNCPAVSSFEWHPFSITSSPGDDFLSVHIRTLGDWTRELKTVFSKVCEPPGGGKSG  732

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +QG+NNP+FPR+LIDGPYGAPAQDY+KY+V+LLVGLGIGATP ISIVKDIV+NM
Sbjct  733  LLRADYMQGENNPSFPRLLIDGPYGAPAQDYRKYDVLLLVGLGIGATPFISIVKDIVNNM  792

Query  299  KAMENSEEEGGGITTGR--SNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEK  126
            K     EEE   +  G   S +   +F T RAYFYWVTREQGSF+WFKG+M+EVAE+D+K
Sbjct  793  KL---KEEESSHLENGSNGSKHKKKSFNTSRAYFYWVTREQGSFEWFKGVMNEVAEIDDK  849

Query  125  HVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             +IE+HNYCTSVYEEGDARSALIAMLQ+L+ AK GVDIVSG
Sbjct  850  RIIELHNYCTSVYEEGDARSALIAMLQALNHAKHGVDIVSG  890



>gb|KHN17442.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=898

 Score =   447 bits (1150),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 210/280 (75%), Positives = 244/280 (87%), Gaps = 5/280 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+ +Y  ERL+RAFRSSIK VKILKV +Y GNVL+L+MSKP GF YKSG
Sbjct  559  YKKTTWMYLAIPITIYALERLVRAFRSSIKSVKILKVTLYPGNVLSLKMSKPHGFSYKSG  618

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHI+ LGDWTR LK  F++ CQ P NG+SG
Sbjct  619  QYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIKILGDWTRSLKAKFTQACQQPLNGQSG  678

Query  479  LLRADCLQGQNNP-NFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+CL+G N+P +FP+VL+DGPYGAPAQDY++YEVVLLVGLGIGATPMISI+KD+V+N
Sbjct  679  LLRAECLKGDNSPSSFPKVLVDGPYGAPAQDYREYEVVLLVGLGIGATPMISILKDMVNN  738

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
             KA++  E    GI   +S   +++FKT RAYFYWVTREQGSFDWFKG+M+EVAE D + 
Sbjct  739  FKAIDEEE----GIGGAKSPTRLSDFKTSRAYFYWVTREQGSFDWFKGVMNEVAEEDRRK  794

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+H+YCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  795  VIELHSYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  834



>ref|XP_010442839.1| PREDICTED: respiratory burst oxidase homolog protein C isoform 
X1 [Camelina sativa]
Length=913

 Score =   447 bits (1150),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 215/282 (76%), Positives = 239/282 (85%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL +P++LY  ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSG
Sbjct  570  HNKTTWMYLVVPVVLYACERLIRAFRSSIKAVTIRKVAVYPGNVLAIHLSRPQNFKYKSG  629

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSIT+AP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SG
Sbjct  630  QYMFVNCAAVSPFEWHPFSITAAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSG  689

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD + G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  690  LLRADMMHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  749

Query  299  KAMENSE---EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA E ++    E G  T+    N   +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D 
Sbjct  750  KAKEQAQLNRMENG--TSEPQRNKKESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDT  807

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  808  NRVIELHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  849



>ref|XP_010442586.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Camelina 
sativa]
Length=913

 Score =   447 bits (1150),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 215/282 (76%), Positives = 239/282 (85%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL +P++LY  ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSG
Sbjct  570  HNKTTWMYLVVPVVLYACERLIRAFRSSIKAVTIRKVAVYPGNVLAIHLSRPQNFKYKSG  629

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSIT+AP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SG
Sbjct  630  QYMFVNCAAVSPFEWHPFSITAAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSG  689

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD + G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  690  LLRADMMHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  749

Query  299  KAMENSE---EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA E ++    E G  T+    N   +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D 
Sbjct  750  KAKEQAQLNRMENG--TSEPQRNKKESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDT  807

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  808  NRVIELHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  849



>ref|XP_010438870.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Camelina 
sativa]
Length=924

 Score =   447 bits (1151),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 216/279 (77%), Positives = 247/279 (89%), Gaps = 3/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY  ERLIRAFRSSIKPVK+LKVAVY GNVL+L M+KPQGF+YKSG
Sbjct  585  YQKTTWMYLAVPILLYASERLIRAFRSSIKPVKMLKVAVYPGNVLSLHMTKPQGFKYKSG  644

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGD+YLSVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  645  QYMFVNCRAVSPFEWHPFSITSAPGDEYLSVHIRTLGDWTRKLRTVFSEVCKPPTAGKSG  704

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G  N  FP+VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NM
Sbjct  705  LLRAD--GGDGNLPFPKVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNM  762

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K+ E  + +     +  +NNN   FKTR+AYFYWVTREQGSF+WFKGIMDEV+E+D++ +
Sbjct  763  KSPER-DSDIENNNSNNNNNNSKGFKTRKAYFYWVTREQGSFEWFKGIMDEVSELDDEGI  821

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  822  IELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  860



>ref|XP_010482435.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Camelina 
sativa]
Length=913

 Score =   447 bits (1150),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 215/282 (76%), Positives = 239/282 (85%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL +P++LY  ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSG
Sbjct  570  HNKTTWMYLVVPVVLYACERLIRAFRSSIKAVTIRKVAVYPGNVLAIHLSRPQNFKYKSG  629

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSIT+AP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SG
Sbjct  630  QYMFVNCAAVSPFEWHPFSITAAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSG  689

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD + G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  690  LLRADMMHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  749

Query  299  KAMENSE---EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA E ++    E G  T+    N   +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D 
Sbjct  750  KAKEQAQLNRMENG--TSEPQRNKKESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDT  807

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  808  NRVIELHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  849



>gb|AFJ66221.1| hypothetical protein 34G24.26 [Capsella rubella]
Length=957

 Score =   448 bits (1153),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 217/282 (77%), Positives = 238/282 (84%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL  P++LY  ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSG
Sbjct  600  HNKTTWMYLVAPVVLYACERLIRAFRSSIKAVTIRKVAVYPGNVLAMHISRPQNFKYKSG  659

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SG
Sbjct  660  QYMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSG  719

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD + G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  720  LLRADMMHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  779

Query  299  KAMENSE---EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA E ++    E G  T+    N   +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D 
Sbjct  780  KAKEQAQLNRMENG--TSEPQRNKKESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDT  837

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIEMHNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  838  NRVIEMHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  879



>ref|XP_003525163.2| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
3 [Glycine max]
Length=898

 Score =   446 bits (1147),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 209/280 (75%), Positives = 244/280 (87%), Gaps = 5/280 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+ +Y  ERL+RAFRSSIK V+ILKV +Y GNVL+L+MSKP GF YKSG
Sbjct  559  YKKTTWMYLAIPITIYALERLVRAFRSSIKSVRILKVTLYPGNVLSLKMSKPHGFSYKSG  618

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHI+ LGDWTR LK  F++ CQ P NG+SG
Sbjct  619  QYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIKILGDWTRSLKAKFTQACQQPLNGQSG  678

Query  479  LLRADCLQGQNNP-NFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+CL+G N+P +FP+VL+DGPYGAPAQDY++YEVVLLVGLGIGATPMISI+KD+V+N
Sbjct  679  LLRAECLKGDNSPSSFPKVLVDGPYGAPAQDYREYEVVLLVGLGIGATPMISILKDMVNN  738

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
             KA++  E    GI   +S   +++FKT RAYFYWVTREQGSFDWFKG+M+EVAE D + 
Sbjct  739  FKAIDEEE----GIGGAKSPTRLSDFKTSRAYFYWVTREQGSFDWFKGVMNEVAEEDRRK  794

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+H+YCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  795  VIELHSYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  834



>ref|XP_009404193.1| PREDICTED: respiratory burst oxidase homolog protein B [Musa 
acuminata subsp. malaccensis]
Length=938

 Score =   447 bits (1149),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 248/304 (82%), Gaps = 25/304 (8%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP++LY  ERL+RA RSS++PVKILKVAVY GNVLTL +SKPQGF+Y+SG
Sbjct  571  YKKTTWMYLAIPVILYASERLVRALRSSVRPVKILKVAVYPGNVLTLHVSKPQGFKYRSG  630

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTRQLK VFSEVCQPP  G+SG
Sbjct  631  QYIFVNCAAVSPFQWHPFSITSAPQDDYISVHIRTLGDWTRQLKMVFSEVCQPPTGGRSG  690

Query  479  LLRADCLQGQN---NPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV  309
            LLRAD     N   NP+FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATP ISIVKDIV
Sbjct  691  LLRADYGDSSNNGMNPSFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPFISIVKDIV  750

Query  308  SNMKAME-----NSEEEGGGITTGRSNNNVNN-----------------FKTRRAYFYWV  195
            +NMK +E     + EE+      G SN+N  +                 F+TRRAYFYWV
Sbjct  751  NNMKQLESLGLGDVEEQDLENRGGGSNSNSGHHKRGGSTSTSVSVSTSSFRTRRAYFYWV  810

Query  194  TREQGSFDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVD  15
            TREQ SF+WF+G+M+EVAE D+K VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK GVD
Sbjct  811  TREQDSFEWFRGVMNEVAETDKKGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKHGVD  870

Query  14   IVSG  3
            +VSG
Sbjct  871  VVSG  874



>ref|XP_008807833.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
X1 [Phoenix dactylifera]
Length=921

 Score =   446 bits (1147),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 214/291 (74%), Positives = 246/291 (85%), Gaps = 13/291 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKK+TWMYLAIP+++Y  ERLIRAFRSS++PVKILKVAVY GNVL L +SKPQGF+Y+SG
Sbjct  568  YKKSTWMYLAIPMIIYATERLIRAFRSSVRPVKILKVAVYPGNVLALHVSKPQGFKYRSG  627

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDYLSVHIRTLGDWTRQLKTVFS VCQ P +GKSG
Sbjct  628  QYIFVNCAAVSPFQWHPFSITSAPEDDYLSVHIRTLGDWTRQLKTVFSRVCQRPADGKSG  687

Query  479  LLRADCLQGQNN---PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV  309
            LLRADC  G  +   P+ PRVLIDGPYGAPAQDYKKY+VVLLVGLGIGATP ISI+KDIV
Sbjct  688  LLRADC-DGDADISIPSMPRVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPFISILKDIV  746

Query  308  SNMKAME---------NSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGI  156
            +NMK +E         + + EG G ++ R +   + F TRRAYFYWVTREQGSF+WF+G+
Sbjct  747  NNMKQLESEGLLDSEGDRDLEGAGGSSHRPSGTSSTFNTRRAYFYWVTREQGSFEWFRGV  806

Query  155  MDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            M+EVAE D+K VIE+H YCTSVYEEGDARSALI MLQSL+ AK GVD+VSG
Sbjct  807  MNEVAETDKKGVIELHTYCTSVYEEGDARSALITMLQSLNHAKHGVDVVSG  857



>gb|ABA94089.2| respiratory burst oxidase protein D, putative, expressed [Oryza 
sativa Japonica Group]
Length=936

 Score =   446 bits (1147),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 210/281 (75%), Positives = 243/281 (86%), Gaps = 3/281 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY  ERL RA RSS++PVKILKVAVY GNVL+L  SKPQGF+YKSG
Sbjct  593  YKKTTWMYLAVPMFLYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFKYKSG  652

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS VC+PP  GKSG
Sbjct  653  QYIFVNCAAVSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSRVCRPPTEGKSG  712

Query  479  LLRA--DCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVS  306
            LLRA  D      NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMISI+KDI++
Sbjct  713  LLRAEYDRDGAMTNPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIIN  772

Query  305  NMKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEK  126
            NM+ ++   E+G G     S+++   FKTRRAYFYWVTREQGSF+WF+G+MDEVAE D+K
Sbjct  773  NMRQLDGDLEDGDGNDNSVSSSSA-AFKTRRAYFYWVTREQGSFEWFRGVMDEVAETDKK  831

Query  125  HVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  832  GVIELHNYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  872



>gb|AAC39479.1| respiratory burst oxidase protein D [Arabidopsis thaliana]
Length=921

 Score =   446 bits (1146),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 214/279 (77%), Positives = 244/279 (87%), Gaps = 6/279 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY  ERL+RAFRSSIKPVK++KVAVY GNVL+L M+KPQGF+YKSG
Sbjct  585  YQKTTWMYLAVPILLYASERLLRAFRSSIKPVKMIKVAVYPGNVLSLHMTKPQGFKYKSG  644

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            Q+M VNC AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  645  QFMLVNCRAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRKLRTVFSEVCKPPTAGKSG  704

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G  N  FP+VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NM
Sbjct  705  LLRADG--GDGNLPFPKVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNM  762

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +   +    I    SNNN   FKTR+AYFYWVTREQGSF+WFKGIMDE++E+DE+ +
Sbjct  763  KGPDRDSD----IENNNSNNNSKGFKTRKAYFYWVTREQGSFEWFKGIMDEISELDEEGI  818

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  819  IELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  857



>ref|NP_199602.1| respiratory burst oxidase-D [Arabidopsis thaliana]
 sp|Q9FIJ0.1|RBOHD_ARATH RecName: Full=Respiratory burst oxidase homolog protein D; AltName: 
Full=NADPH oxidase RBOHD; Short=AtRBOHD [Arabidopsis 
thaliana]
 gb|AAL11618.1|AF424625_1 AT5g47910/MCA23_25 [Arabidopsis thaliana]
 dbj|BAB11338.1| respiratory burst oxidase protein [Arabidopsis thaliana]
 gb|AAO11567.1| At5g47910/MCA23_25 [Arabidopsis thaliana]
 gb|AED95593.1| respiratory burst oxidase-D [Arabidopsis thaliana]
Length=921

 Score =   445 bits (1145),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 214/279 (77%), Positives = 244/279 (87%), Gaps = 6/279 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY  ERL+RAFRSSIKPVK++KVAVY GNVL+L M+KPQGF+YKSG
Sbjct  585  YQKTTWMYLAVPILLYASERLLRAFRSSIKPVKMIKVAVYPGNVLSLHMTKPQGFKYKSG  644

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            Q+M VNC AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  645  QFMLVNCRAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRKLRTVFSEVCKPPTAGKSG  704

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G  N  FP+VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NM
Sbjct  705  LLRADG--GDGNLPFPKVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNM  762

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +   +    I    SNNN   FKTR+AYFYWVTREQGSF+WFKGIMDE++E+DE+ +
Sbjct  763  KGPDRDSD----IENNNSNNNSKGFKTRKAYFYWVTREQGSFEWFKGIMDEISELDEEGI  818

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  819  IELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  857



>dbj|BAC41837.1| putative respiratory burst oxidase protein [Arabidopsis thaliana]
Length=905

 Score =   445 bits (1144),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 217/282 (77%), Positives = 237/282 (84%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL +P++LY  ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSG
Sbjct  562  HNKTTWMYLVVPVVLYACERLIRAFRSSIKAVTIRKVAVYPGNVLAIHLSRPQNFKYKSG  621

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PP  G SG
Sbjct  622  QYMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPLAGVSG  681

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD L G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  682  LLRADMLHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  741

Query  299  KAMENSE---EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA E ++    E G     RS     +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D 
Sbjct  742  KAKEQAQLNRMENGTSEPQRSKK--ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDA  799

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIEMHNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  800  NRVIEMHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  841



>ref|XP_004979405.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Setaria 
italica]
Length=931

 Score =   446 bits (1146),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 212/283 (75%), Positives = 248/283 (88%), Gaps = 10/283 (4%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KK+TWMYLA+PL++Y  ERL RA RSS++PVKILKVAVY GNVL+L  SKPQGFRYKSGQ
Sbjct  590  KKSTWMYLAVPLVMYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFRYKSGQ  649

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            Y+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LKTVFS+VC+PP  GKSGL
Sbjct  650  YIFVNCAAVSPFQWHPFSITSAPKDDYVSVHIRTLGDWTRELKTVFSKVCRPPTEGKSGL  709

Query  476  LRADCLQG---QNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVS  306
            LRA+  +      NP+FP+VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++
Sbjct  710  LRAEYDRDGSTMTNPSFPKVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIIKDIIN  769

Query  305  NMKAMENSEEEGGGITTGRSNNNVN--NFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMD  132
            NMK ++   E G G     ++N+V+  +F+TRRAYFYWVTREQGSF+WF+G+MDEVAE D
Sbjct  770  NMKQLDGDLEAGSG-----NDNSVSTASFRTRRAYFYWVTREQGSFEWFRGVMDEVAETD  824

Query  131  EKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +K VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  825  KKGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  867



>dbj|BAJ89207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   439 bits (1129),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 210/282 (74%), Positives = 244/282 (87%), Gaps = 10/282 (4%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KK+TWMYLA+P++LY  ERL RA RSS++PVKILKVAVY GNVL+L  SKPQGFRYKSGQ
Sbjct  377  KKSTWMYLAVPMILYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFRYKSGQ  436

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            Y+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS+VC+PP  GKSGL
Sbjct  437  YIFVNCAAVSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSKVCRPPTEGKSGL  496

Query  476  LRA--DCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LRA  D     +NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMISI+KDI++N
Sbjct  497  LRAEYDRDGAMSNPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINN  556

Query  302  MKAMENSEEEG--GGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            MK +E   E G  G  +T  S      F+TRRAYFYWVTREQGSF+WF+G+MDE+AE D+
Sbjct  557  MKRLEGDVESGNPGDASTSTS------FRTRRAYFYWVTREQGSFEWFRGVMDEIAESDK  610

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            K VIE+HNYCTSVYE+GDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  611  KGVIELHNYCTSVYEDGDARSALIAMLQSLNHAKNGVDIVSG  652



>emb|CDX85316.1| BnaC07g26270D [Brassica napus]
Length=922

 Score =   445 bits (1144),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 215/279 (77%), Positives = 243/279 (87%), Gaps = 7/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY  ERL+RA RSSIKPVKILKVAVY GNVL+L ++KPQGF+YKSG
Sbjct  587  YQKTTWMYLAVPMLLYASERLLRALRSSIKPVKILKVAVYPGNVLSLHVTKPQGFKYKSG  646

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  647  QYMFVNCRAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRKLRTVFSEVCKPPTAGKSG  706

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G ++  FP VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI+SNM
Sbjct  707  LLRAD---GGDSVAFPTVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIISNM  763

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K    ++     I    SN N   F+TR+AYFYWVTREQGSF+WFKGIMDEVAE+DE+ +
Sbjct  764  K----TDAHDRDIENNNSNGNSKGFRTRKAYFYWVTREQGSFEWFKGIMDEVAELDEEGI  819

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYE+GDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  820  IELHNYCTSVYEDGDARVALIAMLQSLQHAKNGVDVVSG  858



>gb|EMT25284.1| Respiratory burst oxidase-B-like protein [Aegilops tauschii]
Length=717

 Score =   439 bits (1129),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 208/283 (73%), Positives = 245/283 (87%), Gaps = 11/283 (4%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KK+TWMYLA+P+++Y  ERL RA RSS++PVKILKVAVY GNVL+L  SKPQGFRYKSGQ
Sbjct  377  KKSTWMYLAVPMVMYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFRYKSGQ  436

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            Y+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS+VC+PP  GKSGL
Sbjct  437  YIFVNCAAVSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSKVCRPPTEGKSGL  496

Query  476  LRADC---LQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVS  306
            LRA+    +   +NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMISI+KDI++
Sbjct  497  LRAEYDRDVGAMSNPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIIN  556

Query  305  NMKAMENSEEEG--GGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMD  132
            NMK +E   E G  G  +T  S      F+TRRAYFYWVTREQGSF+WF+G+MDE+AE D
Sbjct  557  NMKRLEGDVESGNPGDASTSAS------FRTRRAYFYWVTREQGSFEWFRGVMDEIAESD  610

Query  131  EKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +K VIE+HNYCTSVYE+GDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  611  KKSVIELHNYCTSVYEDGDARSALIAMLQSLNHAKNGVDIVSG  653



>dbj|BAJ93971.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   439 bits (1129),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 210/282 (74%), Positives = 244/282 (87%), Gaps = 10/282 (4%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KK+TWMYLA+P++LY  ERL RA RSS++PVKILKVAVY GNVL+L  SKPQGFRYKSGQ
Sbjct  377  KKSTWMYLAVPMILYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFRYKSGQ  436

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            Y+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS+VC+PP  GKSGL
Sbjct  437  YIFVNCAAVSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSKVCRPPTEGKSGL  496

Query  476  LRA--DCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LRA  D     +NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMISI+KDI++N
Sbjct  497  LRAEYDRDGAMSNPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINN  556

Query  302  MKAMENSEEEG--GGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            MK +E   E G  G  +T  S      F+TRRAYFYWVTREQGSF+WF+G+MDE+AE D+
Sbjct  557  MKRLEGDVESGNPGDASTSTS------FRTRRAYFYWVTREQGSFEWFRGVMDEIAESDK  610

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            K VIE+HNYCTSVYE+GDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  611  KGVIELHNYCTSVYEDGDARSALIAMLQSLNHAKNGVDIVSG  652



>ref|XP_008807834.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
X2 [Phoenix dactylifera]
Length=921

 Score =   445 bits (1144),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 213/291 (73%), Positives = 246/291 (85%), Gaps = 13/291 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKK+TWMYLAIP+++Y  ERLIRAFRSS++PVKILKVAVY GNVL L +SKPQGF+Y+SG
Sbjct  568  YKKSTWMYLAIPMIIYATERLIRAFRSSVRPVKILKVAVYPGNVLALHVSKPQGFKYRSG  627

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDYLSVHIRTLGDWTRQLKTVFS VCQ P +GKSG
Sbjct  628  QYIFVNCAAVSPFQWHPFSITSAPEDDYLSVHIRTLGDWTRQLKTVFSRVCQRPADGKSG  687

Query  479  LLRADCLQGQNN---PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV  309
            LLRADC  G  +   P+ PRVLIDGPYGAPAQDYKKY+VVLLVGLGIGATP ISI+KDIV
Sbjct  688  LLRADC-DGDADISIPSMPRVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPFISILKDIV  746

Query  308  SNMKAME---------NSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGI  156
            +NMK +E         + + EG G ++ R +   + F TRRAYFYWVTREQGSF+WF+G+
Sbjct  747  NNMKQLESEGLLDSEGDRDLEGAGGSSHRPSGTSSTFNTRRAYFYWVTREQGSFEWFRGV  806

Query  155  MDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            M+EVAE D+K +IE+H YCTSVYEEGDARSALI MLQSL+ AK GVD+VSG
Sbjct  807  MNEVAETDKKGMIELHTYCTSVYEEGDARSALITMLQSLNHAKHGVDVVSG  857



>gb|KFK35232.1| hypothetical protein AALP_AA5G257400 [Arabis alpina]
Length=914

 Score =   444 bits (1143),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 212/279 (76%), Positives = 240/279 (86%), Gaps = 9/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY  ERLIRAFRSSIKPVK+LKVAVY GNVL L M+KPQGF+YKSG
Sbjct  581  YQKTTWMYLAVPILLYASERLIRAFRSSIKPVKMLKVAVYPGNVLALHMTKPQGFKYKSG  640

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            Q+MFVNC AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  641  QFMFVNCRAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRKLRTVFSEVCKPPTAGKSG  700

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD      N  FP++LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NM
Sbjct  701  LLRADG-GDSGNLAFPKILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNM  759

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K+  + E +      G        F+T +AYFYWVTREQGSF+WFKGIMDEV+E+DE+ V
Sbjct  760  KSSSDIENDNNNNNKG--------FRTSKAYFYWVTREQGSFEWFKGIMDEVSELDEEGV  811

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  812  IELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  850



>gb|AFJ66196.1| hypothetical protein 7G9.15 [Boechera stricta]
Length=893

 Score =   444 bits (1142),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 213/282 (76%), Positives = 238/282 (84%), Gaps = 5/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL +P++LY  ERLIRAFRS+IK V I KVAVY GNVL + +S+PQ F+YKSG
Sbjct  572  HSKTTWMYLVVPVILYACERLIRAFRSTIKAVTIRKVAVYPGNVLAMHLSRPQNFKYKSG  631

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SG
Sbjct  632  QYMFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSG  691

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD + G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  692  LLRADMMHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  751

Query  299  KAMENSE---EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            KA E ++    E G  T+        +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D 
Sbjct  752  KAKEQAQLNRMENG--TSEPQRKKKESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDT  809

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VI++HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  810  NRVIDLHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  851



>emb|CDX86335.1| BnaA06g30520D [Brassica napus]
Length=922

 Score =   444 bits (1143),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 214/279 (77%), Positives = 243/279 (87%), Gaps = 7/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY  ERL+RA RSSIKPVKILKVAVY GNVL+L ++KPQGF+YKSG
Sbjct  587  YQKTTWMYLAVPMLLYASERLLRALRSSIKPVKILKVAVYPGNVLSLHVTKPQGFKYKSG  646

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  647  QYMFVNCRAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRKLRTVFSEVCKPPTAGKSG  706

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G ++  FP VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NM
Sbjct  707  LLRAD---GGDSVAFPTVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNM  763

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K    ++     I    SN N   F+TR+AYFYWVTREQGSF+WFKGIMDEVAE+DE+ +
Sbjct  764  K----TDAHDRDIENNNSNGNSKGFRTRKAYFYWVTREQGSFEWFKGIMDEVAELDEEGI  819

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYE+GDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  820  IELHNYCTSVYEDGDARVALIAMLQSLQHAKNGVDVVSG  858



>ref|XP_009151593.1| PREDICTED: respiratory burst oxidase homolog protein D [Brassica 
rapa]
Length=922

 Score =   444 bits (1143),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 214/279 (77%), Positives = 243/279 (87%), Gaps = 7/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY  ERL+RA RSSIKPVKILKVAVY GNVL+L ++KPQGF+YKSG
Sbjct  587  YQKTTWMYLAVPMLLYASERLLRALRSSIKPVKILKVAVYPGNVLSLHVTKPQGFKYKSG  646

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  647  QYMFVNCRAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRKLRTVFSEVCKPPTAGKSG  706

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G ++  FP VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NM
Sbjct  707  LLRAD---GGDSVAFPTVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNM  763

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K    ++     I    SN N   F+TR+AYFYWVTREQGSF+WFKGIMDEVAE+DE+ +
Sbjct  764  K----TDAHDRDIENNNSNGNSKGFRTRKAYFYWVTREQGSFEWFKGIMDEVAELDEEGI  819

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYE+GDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  820  IELHNYCTSVYEDGDARVALIAMLQSLQHAKNGVDVVSG  858



>ref|XP_010482026.1| PREDICTED: respiratory burst oxidase homolog protein D [Camelina 
sativa]
Length=923

 Score =   444 bits (1143),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 216/280 (77%), Positives = 248/280 (89%), Gaps = 6/280 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY  ERLIRAFRSSIKPVK+LKVAVY GNVL+L M+KPQGF+YKSG
Sbjct  585  YQKTTWMYLAVPILLYASERLIRAFRSSIKPVKMLKVAVYPGNVLSLHMTKPQGFKYKSG  644

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAPGD+Y+SVHIRTLGDWTR+L+TVFSEVC+PP  GKSG
Sbjct  645  QYMFVNCRAVSPFEWHPFSITSAPGDEYVSVHIRTLGDWTRKLRTVFSEVCKPPTAGKSG  704

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G  N  FP+VLIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI++NM
Sbjct  705  LLRAD--GGDGNLPFPKVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNM  762

Query  299  KAME-NSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            K+ + +S+ E        +NNN   FKTR+AYFYWVTREQGSF+WFKGIMDEV+E+D++ 
Sbjct  763  KSPDRDSDIE---NNNSNNNNNSKGFKTRKAYFYWVTREQGSFEWFKGIMDEVSELDDEG  819

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +IE+HNYCTSVYEEGDAR ALIAMLQSL  AK+GVD+VSG
Sbjct  820  IIELHNYCTSVYEEGDARVALIAMLQSLQHAKNGVDVVSG  859



>ref|XP_006402027.1| hypothetical protein EUTSA_v10012613mg [Eutrema salsugineum]
 gb|ESQ43480.1| hypothetical protein EUTSA_v10012613mg [Eutrema salsugineum]
Length=913

 Score =   444 bits (1142),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 210/279 (75%), Positives = 236/279 (85%), Gaps = 2/279 (1%)
 Frame = -1

Query  833  KTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQY  654
            KTTWMYL +P++LY  ERLIRAFRS+IK V   KVA+Y GNVL L +S+PQ F+YKSGQY
Sbjct  571  KTTWMYLVVPVILYACERLIRAFRSTIKAVTTRKVALYPGNVLALHLSRPQNFKYKSGQY  630

Query  653  MFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGLL  474
            MFVNCAAVSPFEWHPFSITSAP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SGLL
Sbjct  631  MFVNCAAVSPFEWHPFSITSAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSGLL  690

Query  473  RADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMKA  294
            RAD + G NNP+FP+VLIDGPYGAPAQDYKK+EVVLLVGLGIGATPMISIVKDIV+N++A
Sbjct  691  RADMMHGANNPDFPKVLIDGPYGAPAQDYKKFEVVLLVGLGIGATPMISIVKDIVNNIRA  750

Query  293  MENSE--EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
             E ++      G +  +  N   +F+TRRAYFYWVTREQGSFDWFK IM+EVAE D   V
Sbjct  751  KEQAQLNRMEHGTSAPQQKNKKESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNRV  810

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  811  IELHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  849



>gb|EEC68302.1| hypothetical protein OsI_36373 [Oryza sativa Indica Group]
Length=983

 Score =   445 bits (1145),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 211/285 (74%), Positives = 246/285 (86%), Gaps = 11/285 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY  ERL RA RSS++PVKILKVAVY GNVL+L  SKPQGF+YKSG
Sbjct  606  YKKTTWMYLAVPMFLYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFKYKSG  665

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS VC+PP  GKSG
Sbjct  666  QYIFVNCAAVSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSRVCRPPTEGKSG  725

Query  479  LLRA--DCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVS  306
            LLRA  D      NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMISI+KDI++
Sbjct  726  LLRAEYDRDGAMTNPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIIN  785

Query  305  NMKAMENSEEEGGGITTGRSNNNVNN----FKTRRAYFYWVTREQGSFDWFKGIMDEVAE  138
            NM+ ++   E+G G     ++N+V++    FKTRRAYFYWVTREQGSF+WF+G+MDEVAE
Sbjct  786  NMRQLDGDLEDGDG-----NDNSVSSAAAAFKTRRAYFYWVTREQGSFEWFRGVMDEVAE  840

Query  137  MDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             D+K VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  841  TDKKGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  885



>ref|XP_003577502.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Brachypodium 
distachyon]
Length=924

 Score =   443 bits (1140),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 209/280 (75%), Positives = 244/280 (87%), Gaps = 8/280 (3%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KK+TWMYLA+P+L+Y  ERL RA RSS++PVKILKVAVY GNVL+L  SKPQGFRYKSGQ
Sbjct  587  KKSTWMYLAVPILMYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFRYKSGQ  646

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            Y+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS+VC+PP  GKSGL
Sbjct  647  YIFVNCAAVSPFQWHPFSITSAPKDDYVSVHIRTLGDWTRELKNVFSKVCRPPTEGKSGL  706

Query  476  LRA--DCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LRA  D     +NP+FPRVLIDGPYGAPAQDYK+Y+VVLLVGLGIGATPMISI+KDI++N
Sbjct  707  LRAEYDRDGAMSNPSFPRVLIDGPYGAPAQDYKQYDVVLLVGLGIGATPMISILKDIINN  766

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            MK ++      G + +G ++ +  NF+T RAYFYWVTREQGSF+WF+G+MDEVAE D+K 
Sbjct  767  MKRLD------GDVESGDASVSSANFRTTRAYFYWVTREQGSFEWFRGVMDEVAETDKKG  820

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  821  VIELHNYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  860



>ref|XP_002450884.1| hypothetical protein SORBIDRAFT_05g020380 [Sorghum bicolor]
 gb|EES09872.1| hypothetical protein SORBIDRAFT_05g020380 [Sorghum bicolor]
Length=936

 Score =   444 bits (1141),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 209/282 (74%), Positives = 243/282 (86%), Gaps = 4/282 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKK+TWMYLA+P+ LY  ERL RA RSS++PVKILKVAVY GNVL+L  SKPQGFRY+SG
Sbjct  592  YKKSTWMYLAVPVALYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFRYRSG  651

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS VC+PP  GKSG
Sbjct  652  QYIFVNCAAVSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSRVCRPPTEGKSG  711

Query  479  LLRADCLQ---GQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV  309
            LLRA+  +      NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMISI+KDI+
Sbjct  712  LLRAEYDRDGSAMANPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDII  771

Query  308  SNMKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            +NMK  +   E G G  T  S +  ++F+TRRAYFYWVTREQGSF+WF+G+MDEVAE D+
Sbjct  772  NNMKQPDGDLEAGAGADTSAS-SMASSFRTRRAYFYWVTREQGSFEWFRGVMDEVAETDK  830

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            K VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  831  KGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  872



>ref|XP_007030987.1| Respiratory burst oxidase B [Theobroma cacao]
 gb|EOY11489.1| Respiratory burst oxidase B [Theobroma cacao]
Length=889

 Score =   442 bits (1137),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/279 (74%), Positives = 237/279 (85%), Gaps = 3/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLY  ERLIRAFRS  K VKILKVAVY GNVL+L MSKPQGF+Y SG
Sbjct  550  YKKTTWMYLAVPMLLYACERLIRAFRSGYKSVKILKVAVYPGNVLSLHMSKPQGFKYTSG  609

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITS+P DDYLS+HIRTLGDWT QLK +F +VCQPP   +SG
Sbjct  610  QYIFVNCAAVSPFQWHPFSITSSPADDYLSIHIRTLGDWTSQLKALFVKVCQPPSVNQSG  669

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  +G+N P  P++LIDGPYGAPAQDYKKY+V+LLVGLGIGATP+ISIVKD+++N+
Sbjct  670  LLRADIGKGENKPRLPKLLIDGPYGAPAQDYKKYDVLLLVGLGIGATPLISIVKDVLNNI  729

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +  EE   GI  G  NN    F T+RAYFYWVTREQGSF+WF+G+M+EVAE D   +
Sbjct  730  KQQKEMEE---GIENGVKNNKRKPFATKRAYFYWVTREQGSFEWFRGVMNEVAEYDRDRM  786

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSV+EEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  787  IELHNYCTSVFEEGDARSALITMLQSLHHAKSGVDIVSG  825



>ref|XP_009421001.1| PREDICTED: respiratory burst oxidase homolog protein B [Musa 
acuminata subsp. malaccensis]
Length=940

 Score =   443 bits (1140),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 216/294 (73%), Positives = 243/294 (83%), Gaps = 16/294 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIPL+LY  ERLIRA RSS++ VKILKVAVY GNVLTLQMSKPQGF+Y+SG
Sbjct  584  YKKTTWMYLAIPLILYASERLIRALRSSVRAVKILKVAVYPGNVLTLQMSKPQGFKYRSG  643

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTRQLK VFSEVCQPP +G+SG
Sbjct  644  QYIFVNCAAVSPFQWHPFSITSAPQDDYISVHIRTLGDWTRQLKAVFSEVCQPPTSGQSG  703

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLR+D     NN  FP+VLIDGPYGAPAQ+YKKYEVVLLVGLGIGATP ISIVKDIV+NM
Sbjct  704  LLRSD-YDSNNNLIFPKVLIDGPYGAPAQEYKKYEVVLLVGLGIGATPFISIVKDIVNNM  762

Query  299  KAMENSEEEGGGITTGRS---------------NNNVNNFKTRRAYFYWVTREQGSFDWF  165
            K  +  E   G      S                ++ ++FKTRRAYFYWVTREQGSF+WF
Sbjct  763  KQWDPEESSDGDDVRDASEGGSGGHSSSHRRPVTSSTSSFKTRRAYFYWVTREQGSFEWF  822

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +G+M+EVAE D+K VIE+HN+CTSVYEEGDARSALI MLQSL+ AK GVDIVSG
Sbjct  823  RGVMNEVAETDKKGVIELHNFCTSVYEEGDARSALIVMLQSLNHAKHGVDIVSG  876



>gb|KHN43296.1| Respiratory burst oxidase like protein B [Glycine soja]
Length=866

 Score =   441 bits (1134),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 206/279 (74%), Positives = 236/279 (85%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP++LY  ERL+RAFRS  K VKILKVAVY GNVL L MSKPQGF+Y SG
Sbjct  526  YKKTTWMYLAIPMILYACERLLRAFRSGYKSVKILKVAVYPGNVLALHMSKPQGFKYSSG  585

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC  VSPF+WHPFSITSAPGDDY+SVHIRTLGDWT QLK VF++ CQP  + +SG
Sbjct  586  QYIFVNCPDVSPFQWHPFSITSAPGDDYVSVHIRTLGDWTSQLKAVFAKACQPASSDQSG  645

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  P+++IDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++NM
Sbjct  646  LLRADMLQGNNIPRMPKLVIDGPYGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNM  705

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ EE  G + +G  NN    F T RAYFYWVTREQGSF+WFKG+MD+VAE D+  +
Sbjct  706  KQQKDIEE--GMVESGVKNNKRKPFATNRAYFYWVTREQGSFEWFKGVMDDVAEYDKDGI  763

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  764  IELHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSG  802



>ref|XP_003630437.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AET04913.1| respiratory burst oxidase-like protein D [Medicago truncatula]
Length=898

 Score =   441 bits (1134),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 207/282 (73%), Positives = 243/282 (86%), Gaps = 5/282 (2%)
 Frame = -1

Query  833  KTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQY  654
            KTTWMYLAIP+ +YG ERLIRA RSSIK V+ILKVAVY GNVL + MSKPQGF YKSGQY
Sbjct  553  KTTWMYLAIPITIYGLERLIRALRSSIKSVRILKVAVYPGNVLAINMSKPQGFSYKSGQY  612

Query  653  MFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGLL  474
            M VNCAAVSP EWHPFSITSAP DDYLSVHI+ LGDWTR LKT FS+ CQP  NG+SGLL
Sbjct  613  MLVNCAAVSPLEWHPFSITSAPNDDYLSVHIKILGDWTRSLKTKFSQACQPAINGQSGLL  672

Query  473  RADCLQGQNNPN-FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMK  297
            RA+CL+G N+P+ FP+VLIDGPYGAPAQDY++YEVVLLVGLGIGATPMISI+KD+V+N K
Sbjct  673  RAECLKGDNSPSTFPKVLIDGPYGAPAQDYREYEVVLLVGLGIGATPMISILKDMVNNFK  732

Query  296  AMENSE----EEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            AME  +    EEG  +T  + ++  ++FKTRRAYFYWVTREQGSFDWFKG+M++V E D 
Sbjct  733  AMEEEDGFAMEEGSPMTPNQKDSRFSDFKTRRAYFYWVTREQGSFDWFKGVMNDVPEEDR  792

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            + +IE+H+YCTSVYE+GDARSALIAM+QS++ AK GVD+VSG
Sbjct  793  RGLIELHSYCTSVYEQGDARSALIAMVQSINHAKHGVDVVSG  834



>emb|CAM35833.1| respiratory burst oxidase homologue [Medicago truncatula]
Length=716

 Score =   436 bits (1120),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 203/279 (73%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+++Y  ERL+RAFRS  K VKILKVAVY GNVL L +SKPQGF+Y SG
Sbjct  376  YKKTTWMYLAIPMIIYACERLLRAFRSGYKSVKILKVAVYPGNVLALHVSKPQGFKYHSG  435

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCA VSPF+WHPFSITSAPGDDY+SVHIRT GDWT QLK VF++ CQP    +SG
Sbjct  436  QYIFVNCADVSPFQWHPFSITSAPGDDYVSVHIRTAGDWTSQLKAVFAKACQPASGDQSG  495

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  P++LIDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++NM
Sbjct  496  LLRADMLQGNNIPRMPKLLIDGPYGAPAQDYKDYEVILLVGLGIGATPLISILKDVLNNM  555

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ E+  G + +G  NN    F T RAYFYWVTREQGSF+WFKG+MDE+A+ D+  +
Sbjct  556  KQQKDIEQ--GVVESGVKNNKRKPFATNRAYFYWVTREQGSFEWFKGVMDEIADYDKDGL  613

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  614  IELHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSG  652



>gb|KHG19081.1| Respiratory burst oxidase D -like protein [Gossypium arboreum]
 gb|KHG23280.1| Respiratory burst oxidase D -like protein [Gossypium arboreum]
Length=651

 Score =   433 bits (1114),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 224/312 (72%), Positives = 248/312 (79%), Gaps = 38/312 (12%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+ LY  ERLIRAFRSSIK VKILKVAVY GNVL+L MSKPQGF+YKSG
Sbjct  281  YQKTTWMYLAVPITLYACERLIRAFRSSIKAVKILKVAVYPGNVLSLHMSKPQGFKYKSG  340

Query  659  QYMFVNCAAVSPFEW-----------------------------HPFSITSAPGDDYLSV  567
            Q+MFVNC+AVS FEW                             HPFSITSAPGDDYLSV
Sbjct  341  QFMFVNCSAVSSFEWYVHFDPCSIPHFASSLPFSLTERTIGKSRHPFSITSAPGDDYLSV  400

Query  566  HIRTLGDWTRQLKTVFSEVCQPPPNGKSGLLRADCLQGQNNPNFPRVLIDGPYGAPAQDY  387
            HIRTLGDWTRQLKTVFSEVCQPPP GKSGLLRA+      N +FP++LIDGPYGAPAQDY
Sbjct  401  HIRTLGDWTRQLKTVFSEVCQPPPAGKSGLLRAE----GTNTSFPKILIDGPYGAPAQDY  456

Query  386  KKYEVVLLVGLGIGATPMISIVKDIVSNMKAMENSEEE---GGGI-TTGRSNNNVNNFKT  219
            KKY+VVLLVGLGIGATPMISIVKDI++NMK ME  EE+   G G+     +  N   FKT
Sbjct  457  KKYDVVLLVGLGIGATPMISIVKDIINNMK-MEEMEEDSFPGSGLENGNYNKKNNKGFKT  515

Query  218  RRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSL  39
            R+AYFYWVTREQGSF+WFKGIM+EVAEMDE+ VIE+HNYCTSVYEEGDARSALI MLQSL
Sbjct  516  RKAYFYWVTREQGSFEWFKGIMNEVAEMDEQWVIELHNYCTSVYEEGDARSALITMLQSL  575

Query  38   HLAKSGVDIVSG  3
            H AK+GVD+VSG
Sbjct  576  HHAKNGVDVVSG  587



>ref|XP_004494602.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Cicer 
arietinum]
Length=891

 Score =   440 bits (1131),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 205/279 (73%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+++Y  ERL+RAFRS  K VKILKVAVY GNVL L MSKPQGF+Y SG
Sbjct  551  YKKTTWMYLAVPMIIYACERLLRAFRSGNKSVKILKVAVYPGNVLALHMSKPQGFKYHSG  610

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCA VSPF+WHPFSITSAPGDDY+SVHIRT GDWT QLK VF++ CQP    +SG
Sbjct  611  QYIFVNCADVSPFQWHPFSITSAPGDDYVSVHIRTSGDWTSQLKAVFAKACQPASGDQSG  670

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  P++LIDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++NM
Sbjct  671  LLRADMLQGNNIPRMPKLLIDGPYGAPAQDYKDYEVILLVGLGIGATPLISILKDVLNNM  730

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ E+  G + +G  NN    F T RAYFYWVTREQGSF+WFKG+MDEVAE D+  +
Sbjct  731  KQQKDIEQ--GVVESGVKNNKRKPFATNRAYFYWVTREQGSFEWFKGVMDEVAEYDKDRI  788

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  789  IELHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSG  827



>dbj|BAJ97450.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=916

 Score =   441 bits (1133),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/282 (74%), Positives = 244/282 (87%), Gaps = 10/282 (4%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KK+TWMYLA+P++LY  ERL RA RSS++PVKILKVAVY GNVL+L  SKPQGFRYKSGQ
Sbjct  577  KKSTWMYLAVPMILYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFRYKSGQ  636

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            Y+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS+VC+PP  GKSGL
Sbjct  637  YIFVNCAAVSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSKVCRPPTEGKSGL  696

Query  476  LRA--DCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LRA  D     +NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMISI+KDI++N
Sbjct  697  LRAEYDRDGAMSNPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINN  756

Query  302  MKAMENSEEEG--GGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            MK +E   E G  G  +T  S      F+TRRAYFYWVTREQGSF+WF+G+MDE+AE D+
Sbjct  757  MKRLEGDVESGNPGDASTSTS------FRTRRAYFYWVTREQGSFEWFRGVMDEIAESDK  810

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            K VIE+HNYCTSVYE+GDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  811  KGVIELHNYCTSVYEDGDARSALIAMLQSLNHAKNGVDIVSG  852



>ref|XP_007144946.1| hypothetical protein PHAVU_007G196800g [Phaseolus vulgaris]
 gb|ESW16940.1| hypothetical protein PHAVU_007G196800g [Phaseolus vulgaris]
Length=890

 Score =   439 bits (1130),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 203/279 (73%), Positives = 242/279 (87%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LYG ERL+RAFRS  K V+ILKVAVY GNVL L +SKPQGF+Y SG
Sbjct  550  YKKTTWMYLAVPMILYGCERLLRAFRSGNKSVRILKVAVYPGNVLALHVSKPQGFKYSSG  609

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY++VNC+ VSPFEWHPFSITSAPGDDY+SVHIRTLGDWT QLK+VF++ CQP  +G+SG
Sbjct  610  QYIYVNCSDVSPFEWHPFSITSAPGDDYVSVHIRTLGDWTSQLKSVFAKACQPANDGQSG  669

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  P VLIDGPYGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD+++N+
Sbjct  670  LLRADMLQGNNKPRMPSVLIDGPYGAPAQDYKNYDVILLVGLGIGATPLISILKDVLNNI  729

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ +EE G + +G  +N    F T+RAYFYWVTRE+GSF+WFKG+M+EVAE D++ V
Sbjct  730  K--QHQDEEEGVVESGVKDNKRKPFATKRAYFYWVTREEGSFEWFKGVMNEVAENDKEGV  787

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AK+GVDIVSG
Sbjct  788  IELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSG  826



>ref|XP_006437008.1| hypothetical protein CICLE_v10030649mg [Citrus clementina]
 gb|ESR50248.1| hypothetical protein CICLE_v10030649mg [Citrus clementina]
Length=929

 Score =   440 bits (1132),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 223/297 (75%), Positives = 244/297 (82%), Gaps = 21/297 (7%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+ LY  ERLIRA RSSIK V I KVAVY GNVL L MSKP  FRYKSG
Sbjct  572  YKKTTWMYLAIPICLYATERLIRALRSSIKAVSIQKVAVYPGNVLALHMSKPDRFRYKSG  631

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIRTLGDWTRQL+TVFSEVC+PPPNG SG
Sbjct  632  QYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIRTLGDWTRQLRTVFSEVCRPPPNGISG  691

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRA   +G NNP+FPRVLIDGPYGAPAQDYK+YEVVLLVGLGIGATPMISIVKDIV+NM
Sbjct  692  LLRA---EGHNNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIVNNM  748

Query  299  KA--------MENSEEEG----------GGITTGRSNNNVNNFKTRRAYFYWVTREQGSF  174
            KA        +EN  + G              +   +   + F+TRRAYFYWVTREQGSF
Sbjct  749  KAIEEEEENDLENGRDTGVNTTSSSSTTTTSPSSSGHRRRDQFRTRRAYFYWVTREQGSF  808

Query  173  DWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            DWFKG+M+EVAE+D  +VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVD+VSG
Sbjct  809  DWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSG  865



>ref|XP_006485050.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Citrus 
sinensis]
Length=929

 Score =   440 bits (1132),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 223/297 (75%), Positives = 244/297 (82%), Gaps = 21/297 (7%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+ LY  ERLIRA RSSIK V I KVAVY GNVL L MSKP  FRYKSG
Sbjct  572  YKKTTWMYLAIPICLYATERLIRALRSSIKAVSIQKVAVYPGNVLALHMSKPDRFRYKSG  631

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIRTLGDWTRQL+TVFSEVC+PPPNG SG
Sbjct  632  QYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIRTLGDWTRQLRTVFSEVCRPPPNGISG  691

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRA   +G NNP+FPRVLIDGPYGAPAQDYK+YEVVLLVGLGIGATPMISIVKDIV+NM
Sbjct  692  LLRA---EGHNNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIVNNM  748

Query  299  KA--------MENSEEEG----------GGITTGRSNNNVNNFKTRRAYFYWVTREQGSF  174
            KA        +EN  + G              +   +   + F+TRRAYFYWVTREQGSF
Sbjct  749  KAIEEEEENDLENGRDTGVNTTSSSSTTTTSPSSSGHRRRDQFRTRRAYFYWVTREQGSF  808

Query  173  DWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            DWFKG+M+EVAE+D  +VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVD+VSG
Sbjct  809  DWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSG  865



>ref|XP_009404717.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=926

 Score =   440 bits (1132),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 214/297 (72%), Positives = 246/297 (83%), Gaps = 22/297 (7%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP++LY  ERLIRA RSS++ VKILKVAVY GNVLTLQMSKPQGF+ +SG
Sbjct  570  YKKTTWMYLAIPVILYASERLIRALRSSVRAVKILKVAVYPGNVLTLQMSKPQGFKCRSG  629

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTRQLK VFSEVCQPP +G+SG
Sbjct  630  QYIFVNCAAVSPFQWHPFSITSAPQDDYISVHIRTLGDWTRQLKAVFSEVCQPPTSGQSG  689

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLR+D  + +++  FPRVLIDGPYGAPAQ+YKKYEVVLLVGLGIGATP ISIVKDIV+NM
Sbjct  690  LLRSDH-ESRSSLAFPRVLIDGPYGAPAQEYKKYEVVLLVGLGIGATPFISIVKDIVNNM  748

Query  299  KAMENSEEEGGGITTGRSNNNV------------------NNFKTRRAYFYWVTREQGSF  174
            K ++  EE       GRS  +                   ++F+TRRAYFYWVTREQGSF
Sbjct  749  KQLDPDEESSDD---GRSEEDGSGGGGSSSHQRKLTSSPSSSFRTRRAYFYWVTREQGSF  805

Query  173  DWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +WF+G+M+EVAE D+K VIE+HN+CTSVYEEGDARSALI MLQSL+ AK GVDIVSG
Sbjct  806  EWFRGVMNEVAEADKKGVIELHNFCTSVYEEGDARSALIVMLQSLNHAKHGVDIVSG  862



>ref|XP_003554649.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
1 [Glycine max]
Length=887

 Score =   439 bits (1128),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 205/279 (73%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP++LY  ERL+RAFRS  K VKILKVAVY GNVL L MSKPQGF+Y SG
Sbjct  547  YKKTTWMYLAIPMILYACERLLRAFRSGYKSVKILKVAVYPGNVLALHMSKPQGFKYSSG  606

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC  VSPF+WHPFSITSAPGDDY+SVHIRTLGDWT QLK VF++ CQP  + +SG
Sbjct  607  QYIFVNCPDVSPFQWHPFSITSAPGDDYVSVHIRTLGDWTSQLKAVFAKACQPASSDQSG  666

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  P+++IDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++NM
Sbjct  667  LLRADMLQGNNIPRMPKLVIDGPYGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNM  726

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ EE    + +G  NN    F T RAYFYWVTREQGSF+WFKG+MD+VAE D+  +
Sbjct  727  KQQKDIEE--AMVESGVKNNKRKPFATNRAYFYWVTREQGSFEWFKGVMDDVAEYDKDGI  784

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  785  IELHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSG  823



>ref|XP_009404716.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=938

 Score =   440 bits (1131),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 214/297 (72%), Positives = 246/297 (83%), Gaps = 22/297 (7%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP++LY  ERLIRA RSS++ VKILKVAVY GNVLTLQMSKPQGF+ +SG
Sbjct  582  YKKTTWMYLAIPVILYASERLIRALRSSVRAVKILKVAVYPGNVLTLQMSKPQGFKCRSG  641

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTRQLK VFSEVCQPP +G+SG
Sbjct  642  QYIFVNCAAVSPFQWHPFSITSAPQDDYISVHIRTLGDWTRQLKAVFSEVCQPPTSGQSG  701

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLR+D  + +++  FPRVLIDGPYGAPAQ+YKKYEVVLLVGLGIGATP ISIVKDIV+NM
Sbjct  702  LLRSDH-ESRSSLAFPRVLIDGPYGAPAQEYKKYEVVLLVGLGIGATPFISIVKDIVNNM  760

Query  299  KAMENSEEEGGGITTGRSNNNV------------------NNFKTRRAYFYWVTREQGSF  174
            K ++  EE       GRS  +                   ++F+TRRAYFYWVTREQGSF
Sbjct  761  KQLDPDEESSDD---GRSEEDGSGGGGSSSHQRKLTSSPSSSFRTRRAYFYWVTREQGSF  817

Query  173  DWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +WF+G+M+EVAE D+K VIE+HN+CTSVYEEGDARSALI MLQSL+ AK GVDIVSG
Sbjct  818  EWFRGVMNEVAEADKKGVIELHNFCTSVYEEGDARSALIVMLQSLNHAKHGVDIVSG  874



>ref|XP_010442849.1| PREDICTED: respiratory burst oxidase homolog protein C isoform 
X2 [Camelina sativa]
Length=922

 Score =   439 bits (1129),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 215/291 (74%), Positives = 239/291 (82%), Gaps = 14/291 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            + KTTWMYL +P++LY  ERLIRAFRSSIK V I KVAVY GNVL + +S+PQ F+YKSG
Sbjct  570  HNKTTWMYLVVPVVLYACERLIRAFRSSIKAVTIRKVAVYPGNVLAIHLSRPQNFKYKSG  629

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSIT+AP DDYLSVHIR LGDWTR LK VFSEVC+PPP G SG
Sbjct  630  QYMFVNCAAVSPFEWHPFSITAAPQDDYLSVHIRVLGDWTRALKGVFSEVCKPPPAGVSG  689

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD + G NNP+FP+VLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV+N+
Sbjct  690  LLRADMMHGANNPDFPKVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNI  749

Query  299  KAMENSE---EEGGGITTGRSNNNVNNFKTRR---------AYFYWVTREQGSFDWFKGI  156
            KA E ++    E G  T+    N   +F+TRR         AYFYWVTREQGSFDWFK I
Sbjct  750  KAKEQAQLNRMENG--TSEPQRNKKESFRTRRAYFYWVTREAYFYWVTREQGSFDWFKNI  807

Query  155  MDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            M+EVAE D   VIE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  808  MNEVAERDTNRVIELHNYCTSVYEEGDARSALIHMLQSLNHAKNGVDIVSG  858



>dbj|BAK03403.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=916

 Score =   439 bits (1128),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 209/282 (74%), Positives = 243/282 (86%), Gaps = 10/282 (4%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KK+TWMYLA+P++LY  ERL RA RSS++PVKILKVAVY GNVL+L  SKPQGFRYKSGQ
Sbjct  577  KKSTWMYLAVPMILYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFRYKSGQ  636

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            Y+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS+VC+PP  GKSGL
Sbjct  637  YIFVNCAAVSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSKVCRPPTEGKSGL  696

Query  476  LRA--DCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LRA  D     +NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMIS +KDI++N
Sbjct  697  LRAEYDRDGAMSNPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISTIKDIINN  756

Query  302  MKAMENSEEEG--GGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            MK +E   E G  G  +T  S      F+TRRAYFYWVTREQGSF+WF+G+MDE+AE D+
Sbjct  757  MKRLEGDVESGNPGDASTSTS------FRTRRAYFYWVTREQGSFEWFRGVMDEIAESDK  810

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            K VIE+HNYCTSVYE+GDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  811  KGVIELHNYCTSVYEDGDARSALIAMLQSLNHAKNGVDIVSG  852



>ref|XP_010942321.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Elaeis 
guineensis]
Length=928

 Score =   438 bits (1127),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 214/301 (71%), Positives = 244/301 (81%), Gaps = 24/301 (8%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKK+TWMYLAIP+++YG ERLIRAFRSS++PVKILKVAVY GNVL L +SKPQGF+Y+SG
Sbjct  566  YKKSTWMYLAIPMIIYGAERLIRAFRSSVRPVKILKVAVYPGNVLALHVSKPQGFKYRSG  625

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY FVNCAAVSPF+WHPFSITSAP D YLSVHIRTLGDWTRQLKTVFS+VCQ P +GKSG
Sbjct  626  QYTFVNCAAVSPFQWHPFSITSAPQDHYLSVHIRTLGDWTRQLKTVFSQVCQRPADGKSG  685

Query  479  LLRADCLQGQNN--PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVS  306
            LLRADC    N+  P+ PRVLIDGPYGAPAQDYKKY+VVLLVGLGIGATP ISI+KDIV+
Sbjct  686  LLRADCDGDANSSIPSMPRVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPFISILKDIVN  745

Query  305  NMKAM--------------------ENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTRE  186
            NMK +                    E S  +G G ++ R +     F TRRAYFYWVTRE
Sbjct  746  NMKQLELEGLLDSEGDRDLENAVVGEGSSTKGAGGSSHRPSGTT--FNTRRAYFYWVTRE  803

Query  185  QGSFDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVS  6
            QGSF+WF+G+M+EVAE D+K VIE+H YCTSVYEEGDARSALI MLQSL+ AK GVD+VS
Sbjct  804  QGSFEWFRGVMNEVAETDKKGVIELHTYCTSVYEEGDARSALITMLQSLNHAKHGVDVVS  863

Query  5    G  3
            G
Sbjct  864  G  864



>ref|XP_003626255.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES82473.1| respiratory burst oxidase-like protein [Medicago truncatula]
Length=864

 Score =   436 bits (1122),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 203/279 (73%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+++Y  ERL+RAFRS  K VKILKVAVY GNVL L +SKPQGF+Y SG
Sbjct  555  YKKTTWMYLAIPMIIYACERLLRAFRSGYKSVKILKVAVYPGNVLALHVSKPQGFKYHSG  614

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCA VSPF+WHPFSITSAPGDDY+SVHIRT GDWT QLK VF++ CQP    +SG
Sbjct  615  QYIFVNCADVSPFQWHPFSITSAPGDDYVSVHIRTAGDWTSQLKAVFAKACQPASGDQSG  674

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  P++LIDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++NM
Sbjct  675  LLRADMLQGNNIPRMPKLLIDGPYGAPAQDYKDYEVILLVGLGIGATPLISILKDVLNNM  734

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ E+  G + +G  NN    F T RAYFYWVTREQGSF+WFKG+MDE+A+ D+  +
Sbjct  735  KQQKDIEQ--GVVESGVKNNKRKPFATNRAYFYWVTREQGSFEWFKGVMDEIADYDKDGL  792

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  793  IELHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSG  831



>ref|XP_003626253.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AAW78864.1| respiratory burst oxidase 2 [Medicago truncatula]
 gb|ABN08032.1| Calcium-binding EF-hand; Ferric reductase-like transmembrane 
component [Medicago truncatula]
 gb|AES82471.1| respiratory burst oxidase-like protein [Medicago truncatula]
Length=895

 Score =   436 bits (1122),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 203/279 (73%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+++Y  ERL+RAFRS  K VKILKVAVY GNVL L +SKPQGF+Y SG
Sbjct  555  YKKTTWMYLAIPMIIYACERLLRAFRSGYKSVKILKVAVYPGNVLALHVSKPQGFKYHSG  614

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCA VSPF+WHPFSITSAPGDDY+SVHIRT GDWT QLK VF++ CQP    +SG
Sbjct  615  QYIFVNCADVSPFQWHPFSITSAPGDDYVSVHIRTAGDWTSQLKAVFAKACQPASGDQSG  674

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  P++LIDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++NM
Sbjct  675  LLRADMLQGNNIPRMPKLLIDGPYGAPAQDYKDYEVILLVGLGIGATPLISILKDVLNNM  734

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ E+  G + +G  NN    F T RAYFYWVTREQGSF+WFKG+MDE+A+ D+  +
Sbjct  735  KQQKDIEQ--GVVESGVKNNKRKPFATNRAYFYWVTREQGSFEWFKGVMDEIADYDKDGL  792

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  793  IELHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSG  831



>emb|CAN64415.1| hypothetical protein VITISV_013316 [Vitis vinifera]
Length=894

 Score =   436 bits (1122),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 205/279 (73%), Positives = 236/279 (85%), Gaps = 1/279 (0%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LY  ERLIRAFRS  K V+ILKVAVY GNVL L MSKPQGF+Y SG
Sbjct  553  YKKTTWMYLAVPIILYACERLIRAFRSGYKSVRILKVAVYPGNVLALHMSKPQGFKYTSG  612

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVS F+WHPFSITSAPGD+YLSV+IRTLGDWT QLKTVFS+ CQP    +SG
Sbjct  613  QYMFVNCSAVSAFQWHPFSITSAPGDEYLSVYIRTLGDWTSQLKTVFSKACQPSNENQSG  672

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD ++G+N P  P++LIDGPYGAPAQDYKKY+VVLLVGLGIGATP+ISIVKD+++N+
Sbjct  673  LLRADMMKGENKPRLPKLLIDGPYGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNV  732

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +   EEG   + G   N    F TRRAYFYWVTREQGSF+WF+ +M+EV E D+  V
Sbjct  733  KQYQEL-EEGMTESNGERGNARKPFATRRAYFYWVTREQGSFEWFRSVMNEVTENDKDGV  791

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVDIVSG
Sbjct  792  IELHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDIVSG  830



>gb|KHN03979.1| Respiratory burst oxidase like protein B [Glycine soja]
Length=777

 Score =   433 bits (1113),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 204/279 (73%), Positives = 232/279 (83%), Gaps = 3/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP++LY  ERL+RAFRS  K VKILKVAVY GNVL L MSKPQGF+Y SG
Sbjct  438  YKKTTWMYLAIPMILYACERLLRAFRSGYKSVKILKVAVYPGNVLALHMSKPQGFKYSSG  497

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC  VSPF+WHPFSITSAPGDDY+SVHIRTLGDWT QLK VF++ CQP    +SG
Sbjct  498  QYVFVNCPDVSPFQWHPFSITSAPGDDYVSVHIRTLGDWTSQLKAVFAKACQPASGDQSG  557

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  P+++IDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++NM
Sbjct  558  LLRADMLQGNNIPRMPKLVIDGPYGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNM  617

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ EE   G+      N    F T RAYFYWVTREQGSF+WFKG+MD+VAE D+  +
Sbjct  618  KQQKDIEE---GMVESGVKNKRKPFATNRAYFYWVTREQGSFEWFKGVMDDVAEYDKDGI  674

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  675  IELHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSG  713



>ref|XP_007147029.1| hypothetical protein PHAVU_006G090200g [Phaseolus vulgaris]
 gb|AEX56132.1| NADPH oxidase [Phaseolus vulgaris]
 gb|ESW19023.1| hypothetical protein PHAVU_006G090200g [Phaseolus vulgaris]
Length=881

 Score =   436 bits (1120),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 205/279 (73%), Positives = 233/279 (84%), Gaps = 3/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMY+AIP++LY  ERL+RAFRS  K VKILKVAVY GNVL L +SKPQGF+Y SG
Sbjct  542  YKKTTWMYIAIPVILYACERLLRAFRSGNKSVKILKVAVYPGNVLALHVSKPQGFKYSSG  601

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+ VSPF+WHPFSITSAPGDDY+SVHIRTLGDWT QLK VF++ CQP    +SG
Sbjct  602  QYIFVNCSDVSPFQWHPFSITSAPGDDYVSVHIRTLGDWTSQLKNVFAKACQPASGDQSG  661

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  P++LIDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++NM
Sbjct  662  LLRADMLQGNNIPRMPKLLIDGPYGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNM  721

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ EE   GI      N    F T RAYFYWVTREQGSF+WFKG+MDEVAE D+  +
Sbjct  722  KQQKDLEE---GIVESGVKNKRKPFATNRAYFYWVTREQGSFEWFKGVMDEVAEYDKDGI  778

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  779  IELHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSG  817



>emb|CBI39505.3| unnamed protein product [Vitis vinifera]
Length=873

 Score =   435 bits (1119),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 204/279 (73%), Positives = 236/279 (85%), Gaps = 1/279 (0%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LY  ERLIRAFRS  K V+ILKVAVY GNVL L MSKPQGF+Y SG
Sbjct  532  YKKTTWMYLAVPIILYACERLIRAFRSGYKSVRILKVAVYPGNVLALHMSKPQGFKYTSG  591

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVS F+WHPFSITSAPGD+YLS++IRTLGDWT QLKTVFS+ CQP    +SG
Sbjct  592  QYMFVNCSAVSAFQWHPFSITSAPGDEYLSIYIRTLGDWTSQLKTVFSKACQPSNENQSG  651

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD ++G+N P  P++LIDGPYGAPAQDYKKY+VVLLVGLGIGATP+ISIVKD+++N+
Sbjct  652  LLRADMMKGENKPRLPKLLIDGPYGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNV  711

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +   EEG   + G   N    F TRRAYFYWVTREQGSF+WF+ +M+EV E D+  V
Sbjct  712  KQYQEL-EEGMTESNGERGNARKPFATRRAYFYWVTREQGSFEWFRSVMNEVTENDKDGV  770

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVDIVSG
Sbjct  771  IELHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDIVSG  809



>ref|XP_002283888.1| PREDICTED: respiratory burst oxidase homolog protein B [Vitis 
vinifera]
Length=894

 Score =   436 bits (1120),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 204/279 (73%), Positives = 236/279 (85%), Gaps = 1/279 (0%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LY  ERLIRAFRS  K V+ILKVAVY GNVL L MSKPQGF+Y SG
Sbjct  553  YKKTTWMYLAVPIILYACERLIRAFRSGYKSVRILKVAVYPGNVLALHMSKPQGFKYTSG  612

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVS F+WHPFSITSAPGD+YLS++IRTLGDWT QLKTVFS+ CQP    +SG
Sbjct  613  QYMFVNCSAVSAFQWHPFSITSAPGDEYLSIYIRTLGDWTSQLKTVFSKACQPSNENQSG  672

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD ++G+N P  P++LIDGPYGAPAQDYKKY+VVLLVGLGIGATP+ISIVKD+++N+
Sbjct  673  LLRADMMKGENKPRLPKLLIDGPYGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNV  732

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +   EEG   + G   N    F TRRAYFYWVTREQGSF+WF+ +M+EV E D+  V
Sbjct  733  KQYQEL-EEGMTESNGERGNARKPFATRRAYFYWVTREQGSFEWFRSVMNEVTENDKDGV  791

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVDIVSG
Sbjct  792  IELHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDIVSG  830



>ref|XP_011036858.1| PREDICTED: respiratory burst oxidase homolog protein B [Populus 
euphratica]
 ref|XP_011036859.1| PREDICTED: respiratory burst oxidase homolog protein B [Populus 
euphratica]
Length=886

 Score =   435 bits (1119),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 205/278 (74%), Positives = 233/278 (84%), Gaps = 2/278 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLY  ERL RAFRS  K V+ILKVAVY GNVL L MSKPQGFRY SG
Sbjct  546  YKKTTWMYLAVPILLYTCERLTRAFRSGYKTVRILKVAVYPGNVLALHMSKPQGFRYTSG  605

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+AVS F+WHPFSITSAPGDDYLS+HIRTLGDWT QLK VFS+VCQP    +SG
Sbjct  606  QYVFVNCSAVSTFQWHPFSITSAPGDDYLSIHIRTLGDWTSQLKAVFSKVCQPASTHQSG  665

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  Q  N P  PR+LIDGPYGAPAQDYKKY+V+LLVGLGIGATP+ISIVKD+++N+
Sbjct  666  LLRADMAQRDNQPRLPRLLIDGPYGAPAQDYKKYDVLLLVGLGIGATPLISIVKDVLNNI  725

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +  EE  G + +G   NN   F T+RAYFYWVTREQGSF+WF+G+M+EVA+ D+  V
Sbjct  726  KQQKEMEE--GLVESGIKGNNRKPFATKRAYFYWVTREQGSFEWFRGVMNEVADYDQDRV  783

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVS  6
            IE+HNYCTSVYEEGDARSALI MLQSL  AKSGVDIVS
Sbjct  784  IELHNYCTSVYEEGDARSALITMLQSLQHAKSGVDIVS  821



>ref|XP_010259644.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Nelumbo 
nucifera]
 ref|XP_010259645.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Nelumbo 
nucifera]
Length=890

 Score =   435 bits (1119),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/279 (73%), Positives = 233/279 (84%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY  ERLIR FRS  K VKILKVAVY GNVL L MSKPQGF+Y+SG
Sbjct  550  YKKTTWMYLAVPVTLYACERLIRTFRSGYKTVKILKVAVYPGNVLALHMSKPQGFKYRSG  609

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+AVS  +WHPFSITSAPGDDYLS+HIRTLGDWT QLK VF++VCQPP   +SG
Sbjct  610  QYIFVNCSAVSSLQWHPFSITSAPGDDYLSIHIRTLGDWTSQLKAVFAQVCQPPTEDQSG  669

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G N P  PR+LIDGPYGAPAQDYK+Y+V+LLVGLGIGATP+ISIVKD+++N+
Sbjct  670  LLRADIKTGSNPPRLPRLLIDGPYGAPAQDYKEYDVLLLVGLGIGATPLISIVKDVLNNI  729

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K   + EE  G +  G  +N    F T+RAYFYWVTREQGSF+WF+G+++EVAE D   V
Sbjct  730  KQQNDVEE--GAVEVGSKDNKKKPFATKRAYFYWVTREQGSFEWFRGVLNEVAEYDRDGV  787

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  788  IELHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSG  826



>ref|XP_003521697.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
1 [Glycine max]
Length=885

 Score =   434 bits (1117),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 204/279 (73%), Positives = 232/279 (83%), Gaps = 3/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP++LY  ERL+RAFRS  K VKILKVAVY GNVL L MSKPQGF+Y SG
Sbjct  546  YKKTTWMYLAIPMILYACERLLRAFRSGYKSVKILKVAVYPGNVLALHMSKPQGFKYSSG  605

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC  VSPF+WHPFSITSAPGDDY+SVHIRTLGDWT QLK VF++ CQP    +SG
Sbjct  606  QYIFVNCPDVSPFQWHPFSITSAPGDDYVSVHIRTLGDWTSQLKAVFAKACQPASGDQSG  665

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  P+++IDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++NM
Sbjct  666  LLRADMLQGNNIPRMPKLVIDGPYGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNM  725

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ EE   G+      N    F T RAYFYWVTREQGSF+WFKG+MD+VAE D+  +
Sbjct  726  KQQKDIEE---GMVESGVKNKRKPFATNRAYFYWVTREQGSFEWFKGVMDDVAEYDKDGI  782

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  783  IELHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSG  821



>ref|XP_004503856.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cicer 
arietinum]
Length=933

 Score =   436 bits (1120),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/284 (74%), Positives = 242/284 (85%), Gaps = 5/284 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+ +Y  ERLI+A RSSIK V+ILKVAVY GNVL + MSKPQGF YKSG
Sbjct  586  YKKTTWMYLAIPITIYALERLIKALRSSIKSVRILKVAVYPGNVLVIHMSKPQGFSYKSG  645

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYM VNCAAVSP EWHPFSITSAP DDYLSVHI+ LGDWTR LK  FS+ CQP  NG+SG
Sbjct  646  QYMLVNCAAVSPLEWHPFSITSAPNDDYLSVHIKILGDWTRSLKEKFSQACQPAINGQSG  705

Query  479  LLRADCLQGQNNPN-FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+CL+G N+P+ FP+VLIDGPYGAPAQ Y++YEVVLLVGLGIGATPMISI+KD+V+N
Sbjct  706  LLRAECLKGDNSPSTFPKVLIDGPYGAPAQKYREYEVVLLVGLGIGATPMISILKDMVNN  765

Query  302  MKAM----ENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEM  135
             KAM    E S EEG  +T  + +   N+FKTRRAYFYWVTREQGSFDWFKG+M+EVAE 
Sbjct  766  FKAMEEEDEFSIEEGSPMTNNQKDTRFNDFKTRRAYFYWVTREQGSFDWFKGVMNEVAEE  825

Query  134  DEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            D + +IE+H+YCTSVYE+GDARSALIAM+QS++ AK GVD+VSG
Sbjct  826  DRRGLIELHSYCTSVYEQGDARSALIAMVQSINHAKKGVDVVSG  869



>ref|XP_003591142.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES61393.1| respiratory burst oxidase-like protein [Medicago truncatula]
Length=885

 Score =   434 bits (1115),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 200/279 (72%), Positives = 238/279 (85%), Gaps = 1/279 (0%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LYG ERL+RAFRS  K V+ILKVAVY GNVL L  SKPQGF+Y SG
Sbjct  542  YKKTTWMYLAVPMILYGCERLLRAFRSGYKSVRILKVAVYPGNVLALHASKPQGFKYTSG  601

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY++VNC+ +SPFEWHPFSITSAPGDDY+SVHIRTLGDWT QLK +F++ CQP  + +SG
Sbjct  602  QYIYVNCSDISPFEWHPFSITSAPGDDYISVHIRTLGDWTSQLKGIFAKACQPANDDQSG  661

Query  479  LLRADCLQGQNN-PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRAD L G+++ P  PR+ IDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++N
Sbjct  662  LLRADMLPGKSSLPRMPRLRIDGPYGAPAQDYKNYEVLLLVGLGIGATPLISILKDVLNN  721

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            +K  E   EEGG + +G  NN    F T+RAYFYWVTREQGSF+WFKG+M+EVAE D++ 
Sbjct  722  IKQQEEDLEEGGEVESGVKNNKKRPFATKRAYFYWVTREQGSFEWFKGVMNEVAENDKEG  781

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVS  6
            VIE+HNYCTSVYEEGDARSALI MLQSLH AK+GVD+VS
Sbjct  782  VIELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDVVS  820



>gb|KDO56233.1| hypothetical protein CISIN_1g002711mg [Citrus sinensis]
Length=889

 Score =   434 bits (1115),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 203/282 (72%), Positives = 238/282 (84%), Gaps = 6/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYLA+P+LLY  ERLIRAFRS  K V+ILKVAVY GNVL LQMSKPQGF+Y SG
Sbjct  547  YKRTTWMYLAVPVLLYACERLIRAFRSGYKSVRILKVAVYPGNVLALQMSKPQGFKYTSG  606

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVS F+WHPFSITSAPGDDYLS+HIRTLGDWT QLK++F++VCQPP   +SG
Sbjct  607  QYIFVNCAAVSQFQWHPFSITSAPGDDYLSIHIRTLGDWTSQLKSIFAKVCQPPSVDQSG  666

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  Q  N P  P++LIDGPYGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD+++N+
Sbjct  667  LLRADIGQADNRPRIPKLLIDGPYGAPAQDYKDYDVLLLVGLGIGATPLISIIKDVLNNI  726

Query  299  KAMENSEE---EGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            K  +  EE   E GG T    N+    F T+RAYFYWVTREQGSF+WF+G+M+EVAE D+
Sbjct  727  KQQKEIEEGITEDGGAT---KNSKKKPFATKRAYFYWVTREQGSFEWFRGVMNEVAEYDQ  783

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIE+HNYCTSVYEEGDARSALI MLQS+H AK+G+DIVSG
Sbjct  784  DGVIELHNYCTSVYEEGDARSALITMLQSIHHAKNGLDIVSG  825



>ref|XP_006433403.1| hypothetical protein CICLE_v10000227mg [Citrus clementina]
 ref|XP_006472080.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Citrus 
sinensis]
 gb|ESR46643.1| hypothetical protein CICLE_v10000227mg [Citrus clementina]
Length=889

 Score =   433 bits (1114),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 203/282 (72%), Positives = 238/282 (84%), Gaps = 6/282 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYLA+P+LLY  ERLIRAFRS  K V+ILKVAVY GNVL LQMSKPQGF+Y SG
Sbjct  547  YKRTTWMYLAVPVLLYACERLIRAFRSGYKSVRILKVAVYPGNVLALQMSKPQGFKYTSG  606

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVS F+WHPFSITSAPGDDYLS+HIRTLGDWT QLK++F++VCQPP   +SG
Sbjct  607  QYIFVNCAAVSQFQWHPFSITSAPGDDYLSIHIRTLGDWTSQLKSIFAKVCQPPSVDQSG  666

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  Q  N P  P++LIDGPYGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD+++N+
Sbjct  667  LLRADIGQADNRPRIPKLLIDGPYGAPAQDYKDYDVLLLVGLGIGATPLISIIKDVLNNI  726

Query  299  KAMENSEE---EGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            K  +  EE   E GG T    N+    F T+RAYFYWVTREQGSF+WF+G+M+EVAE D+
Sbjct  727  KQQKEIEEGITEDGGAT---KNSKKKPFATKRAYFYWVTREQGSFEWFRGVMNEVAEYDQ  783

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIE+HNYCTSVYEEGDARSALI MLQS+H AK+G+DIVSG
Sbjct  784  DGVIELHNYCTSVYEEGDARSALITMLQSIHHAKNGLDIVSG  825



>gb|AEP25512.1| putative respiratory burst oxidase-like protein A [Vicia faba]
Length=894

 Score =   433 bits (1114),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 234/279 (84%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+++Y  ERL+RA RS  K VKILKVAVY GNVL L +SKPQGF+Y SG
Sbjct  554  YKKTTWMYLAVPMIIYACERLLRALRSGNKSVKILKVAVYPGNVLALHVSKPQGFKYHSG  613

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC  VSPF+WHPFSITSAPGDDY+SVHIRTLGDWT QLK VF++ CQP    +SG
Sbjct  614  QYIFVNCPDVSPFQWHPFSITSAPGDDYVSVHIRTLGDWTSQLKAVFAKACQPASGDQSG  673

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  P++LIDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++NM
Sbjct  674  LLRADMLQGNNIPRMPKLLIDGPYGAPAQDYKDYEVILLVGLGIGATPLISILKDVLNNM  733

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ E+  GG+ +   NN    F T RAYFYWVTREQGSF+WFKG+MDE+A+ D+  +
Sbjct  734  KQQKDIEQ--GGVESDVKNNKRKPFATNRAYFYWVTREQGSFEWFKGVMDEIADYDKDGL  791

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AKSGVDIVSG
Sbjct  792  IELHNYCTSVYEEGDARSALITMLQSLHHAKSGVDIVSG  830



>gb|KCW44695.1| hypothetical protein EUGRSUZ_L017712, partial [Eucalyptus grandis]
Length=853

 Score =   432 bits (1111),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYLA+P+ LY  ERL+RA RS  K V+I KVAVY GNV+ L MSKPQGFRY SG
Sbjct  549  YKRTTWMYLAVPVTLYASERLLRALRSGYKTVRIFKVAVYPGNVMALHMSKPQGFRYTSG  608

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAPGDDYLS+HIRT+GDWT QLK+VFS+ CQPP   +SG
Sbjct  609  QYIFVNCAAVSPFQWHPFSITSAPGDDYLSLHIRTVGDWTSQLKSVFSKACQPPSIDQSG  668

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G+N P  PR+LIDGPYGAPAQDYK Y+V+LLVGLGIGATP+ISIVKD+++N+
Sbjct  669  LLRADIATGENVPRIPRLLIDGPYGAPAQDYKNYDVLLLVGLGIGATPLISIVKDVLNNI  728

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +  E E G + +G  +N    F TRRAYFYWVTREQGSF+WF+G+M+EVAE D   V
Sbjct  729  K--QQKEMEKGIVESGAKSNKRKPFLTRRAYFYWVTREQGSFEWFRGVMNEVAENDRDGV  786

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  787  IELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  825



>ref|XP_010530642.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Tarenaya 
hassleriana]
Length=929

 Score =   434 bits (1116),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 212/279 (76%), Positives = 239/279 (86%), Gaps = 4/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLAIPLLLY  ERLIRAFRSSIK VK+LK+ VY GNVL L M+KP GF+YKSG
Sbjct  591  YNKTTWMYLAIPLLLYSCERLIRAFRSSIKAVKLLKIVVYPGNVLALHMTKPNGFKYKSG  650

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC AVSPFEWHPFSITSAPGDD+LSVHIRTLGDWTRQL+TVF+E CQPP  GKSG
Sbjct  651  QYVFVNCRAVSPFEWHPFSITSAPGDDHLSVHIRTLGDWTRQLRTVFAEACQPPTAGKSG  710

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRA   +G +N    ++ IDGPYGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI++NM
Sbjct  711  LLRA---EGASNIESLKIRIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNM  767

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K+  N  +         +N+N N F+T++AYFYWVTREQGSF+WFKGIMDEVAEMDE+ V
Sbjct  768  KS-SNDNQMDRMENQNNNNSNNNGFRTKKAYFYWVTREQGSFEWFKGIMDEVAEMDEEGV  826

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALIAMLQSL  AK+GVD+VSG
Sbjct  827  IELHNYCTSVYEEGDARSALIAMLQSLQHAKTGVDVVSG  865



>ref|XP_003556516.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Glycine 
max]
Length=889

 Score =   433 bits (1113),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 237/279 (85%), Gaps = 5/279 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LYG ERL+RAFRS  K V+ILKVAVY GNVL L +SKP GF+Y SG
Sbjct  552  YKKTTWMYLAVPMILYGCERLLRAFRSGYKSVRILKVAVYPGNVLALHVSKPHGFKYSSG  611

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY++VNC+ VSPFEWHPFSITSAPGDDYLSVHIRTLGDWT QLK VF++ CQP  +G+SG
Sbjct  612  QYIYVNCSDVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTSQLKGVFAKACQPASDGQSG  671

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  PR+LIDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++N+
Sbjct  672  LLRADMLQGNNKPRMPRLLIDGPYGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNI  731

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ EE  G +     +N    F T+RAYFYWVTRE+GSF+WFKG+M+EV E D++ V
Sbjct  732  KQHKDVEE--GAV---EKDNKRKPFATKRAYFYWVTREEGSFEWFKGVMNEVEENDKEGV  786

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AK+GVDIVSG
Sbjct  787  IELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSG  825



>gb|AEP25514.1| putative respiratory burst oxidase-like protein B, partial [Vicia 
faba]
Length=375

 Score =   416 bits (1069),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 199/279 (71%), Positives = 238/279 (85%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LYG ERL+RAFRS  K VKILKVAVY GNVL L +SKPQGF+Y SG
Sbjct  33   YKKTTWMYLAVPMILYGCERLLRAFRSGYKSVKILKVAVYPGNVLALHVSKPQGFKYTSG  92

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY++VNC+ +SPFEWHPFSITSAPGDDY+SVHIRTLGDWT QLK +F++ CQP  +G+SG
Sbjct  93   QYIYVNCSDISPFEWHPFSITSAPGDDYISVHIRTLGDWTSQLKGIFAKACQPANDGQSG  152

Query  479  LLRADCLQGQNN-PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRAD L G+ + P  PRV IDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++N
Sbjct  153  LLRADMLPGKPSLPRMPRVRIDGPYGAPAQDYKNYEVLLLVGLGIGATPLISILKDVLNN  212

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            +K  +  + E G + +G  +N    F T+RAYFYWVTREQGSF+WFKG+M+E+AE D++ 
Sbjct  213  IK-QQEEDLEEGEVESGVKSNKKKPFATKRAYFYWVTREQGSFEWFKGVMNEIAENDKEG  271

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVS  6
            VIE+HNYCTSVYEEGDARSALI MLQSLH AKSGVD+VS
Sbjct  272  VIELHNYCTSVYEEGDARSALITMLQSLHHAKSGVDVVS  310



>ref|XP_010041041.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Eucalyptus 
grandis]
Length=889

 Score =   432 bits (1111),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYLA+P+ LY  ERL+RA RS  K V+I KVAVY GNV+ L MSKPQGFRY SG
Sbjct  549  YKRTTWMYLAVPVTLYASERLLRALRSGYKTVRIFKVAVYPGNVMALHMSKPQGFRYTSG  608

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAPGDDYLS+HIRT+GDWT QLK+VFS+ CQPP   +SG
Sbjct  609  QYIFVNCAAVSPFQWHPFSITSAPGDDYLSLHIRTVGDWTSQLKSVFSKACQPPSIDQSG  668

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G+N P  PR+LIDGPYGAPAQDYK Y+V+LLVGLGIGATP+ISIVKD+++N+
Sbjct  669  LLRADIATGENVPRIPRLLIDGPYGAPAQDYKNYDVLLLVGLGIGATPLISIVKDVLNNI  728

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +  E E G + +G  +N    F TRRAYFYWVTREQGSF+WF+G+M+EVAE D   V
Sbjct  729  K--QQKEMEKGIVESGAKSNKRKPFLTRRAYFYWVTREQGSFEWFRGVMNEVAENDRDGV  786

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  787  IELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  825



>gb|AFW64933.1| respiratory burst oxidase protein D variant alpha [Zea mays]
Length=932

 Score =   432 bits (1112),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 246/286 (86%), Gaps = 12/286 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKK+TWMYLA+P++LY  ERL RA RSS++PV+ILKVAVY GNVL+L  SKPQGFRYKSG
Sbjct  588  YKKSTWMYLAVPMVLYACERLTRALRSSVRPVRILKVAVYPGNVLSLHFSKPQGFRYKSG  647

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS VC+PP  GKSG
Sbjct  648  QYIFVNCAAVSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSRVCRPPTEGKSG  707

Query  479  LLRADCLQGQN---NPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV  309
            LLRA+  +  +   NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMISI+KDI+
Sbjct  708  LLRAEYDRDGSAVANPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDII  767

Query  308  SNMKAMENSEEEGGG----ITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVA  141
            +NM+ +     +GGG         S++++ +F+TRRAYFYWVTREQGSF+WF+G+MDEVA
Sbjct  768  NNMRQL-----DGGGDLEASDASASSSSMASFRTRRAYFYWVTREQGSFEWFRGVMDEVA  822

Query  140  EMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            E D K VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  823  ETDRKGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  868



>ref|NP_001157759.1| LOC100136880 isoform 1 [Zea mays]
 gb|ACJ05393.1| respiratory burst oxidase protein D variant alpha [Zea mays]
Length=932

 Score =   432 bits (1112),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 246/286 (86%), Gaps = 12/286 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKK+TWMYLA+P++LY  ERL RA RSS++PV+ILKVAVY GNVL+L  SKPQGFRYKSG
Sbjct  588  YKKSTWMYLAVPMVLYACERLTRALRSSVRPVRILKVAVYPGNVLSLHFSKPQGFRYKSG  647

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS VC+PP  GKSG
Sbjct  648  QYIFVNCAAVSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSRVCRPPTEGKSG  707

Query  479  LLRADCLQGQN---NPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV  309
            LLRA+  +  +   NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMISI+KDI+
Sbjct  708  LLRAEYDRDGSAVANPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDII  767

Query  308  SNMKAMENSEEEGGG----ITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVA  141
            +NM+ +     +GGG         S++++ +F+TRRAYFYWVTREQGSF+WF+G+MDEVA
Sbjct  768  NNMRQL-----DGGGDLEASDASSSSSSMASFRTRRAYFYWVTREQGSFEWFRGVMDEVA  822

Query  140  EMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            E D K VIE+HNYCTSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  823  ETDRKGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  868



>ref|XP_010025215.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Eucalyptus 
grandis]
 gb|KCW61820.1| hypothetical protein EUGRSUZ_H04514 [Eucalyptus grandis]
Length=889

 Score =   431 bits (1109),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 234/279 (84%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYLA+P+ LY  ERL+RA RS  K V+I KVAVY GNV+ L MSKPQGFRY SG
Sbjct  549  YKRTTWMYLAVPVTLYASERLLRALRSGYKTVRIFKVAVYPGNVMALHMSKPQGFRYTSG  608

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAPGDDYLS+HIRT+GDWT QLK VFS+ CQPP   +SG
Sbjct  609  QYIFVNCAAVSPFQWHPFSITSAPGDDYLSLHIRTVGDWTSQLKAVFSKACQPPSIDQSG  668

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G+N P  PR+LIDGPYGAPAQDYK Y+V+LLVGLGIGATP+ISIVKD+++N+
Sbjct  669  LLRADIATGENVPRIPRLLIDGPYGAPAQDYKNYDVLLLVGLGIGATPLISIVKDVLNNI  728

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +  E E G + +G  +N    F TRRAYFYWVTREQGSF+WF+G+M+EVAE D   V
Sbjct  729  K--QQKEMEKGIVESGAKSNKRKPFLTRRAYFYWVTREQGSFEWFRGVMNEVAENDRDGV  786

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALIAMLQSL+ AK+GVDIVSG
Sbjct  787  IELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSG  825



>ref|XP_006382490.1| respiratory burst oxidase protein B [Populus trichocarpa]
 gb|ERP60287.1| respiratory burst oxidase protein B [Populus trichocarpa]
Length=876

 Score =   431 bits (1107),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 204/278 (73%), Positives = 232/278 (83%), Gaps = 2/278 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLY  ERL RAFRS  K V+ILKVAVY GNVL L MSKPQGFRY SG
Sbjct  536  YKKTTWMYLAVPILLYTCERLTRAFRSGYKTVRILKVAVYPGNVLALHMSKPQGFRYTSG  595

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+AVS F+WHPFSITSAPGDDYLS+HIRTLGDWT QLK VFS+VCQP    +SG
Sbjct  596  QYVFVNCSAVSTFQWHPFSITSAPGDDYLSIHIRTLGDWTSQLKAVFSKVCQPASIHQSG  655

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  Q  N P  PR+LIDGPYGAPAQDYKKY+V+LLVGLGIGATP+ISIVKD+++N+
Sbjct  656  LLRADMAQRDNQPRLPRLLIDGPYGAPAQDYKKYDVLLLVGLGIGATPLISIVKDVLNNI  715

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +  EE  G + +G   N    F T+RAYFYWVTREQGSF+WF+G+M+EVA+ D+  V
Sbjct  716  KQQKEMEE--GLVESGIKGNYRKPFATKRAYFYWVTREQGSFEWFRGVMNEVADYDQDRV  773

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVS  6
            IE+HNYCTSVYEEGDARSALI MLQSL  AKSGVDIVS
Sbjct  774  IELHNYCTSVYEEGDARSALITMLQSLQHAKSGVDIVS  811



>ref|XP_002512422.1| respiratory burst oxidase, putative [Ricinus communis]
 gb|EEF49874.1| respiratory burst oxidase, putative [Ricinus communis]
Length=888

 Score =   430 bits (1105),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 204/279 (73%), Positives = 236/279 (85%), Gaps = 3/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY  ERLIRAFRS  K VKILKVAVY GNVL L MSKPQGFRY SG
Sbjct  547  YKKTTWMYLAVPMGLYAIERLIRAFRSGYKSVKILKVAVYPGNVLALHMSKPQGFRYTSG  606

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+AVSPF+WHPFSITSAPGDDYLS+HIRTLGDWT QLK+VFS+VCQP  + +SG
Sbjct  607  QYIFVNCSAVSPFQWHPFSITSAPGDDYLSIHIRTLGDWTSQLKSVFSKVCQPASSNQSG  666

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  +  N P  P++LIDGPYGAPAQDYKKY+V+LLVGLGIGATP+ISIVKD+++N+
Sbjct  667  LLRADVEKSGNKPRLPKLLIDGPYGAPAQDYKKYDVLLLVGLGIGATPLISIVKDVLNNI  726

Query  299  KAMENSEEEGGGITTGRSNNNVNN-FKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            K  +  E+E G +  G +  +    F TRRAYFYWVTREQGSF+WFKG+M+EVAE D+  
Sbjct  727  K--QQKEKEEGIVENGINKGSKRKPFATRRAYFYWVTREQGSFEWFKGVMNEVAEYDQDK  784

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVS  6
            VIE+HNYCTSVYEEGDARSALI MLQS+  AK+GVDIVS
Sbjct  785  VIELHNYCTSVYEEGDARSALITMLQSIQHAKNGVDIVS  823



>gb|AEX56131.1| NADPH oxidase [Phaseolus vulgaris]
Length=876

 Score =   429 bits (1104),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/280 (74%), Positives = 239/280 (85%), Gaps = 1/280 (0%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ +Y  ERL RA RSSIK VKILKV +Y GNVL+LQMSKPQGF YKSG
Sbjct  533  YKKTTWMYLAVPITIYALERLTRALRSSIKSVKILKVTLYPGNVLSLQMSKPQGFTYKSG  592

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHI+ +GDWTR LKT FS+ CQ P NG+SG
Sbjct  593  QYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIKIVGDWTRSLKTKFSQACQQPLNGQSG  652

Query  479  LLRADCLQGQNNP-NFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+CL+  N+  +FP+VL+DGPYGAPAQDY++YEVVLLVGLGIGATPMISIVKD+V  
Sbjct  653  LLRAECLKEDNSSVSFPKVLVDGPYGAPAQDYREYEVVLLVGLGIGATPMISIVKDMVKM  712

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            +K +E  EE G       +  + + FKTRRAYFYWVTREQGSFDWFKG+M+EVAE D K 
Sbjct  713  LKEIEEEEERGMEEGAAGAVKSDDEFKTRRAYFYWVTREQGSFDWFKGVMNEVAEEDRKK  772

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+H+YCTSVYEEGDARSALIAMLQS++ AK+G+DIVSG
Sbjct  773  VIELHSYCTSVYEEGDARSALIAMLQSINHAKNGLDIVSG  812



>ref|XP_008797083.1| PREDICTED: respiratory burst oxidase homolog protein C [Phoenix 
dactylifera]
Length=934

 Score =   431 bits (1108),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/303 (70%), Positives = 245/303 (81%), Gaps = 26/303 (9%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+++YG ERLIRAFRSS++PVKILKVAVY GNVL+L ++KPQGF+Y+SG
Sbjct  570  YKKTTWMYLAIPMIVYGTERLIRAFRSSVRPVKILKVAVYPGNVLSLHVTKPQGFKYRSG  629

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDYLSVHIRTLGDWTRQLKTVFS VCQ P +GKSG
Sbjct  630  QYIFVNCAAVSPFQWHPFSITSAPQDDYLSVHIRTLGDWTRQLKTVFSRVCQRPADGKSG  689

Query  479  LLRADCLQGQNN--PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVS  306
            LLRAD     ++  P+ PRVLIDGPYGAPAQDYK YEVVLLVGLGIGATP ISIVKDI +
Sbjct  690  LLRADYDGHASSPIPSLPRVLIDGPYGAPAQDYKNYEVVLLVGLGIGATPFISIVKDIAN  749

Query  305  NMKAMENS---EEEG-------------------GGITTGRSNNNVNNFKTRRAYFYWVT  192
            NMK +E+    + EG                    G ++ R       F+TRRAYFYWVT
Sbjct  750  NMKQLESEGLLDSEGDRDLEGGVGGDDGSSSSKRAGGSSQRHGGTT--FRTRRAYFYWVT  807

Query  191  REQGSFDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDI  12
            REQGSF+WF+G+M+EVAE D+K +IE+H YCTSVYEEGDARSALIAMLQSL+ AK GVD+
Sbjct  808  REQGSFEWFRGVMNEVAETDKKGMIELHTYCTSVYEEGDARSALIAMLQSLNHAKHGVDV  867

Query  11   VSG  3
            VSG
Sbjct  868  VSG  870



>gb|KDP23484.1| hypothetical protein JCGZ_23317 [Jatropha curcas]
Length=891

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 203/279 (73%), Positives = 235/279 (84%), Gaps = 3/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKP-VKILKVAVYHGNVLTLQMSKPQGFRYKS  663
            YKKTTWMYLAIP+ LY  ERLIRAFRS  K  V+ILKVAVY GNVL+L MSKPQGFRY S
Sbjct  550  YKKTTWMYLAIPMGLYACERLIRAFRSGYKSSVRILKVAVYPGNVLSLHMSKPQGFRYTS  609

Query  662  GQYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKS  483
            GQY+FVNCAAVSPFEWHPFSITSAPGDDYLS+HIRTLGDWT QLKTVFS+VCQP  + +S
Sbjct  610  GQYIFVNCAAVSPFEWHPFSITSAPGDDYLSIHIRTLGDWTSQLKTVFSKVCQPASSNQS  669

Query  482  GLLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            GLLRAD     N P  P++LIDGPYGAPAQDYKKY+V+LLVGLGIGATP+ISI+KD+++N
Sbjct  670  GLLRADIASSDNKPKLPKLLIDGPYGAPAQDYKKYDVLLLVGLGIGATPLISIIKDVLNN  729

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            +K  ++ EE  G + +G   N    F T+ AYFYWVTREQGSF+WF+G+M+EVA+ D+  
Sbjct  730  IKQQKDLEE--GIVESGIKGNKRKPFATKHAYFYWVTREQGSFEWFRGVMNEVADYDQDR  787

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVS  6
            VIE+HNYCTSVYEEGDARSALI MLQSL  AK+GVD+VS
Sbjct  788  VIELHNYCTSVYEEGDARSALITMLQSLQHAKNGVDVVS  826



>ref|XP_007159934.1| hypothetical protein PHAVU_002G279700g [Phaseolus vulgaris]
 gb|ESW31928.1| hypothetical protein PHAVU_002G279700g [Phaseolus vulgaris]
Length=899

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/280 (74%), Positives = 239/280 (85%), Gaps = 1/280 (0%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ +Y  ERL RA RSSIK VKILKV +Y GNVL+LQMSKPQGF YKSG
Sbjct  556  YKKTTWMYLAVPITIYALERLTRALRSSIKSVKILKVTLYPGNVLSLQMSKPQGFTYKSG  615

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAP DDYLSVHI+ +GDWTR LKT FS+ CQ P NG+SG
Sbjct  616  QYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIKIVGDWTRSLKTKFSQACQQPLNGQSG  675

Query  479  LLRADCLQGQNNP-NFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRA+CL+  N+  +FP+VL+DGPYGAPAQDY++YEVVLLVGLGIGATPMISIVKD+V  
Sbjct  676  LLRAECLKEDNSSVSFPKVLVDGPYGAPAQDYREYEVVLLVGLGIGATPMISIVKDMVKM  735

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            +K +E  EE G       +  + + FKTRRAYFYWVTREQGSFDWFKG+M+EVAE D K 
Sbjct  736  LKEIEEEEERGMEEGAAGAVKSDDEFKTRRAYFYWVTREQGSFDWFKGVMNEVAEEDRKK  795

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+H+YCTSVYEEGDARSALIAMLQS++ AK+G+DIVSG
Sbjct  796  VIELHSYCTSVYEEGDARSALIAMLQSINHAKNGLDIVSG  835



>ref|XP_008807835.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
X3 [Phoenix dactylifera]
Length=929

 Score =   431 bits (1107),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/299 (71%), Positives = 244/299 (82%), Gaps = 21/299 (7%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKK+TWMYLAIP+++Y  ERLIRAFRSS++PVKILKVAVY GNVL L +SKPQGF+Y+SG
Sbjct  568  YKKSTWMYLAIPMIIYATERLIRAFRSSVRPVKILKVAVYPGNVLALHVSKPQGFKYRSG  627

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAP DDYLSVHIRTLGDWTRQLKTVFS VCQ P +GKSG
Sbjct  628  QYIFVNCAAVSPFQWHPFSITSAPEDDYLSVHIRTLGDWTRQLKTVFSRVCQRPADGKSG  687

Query  479  LLRADCLQGQNN---PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV  309
            LLRADC  G  +   P+ PRVLIDGPYGAPAQDYKKY+VVLLVGLGIGATP ISI+KDIV
Sbjct  688  LLRADC-DGDADISIPSMPRVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPFISILKDIV  746

Query  308  SNMKAME---------NSEEEGGGITTGRSNNNVNNFKTRRA--------YFYWVTREQG  180
            +NMK +E         + + EG G ++ R +   + F T  A        YFYWVTREQG
Sbjct  747  NNMKQLESEGLLDSEGDRDLEGAGGSSHRPSGTSSTFTTAPAYTKKGTPGYFYWVTREQG  806

Query  179  SFDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            SF+WF+G+M+EVAE D+K +IE+H YCTSVYEEGDARSALI MLQSL+ AK GVD+VSG
Sbjct  807  SFEWFRGVMNEVAETDKKGMIELHTYCTSVYEEGDARSALITMLQSLNHAKHGVDVVSG  865



>ref|XP_003536070.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Glycine 
max]
Length=888

 Score =   429 bits (1103),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 236/279 (85%), Gaps = 6/279 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LYG ERL+RAFRS  K V+ILKVAVY GNVL L +SKPQGF+Y SG
Sbjct  552  YKKTTWMYLAVPMILYGCERLLRAFRSGYKSVRILKVAVYPGNVLALHVSKPQGFKYSSG  611

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY++VNC+ VSPFEWHPFSITSAPGDDYLSVHIRTLGDWT QLK VF++ CQP   G+SG
Sbjct  612  QYIYVNCSDVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTSQLKGVFAKACQPASEGQSG  671

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD LQG N P  PR+LIDGPYGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD+++N+
Sbjct  672  LLRADMLQGNNKPRMPRLLIDGPYGAPAQDYKNYDVILLVGLGIGATPLISILKDVLNNI  731

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ EE  G +      +    F T+RAYFYWVTRE+GSF+WFKG+M+EV E D++ V
Sbjct  732  KQHKDVEE--GEV----EKDKRKPFATKRAYFYWVTREEGSFEWFKGVMNEVEENDKEGV  785

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AK+GVDIVSG
Sbjct  786  IELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSG  824



>ref|XP_007206556.1| hypothetical protein PRUPE_ppa019730mg [Prunus persica]
 gb|EMJ07755.1| hypothetical protein PRUPE_ppa019730mg [Prunus persica]
Length=893

 Score =   428 bits (1101),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 199/281 (71%), Positives = 237/281 (84%), Gaps = 3/281 (1%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KKTTWMYLA+P+LLY  ERLIRAFRS  K V+ILKVAVY GNVL L MS PQGF+Y SGQ
Sbjct  549  KKTTWMYLAVPILLYACERLIRAFRSGYKTVRILKVAVYPGNVLALHMSTPQGFKYTSGQ  608

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            Y++VNC+A+SPF+WHPFSITSAPGDDYLS+HIRTLGDWT QLK++FS+VCQPP + +SGL
Sbjct  609  YIYVNCSAISPFQWHPFSITSAPGDDYLSIHIRTLGDWTSQLKSIFSKVCQPPSSEQSGL  668

Query  476  LRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMK  297
            LRAD   G      PR+LIDGPYGAPAQDYK+YEV+LLVGLGIGATP+ISIVKD+++N+K
Sbjct  669  LRADIAPGNVKLRMPRLLIDGPYGAPAQDYKEYEVLLLVGLGIGATPLISIVKDVLTNIK  728

Query  296  AMENSEEEGGGITTGRSNNNVN---NFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEK  126
              + +E+  G +     +N  N   +F T+RAYFYW+TREQGSF+WF+G+MDEVAE D+ 
Sbjct  729  QQKETEDHQGNMVENNGDNKDNKRKSFVTKRAYFYWITREQGSFEWFRGVMDEVAENDKD  788

Query  125  HVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             VIE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  789  GVIELHNYCTSVYEEGDARSALITMLQSLNHAKNGVDIVSG  829



>ref|XP_010929525.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Elaeis 
guineensis]
Length=934

 Score =   428 bits (1100),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 212/299 (71%), Positives = 246/299 (82%), Gaps = 20/299 (7%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+++YG ERLIR FRSS++PVKILKVAVY GNVL L +SKPQGF+Y+SG
Sbjct  572  YKKTTWMYLAIPMIIYGTERLIRTFRSSVRPVKILKVAVYPGNVLALHVSKPQGFKYRSG  631

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCA VSPF+WHPFSITSAP DDYLSVHIRTLGDWT QLK VFS+VCQ P +GKSG
Sbjct  632  QYIFVNCADVSPFQWHPFSITSAPQDDYLSVHIRTLGDWTGQLKMVFSKVCQRPADGKSG  691

Query  479  LLRADCLQGQNN--PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVS  306
            LLRAD     ++  P+ PR+LIDGPYGAPAQDYKKYEVVLLVGLGIGATP ISIVKDIV+
Sbjct  692  LLRADYDGHASSPIPSLPRLLIDGPYGAPAQDYKKYEVVLLVGLGIGATPFISIVKDIVN  751

Query  305  NMKAME-----NSEEE--------GGGITTGRSNNNVN-----NFKTRRAYFYWVTREQG  180
            NMK +E     +SE +        G   +T R+  + +      F+TRRAYFYWVTREQG
Sbjct  752  NMKQLESEGLLDSEGDQDLESAVGGESRSTKRAAGSSHRPGGGTFRTRRAYFYWVTREQG  811

Query  179  SFDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            SF+WF+G+M+EVAE D+K +IE+H YCTSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  812  SFEWFRGVMNEVAETDKKGLIELHTYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  870



>ref|XP_008450637.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X1 [Cucumis melo]
Length=889

 Score =   427 bits (1097),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 200/279 (72%), Positives = 231/279 (83%), Gaps = 7/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLY  ERLIRAFRS  K V+I KVAVY GNVL LQMSKP GF+Y SG
Sbjct  554  YKKTTWMYLAVPVLLYACERLIRAFRSGYKTVRISKVAVYPGNVLALQMSKPHGFKYTSG  613

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+A+SPF+WHPFSITSAPGDDYLS+HIRT+GDWT QLKT+FS+VCQPP   +SG
Sbjct  614  QYIFVNCSAISPFQWHPFSITSAPGDDYLSIHIRTVGDWTSQLKTIFSKVCQPPSVNQSG  673

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  Q  N    PR+LIDGPYGAPAQDYK+Y+V+LLVGLGIGATP+ISIVKD+++N+
Sbjct  674  LLRADIGQSSNKIRLPRLLIDGPYGAPAQDYKQYDVLLLVGLGIGATPLISIVKDVLNNI  733

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K       E   I  G ++     F T+RAYFYWVTREQGSF+WF+G+MDEVAE D   V
Sbjct  734  K-------EQKDIENGVADKQAKPFVTKRAYFYWVTREQGSFEWFRGVMDEVAENDRDRV  786

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQ L+ AK+GVDIVSG
Sbjct  787  IELHNYCTSVYEEGDARSALITMLQDLNHAKNGVDIVSG  825



>ref|XP_008246416.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X2 [Prunus mume]
Length=893

 Score =   427 bits (1097),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/281 (71%), Positives = 236/281 (84%), Gaps = 3/281 (1%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KKTTWMYLA+P+LLY  ERLIRAFRS  K V+ILKVAVY GNVL L MS PQGF+Y SGQ
Sbjct  549  KKTTWMYLAVPILLYACERLIRAFRSGYKTVRILKVAVYPGNVLALHMSTPQGFKYTSGQ  608

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            Y++VNC+A+SPF+WHPFSITSAPGDDYLS+HIRTLGDWT QLK++FS+VCQPP + +SGL
Sbjct  609  YIYVNCSAISPFQWHPFSITSAPGDDYLSIHIRTLGDWTSQLKSIFSKVCQPPSSEQSGL  668

Query  476  LRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMK  297
            LRAD   G      PR+LIDGPYGAPAQDYK+YEV+LLVGLGIGATP+ISIVKD+++N+K
Sbjct  669  LRADIAPGNVKLRMPRLLIDGPYGAPAQDYKEYEVLLLVGLGIGATPLISIVKDVLTNIK  728

Query  296  AMENSEEEGGGITTGRSNNNVN---NFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEK  126
              + +E+  G +      N  N   +F T+RAYFYW+TREQGSF+WF+G+MDEVAE D+ 
Sbjct  729  QQKETEDHRGNMVENNGANKDNKRKSFVTKRAYFYWITREQGSFEWFRGVMDEVAENDKD  788

Query  125  HVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             VIE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  789  GVIELHNYCTSVYEEGDARSALITMLQSLNHAKNGVDIVSG  829



>ref|XP_004168501.1| PREDICTED: respiratory burst oxidase homolog protein B-like, 
partial [Cucumis sativus]
Length=853

 Score =   425 bits (1093),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/279 (71%), Positives = 231/279 (83%), Gaps = 7/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLY  ERLIRAFRS  K V+I KVAVY GNVL LQMSKP GF+Y SG
Sbjct  554  YKKTTWMYLAVPVLLYACERLIRAFRSGYKTVRISKVAVYPGNVLALQMSKPHGFKYTSG  613

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+A+SPF+WHPFSITSAPGDDYLS+HIRT+GDWT QLKT+FS+VCQPP   +SG
Sbjct  614  QYIFVNCSAISPFQWHPFSITSAPGDDYLSIHIRTVGDWTSQLKTIFSKVCQPPSVNQSG  673

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  Q  N    PR+LIDGPYGAPAQDYK+Y+V+LLVGLGIGATP+ISIVKD+++N+
Sbjct  674  LLRADIGQSSNKIRLPRLLIDGPYGAPAQDYKQYDVLLLVGLGIGATPLISIVKDVLNNI  733

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++       I  G  +     F T+RAYFYWVTREQGSF+WF+G+MDEVAE D   V
Sbjct  734  KDQKD-------IENGVGDKQAKPFVTKRAYFYWVTREQGSFEWFRGVMDEVAENDRDRV  786

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQ L+ AK+GVDIVSG
Sbjct  787  IELHNYCTSVYEEGDARSALITMLQDLNHAKNGVDIVSG  825



>ref|XP_010523349.1| PREDICTED: respiratory burst oxidase homolog protein A isoform 
X2 [Tarenaya hassleriana]
Length=867

 Score =   425 bits (1093),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 205/286 (72%), Positives = 236/286 (83%), Gaps = 8/286 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMY+AIP++LY  ERLIRAFRSSIK V ILKVAVY GNVL+LQMSKP  F Y+SG
Sbjct  547  YKKTTWMYMAIPVVLYVSERLIRAFRSSIKAVSILKVAVYPGNVLSLQMSKPHNFGYRSG  606

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVSPFEWHPFSITSAP DDYLSVHIR LGDWT+QL++VFSE C+   + + G
Sbjct  607  QYMFVNCSAVSPFEWHPFSITSAPDDDYLSVHIRVLGDWTQQLRSVFSEACKQTLDEEHG  666

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L R D   G + PNFPR+LIDGPYGAPAQDYKK+EVVLLVGLGIGATPMISIV+DIV+N+
Sbjct  667  LRRDDYRHGNSIPNFPRILIDGPYGAPAQDYKKFEVVLLVGLGIGATPMISIVRDIVNNI  726

Query  299  KAMENSEEEGGGITTGRS-------NNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVA  141
            ++ +  E+  G +T  R+             F+TRRAYFYWVTREQGSF+WFK +MDE A
Sbjct  727  RS-KGDEDSAGRMTRSRNVIIPSSPARKREGFRTRRAYFYWVTREQGSFEWFKNVMDEAA  785

Query  140  EMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            E D  +VIEMHNYCTSVYEEGDARSALIAMLQSL+ AK+GVD+VSG
Sbjct  786  EPDLNNVIEMHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSG  831



>ref|XP_004135613.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Cucumis 
sativus]
 gb|KGN66068.1| hypothetical protein Csa_1G569450 [Cucumis sativus]
Length=889

 Score =   426 bits (1094),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 199/279 (71%), Positives = 231/279 (83%), Gaps = 7/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+LLY  ERLIRAFRS  K V+I KVAVY GNVL LQMSKP GF+Y SG
Sbjct  554  YKKTTWMYLAVPVLLYACERLIRAFRSGYKTVRISKVAVYPGNVLALQMSKPHGFKYTSG  613

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+A+SPF+WHPFSITSAPGDDYLS+HIRT+GDWT QLKT+FS+VCQPP   +SG
Sbjct  614  QYIFVNCSAISPFQWHPFSITSAPGDDYLSIHIRTVGDWTSQLKTIFSKVCQPPSVNQSG  673

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  Q  N    PR+LIDGPYGAPAQDYK+Y+V+LLVGLGIGATP+ISIVKD+++N+
Sbjct  674  LLRADIGQSSNKIRLPRLLIDGPYGAPAQDYKQYDVLLLVGLGIGATPLISIVKDVLNNI  733

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++       I  G  +     F T+RAYFYWVTREQGSF+WF+G+MDEVAE D   V
Sbjct  734  KDQKD-------IENGVGDKQAKPFVTKRAYFYWVTREQGSFEWFRGVMDEVAENDRDRV  786

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQ L+ AK+GVDIVSG
Sbjct  787  IELHNYCTSVYEEGDARSALITMLQDLNHAKNGVDIVSG  825



>ref|XP_010523340.1| PREDICTED: respiratory burst oxidase homolog protein A isoform 
X1 [Tarenaya hassleriana]
Length=895

 Score =   425 bits (1093),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 205/286 (72%), Positives = 236/286 (83%), Gaps = 8/286 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMY+AIP++LY  ERLIRAFRSSIK V ILKVAVY GNVL+LQMSKP  F Y+SG
Sbjct  547  YKKTTWMYMAIPVVLYVSERLIRAFRSSIKAVSILKVAVYPGNVLSLQMSKPHNFGYRSG  606

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC+AVSPFEWHPFSITSAP DDYLSVHIR LGDWT+QL++VFSE C+   + + G
Sbjct  607  QYMFVNCSAVSPFEWHPFSITSAPDDDYLSVHIRVLGDWTQQLRSVFSEACKQTLDEEHG  666

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L R D   G + PNFPR+LIDGPYGAPAQDYKK+EVVLLVGLGIGATPMISIV+DIV+N+
Sbjct  667  LRRDDYRHGNSIPNFPRILIDGPYGAPAQDYKKFEVVLLVGLGIGATPMISIVRDIVNNI  726

Query  299  KAMENSEEEGGGITTGRS-------NNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVA  141
            ++ +  E+  G +T  R+             F+TRRAYFYWVTREQGSF+WFK +MDE A
Sbjct  727  RS-KGDEDSAGRMTRSRNVIIPSSPARKREGFRTRRAYFYWVTREQGSFEWFKNVMDEAA  785

Query  140  EMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            E D  +VIEMHNYCTSVYEEGDARSALIAMLQSL+ AK+GVD+VSG
Sbjct  786  EPDLNNVIEMHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSG  831



>dbj|BAJ94299.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97805.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=925

 Score =   426 bits (1094),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/282 (72%), Positives = 242/282 (86%), Gaps = 7/282 (2%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KK+TWMY+A P++LY  ERL RA RSS++PVKILKVAVY GNVL+L+ SKPQGFR KSGQ
Sbjct  583  KKSTWMYVAAPMVLYACERLARALRSSVRPVKILKVAVYPGNVLSLRFSKPQGFRCKSGQ  642

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            Y+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK+VFS+VC+PP +GKSGL
Sbjct  643  YIFVNCAAVSPFQWHPFSITSAPHDDYISVHIRTLGDWTRELKSVFSKVCRPPTDGKSGL  702

Query  476  LRADCL-QGQNNP---NFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV  309
            LRA+    G   P   +FP VLIDGPYGAPAQDYK+Y+VVLLVGLGIGATPMISI+KDI+
Sbjct  703  LRAEYAGDGGAMPSPSSFPTVLIDGPYGAPAQDYKQYDVVLLVGLGIGATPMISIIKDII  762

Query  308  SNMKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            +NMK ++   E G   +    + +  +F+TRRAYFYWVTRE+GSFDWF+G+MDEVAE D+
Sbjct  763  NNMKRLDGDIESG---SPSDRSVSAASFQTRRAYFYWVTREEGSFDWFRGVMDEVAESDK  819

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            K +IE+HNYCTSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  820  KGIIELHNYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  861



>gb|EYU21750.1| hypothetical protein MIMGU_mgv1a001620mg [Erythranthe guttata]
Length=784

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/285 (71%), Positives = 236/285 (83%), Gaps = 11/285 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY GERLIR FRSSI  VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  441  YKKTTWMYLAVPVALYLGERLIRVFRSSINSVKILKVAVYPGNVLALHMSKPQGFKYKSG  500

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPFEWHPF +TSAP DD+LS+H+RTLGDWTRQLK VFSE CQPP +    
Sbjct  501  QYIFVNCAAVSPFEWHPFYMTSAPMDDHLSIHMRTLGDWTRQLKLVFSEACQPPRS----  556

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
              R+D LQG+N PNFPRVLIDGPY AP+QDY+ Y VVLL+GLGIG+TPMISI+KDIV+N+
Sbjct  557  -FRSDYLQGKNYPNFPRVLIDGPYAAPSQDYRNYGVVLLLGLGIGSTPMISIIKDIVNNI  615

Query  299  KAMENSEEE------GGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAE  138
             +ME  EE              RS++  ++FKTR+AYFYWV REQGSFDWFKG++DEVAE
Sbjct  616  MSMEEEEEANSLEEGTAAPLKSRSDSGAHSFKTRKAYFYWVIREQGSFDWFKGVLDEVAE  675

Query  137  MDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +D + ++EMHNYCTSVYEEGDARS +I MLQSL+ AK+G+D+VSG
Sbjct  676  LDTRGIVEMHNYCTSVYEEGDARSVIITMLQSLNHAKNGLDVVSG  720



>ref|XP_010269487.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Nelumbo 
nucifera]
Length=908

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/283 (72%), Positives = 233/283 (82%), Gaps = 7/283 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL +PL LY  ERL+ AFRS  K VKILKVAVY GNVL L MSKPQGF+YKSG
Sbjct  565  YKKTTWMYLVLPLTLYASERLLSAFRSGYKTVKILKVAVYPGNVLALHMSKPQGFKYKSG  624

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FV C+AVS  +WHPFSITSAPGDDYLSVHIRTLGDWT QLK+VFS+VCQPP   +SG
Sbjct  625  QYIFVKCSAVSSLQWHPFSITSAPGDDYLSVHIRTLGDWTSQLKSVFSQVCQPPSADQSG  684

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G N P  PR+LIDGPYGAPAQDYK+Y+V+LLVGLGIGATP+ISIVKD+++N+
Sbjct  685  LLRADINTGNNAPRLPRLLIDGPYGAPAQDYKEYDVLLLVGLGIGATPLISIVKDVLNNI  744

Query  299  KAMENSEE----EGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMD  132
            K  ++ EE    + GG   G  +N    F T++AYFYWVTREQGSF+WF+G+++EVAE D
Sbjct  745  KQQKDIEEGSVVQSGG---GAKSNKKKPFATKQAYFYWVTREQGSFEWFRGVLNEVAEYD  801

Query  131  EKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
               VIE+HNYCTSVYEEGDARSALIAMLQSL  AK GVDIVSG
Sbjct  802  RDGVIELHNYCTSVYEEGDARSALIAMLQSLQHAKYGVDIVSG  844



>dbj|BAJ86360.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=925

 Score =   425 bits (1092),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/282 (73%), Positives = 244/282 (87%), Gaps = 7/282 (2%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KK+TWMY+A P++LY  ERL RA RSS++PVKILKVAVY GNVL+L+ SKPQGFR +SGQ
Sbjct  583  KKSTWMYVAAPMVLYACERLARALRSSVRPVKILKVAVYPGNVLSLRFSKPQGFRCRSGQ  642

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            Y+FVNCAAVSPF+WHPFSITSAP DDY+SVHIRTLGDWTR+LK+VFS+VC+PP +GKSGL
Sbjct  643  YIFVNCAAVSPFQWHPFSITSAPHDDYISVHIRTLGDWTRELKSVFSKVCRPPTDGKSGL  702

Query  476  LRADCL-QGQNNP---NFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV  309
            LRA+    G   P   +FP VLIDGPYGAPAQDYK+Y+VVLLVGLGIGATPMISI+KDI+
Sbjct  703  LRAEYAGDGGAMPSPSSFPTVLIDGPYGAPAQDYKQYDVVLLVGLGIGATPMISIIKDII  762

Query  308  SNMKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            +NMK ++   + G G  + RS  +  +F+TRRAYFYWVTRE+GSFDWF+G+MDEVAE D+
Sbjct  763  NNMKRLDG--DIGSGSPSDRS-VSAASFQTRRAYFYWVTREEGSFDWFRGVMDEVAESDK  819

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            K +IE+HNYCTSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  820  KGIIELHNYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  861



>gb|ADR70881.1| respiratory burst oxidase B [Manihot esculenta]
Length=885

 Score =   424 bits (1089),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 233/279 (84%), Gaps = 3/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+ LY  ERLIRAFRS  K V+ILKVAVY GNVL L MSKPQGFRY SG
Sbjct  544  YKKTTWMYLAIPMGLYACERLIRAFRSGYKSVRILKVAVYPGNVLALHMSKPQGFRYTSG  603

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+AVS F+WHPFSITSAPGDDYLS+HIRTLGDWT QLK VFS+VCQP  + +SG
Sbjct  604  QYIFVNCSAVSQFQWHPFSITSAPGDDYLSIHIRTLGDWTAQLKAVFSKVCQPASSNQSG  663

Query  479  LLRADCLQGQNNPN-FPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRAD     N P+  P++LIDGPYGAPAQDYK Y+V+LLVGLGIGATP+ISIVKD+++N
Sbjct  664  LLRADIASSDNKPSRLPKLLIDGPYGAPAQDYKNYDVLLLVGLGIGATPLISIVKDVLNN  723

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            +K  +  EE  G + +G   N    F T+RAYFYWVTREQGSF+WF+G+M+EVA+ D+  
Sbjct  724  IKQQKEIEE--GMVESGIKGNKRKPFATKRAYFYWVTREQGSFEWFRGVMNEVADYDQDR  781

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVS  6
            VIE+HNYCTSVYEEGDARSALIAMLQSL  AK+GVD+VS
Sbjct  782  VIELHNYCTSVYEEGDARSALIAMLQSLQHAKNGVDVVS  820



>ref|XP_008246413.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X1 [Prunus mume]
Length=894

 Score =   423 bits (1087),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 199/282 (71%), Positives = 236/282 (84%), Gaps = 4/282 (1%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KKTTWMYLA+P+LLY  ERLIRAFRS  K V+ILKVAVY GNVL L MS PQGF+Y SGQ
Sbjct  549  KKTTWMYLAVPILLYACERLIRAFRSGYKTVRILKVAVYPGNVLALHMSTPQGFKYTSGQ  608

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGL  477
            Y++VNC+A+SPF+WHPFSITSAPGDDYLS+HIRTLGDWT QLK++FS+VCQPP + +SGL
Sbjct  609  YIYVNCSAISPFQWHPFSITSAPGDDYLSIHIRTLGDWTSQLKSIFSKVCQPPSSEQSGL  668

Query  476  LRADCLQGQNN-PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LRAD   G       PR+LIDGPYGAPAQDYK+YEV+LLVGLGIGATP+ISIVKD+++N+
Sbjct  669  LRADIAPGNVKLSRMPRLLIDGPYGAPAQDYKEYEVLLLVGLGIGATPLISIVKDVLTNI  728

Query  299  KAMENSEEEGGGITTGRSNNNVN---NFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            K  + +E+  G +      N  N   +F T+RAYFYW+TREQGSF+WF+G+MDEVAE D+
Sbjct  729  KQQKETEDHRGNMVENNGANKDNKRKSFVTKRAYFYWITREQGSFEWFRGVMDEVAENDK  788

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVDIVSG
Sbjct  789  DGVIELHNYCTSVYEEGDARSALITMLQSLNHAKNGVDIVSG  830



>ref|XP_004241641.1| PREDICTED: respiratory burst oxidase homolog protein D [Solanum 
lycopersicum]
Length=857

 Score =   421 bits (1082),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 207/279 (74%), Positives = 238/279 (85%), Gaps = 7/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP++LY GERL+RAFRSS+K VKILKVA+Y GNVLTLQMSKPQGF YKSG
Sbjct  522  YKKTTWMYLAIPIILYSGERLLRAFRSSVKDVKILKVAMYPGNVLTLQMSKPQGFNYKSG  581

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGD+YLSVHIRT+GDWT +L+ VFSE   P   G+SG
Sbjct  582  QYMFVNCAAVSPFEWHPFSITSAPGDEYLSVHIRTVGDWTTKLRDVFSE---PSQTGRSG  638

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L++A  +Q   N  +P+VLIDGPYGAPAQDYK+YEV+LLVGLGIGATPMISIVKDIV+NM
Sbjct  639  LVKAAYMQDNIN-YYPKVLIDGPYGAPAQDYKEYEVLLLVGLGIGATPMISIVKDIVNNM  697

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  E  + +       + + + +NFK  R YFYWVTREQGSFDWFKG+M+E+AEMD   +
Sbjct  698  KE-EEYDHDLESTEQKKKSGSGSNFK--RVYFYWVTREQGSFDWFKGLMNELAEMDCAEI  754

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IEMHNYCTSVYEEGDARSALIAMLQS++ AK+GVDIVSG
Sbjct  755  IEMHNYCTSVYEEGDARSALIAMLQSINHAKNGVDIVSG  793



>ref|NP_001274981.1| respiratory burst oxidase homolog protein B [Solanum tuberosum]
 sp|Q948T9.1|RBOHB_SOLTU RecName: Full=Respiratory burst oxidase homolog protein B; AltName: 
Full=NADPH oxidase RBOHB; AltName: Full=StRBOHB [Solanum 
tuberosum]
 dbj|BAB70751.1| respiratory burst oxidase homolog [Solanum tuberosum]
Length=867

 Score =   421 bits (1082),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 194/279 (70%), Positives = 234/279 (84%), Gaps = 7/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMY+A+P++LY  ERL+RAFRS  K VKILKVAVY GNV+ + MSKPQGF+Y SG
Sbjct  532  YKKTTWMYIAVPMILYACERLLRAFRSGYKAVKILKVAVYPGNVMAVHMSKPQGFKYTSG  591

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+ VS F+WHPF+I+SAPGDDYLS+HIRTLGDWT QLKT+FS+VC+PP   +SG
Sbjct  592  QYIFVNCSDVSSFQWHPFTISSAPGDDYLSMHIRTLGDWTSQLKTLFSKVCEPPTGDQSG  651

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  +    P  P++LIDGPYGAPAQDYKKY+VVLLVGLGIGATP+ISIVKD+++N+
Sbjct  652  LLRADVAKADYKPRLPKLLIDGPYGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNI  711

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +N E+       G   +  + F T+RAYFYWVTREQGSF+WFKG+MDEV+E D++ +
Sbjct  712  KQQKNIED-------GTKGSKRSPFATKRAYFYWVTREQGSFEWFKGVMDEVSENDQEGL  764

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQS+  AKSGVDIVSG
Sbjct  765  IELHNYCTSVYEEGDARSALITMLQSIQQAKSGVDIVSG  803



>ref|XP_009778242.1| PREDICTED: respiratory burst oxidase homolog protein B [Nicotiana 
sylvestris]
Length=872

 Score =   420 bits (1079),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 192/279 (69%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMY+A+P++LY  ERL+RAFRS  K V+ILKVAVY GNV+ + MSKPQGF+Y SG
Sbjct  532  YKKTTWMYIAVPMILYACERLLRAFRSGYKTVRILKVAVYPGNVMAVHMSKPQGFKYTSG  591

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY FVNC+ VS F+WHPF+I+SAPGDDYLS+HIRT+GDWT QLKT+FS+VC+PP   +SG
Sbjct  592  QYFFVNCSDVSSFQWHPFTISSAPGDDYLSMHIRTVGDWTSQLKTLFSKVCEPPTGDQSG  651

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  +    P  P++LIDGPYGAPAQDYKKY+VVLLVGLGIGATP+ISIVKD+++N+
Sbjct  652  LLRADIAKADYKPRLPKLLIDGPYGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNI  711

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ E+  G I +G      + F T+RAYFYWVTREQGSF+WFKG+MDEV++ D++ +
Sbjct  712  KQQKDIED--GVIESGTKGTKRSPFATKRAYFYWVTREQGSFEWFKGVMDEVSQNDQEGL  769

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQS+  AKSGVDIVSG
Sbjct  770  IELHNYCTSVYEEGDARSALITMLQSIQQAKSGVDIVSG  808



>ref|XP_004230232.1| PREDICTED: respiratory burst oxidase homolog protein B [Solanum 
lycopersicum]
Length=865

 Score =   419 bits (1078),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 193/279 (69%), Positives = 234/279 (84%), Gaps = 7/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMY+A+P++LY  ERL+RAFRS  K V+ILKVAVY GNV+ + MSKPQGF+Y SG
Sbjct  530  YKKTTWMYIAVPMILYACERLLRAFRSGYKAVRILKVAVYPGNVMAVHMSKPQGFKYTSG  589

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+ VS F+WHPF+I+SAPGDDYLSVHIRTLGDWT QLKT+FS+VC+PP   +SG
Sbjct  590  QYIFVNCSDVSSFQWHPFTISSAPGDDYLSVHIRTLGDWTSQLKTLFSKVCEPPTGDQSG  649

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  +    P  P++LIDGPYGAPAQDYKKY+VVLLVGLGIGATP+ISIVKD+++N+
Sbjct  650  LLRADIGKADYKPRLPKLLIDGPYGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNI  709

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
               ++ E+       G   +  + F T+RAYFYWVTREQGSF+WFKG+MDEV+E D++ +
Sbjct  710  NQQKDIED-------GTKGSKKSPFATKRAYFYWVTREQGSFEWFKGVMDEVSENDQEGL  762

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQS+H AKSGVDIVSG
Sbjct  763  IELHNYCTSVYEEGDARSALITMLQSIHQAKSGVDIVSG  801



>gb|AAW78863.1| respiratory burst oxidase 1 [Medicago truncatula]
Length=932

 Score =   420 bits (1080),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 242/315 (77%), Gaps = 39/315 (12%)
 Frame = -1

Query  833  KTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQY  654
            KTTWMYLAIP+ +YG ERLIRA RSSIK V+ILKVAVY GNVL + MSKPQGF YKSGQY
Sbjct  553  KTTWMYLAIPITIYGLERLIRALRSSIKSVRILKVAVYPGNVLAINMSKPQGFSYKSGQY  612

Query  653  MFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVF---------------  519
            M VNCAAVSP EWHPFSITSAP DDYLSVHI+ LGDWTR LKT F               
Sbjct  613  MLVNCAAVSPLEWHPFSITSAPNDDYLSVHIKILGDWTRSLKTKFQACQPAINGQSGLDY  672

Query  518  -------------------SEVCQPPPNGKSGLLRADCLQGQNNPN-FPRVLIDGPYGAP  399
                               S+ CQP  NG+SGLLRA+CL+G N+P+ FP+VLIDGPYGAP
Sbjct  673  LSVHIKILGDWTRSLKTKFSQACQPAINGQSGLLRAECLKGDNSPSTFPKVLIDGPYGAP  732

Query  398  AQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMKAMENSE----EEGGGITTGRSNNNVN  231
            AQDY++YEVVLLVGLGIGATPMISI+KD+V+N KAME  +    EEG  +T  + ++  +
Sbjct  733  AQDYREYEVVLLVGLGIGATPMISILKDMVNNFKAMEEEDGFAMEEGSPMTPNQKDSRFS  792

Query  230  NFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAM  51
            +FKTRRAYFYWVTREQGSFDWFKG+M++VAE D + +IE+H+YCTSVYE+GDARSALIAM
Sbjct  793  DFKTRRAYFYWVTREQGSFDWFKGVMNDVAEEDRRGLIELHSYCTSVYEQGDARSALIAM  852

Query  50   LQSLHLAKSGVDIVS  6
            +QS++ AK  VD+VS
Sbjct  853  VQSINHAKHRVDVVS  867



>sp|Q2HXK9.2|RBOHD_SOLTU RecName: Full=Respiratory burst oxidase homolog protein D; AltName: 
Full=NADPH oxidase RBOHD; AltName: Full=StRBOHD [Solanum 
tuberosum]
 dbj|BAE79345.2| NADPH oxidase [Solanum tuberosum]
Length=858

 Score =   417 bits (1073),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 206/279 (74%), Positives = 235/279 (84%), Gaps = 11/279 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP++LY GERL+RAFRSS+K VKILKVA+Y GNVLTLQMSKPQGF YKSG
Sbjct  527  YKKTTWMYLAIPIILYSGERLLRAFRSSVKDVKILKVAMYTGNVLTLQMSKPQGFNYKSG  586

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNCAAVSPFEWHPFSITSAPGD+YLSVHIR +GDWT +L+ VFSE   P P G+SG
Sbjct  587  QYMFVNCAAVSPFEWHPFSITSAPGDEYLSVHIRIVGDWTTKLRDVFSE---PSPTGRSG  643

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L+ AD L  Q+  N+P+VLIDGPYGAPAQDYK+YEV+LLVGLGIGATPMISIVKDIV+NM
Sbjct  644  LV-ADYL--QDKINYPKVLIDGPYGAPAQDYKEYEVLLLVGLGIGATPMISIVKDIVNNM  700

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +   +      +G   +N      +R YFYWVTREQGSFDWFKG+M+E+A MD   +
Sbjct  701  KEEKYDHDLEKKTVSGSGRSNF-----KRVYFYWVTREQGSFDWFKGLMNELAVMDCDGI  755

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IEMHNYCTSVYEEGDARSALIAMLQS++ AK+GVDIVSG
Sbjct  756  IEMHNYCTSVYEEGDARSALIAMLQSINHAKNGVDIVSG  794



>ref|XP_004495711.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Cicer 
arietinum]
Length=879

 Score =   418 bits (1074),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/279 (70%), Positives = 235/279 (84%), Gaps = 3/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P++LYG ER++RAFRS  K V+ILKVAVY GNVL L +SKPQGF+Y SG
Sbjct  538  YNKTTWMYLAVPMILYGCERILRAFRSGYKSVRILKVAVYPGNVLALHVSKPQGFKYTSG  597

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY++VNC+ +SPFEWHPFSITSAPGD+Y+SVHIRTLGDWT QLK +F++ CQP  + +SG
Sbjct  598  QYIYVNCSDISPFEWHPFSITSAPGDEYISVHIRTLGDWTSQLKGIFAKACQPANDDQSG  657

Query  479  LLRADCLQGQNN-PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRAD L  + + P  PR+ IDGPYGAPAQDYK YEV+LLVGLGIGATP+ISI+KD+++N
Sbjct  658  LLRADMLPAKPSLPRMPRLRIDGPYGAPAQDYKNYEVLLLVGLGIGATPLISILKDVLNN  717

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            +K  E+ EE  G I  G  NN    F T+RAYFYWVTREQGSF+WFKG+M+EVAE D++ 
Sbjct  718  IKQQEDLEE--GVIENGIKNNKKKPFATKRAYFYWVTREQGSFEWFKGVMNEVAENDKEG  775

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVS  6
            VIE+HNYCTSVYEEGDARSALI MLQS+H AK+GVD+VS
Sbjct  776  VIELHNYCTSVYEEGDARSALITMLQSIHHAKNGVDVVS  814



>gb|AFW64932.1| respiratory burst oxidase protein D variant beta [Zea mays]
Length=648

 Score =   411 bits (1056),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 197/272 (72%), Positives = 232/272 (85%), Gaps = 12/272 (4%)
 Frame = -1

Query  797  LYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQYMFVNCAAVSPFE  618
            LY  ERL RA RSS++PV+ILKVAVY GNVL+L  SKPQGFRYKSGQY+FVNCAAVSPF+
Sbjct  318  LYACERLTRALRSSVRPVRILKVAVYPGNVLSLHFSKPQGFRYKSGQYIFVNCAAVSPFQ  377

Query  617  WHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGLLRADCLQGQN---  447
            WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS VC+PP  GKSGLLRA+  +  +   
Sbjct  378  WHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSRVCRPPTEGKSGLLRAEYDRDGSAVA  437

Query  446  NPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMKAMENSEEEGG  267
            NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMISI+KDI++NM+ +     +GG
Sbjct  438  NPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMRQL-----DGG  492

Query  266  G----ITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHVIEMHNYC  99
            G         S++++ +F+TRRAYFYWVTREQGSF+WF+G+MDEVAE D K VIE+HNYC
Sbjct  493  GDLEASDASASSSSMASFRTRRAYFYWVTREQGSFEWFRGVMDEVAETDRKGVIELHNYC  552

Query  98   TSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            TSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  553  TSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  584



>ref|NP_001108123.1| LOC100136880 isoform 2 [Zea mays]
 gb|ABP48737.1| respiratory burst oxidase protein D variant beta [Zea mays]
Length=648

 Score =   411 bits (1056),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 197/272 (72%), Positives = 232/272 (85%), Gaps = 12/272 (4%)
 Frame = -1

Query  797  LYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQYMFVNCAAVSPFE  618
            LY  ERL RA RSS++PV+ILKVAVY GNVL+L  SKPQGFRYKSGQY+FVNCAAVSPF+
Sbjct  318  LYACERLTRALRSSVRPVRILKVAVYPGNVLSLHFSKPQGFRYKSGQYIFVNCAAVSPFQ  377

Query  617  WHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGLLRADCLQGQN---  447
            WHPFSITSAP DDY+SVHIRTLGDWTR+LK VFS VC+PP  GKSGLLRA+  +  +   
Sbjct  378  WHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSRVCRPPTEGKSGLLRAEYDRDGSAVA  437

Query  446  NPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMKAMENSEEEGG  267
            NP+FP+VLIDGPYGAPAQDYK+Y++VLLVGLGIGATPMISI+KDI++NM+ +     +GG
Sbjct  438  NPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMRQL-----DGG  492

Query  266  G----ITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHVIEMHNYC  99
            G         S++++ +F+TRRAYFYWVTREQGSF+WF+G+MDEVAE D K VIE+HNYC
Sbjct  493  GDLEASDASSSSSSMASFRTRRAYFYWVTREQGSFEWFRGVMDEVAETDRKGVIELHNYC  552

Query  98   TSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            TSVYEEGDARSALIAMLQSL+ AK GVD+VSG
Sbjct  553  TSVYEEGDARSALIAMLQSLNHAKHGVDVVSG  584



>emb|CDP15485.1| unnamed protein product [Coffea canephora]
Length=879

 Score =   418 bits (1074),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 194/279 (70%), Positives = 230/279 (82%), Gaps = 2/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LY  ERLIRAFRS  K V+I KVAVY GNV+ L M KPQGF+Y SG
Sbjct  539  YKKTTWMYLAVPMVLYAFERLIRAFRSGYKTVQISKVAVYPGNVMALYMYKPQGFKYTSG  598

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+ +SPF+WHPFSITSAPGDDYLS+HIRTLGDWT QLK VFS+VCQPP N KSG
Sbjct  599  QYIFVNCSDISPFQWHPFSITSAPGDDYLSIHIRTLGDWTSQLKAVFSKVCQPPTNDKSG  658

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L RAD     N P  PR+LIDGPYGAPAQDYKKY+++LLVGLGIGATP+ISIVKD+++N+
Sbjct  659  LRRADIAPEMNKPRLPRLLIDGPYGAPAQDYKKYDILLLVGLGIGATPLISIVKDVLNNI  718

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  +  EE  G    G  +     F  RRAYFYWVTR+QGSF+WF+G+M++VAE D++ +
Sbjct  719  KQQKEIEE--GLAENGLKDIKKKPFAARRAYFYWVTRDQGSFEWFRGVMNDVAEHDKEGL  776

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQ++  AKSG+DIVSG
Sbjct  777  IELHNYCTSVYEEGDARSALITMLQAIQHAKSGIDIVSG  815



>gb|EYU24552.1| hypothetical protein MIMGU_mgv1a001077mg [Erythranthe guttata]
Length=894

 Score =   417 bits (1072),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/290 (69%), Positives = 240/290 (83%), Gaps = 13/290 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P++LYGGERL+R+FRS  + V IL+V VY GNVL L MSKP GF+YKSG
Sbjct  543  YRKTTWMYLAVPMMLYGGERLVRSFRSRAQAVNILQVPVYPGNVLVLHMSKPHGFKYKSG  602

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FV CAAVSPFEWHPFSIT+AP D++LSVHIR +GDWTRQLKTVFS+VCQ PP  KS 
Sbjct  603  QYIFVKCAAVSPFEWHPFSITTAPDDNFLSVHIRIVGDWTRQLKTVFSKVCQQPPVDKSE  662

Query  479  LLRADCLQGQNNP-NFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
               A+ LQ  NNP  FPRVLIDGPYGAP QDYK Y+VVLLVGLGIGATPMIS+V+DI++N
Sbjct  663  --GANSLQEGNNPIFFPRVLIDGPYGAPTQDYKDYDVVLLVGLGIGATPMISVVRDIINN  720

Query  302  MKAMENSEE--EGG--------GITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIM  153
            ++++E  E   EGG           +  S+++ + F+TR+AYFYWVTREQGSFDWFK +M
Sbjct  721  IRSIEEEENSLEGGTRPPTPKQKTGSNSSSSHKHEFRTRKAYFYWVTREQGSFDWFKDVM  780

Query  152  DEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +E AEMD K VIEMHN+CTSVYE+GDARSALIAMLQS++LAK+G+D+VSG
Sbjct  781  NEAAEMDHKGVIEMHNHCTSVYEDGDARSALIAMLQSIYLAKNGLDVVSG  830



>ref|XP_009390376.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Musa 
acuminata subsp. malaccensis]
Length=909

 Score =   417 bits (1072),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/282 (71%), Positives = 233/282 (83%), Gaps = 8/282 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMY+AIP++LY  ERL +  RS I+ VKILKVAVY GNVL L +SKP GF Y+SG
Sbjct  569  YKRTTWMYVAIPVVLYASERLTKVMRSKIQVVKILKVAVYPGNVLALHVSKPPGFTYRSG  628

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+ VNCAAVSPF+WHPFSITSAP DDY+SVHIR+ GDWT QL  VFS+ CQP   GKSG
Sbjct  629  QYITVNCAAVSPFQWHPFSITSAPQDDYISVHIRSAGDWTSQLIEVFSKACQPSTAGKSG  688

Query  479  LLRADCLQGQNN---PNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIV  309
             LRAD   G ++   P+FPRVLIDGPYGAPAQDY+KYEVVLLVGL IGATP ISIVKDI+
Sbjct  689  RLRADINDGSDDGVSPSFPRVLIDGPYGAPAQDYEKYEVVLLVGLAIGATPFISIVKDIL  748

Query  308  SNMKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            +N+K  +   EEGGG   GRS+   N+F+TRRAYFYWVTREQ SF+WF+G+MDEVAE D 
Sbjct  749  NNIK--QRDVEEGGG---GRSSTEANSFRTRRAYFYWVTREQDSFEWFRGVMDEVAEADA  803

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            + VIE+HNYCTSVYEEGDAR+ALIAMLQSL+ AK GVD+V+G
Sbjct  804  QGVIELHNYCTSVYEEGDARAALIAMLQSLNYAKHGVDVVAG  845



>emb|CDY22644.1| BnaC08g42780D [Brassica napus]
Length=576

 Score =   405 bits (1042),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 230/279 (82%), Gaps = 8/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P +LY  ERLIR FRS  K V ILKVAVY GNVL+L MSKP+GF+Y+SG
Sbjct  242  YEKTTWMYLAVPTILYACERLIRLFRSGSKAVTILKVAVYPGNVLSLYMSKPKGFKYRSG  301

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY++VNC+ VSPF+WHPFSITSA GD++LS+HIRTLGDWT QLK +FS+VCQPP   +SG
Sbjct  302  QYIYVNCSDVSPFQWHPFSITSASGDEFLSIHIRTLGDWTSQLKCLFSKVCQPPSTSQSG  361

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L  AD +Q  N   FPR+LIDGPYGAPAQDY+ Y+V+LLVGLGIGATP+ISI+KD+++N+
Sbjct  362  LFTADLVQANNITRFPRLLIDGPYGAPAQDYRNYDVLLLVGLGIGATPLISILKDVLNNI  421

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K    S EEG       +++NVN   T+RAYFYWVTREQGS +WF  +M+EVAE D + +
Sbjct  422  KN-HKSIEEG-------TSHNVNRSNTKRAYFYWVTREQGSLEWFSEVMNEVAEYDSEGI  473

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AK+G+DIVSG
Sbjct  474  IELHNYCTSVYEEGDARSALITMLQSLHHAKNGIDIVSG  512



>gb|EYU26891.1| hypothetical protein MIMGU_mgv1a001109mg [Erythranthe guttata]
Length=887

 Score =   415 bits (1066),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 194/282 (69%), Positives = 233/282 (83%), Gaps = 3/282 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LY  ERLIRAFRS  K V+ILKV+VY GNV++L MSKPQGF+Y SG
Sbjct  542  YKKTTWMYLAVPMILYASERLIRAFRSGHKTVQILKVSVYPGNVMSLHMSKPQGFKYTSG  601

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC  VSPF+WHPFSITSAPGDDYLS+HIRT GDWT QLK +FS+VC  P NG+SG
Sbjct  602  QYIFVNCPEVSPFQWHPFSITSAPGDDYLSIHIRTRGDWTSQLKAIFSKVCHTPDNGQSG  661

Query  479  LLRADCLQ-GQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
            LLRAD      N    P++LIDGPYGAPAQDYKKY++VLL+GLGIGATP+ISIVKD+++N
Sbjct  662  LLRADIGPISSNKLRLPKLLIDGPYGAPAQDYKKYDIVLLIGLGIGATPLISIVKDVLNN  721

Query  302  MKAMENSEEEGGGITTGRSNN--NVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            +K  ++ E+    +     ++    +NF TRRAYFYWVTREQGSF+WF+G+M+EVAE D 
Sbjct  722  IKQQKDIEKGSPLLENNIKSDKKKTSNFATRRAYFYWVTREQGSFEWFRGVMNEVAENDH  781

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
              VIE+HN+CTSVYEEGDARSALIAMLQSL  AK+G+DIVSG
Sbjct  782  DSVIELHNHCTSVYEEGDARSALIAMLQSLEHAKTGLDIVSG  823



>ref|XP_009402525.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Musa 
acuminata subsp. malaccensis]
Length=891

 Score =   412 bits (1060),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 229/279 (82%), Gaps = 3/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKT WMYLAIP+ LY  ERL+RAFRS  K V+I KVAVY GNVL L+MSKPQGF+Y+SG
Sbjct  552  YKKTAWMYLAIPVTLYACERLLRAFRSGHKTVRIQKVAVYPGNVLALRMSKPQGFKYRSG  611

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+F+NCAAVSPFEWHPFSITSAPGDDYLS+HIRT GDWT QL+ +FS+VCQP  + +SG
Sbjct  612  QYIFLNCAAVSPFEWHPFSITSAPGDDYLSIHIRTRGDWTSQLRAIFSQVCQPAKSDQSG  671

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD + G NNP  P++LIDGPYGAPAQDY+ Y+V+LL+GLGIGATP+ISIVKD+++N 
Sbjct  672  LLRADVMPGGNNPRLPKLLIDGPYGAPAQDYEHYDVLLLIGLGIGATPLISIVKDVLNN-  730

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
              +E  +          +      F  +RAYFYWVTRE+GSF+WF+GIM+EVAE D+  V
Sbjct  731  --VEQKKTTAAADVESATKAKKKPFMAQRAYFYWVTREEGSFEWFRGIMNEVAEKDKDGV  788

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HN+CTSVYEEGDARSALI MLQ+LH AK+GVDIVSG
Sbjct  789  IELHNHCTSVYEEGDARSALIVMLQALHHAKNGVDIVSG  827



>ref|XP_010112007.1| Respiratory burst oxidase-like protein D [Morus notabilis]
 gb|EXC32352.1| Respiratory burst oxidase-like protein D [Morus notabilis]
Length=924

 Score =   413 bits (1061),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 202/281 (72%), Positives = 227/281 (81%), Gaps = 37/281 (13%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+ LY GERLIRAFRSSIKPV ILKVAVY GNVL L M+KPQGF+YKSG
Sbjct  615  YQKTTWMYLAVPICLYAGERLIRAFRSSIKPVNILKVAVYPGNVLALHMTKPQGFKYKSG  674

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMF+NCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSE           
Sbjct  675  QYMFLNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSE-----------  723

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
                             +LIDGPYGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI+ N+
Sbjct  724  -----------------ILIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISIMKDIIGNI  766

Query  299  KAMENSEEEGGGITTGRSNNNV--NNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEK  126
            K  E S          +SNN +  + F+TR+AY+YWVTREQGSF+WF+GI++EVAE+DEK
Sbjct  767  KMEEES-------IIVKSNNRLSASGFRTRKAYYYWVTREQGSFEWFRGILNEVAEIDEK  819

Query  125  HVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             VIE+HNYCTSVYEEGDARSALIAMLQSLH AK+GVD+VSG
Sbjct  820  GVIELHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDVVSG  860



>gb|ABG35769.1| NOX2 [Striga asiatica]
Length=528

 Score =   401 bits (1030),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 193/290 (67%), Positives = 231/290 (80%), Gaps = 15/290 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P++LY GER++R FRS    V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  179  YKKTTWMYLAVPVILYAGERILRFFRSGFNSVRLLKVAIYPGNVLTLQMSKPPQFRYKSG  238

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAP DDYLS+HIR LGDWT +LK VFS  C+PP  GKSG
Sbjct  239  QYMFVQCPAVSPFEWHPFSITSAPDDDYLSIHIRQLGDWTHELKRVFSLACEPPVAGKSG  298

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDY+KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  299  LLRAD---ENTKKSLPKLLIDGPYGAPAQDYRKYDVLLLVGLGIGATPFISILKDLLNNI  355

Query  299  KAMENSEEEGGGITTGRSNNNVNNF-----------KTRRAYFYWVTREQGSFDWFKGIM  153
              ME   +    I+   S+ +V++F           +T  AYFYWVTREQGSFDWFKG+M
Sbjct  356  VKMEEQADSTSDISRN-SDQSVSSFDSSNTKRRKTLRTTNAYFYWVTREQGSFDWFKGVM  414

Query  152  DEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +EVAE+D++ VIEMHNY TSVYEEGDARSALI M+Q+L+ AK+GVDIVSG
Sbjct  415  NEVAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSG  464



>ref|XP_006283129.1| hypothetical protein CARUB_v10004156mg [Capsella rubella]
 gb|EOA16027.1| hypothetical protein CARUB_v10004156mg [Capsella rubella]
Length=813

 Score =   409 bits (1051),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/280 (70%), Positives = 231/280 (83%), Gaps = 9/280 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+PL LY GERLIRAFRSSI+ V+++K AVY GNVLTL MS+P  F+Y+SG
Sbjct  478  YKKTTWMYLAVPLALYTGERLIRAFRSSIETVEVVKAAVYPGNVLTLHMSRPTNFKYQSG  537

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMF+NC AVS FEWHPFSITSAP +DYLSVHI++LGDWT+ +K VFSEV +  P G   
Sbjct  538  QYMFINCPAVSSFEWHPFSITSAPQEDYLSVHIKSLGDWTKAIKGVFSEVSKLTPVG---  594

Query  479  LLRADCLQGQN-NPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
                D L G+N NPNFPRV+IDGPYGAPAQDYKKYEVVLLVGLGIGATPMISI+KDI++N
Sbjct  595  ----DMLHGENINPNFPRVMIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIIKDIINN  650

Query  302  MKAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            M+A E+++    G    +    +  F+TR+AYFYWVTREQGS+DWFK IM+E+AE D+  
Sbjct  651  MEAKEHAQLNQPG-KNSQHGKIIETFRTRKAYFYWVTREQGSYDWFKNIMNEIAERDKSK  709

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +IE+HNYCTSVYEEGD RSALI MLQSL+ AKSG+DIVSG
Sbjct  710  IIELHNYCTSVYEEGDVRSALIHMLQSLNHAKSGLDIVSG  749



>ref|XP_009611315.1| PREDICTED: respiratory burst oxidase homolog protein B [Nicotiana 
tomentosiformis]
Length=866

 Score =   410 bits (1055),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 234/279 (84%), Gaps = 5/279 (2%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMY+A+P++LY  ERL+RAFRS  K V+ILKVAVY GNV+ + MSKP GF+Y SG
Sbjct  529  YKKTTWMYIAVPMILYACERLLRAFRSGYKAVRILKVAVYPGNVMAVHMSKPLGFKYTSG  588

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+ VS F+WHPF+I+SAPGDDYLS+HIRT+GDWT QLK +FS+VC+PP   +SG
Sbjct  589  QYIFVNCSDVSSFQWHPFTISSAPGDDYLSMHIRTVGDWTSQLKILFSKVCEPPTGDQSG  648

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD  +    P  P++LIDGPYGAPAQDYKKY+VVLLVGLGIGATP+ISIVKD+++N+
Sbjct  649  LLRADIAKADYKPRLPKLLIDGPYGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNI  708

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ E+  G I +G      + F T+RAYFYWVTREQGSF+WFKG+MDEV++ D++ +
Sbjct  709  KQQKDLED--GLIESGTKK---SPFATKRAYFYWVTREQGSFEWFKGVMDEVSQNDQEGL  763

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQS+  AKSGVDIVSG
Sbjct  764  IELHNYCTSVYEEGDARSALITMLQSIQQAKSGVDIVSG  802



>ref|XP_008800853.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Phoenix 
dactylifera]
Length=880

 Score =   410 bits (1053),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 190/281 (68%), Positives = 234/281 (83%), Gaps = 9/281 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL IP++LY  ERL+RA RS  + V++ KVAVY GNVL LQMSKP GF+Y+SG
Sbjct  543  YKKTTWMYLVIPVMLYLCERLLRALRSGYRTVRVQKVAVYPGNVLALQMSKPHGFKYRSG  602

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAPGDDYLS+HIRT GDWT +L+ +FSEVC+PP  G+SG
Sbjct  603  QYIFVNCAAVSPFQWHPFSITSAPGDDYLSMHIRTKGDWTSRLRNIFSEVCRPPKTGQSG  662

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +  ++NP FP++ IDGPYGAPAQDY+ Y+V+LL+GLGIGATP+ISI+KD+++N+
Sbjct  663  LLRADLMAEESNPKFPKLRIDGPYGAPAQDYRNYDVLLLIGLGIGATPLISILKDVLNNI  722

Query  299  K--AMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEK  126
            K   +   + EGG       N     F T+RAYFYWVTRE+GSF+WF+G+M+EVAE D+ 
Sbjct  723  KQNGVVAGDVEGG-------NKLKKAFMTQRAYFYWVTREEGSFEWFRGVMNEVAEKDKD  775

Query  125  HVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             VIE+HN+CTSVYEEGDARSALI MLQ+LH AK+GVDIVSG
Sbjct  776  GVIELHNHCTSVYEEGDARSALIVMLQALHHAKNGVDIVSG  816



>ref|XP_008366996.1| PREDICTED: respiratory burst oxidase homolog protein A-like, 
partial [Malus domestica]
Length=484

 Score =   397 bits (1021),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 197/296 (67%), Positives = 230/296 (78%), Gaps = 22/296 (7%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYL +P+LLY GER++R FRS    V++LKVA+Y GNVLTLQMSKPQ F+YKSG
Sbjct  130  YLKTTWMYLCVPVLLYAGERILRIFRSGSYIVRLLKVAIYPGNVLTLQMSKPQQFKYKSG  189

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLSVHIR LGDWT++LK VFSE C+PP  GKSG
Sbjct  190  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSVHIRQLGDWTQELKRVFSEACEPPLAGKSG  249

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDY+KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  250  LLRAD---ETTKTSLPKLLIDGPYGAPAQDYRKYDVLLLVGLGIGATPFISILKDLLNNI  306

Query  299  KAME-----------NSEEEGGGITTGRSNNN------VNNFKTRRAYFYWVTREQGSFD  171
              ME            S+   G I  G  N+N          KT  AYFYWVTREQGSFD
Sbjct  307  VKMEEQADSVSDFSRTSDLSSGSI--GSPNHNKVYPKRKKPLKTTNAYFYWVTREQGSFD  364

Query  170  WFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            WFKG+M+EVAE+D++ VIEMHNY TSVYEEGDARS LI M+Q+L+ AK+GVDIVSG
Sbjct  365  WFKGVMNEVAELDQRGVIEMHNYLTSVYEEGDARSTLITMVQALNHAKNGVDIVSG  420



>ref|XP_010549734.1| PREDICTED: respiratory burst oxidase homolog protein B [Tarenaya 
hassleriana]
Length=899

 Score =   410 bits (1054),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 228/279 (82%), Gaps = 4/279 (1%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLAIP+LLY  ERLIRAFRS  K VKILKVAVY GNVL+L MSKP+GF+Y SG
Sbjct  561  YKKTTWMYLAIPMLLYACERLIRAFRSGYKTVKILKVAVYPGNVLSLHMSKPKGFKYTSG  620

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNC+ VSPF+WHPFSITSAPGDDY+S+HIRTLGDWT QL+ VF +VC+ P   +S 
Sbjct  621  QYIFVNCSDVSPFQWHPFSITSAPGDDYISIHIRTLGDWTSQLRDVFFKVCRSPSADESE  680

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
             +  D  Q +N P  P++LIDGPYGAPAQDY+ Y+V+LLVGLGIGATP+ISI+KD+++N+
Sbjct  681  FVGTDITQARNIPRLPKLLIDGPYGAPAQDYRNYDVLLLVGLGIGATPLISIIKDVINNI  740

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  + S E+G G       N   +F T+R YFYWVTREQGSF+WF+ +M+EVAE D   +
Sbjct  741  KT-QKSIEDGSG---NDHKNAKKHFATKRVYFYWVTREQGSFEWFREVMNEVAEYDTDRI  796

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AK+GVDIVSG
Sbjct  797  IELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSG  835



>ref|NP_001190250.1| Respiratory burst oxidase-A [Arabidopsis thaliana]
 gb|AED91152.1| Respiratory burst oxidase-A [Arabidopsis thaliana]
Length=840

 Score =   409 bits (1050),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 229/289 (79%), Gaps = 14/289 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL +P++LY  ERLIRAFRSS++ V +LKVAV  GNVL+L +S+P  FRYKSG
Sbjct  522  YKKTTWMYLMVPVVLYLCERLIRAFRSSVEAVSVLKVAVLPGNVLSLHLSRPSNFRYKSG  581

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYM++NC+AVS  EWHPFSITSAPGDDYLSVHIR LGDWT+QL+++FSEVC+P P  +  
Sbjct  582  QYMYLNCSAVSTLEWHPFSITSAPGDDYLSVHIRVLGDWTKQLRSLFSEVCKPRPPDEHR  641

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L RAD       P+FPR+LIDGPYGAPAQDYKK+EVVLLVGLGIGATPMISIV DI++N+
Sbjct  642  LNRADSKHWDYIPDFPRILIDGPYGAPAQDYKKFEVVLLVGLGIGATPMISIVSDIINNL  701

Query  299  KAMENSEEEGGGITTGRSNNNVN----------NFKTRRAYFYWVTREQGSFDWFKGIMD  150
            K +    EEG        +N V            F+T+RAYFYWVTREQGSFDWFK +MD
Sbjct  702  KGV----EEGSNRRQSPIHNMVTPPVSPSRKSETFRTKRAYFYWVTREQGSFDWFKNVMD  757

Query  149  EVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            EV E D K+VIE+HNYCTSVYEEGDARSALI MLQSL+ AK GVD+VSG
Sbjct  758  EVTETDRKNVIELHNYCTSVYEEGDARSALITMLQSLNHAKHGVDVVSG  806



>ref|XP_010931626.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Elaeis 
guineensis]
Length=885

 Score =   409 bits (1051),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/281 (67%), Positives = 234/281 (83%), Gaps = 9/281 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYL IP++LY  ERL+RA RS  + V++ KVAVY GNVL LQMSKP GF+Y+SG
Sbjct  548  YKRTTWMYLVIPVMLYVCERLLRALRSGYRTVRVQKVAVYPGNVLALQMSKPHGFKYRSG  607

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+FVNCAAVSPF+WHPFSITSAPGDDYLS+HIRT GDWT +L+ +FSEVC+PP  G+SG
Sbjct  608  QYIFVNCAAVSPFQWHPFSITSAPGDDYLSIHIRTKGDWTSRLRDIFSEVCRPPTAGQSG  667

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD +  +++P FP++ IDGPYGAPAQDY+KY+V+LL+GLGIGATP+ISI+KD+++N+
Sbjct  668  LLRADLMARESDPKFPKLRIDGPYGAPAQDYRKYDVLLLIGLGIGATPLISILKDVLNNI  727

Query  299  K--AMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEK  126
            K       + EGG       N     F T+RAYFYWVTRE+GSF+WF+G+M+EVAE D+ 
Sbjct  728  KQNGAVAGDVEGG-------NKPKKAFMTQRAYFYWVTREEGSFEWFRGVMNEVAEKDKD  780

Query  125  HVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             VIE+HN+CTSVYEEGDARSALI MLQ+LH AK+GVDIVSG
Sbjct  781  GVIELHNHCTSVYEEGDARSALIVMLQALHHAKNGVDIVSG  821



>gb|EMT31127.1| Respiratory burst oxidase-F-like protein [Aegilops tauschii]
Length=726

 Score =   404 bits (1038),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 195/294 (66%), Positives = 231/294 (79%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYLA+P+ LY GER +R FRS    V+ILKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  372  YKRTTWMYLAVPVGLYVGERTLRFFRSGSYSVRILKVAIYPGNVLTLQMSKPPTFRYKSG  431

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDD+LS+H+R LGDWTR+LK VFS  C+PP NGKSG
Sbjct  432  QYMFVQCPAVSPFEWHPFSITSAPGDDFLSIHVRQLGDWTRELKRVFSAACEPPMNGKSG  491

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD         FP++LIDGPYG+PAQDY KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  492  LLRAD---ENTKKTFPKLLIDGPYGSPAQDYSKYDVLLLVGLGIGATPFISILKDLINNI  548

Query  299  KAMENSEEEGGGI--TTGRSNNNVN-------------NFKTRRAYFYWVTREQGSFDWF  165
              ME  +E    +    G S  +V+              FKT  AYFYWVTREQGSFDWF
Sbjct  549  IKMEEEDEASTDLYPPIGPSKASVDLDTLMRITSKPKRVFKTTNAYFYWVTREQGSFDWF  608

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KGIM+E+AE+D++++IEMHNY TSVYEEGDARSALI MLQ+L+ AK+GVD+VSG
Sbjct  609  KGIMNEIAELDQRNIIEMHNYLTSVYEEGDARSALITMLQALNHAKNGVDVVSG  662



>gb|AAB70398.1| Strong similarity to Oryza NADPH oxidase (gb|X93301) [Arabidopsis 
thaliana]
Length=578

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/280 (68%), Positives = 229/280 (82%), Gaps = 9/280 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P+LLY  ERLIRAFR   K VK+LKVAVY GNVL+L MSKP+GF+Y SG
Sbjct  243  YHKTTWMYLAVPVLLYAFERLIRAFRPGAKAVKVLKVAVYPGNVLSLYMSKPKGFKYTSG  302

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY+++NC+ VSP +WHPFSITSA GDDYLSVHIRTLGDWT QLK+++S+VCQ P   +SG
Sbjct  303  QYIYINCSDVSPLQWHPFSITSASGDDYLSVHIRTLGDWTSQLKSLYSKVCQLPSTSQSG  362

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L  AD  Q  N   FPR+LIDGPYGAPAQDY+ Y+V+LLVGLGIGATP+ISI++D+++N+
Sbjct  363  LFIADIGQANNITRFPRLLIDGPYGAPAQDYRNYDVLLLVGLGIGATPLISIIRDVLNNI  422

Query  299  KAMENSEEEGGGITTGRSNNNVNNF-KTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            K  +NS E G       +N ++ N+  T+RAYFYWVTREQGS +WF  +M+EVAE D + 
Sbjct  423  KN-QNSIERG-------TNQHIKNYVATKRAYFYWVTREQGSLEWFSEVMNEVAEYDSEG  474

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +IE+HNYCTSVYEEGDARSALI MLQSLH AKSG+DIVSG
Sbjct  475  MIELHNYCTSVYEEGDARSALITMLQSLHHAKSGIDIVSG  514



>gb|AAC39475.1| respiratory burst oxidase protein A [Arabidopsis thaliana]
Length=902

 Score =   408 bits (1049),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 229/289 (79%), Gaps = 14/289 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL +P++LY  ERLIRAFRSS++ V +LKVAV  GNVL+L +S+P  FRYKSG
Sbjct  554  YKKTTWMYLMVPVVLYLCERLIRAFRSSVEAVSVLKVAVLPGNVLSLHLSRPSNFRYKSG  613

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYM++NC+AVS  EWHPFSITSAPGDDYLSVHIR LGDWT+QL+++FSEVC+P P  +  
Sbjct  614  QYMYLNCSAVSTLEWHPFSITSAPGDDYLSVHIRVLGDWTKQLRSLFSEVCKPRPPDEHR  673

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L RAD       P+FPR+LIDGPYGAPAQDYKK+EVVLLVGLGIGATPMISIV DI++N+
Sbjct  674  LNRADSKHWDYIPDFPRILIDGPYGAPAQDYKKFEVVLLVGLGIGATPMISIVSDIINNL  733

Query  299  KAMENSEEEGGGITTGRSNNNVN----------NFKTRRAYFYWVTREQGSFDWFKGIMD  150
            K +    EEG        +N V            F+T+RAYFYWVTREQGSFDWFK +MD
Sbjct  734  KGV----EEGSNRRQSPIHNMVTPPVSPSRKSETFRTKRAYFYWVTREQGSFDWFKNVMD  789

Query  149  EVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            EV E D K+VIE+HNYCTSVYEEGDARSALI MLQSL+ AK GVD+VSG
Sbjct  790  EVTETDRKNVIELHNYCTSVYEEGDARSALITMLQSLNHAKHGVDVVSG  838



>ref|XP_006654681.1| PREDICTED: respiratory burst oxidase homolog protein A-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006654682.1| PREDICTED: respiratory burst oxidase homolog protein A-like isoform 
X2 [Oryza brachyantha]
Length=718

 Score =   403 bits (1036),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 231/294 (79%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYLA+P+ LY GER +R FRS    V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  364  YKRTTWMYLAVPVGLYVGERTLRFFRSGSYSVRLLKVAIYPGNVLTLQMSKPPTFRYKSG  423

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLS+H+R LGDWTR+LK VFS  C+PP  GKSG
Sbjct  424  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSIHVRQLGDWTRELKRVFSAACEPPVGGKSG  483

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD          P++LIDGPYG+PAQDY KY+V+LLVGLGIGATP ISI+KD+++++
Sbjct  484  LLRAD---ETTKKALPKLLIDGPYGSPAQDYSKYDVLLLVGLGIGATPFISILKDLINSI  540

Query  299  KAMENSEEEGGGI--TTGRSNNNVN-------------NFKTRRAYFYWVTREQGSFDWF  165
              ME  EE  G +    GR+  +V+              FKT  AYFYWVTREQGSFDWF
Sbjct  541  IKMEEEEEASGDLYPPIGRNKAHVDLDTLMRITSKPKRVFKTTNAYFYWVTREQGSFDWF  600

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KG+M+E+AE+D++++IEMHNY TSVYEEGDARSALI MLQ+L+ AK+GVDIVSG
Sbjct  601  KGVMNEIAELDQRNIIEMHNYLTSVYEEGDARSALITMLQALNHAKNGVDIVSG  654



>gb|EYU23415.1| hypothetical protein MIMGU_mgv1a0020022mg, partial [Erythranthe 
guttata]
Length=480

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/295 (65%), Positives = 230/295 (78%), Gaps = 20/295 (7%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK TTWMY+AIP+LLY GER++R FRS    V++LKVA+Y GNVL+LQMSKP  F+YKSG
Sbjct  126  YKMTTWMYIAIPVLLYAGERILRYFRSGFHSVRLLKVAIYPGNVLSLQMSKPPQFKYKSG  185

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAP DDYLS+HIR LGDWT +LK VFSE C+PP +GKSG
Sbjct  186  QYMFVQCPAVSPFEWHPFSITSAPDDDYLSIHIRQLGDWTHELKRVFSEACEPPVSGKSG  245

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDY+KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  246  LLRAD---ENTKKSLPKLLIDGPYGAPAQDYRKYDVLLLVGLGIGATPFISILKDLLNNI  302

Query  299  KAMENSEEEGGGITTGRSNNNVNNF----------------KTRRAYFYWVTREQGSFDW  168
              ME   +     +   S+ +V +F                +T  AYFYWVTREQGSFDW
Sbjct  303  LKMEEQADSLSDFSR-YSDQSVGSFDSPALNKASPKRKKALRTTNAYFYWVTREQGSFDW  361

Query  167  FKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            FKG+M+EVAE+D++ VIEMHNY TSVYEEGDARSALI M+Q+L+ AK+GVDIVSG
Sbjct  362  FKGVMNEVAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSG  416



>ref|NP_196356.1| Respiratory burst oxidase-A [Arabidopsis thaliana]
 sp|O81209.2|RBOHA_ARATH RecName: Full=Respiratory burst oxidase homolog protein A; AltName: 
Full=NADPH oxidase RBOHA; Short=AtRBOHA [Arabidopsis 
thaliana]
 emb|CAB87928.1| respiratory burst oxidase protein A [Arabidopsis thaliana]
 gb|AAO41907.1| putative respiratory burst oxidase protein A [Arabidopsis thaliana]
 gb|AED91151.1| Respiratory burst oxidase-A [Arabidopsis thaliana]
Length=902

 Score =   408 bits (1049),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 229/289 (79%), Gaps = 14/289 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL +P++LY  ERLIRAFRSS++ V +LKVAV  GNVL+L +S+P  FRYKSG
Sbjct  554  YKKTTWMYLMVPVVLYLCERLIRAFRSSVEAVSVLKVAVLPGNVLSLHLSRPSNFRYKSG  613

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYM++NC+AVS  EWHPFSITSAPGDDYLSVHIR LGDWT+QL+++FSEVC+P P  +  
Sbjct  614  QYMYLNCSAVSTLEWHPFSITSAPGDDYLSVHIRVLGDWTKQLRSLFSEVCKPRPPDEHR  673

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L RAD       P+FPR+LIDGPYGAPAQDYKK+EVVLLVGLGIGATPMISIV DI++N+
Sbjct  674  LNRADSKHWDYIPDFPRILIDGPYGAPAQDYKKFEVVLLVGLGIGATPMISIVSDIINNL  733

Query  299  KAMENSEEEGGGITTGRSNNNVN----------NFKTRRAYFYWVTREQGSFDWFKGIMD  150
            K +    EEG        +N V            F+T+RAYFYWVTREQGSFDWFK +MD
Sbjct  734  KGV----EEGSNRRQSPIHNMVTPPVSPSRKSETFRTKRAYFYWVTREQGSFDWFKNVMD  789

Query  149  EVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            EV E D K+VIE+HNYCTSVYEEGDARSALI MLQSL+ AK GVD+VSG
Sbjct  790  EVTETDRKNVIELHNYCTSVYEEGDARSALITMLQSLNHAKHGVDVVSG  838



>gb|ACB56488.1| respiratory burst oxidase-like protein F2, partial [Hordeum vulgare 
subsp. vulgare]
Length=756

 Score =   404 bits (1037),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 195/294 (66%), Positives = 231/294 (79%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYLA+P+ LY GER +R FRS    V+ILKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  402  YKRTTWMYLAVPVGLYVGERTLRFFRSGSYSVRILKVAIYPGNVLTLQMSKPPTFRYKSG  461

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDD+LS+H+R LGDWTR+LK VFS  C+PP NGKSG
Sbjct  462  QYMFVQCPAVSPFEWHPFSITSAPGDDFLSIHVRQLGDWTRELKRVFSAACEPPMNGKSG  521

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD         FP++LIDGPYG+PAQDY KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  522  LLRAD---ENTKKTFPKLLIDGPYGSPAQDYSKYDVLLLVGLGIGATPFISILKDLINNI  578

Query  299  KAMENSEEEGGGI--TTGRSNNNVN-------------NFKTRRAYFYWVTREQGSFDWF  165
              ME  +E    +    G S  +V+              FKT  AYFYWVTREQGSFDWF
Sbjct  579  IKMEEEDEASTDLYPPIGPSKASVDLDTLMRITSKPKRVFKTTNAYFYWVTREQGSFDWF  638

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KGIM+E+AE+D++++IEMHNY TSVYEEGDARSALI MLQ+L+ AK+GVD+VSG
Sbjct  639  KGIMNEIAELDQRNIIEMHNYLTSVYEEGDARSALITMLQALNHAKNGVDVVSG  692



>ref|NP_194239.2| riboflavin synthase-like superfamily protein [Arabidopsis thaliana]
 sp|Q9SW17.2|RBOHG_ARATH RecName: Full=Putative respiratory burst oxidase homolog protein 
G; AltName: Full=NADPH oxidase RBOHG; Short=AtRBOHG [Arabidopsis 
thaliana]
 gb|AEE85005.1| riboflavin synthase-like superfamily protein [Arabidopsis thaliana]
Length=849

 Score =   406 bits (1044),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 193/280 (69%), Positives = 225/280 (80%), Gaps = 10/280 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY  ERLIRAFRSSI+ VK+LK+A Y G VLTLQMSKP  F+Y SG
Sbjct  515  YKKTTWMYLAVPVALYAYERLIRAFRSSIRTVKVLKMAAYPGKVLTLQMSKPTNFKYMSG  574

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITS P DDYLSVHI+ LGDWT  ++ VFSEV +PPP G   
Sbjct  575  QYMFVNCPAVSPFEWHPFSITSTPQDDYLSVHIKALGDWTEAIQGVFSEVSKPPPVG---  631

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
                D L G N+P FP+++IDGPYGAPAQDYKKYEVVLL+GLGIGATPMISI+KDI++N 
Sbjct  632  ----DMLNGANSPRFPKIMIDGPYGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNT  687

Query  299  KAMEN-SEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            +  E  S+ E G  +      N   FKTRRAYFYWVT+EQG+FDWFK IM+E+AE D+  
Sbjct  688  ETKEQLSQMEKG--SPQEQQGNKETFKTRRAYFYWVTKEQGTFDWFKNIMNEIAERDKSK  745

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+HN+CTSVYEEGD RSALI MLQSL+ AK+G+DIV+G
Sbjct  746  VIELHNHCTSVYEEGDVRSALIRMLQSLNYAKNGLDIVAG  785



>ref|XP_010475733.1| PREDICTED: respiratory burst oxidase homolog protein B [Camelina 
sativa]
Length=844

 Score =   406 bits (1043),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 192/282 (68%), Positives = 229/282 (81%), Gaps = 10/282 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P+LLY  ERLIRAFR   K VKILKVAVY GNVL+L MSKP+GF+Y SG
Sbjct  506  YHKTTWMYLAVPVLLYASERLIRAFRPGAKAVKILKVAVYPGNVLSLYMSKPKGFKYTSG  565

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY++VNC+ VSP +WHPFSITSA GDDYLS+HIRTLGDWT QLK++FS+VCQ P   +SG
Sbjct  566  QYIYVNCSDVSPLQWHPFSITSASGDDYLSIHIRTLGDWTSQLKSLFSKVCQLPSTSQSG  625

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L  AD  Q  N   FPR+LIDGPYGAPAQDY+ Y+V+LLVGLGIGATP+ISI++D+++N+
Sbjct  626  LFIADIGQANNITRFPRLLIDGPYGAPAQDYRNYDVLLLVGLGIGATPLISIIRDVLNNI  685

Query  299  KAMENSEEEGGGITTGRSNNNV---NNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDE  129
            K  ++ E+       G SN+NV   N   T+RAYFYWVTREQGS +WF  +M+EVAE D 
Sbjct  686  KNQKSIEQ-------GTSNHNVPIKNYVATKRAYFYWVTREQGSLEWFSEVMNEVAEYDS  738

Query  128  KHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            + +IE+HNYCTSVYEEGDARSALI MLQSLH AKSG+DIVSG
Sbjct  739  EGMIELHNYCTSVYEEGDARSALITMLQSLHHAKSGIDIVSG  780



>ref|NP_001190833.1| riboflavin synthase-like superfamily protein [Arabidopsis thaliana]
 gb|AEE85006.1| riboflavin synthase-like superfamily protein [Arabidopsis thaliana]
Length=837

 Score =   405 bits (1042),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 193/280 (69%), Positives = 225/280 (80%), Gaps = 10/280 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY  ERLIRAFRSSI+ VK+LK+A Y G VLTLQMSKP  F+Y SG
Sbjct  503  YKKTTWMYLAVPVALYAYERLIRAFRSSIRTVKVLKMAAYPGKVLTLQMSKPTNFKYMSG  562

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITS P DDYLSVHI+ LGDWT  ++ VFSEV +PPP G   
Sbjct  563  QYMFVNCPAVSPFEWHPFSITSTPQDDYLSVHIKALGDWTEAIQGVFSEVSKPPPVG---  619

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
                D L G N+P FP+++IDGPYGAPAQDYKKYEVVLL+GLGIGATPMISI+KDI++N 
Sbjct  620  ----DMLNGANSPRFPKIMIDGPYGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNT  675

Query  299  KAMEN-SEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            +  E  S+ E G  +      N   FKTRRAYFYWVT+EQG+FDWFK IM+E+AE D+  
Sbjct  676  ETKEQLSQMEKG--SPQEQQGNKETFKTRRAYFYWVTKEQGTFDWFKNIMNEIAERDKSK  733

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+HN+CTSVYEEGD RSALI MLQSL+ AK+G+DIV+G
Sbjct  734  VIELHNHCTSVYEEGDVRSALIRMLQSLNYAKNGLDIVAG  773



>ref|XP_002867627.1| hypothetical protein ARALYDRAFT_492327 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43886.1| hypothetical protein ARALYDRAFT_492327 [Arabidopsis lyrata subsp. 
lyrata]
Length=860

 Score =   406 bits (1044),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 192/280 (69%), Positives = 226/280 (81%), Gaps = 10/280 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY  ERLIRAFRSSI+ VK+LKVA Y G VLTLQMSKP  F+YKSG
Sbjct  526  YKKTTWMYLAVPVALYAYERLIRAFRSSIRTVKVLKVAAYPGKVLTLQMSKPTNFKYKSG  585

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITS P +DYLSVHI++LGDWT  ++ VFSEV +PPP G   
Sbjct  586  QYMFVNCPAVSPFEWHPFSITSTPQEDYLSVHIKSLGDWTEAIQGVFSEVSKPPPVG---  642

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
                D L G N+P FP+++IDGPYGAPAQDYKKYEVVLL+GLGIGATPMISI+KDI++N 
Sbjct  643  ----DMLHGANSPGFPKIMIDGPYGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNT  698

Query  299  KAMEN-SEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            +  E  S+ E G     +       FKTRRAYFYWVT+EQG+FDWFK +M+E+AE D+  
Sbjct  699  ETKEQLSQMEKGAPQEQQVKK--ETFKTRRAYFYWVTKEQGTFDWFKNVMNEIAERDKSK  756

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+HN+CTSVYEEGD RSALI MLQSL+ AK+G+DIV+G
Sbjct  757  VIELHNHCTSVYEEGDVRSALIRMLQSLNYAKNGLDIVAG  796



>ref|XP_009784877.1| PREDICTED: respiratory burst oxidase homolog protein A [Nicotiana 
sylvestris]
Length=627

 Score =   399 bits (1024),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/296 (65%), Positives = 229/296 (77%), Gaps = 21/296 (7%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P+LLY GER +R FRS +  V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  272  YSKTTWMYLAVPVLLYAGERTLRFFRSGLYTVRLLKVAIYPGNVLTLQMSKPPQFRYKSG  331

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLS+HIR LGDWT++LK VFSE C+ P  GKSG
Sbjct  332  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSIHIRQLGDWTQELKRVFSEACERPEAGKSG  391

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDY+KY+V+LLVGLGIGATP ISI+KD++ N+
Sbjct  392  LLRAD---ENTKKSLPKLLIDGPYGAPAQDYRKYDVLLLVGLGIGATPFISILKDLLVNI  448

Query  299  KAMENSEEEGGGITTGRSNNNV-----------------NNFKTRRAYFYWVTREQGSFD  171
              ME   +      +G S+ +V                 +  +T  AYFYWVTREQGSFD
Sbjct  449  VKMEEQADLASDF-SGNSDMSVATSEQPALNKISLKRRKSTLRTTNAYFYWVTREQGSFD  507

Query  170  WFKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            WFKG+M+EVAE+D++ VIEMHNY TSVYEEGDARSALI M+Q+L+ AK+GVDIVSG
Sbjct  508  WFKGVMNEVAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSG  563



>ref|XP_009112796.1| PREDICTED: respiratory burst oxidase homolog protein F [Brassica 
rapa]
Length=948

 Score =   407 bits (1047),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 198/292 (68%), Positives = 229/292 (78%), Gaps = 16/292 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y  TTWMYLA+P+LLYGGER +R FRS    V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  596  YVHTTWMYLAVPVLLYGGERTLRYFRSGSYSVRLLKVAIYPGNVLTLQMSKPSQFRYKSG  655

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLS+HIR LGDWT++LK VFSEVC+PP  GKSG
Sbjct  656  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSIHIRQLGDWTQELKRVFSEVCEPPVAGKSG  715

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDY+KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  716  LLRAD---ETTKKSLPKLLIDGPYGAPAQDYRKYDVLLLVGLGIGATPFISILKDLLNNI  772

Query  299  KAMENSEEEGGGI-------TTGRSNNNVNN------FKTRRAYFYWVTREQGSFDWFKG  159
              ME   +            T   S NN N        KT  AYFYWVTREQGSFDWFKG
Sbjct  773  VKMEEQADSISDFSRSSENSTGSNSGNNANTPRGKKILKTTNAYFYWVTREQGSFDWFKG  832

Query  158  IMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +M+EVAE+D++ VIEMHNY TSVYEEGDARSALI M+Q+L+ AK+GVDIVSG
Sbjct  833  VMNEVAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSG  884



>emb|CDY08347.1| BnaC09g12490D [Brassica napus]
Length=944

 Score =   407 bits (1047),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 198/292 (68%), Positives = 229/292 (78%), Gaps = 16/292 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y  TTWMYLA+P+LLYGGER +R FRS    V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  592  YVHTTWMYLAVPVLLYGGERTLRYFRSGSYSVRLLKVAIYPGNVLTLQMSKPSQFRYKSG  651

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLS+HIR LGDWT++LK VFSEVC+PP  GKSG
Sbjct  652  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSIHIRQLGDWTQELKRVFSEVCEPPVAGKSG  711

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDY+KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  712  LLRAD---ETTKKSLPKLLIDGPYGAPAQDYRKYDVLLLVGLGIGATPFISILKDLLNNI  768

Query  299  KAMENSEEEGGGI-------TTGRSNNNVNN------FKTRRAYFYWVTREQGSFDWFKG  159
              ME   +            T   S NN N        KT  AYFYWVTREQGSFDWFKG
Sbjct  769  LKMEEQADSISDFSRSSENSTGSNSGNNANTPRGKKILKTTNAYFYWVTREQGSFDWFKG  828

Query  158  IMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +M+EVAE+D++ VIEMHNY TSVYEEGDARSALI M+Q+L+ AK+GVDIVSG
Sbjct  829  VMNEVAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSG  880



>emb|CDY38202.1| BnaA09g11870D [Brassica napus]
Length=943

 Score =   407 bits (1046),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 198/292 (68%), Positives = 229/292 (78%), Gaps = 16/292 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y  TTWMYLA+P+LLYGGER +R FRS    V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  591  YVHTTWMYLAVPVLLYGGERTLRYFRSGSYSVRLLKVAIYPGNVLTLQMSKPSQFRYKSG  650

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLS+HIR LGDWT++LK VFSEVC+PP  GKSG
Sbjct  651  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSIHIRQLGDWTQELKRVFSEVCEPPVAGKSG  710

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDY+KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  711  LLRAD---ETTKKSLPKLLIDGPYGAPAQDYRKYDVLLLVGLGIGATPFISILKDLLNNI  767

Query  299  KAMENSEEEGGGI-------TTGRSNNNVNN------FKTRRAYFYWVTREQGSFDWFKG  159
              ME   +            T   S NN N        KT  AYFYWVTREQGSFDWFKG
Sbjct  768  VKMEEQADSISDFSRSSENSTGSNSGNNANTPRGKKILKTTNAYFYWVTREQGSFDWFKG  827

Query  158  IMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +M+EVAE+D++ VIEMHNY TSVYEEGDARSALI M+Q+L+ AK+GVDIVSG
Sbjct  828  VMNEVAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSG  879



>ref|XP_002865538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=630

 Score =   398 bits (1023),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/280 (68%), Positives = 221/280 (79%), Gaps = 8/280 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+  Y  ERLIRAFRS ++ VK++K A Y GNVLTL MS+P  F YKSG
Sbjct  294  YKKTTWMYLAVPVAFYACERLIRAFRSKMETVKVIKAATYPGNVLTLHMSRPTNFEYKSG  353

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITSAP D+YLSVHI++LGDWT+ +K VFSEV  P P G+  
Sbjct  354  QYMFVNCPAVSPFEWHPFSITSAPHDEYLSVHIKSLGDWTKAIKGVFSEVSMPLPVGEMS  413

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
                    G NN +FPR++IDGPYGAPAQDYKKYEVVLL+GLGIGATPMISI+KDI++N 
Sbjct  414  -------HGANNSDFPRIMIDGPYGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNT  466

Query  299  KAMENSEEEGGGI-TTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            +  E S+ + G + +          FKTRRAYFYWVTREQGS+DWFK IM+E+AE D+  
Sbjct  467  ETKELSQVDLGKVGSQHEPQGEKETFKTRRAYFYWVTREQGSYDWFKNIMNEIAERDKNK  526

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+HNYCTSVYEEGD RSA I MLQSL+ AKSG+DIVSG
Sbjct  527  VIELHNYCTSVYEEGDVRSAFIHMLQSLNHAKSGLDIVSG  566



>ref|XP_002873307.1| respiratory burst oxidase protein A [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49566.1| respiratory burst oxidase protein A [Arabidopsis lyrata subsp. 
lyrata]
Length=897

 Score =   406 bits (1043),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 229/289 (79%), Gaps = 14/289 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL +P++LY  ERLIRAFRSS++ V +LKVAV  GNVL+L +S+P  FRYKSG
Sbjct  549  YKKTTWMYLMVPVVLYLFERLIRAFRSSVEAVSVLKVAVLPGNVLSLHLSRPTNFRYKSG  608

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYM++NC+AVS  EWHPFSITSAPGDDYLSVHIR LGDWT++L+++FSEVC+P P  ++ 
Sbjct  609  QYMYLNCSAVSTLEWHPFSITSAPGDDYLSVHIRVLGDWTKELRSLFSEVCKPRPPDENR  668

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L RAD     N PNFPR+LIDGPYGAPAQDYKK+EV+LLVGLGIGATPMISIVKDI++++
Sbjct  669  LNRADSRDWDNIPNFPRILIDGPYGAPAQDYKKFEVLLLVGLGIGATPMISIVKDIINHL  728

Query  299  KAMENSEEEGGGITTGRSNNNVN----------NFKTRRAYFYWVTREQGSFDWFKGIMD  150
            K +    EEG        +N V            F T+RAYFYWVTREQGSFDWFK +MD
Sbjct  729  KGV----EEGSNRRQSPIHNMVTPPVSPSRKSETFITKRAYFYWVTREQGSFDWFKNVMD  784

Query  149  EVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            EV E D   VIE+HNYCTSVYEEGDARSALI MLQSL+ AK GVD+VSG
Sbjct  785  EVTETDRNKVIELHNYCTSVYEEGDARSALITMLQSLNHAKHGVDVVSG  833



>ref|XP_009118326.1| PREDICTED: respiratory burst oxidase homolog protein B [Brassica 
rapa]
Length=846

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/279 (68%), Positives = 229/279 (82%), Gaps = 8/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P +LY  ERLIR FRS  K V ILKVAVY GNVL+L MSKP+GF+Y+SG
Sbjct  512  YEKTTWMYLAVPTILYACERLIRLFRSGSKAVTILKVAVYPGNVLSLYMSKPKGFKYRSG  571

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY++VNC+ VSPF+WHPFSITSA GD++LS+HIRTLGDWT QLK +FS+VCQPP   +SG
Sbjct  572  QYIYVNCSDVSPFQWHPFSITSASGDEFLSIHIRTLGDWTSQLKCLFSKVCQPPSTSQSG  631

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L  AD +Q  N   FPR+LIDGPYGA AQDY+ Y+V+LLVGLGIGATP+ISI+KD+++N+
Sbjct  632  LFTADLVQANNITRFPRLLIDGPYGAQAQDYRNYDVLLLVGLGIGATPLISILKDVLNNI  691

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K    S EEG       +++NVN   T+RAYFYWVTREQGS +WF  +M+EVAE D + +
Sbjct  692  KN-HKSIEEG-------TSHNVNRSNTKRAYFYWVTREQGSLEWFSEVMNEVAEYDSEGI  743

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AK+G+DIVSG
Sbjct  744  IELHNYCTSVYEEGDARSALITMLQSLHHAKNGIDIVSG  782



>ref|XP_006399223.1| hypothetical protein EUTSA_v10012617mg [Eutrema salsugineum]
 gb|ESQ40676.1| hypothetical protein EUTSA_v10012617mg [Eutrema salsugineum]
Length=907

 Score =   406 bits (1043),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 201/292 (69%), Positives = 229/292 (78%), Gaps = 16/292 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL +P++LY  ERLIRA RS I+ V ILKVAV  GNVL+LQMS+P  F YKSG
Sbjct  555  YKKTTWMYLMVPVVLYLSERLIRALRSGIEAVSILKVAVLPGNVLSLQMSRPSNFSYKSG  614

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYM++NC+ VS  EWHPFSITSAPGDDYLSVHIR LGDWT+QL+ +FSEVC+P    ++ 
Sbjct  615  QYMYLNCSEVSSLEWHPFSITSAPGDDYLSVHIRVLGDWTKQLRLLFSEVCKPRLPDENR  674

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L RAD     N PNFPR+LIDGPYGAPAQDYK +EVVLLVGLGIGATPMISIVKDI++N+
Sbjct  675  LNRADSSPLNNIPNFPRILIDGPYGAPAQDYKNFEVVLLVGLGIGATPMISIVKDIINNL  734

Query  299  KAMENSEEEGGGITTGRSNNNVN-------------NFKTRRAYFYWVTREQGSFDWFKG  159
            K   N EEEG G + GR + N N              F+T+RAYFYWVTREQGSFDWFK 
Sbjct  735  KG--NGEEEGRG-SNGRWSPNHNMVTPPLSPARKSEMFRTKRAYFYWVTREQGSFDWFKN  791

Query  158  IMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +MDEVA  D   VIE+HNYCTSVYEEGDARSALI MLQSL+ AK GVD+VSG
Sbjct  792  VMDEVAITDRNKVIELHNYCTSVYEEGDARSALITMLQSLNHAKHGVDVVSG  843



>ref|XP_010452698.1| PREDICTED: respiratory burst oxidase homolog protein A [Camelina 
sativa]
Length=891

 Score =   405 bits (1042),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/293 (66%), Positives = 232/293 (79%), Gaps = 22/293 (8%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYL +P++LY  ERLIRAFRSS++ V +LKV+V  GNVL+L +S+P  FRYKSG
Sbjct  543  YKKTTWMYLMVPVVLYLFERLIRAFRSSVEAVSVLKVSVLPGNVLSLHLSRPNNFRYKSG  602

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYM++NC+AVS  EWHPFSITSAPGDDYLSVHIR LGDWTRQL+++FSE+C+P   G+S 
Sbjct  603  QYMYLNCSAVSTLEWHPFSITSAPGDDYLSVHIRVLGDWTRQLRSLFSELCKPHLLGESR  662

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L  A      N  N+PR+LIDGPYGAPAQDYKK+EVVLLVGLGIGATPMISIVKDI++N+
Sbjct  663  LNIASPRHRDNRSNYPRILIDGPYGAPAQDYKKFEVVLLVGLGIGATPMISIVKDIINNL  722

Query  299  KAMENSEEEGGGITTGRSNNNVNN--------------FKTRRAYFYWVTREQGSFDWFK  162
            K        G G ++ R  + ++N              F+T+RAYFYWVTREQGSFDWFK
Sbjct  723  K--------GNGESSNRRQSPIHNMVSPPLSPARKSDAFRTKRAYFYWVTREQGSFDWFK  774

Query  161  GIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
             +MDEVAE D  +VIE+HNYCTSVYEEGDARSALI MLQSL+ AK+GVD+VSG
Sbjct  775  NVMDEVAETDRNNVIELHNYCTSVYEEGDARSALITMLQSLNHAKNGVDVVSG  827



>gb|EEC71441.1| hypothetical protein OsI_03642 [Oryza sativa Indica Group]
Length=532

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 230/294 (78%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y++TTWMYL++P+ LY GER++R FRS    V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  178  YRRTTWMYLSVPVCLYVGERILRFFRSGSYSVRLLKVAIYPGNVLTLQMSKPPTFRYKSG  237

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLS+H+R LGDWTR+LK VF+  C+PP  GKSG
Sbjct  238  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSIHVRQLGDWTRELKRVFAAACEPPAGGKSG  297

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD          P++LIDGPYG+PAQDY KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  298  LLRAD---ETTKKTLPKLLIDGPYGSPAQDYSKYDVLLLVGLGIGATPFISILKDLLNNI  354

Query  299  KAMENSEEEGGGI--TTGRSNNNVN-------------NFKTRRAYFYWVTREQGSFDWF  165
              ME  E+    +    GR+  +V+               KT  AYFYWVTREQGSFDWF
Sbjct  355  IKMEEEEDASTDLYPPIGRNKPHVDLGTLMTITSRPKKILKTTNAYFYWVTREQGSFDWF  414

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KG+M+E+A++D++++IEMHNY TSVYEEGDARSALI MLQ+L+ AK+GVDIVSG
Sbjct  415  KGVMNEIADLDQRNIIEMHNYLTSVYEEGDARSALITMLQALNHAKNGVDIVSG  468



>ref|XP_010533625.1| PREDICTED: respiratory burst oxidase homolog protein F isoform 
X2 [Tarenaya hassleriana]
Length=949

 Score =   406 bits (1044),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 196/294 (67%), Positives = 232/294 (79%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYL++P+LLY GER +R FRS    V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  595  YLKTTWMYLSVPILLYCGERTLRYFRSGFYTVRLLKVAIYPGNVLTLQMSKPSQFRYKSG  654

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLS+HIR LGDWT++LK +FSEVC+PP  GKSG
Sbjct  655  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSIHIRQLGDWTQELKRMFSEVCEPPVAGKSG  714

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        N P++LIDGPYGAPAQDY+KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  715  LLRAD---ETTKKNLPKLLIDGPYGAPAQDYRKYDVLLLVGLGIGATPFISILKDLLNNI  771

Query  299  KAMENSEEEGGGITTGR------SNNNVNN---------FKTRRAYFYWVTREQGSFDWF  165
              ME   +    ++         SN+N +N          KT  AYFYWVTREQGSFDWF
Sbjct  772  IKMEEQADSVYDMSRTSEHSSIGSNDNSSNRVSPKRKRILKTTNAYFYWVTREQGSFDWF  831

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KG+M+EVAE+D++ VIEMHNY TSVYEEGDARSALI M+Q+L+ AK+GVDIVSG
Sbjct  832  KGVMNEVAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSG  885



>gb|KHG03419.1| Respiratory burst oxidase A [Gossypium arboreum]
Length=819

 Score =   403 bits (1035),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 229/295 (78%), Gaps = 19/295 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y++TTWMYLA+P+LLY GER++R FRS    V++LKVA+Y G VLTLQMSKP  FRYKSG
Sbjct  464  YRRTTWMYLAVPVLLYAGERILRFFRSGFSTVRLLKVAIYPGGVLTLQMSKPPQFRYKSG  523

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLSVHIR LGDWT+ LK +FSEVC+PP  GKSG
Sbjct  524  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSVHIRQLGDWTQALKRLFSEVCEPPVAGKSG  583

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDY KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  584  LLRAD---EATKKSLPKLLIDGPYGAPAQDYSKYDVLLLVGLGIGATPFISILKDLLNNI  640

Query  299  KAMENSEE------EGGGITTGRSNNNVN----------NFKTRRAYFYWVTREQGSFDW  168
              ME   +      +   ++   SN +              KT  AYFYWVTREQGSFDW
Sbjct  641  VKMEEQADSVSDTSKASDVSVASSNESTTPNRVPSKRKKTLKTTNAYFYWVTREQGSFDW  700

Query  167  FKGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            FKG+M+EVAE+D++ VIEMHNY TSVYEEGDARSALI M+Q+L+ AK+GVDIVSG
Sbjct  701  FKGVMNEVAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSG  755



>ref|XP_008349116.1| PREDICTED: respiratory burst oxidase homolog protein A-like [Malus 
domestica]
Length=573

 Score =   395 bits (1015),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 228/294 (78%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYL++P+LLY GER++R FRS    V++LKVA+Y GNVLTLQMSKPQ F+YKSG
Sbjct  219  YLKTTWMYLSVPVLLYAGERILRIFRSGFYTVRLLKVAIYPGNVLTLQMSKPQQFKYKSG  278

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLSVHIR LGDWT++LK VFSE C+P   GKSG
Sbjct  279  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSVHIRQLGDWTQELKRVFSEACEPSLAGKSG  338

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDY+KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  339  LLRAD---ETTKTSLPKLLIDGPYGAPAQDYRKYDVLLLVGLGIGATPFISILKDLLNNI  395

Query  299  KAME-----------NSEEEGGGITTGRSN----NNVNNFKTRRAYFYWVTREQGSFDWF  165
              ME            S+   G I +   N          KT  AYFYWVTREQGSFDWF
Sbjct  396  VKMEEQADSVSDFNRTSDLSFGSIDSPNPNKVYPKRKKPLKTTNAYFYWVTREQGSFDWF  455

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KG+M+EVAE+D++ VIEMHNY TSVYEEGDARS LI M+Q+L+ AK+GVDIVSG
Sbjct  456  KGVMNEVAELDQRGVIEMHNYLTSVYEEGDARSTLITMVQALNHAKNGVDIVSG  509



>ref|XP_010674039.1| PREDICTED: respiratory burst oxidase homolog protein B [Beta 
vulgaris subsp. vulgaris]
Length=887

 Score =   405 bits (1040),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 195/279 (70%), Positives = 233/279 (84%), Gaps = 5/279 (2%)
 Frame = -1

Query  836  KKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQ  657
            KKTTWMYLA+P+LLY  ER+IRAFRS  K V+I KVAVY GNVL+LQM+KPQ FRY SGQ
Sbjct  549  KKTTWMYLAVPVLLYAFERVIRAFRSGYKTVQISKVAVYPGNVLSLQMTKPQNFRYTSGQ  608

Query  656  YMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNG-KSG  480
            Y+FVNCA VSPFEWHPFS+TSAPGDDY+SVHIRTLGDWT QL+T+FS++CQPP +  +SG
Sbjct  609  YIFVNCAEVSPFEWHPFSLTSAPGDDYVSVHIRTLGDWTSQLRTLFSKLCQPPTSSDQSG  668

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD   G   P  P++ IDGPYGAPAQDYKKY+V+LLVGLGIGATP+ISI+KD++ ++
Sbjct  669  LLRADMGNGP-IPRMPKLKIDGPYGAPAQDYKKYDVLLLVGLGIGATPLISILKDVLYHI  727

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  ++ E+   GI    + +    F  +RAYFYWVTREQGSFDWF+ +M+EVAE D  +V
Sbjct  728  KQQKDVEK---GIADDFNVHKKKPFLVKRAYFYWVTREQGSFDWFRSVMNEVAENDRDNV  784

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALIAMLQSLH AK+G+DIVSG
Sbjct  785  IELHNYCTSVYEEGDARSALIAMLQSLHHAKNGMDIVSG  823



>ref|XP_010438933.1| PREDICTED: putative respiratory burst oxidase homolog protein 
G [Camelina sativa]
Length=429

 Score =   390 bits (1001),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 185/280 (66%), Positives = 224/280 (80%), Gaps = 10/280 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY  ERLIRAFRSSI+ VK+LKVA Y G VLTLQMSKP+ F+Y SG
Sbjct  95   YKKTTWMYLAVPVALYAFERLIRAFRSSIRTVKVLKVAAYPGKVLTLQMSKPKNFKYMSG  154

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFVNC AVSPFEWHPFSITS P +D+LSVH+++LGDWT  ++ VFSEV +P P G   
Sbjct  155  QYMFVNCPAVSPFEWHPFSITSTPQEDFLSVHMKSLGDWTEAIQGVFSEVSKPSPVG---  211

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
                D L G N+  +P++++DGPYGAPAQDYKKYEVVLL+GLGIGATPMISI+KDI++N 
Sbjct  212  ----DTLHGANSSCYPKIMLDGPYGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNT  267

Query  299  KAMEN-SEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKH  123
            +  E  S+ E G  +  +       FKTRRAYFYWVT+E+G+FDWFK IM+E+AE D   
Sbjct  268  ETKEQLSQMEKG--SQQKPQVKKETFKTRRAYFYWVTKEEGTFDWFKNIMNEIAERDTSK  325

Query  122  VIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VIE+HN+CTSVYEEGD RSALI MLQSL+ AK+G+DIV+G
Sbjct  326  VIELHNHCTSVYEEGDVRSALIRMLQSLNYAKNGLDIVAG  365



>emb|CAA63704.1| NAD(P)H oxidase [Oryza sativa Japonica Group]
Length=590

 Score =   395 bits (1016),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 189/294 (64%), Positives = 231/294 (79%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y++TTWMYL++P+ LY GER++R FRS    V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  236  YRRTTWMYLSVPVCLYVGERILRFFRSGSYSVRLLKVAIYPGNVLTLQMSKPPTFRYKSG  295

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLS+H+R LGDWTR+LK VF+  C+PP  GKSG
Sbjct  296  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSIHVRQLGDWTRELKRVFAAACEPPAGGKSG  355

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD          P++LIDGPYG+PAQDY KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  356  LLRAD---ETTKKILPKLLIDGPYGSPAQDYSKYDVLLLVGLGIGATPFISILKDLLNNI  412

Query  299  KAMENSEEEGGGI--TTGRSNNNVN-------------NFKTRRAYFYWVTREQGSFDWF  165
              ME  E+    +    GR+N +V+               KT  AYFYWVTREQGSFDWF
Sbjct  413  IKMEEEEDASTDLYPPMGRNNPHVDLGTLMTITSRPKKILKTTNAYFYWVTREQGSFDWF  472

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KG+M+E+A++D++++IEMHNY TSVYEEGDARSALI MLQ+L+ AK+GVDIVSG
Sbjct  473  KGVMNEIADLDQRNIIEMHNYLTSVYEEGDARSALITMLQALNHAKNGVDIVSG  526



>dbj|BAD87798.1| putative NAD(P)H oxidase [Oryza sativa Japonica Group]
 dbj|BAD87440.1| putative NAD(P)H oxidase [Oryza sativa Japonica Group]
Length=532

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 230/294 (78%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y++TTWMYL++P+ LY GER++R FRS    V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  178  YRRTTWMYLSVPVCLYVGERILRFFRSGSYSVRLLKVAIYPGNVLTLQMSKPPTFRYKSG  237

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLS+H+R LGDWTR+LK VF+  C+PP  GKSG
Sbjct  238  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSIHVRQLGDWTRELKRVFAAACEPPAGGKSG  297

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD          P++LIDGPYG+PAQDY KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  298  LLRAD---ETTKKILPKLLIDGPYGSPAQDYSKYDVLLLVGLGIGATPFISILKDLLNNI  354

Query  299  KAMENSEEEGGGI--TTGRSNNNVN-------------NFKTRRAYFYWVTREQGSFDWF  165
              ME  E+    +    GR+  +V+               KT  AYFYWVTREQGSFDWF
Sbjct  355  IKMEEEEDASTDLYPPMGRNKPHVDLGTLMTITSRPKKILKTTNAYFYWVTREQGSFDWF  414

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KG+M+E+A++D++++IEMHNY TSVYEEGDARSALI MLQ+L+ AK+GVDIVSG
Sbjct  415  KGVMNEIADLDQRNIIEMHNYLTSVYEEGDARSALITMLQALNHAKNGVDIVSG  468



>ref|XP_010924767.1| PREDICTED: respiratory burst oxidase homolog protein A [Elaeis 
guineensis]
Length=939

 Score =   405 bits (1041),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/292 (66%), Positives = 231/292 (79%), Gaps = 16/292 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY GER +R FRS    V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  587  YRKTTWMYLAVPILLYAGERTLRTFRSGYYSVRLLKVAIYPGNVLTLQMSKPPAFRYKSG  646

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C A+SPFEWHPFSITSAPGDDYLS+HIR LGDWTR+LK VFSE C+PP  GKSG
Sbjct  647  QYMFVQCPAISPFEWHPFSITSAPGDDYLSIHIRQLGDWTRELKRVFSEACEPPVPGKSG  706

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDYKKY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  707  LLRAD---ETTKKSLPKLLIDGPYGAPAQDYKKYDVLLLVGLGIGATPFISILKDLLNNI  763

Query  299  KAMENSEE----------EGGGITTG---RSNNNVNNFKTRRAYFYWVTREQGSFDWFKG  159
              ME   +          + G +  G   +++      KT  AYFYWVTREQGSFDWFKG
Sbjct  764  VKMEEQADSISDYFPPPGQNGRVDLGTILKASRPKWTLKTTNAYFYWVTREQGSFDWFKG  823

Query  158  IMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            +M+EVAE+D++ +I+MHNY TSVYEEGDARSALI M+Q+L+ AK+GVDIVSG
Sbjct  824  VMNEVAELDQRGIIDMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSG  875



>ref|XP_007040366.1| Respiratory burst oxidase protein A [Theobroma cacao]
 gb|EOY24867.1| Respiratory burst oxidase protein A [Theobroma cacao]
Length=932

 Score =   405 bits (1040),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/294 (66%), Positives = 231/294 (79%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+KTTWMYLA+P+LLY GER++R FRS    V+ILKVA+Y G VLTLQMSKP  FRYKSG
Sbjct  578  YRKTTWMYLAVPVLLYAGERILRFFRSGSYTVRILKVAIYPGGVLTLQMSKPPQFRYKSG  637

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDDYLSVHIR LGDWT++L+ +FSEVC+PP  GKSG
Sbjct  638  QYMFVQCPAVSPFEWHPFSITSAPGDDYLSVHIRQLGDWTQELRRLFSEVCEPPVAGKSG  697

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDY KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  698  LLRAD---ETTKKSLPKLLIDGPYGAPAQDYHKYDVLLLVGLGIGATPFISILKDLLNNI  754

Query  299  KAMENSEE------EGGGITTGRSNNNVNN---------FKTRRAYFYWVTREQGSFDWF  165
              ME   +          I+ G +++   N          KT  AYFYWVTREQGSFDWF
Sbjct  755  VKMEEQADSVSDTSRTSDISIGSNDSTTPNRVSPKRKKTLKTTNAYFYWVTREQGSFDWF  814

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KG+M+EVAE+D++ VIEMHNY TSVYEEGDARSALI M+Q+L+ AK+GVDIVSG
Sbjct  815  KGVMNEVAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSG  868



>ref|XP_006301285.1| hypothetical protein CARUB_v10021686mg [Capsella rubella]
 gb|EOA34183.1| hypothetical protein CARUB_v10021686mg [Capsella rubella]
Length=938

 Score =   405 bits (1040),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 229/288 (80%), Gaps = 12/288 (4%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y +TTWMYLA+P+LLYGGER +R FRS    V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  590  YVRTTWMYLAVPILLYGGERTLRYFRSGSYSVRLLKVAIYPGNVLTLQMSKPTQFRYKSG  649

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAP DDYLS+HIR LGDWT++LK VFSEVC+PP  GKSG
Sbjct  650  QYMFVQCPAVSPFEWHPFSITSAPEDDYLSIHIRQLGDWTQELKRVFSEVCEPPVAGKSG  709

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDY+KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  710  LLRAD---ETTKTSLPKLLIDGPYGAPAQDYRKYDVLLLVGLGIGATPFISILKDLLNNI  766

Query  299  KAMENSEEEGGGITTGRSNNNVNN---------FKTRRAYFYWVTREQGSFDWFKGIMDE  147
              ME   +     +    ++  +N          KT  AYFYWVTREQGSFDWFKG+M+E
Sbjct  767  VKMEEHADSISDFSRSSEHSTGSNGDTPRRKKILKTTNAYFYWVTREQGSFDWFKGVMNE  826

Query  146  VAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            VAE+D++ VIEMHNY TSVYEEGDARSALI M+Q+L+ AK+GVDIVSG
Sbjct  827  VAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSG  874



>gb|ACB56487.1| respiratory burst oxidase-like protein F1, partial [Hordeum vulgare 
subsp. vulgare]
Length=649

 Score =   397 bits (1019),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/294 (64%), Positives = 231/294 (79%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y+K+TWMYLA+P+ LY GER++R FRS    V++LKVA+Y GNVLTLQM+KP  FRYKSG
Sbjct  295  YRKSTWMYLAVPVCLYLGERILRFFRSGSYAVRLLKVAIYPGNVLTLQMTKPATFRYKSG  354

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGD+YLS+H+R LGDWTR+LK VFS  C+PP +GKSG
Sbjct  355  QYMFVQCPAVSPFEWHPFSITSAPGDEYLSIHVRQLGDWTRELKRVFSAACEPPVSGKSG  414

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD          P++LIDGPYG+PAQDY KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  415  LLRAD---ETTKKTLPKLLIDGPYGSPAQDYGKYDVLLLVGLGIGATPFISILKDLLNNI  471

Query  299  KAMENSEEEGGGI--TTGRSNNNVN-------------NFKTRRAYFYWVTREQGSFDWF  165
              ME  E+    +    GR+  +V+               KT  AYFYWVTREQGSFDWF
Sbjct  472  IKMEEEEDTSTDLYPPVGRNKPHVDLGTLMRVTTRPKKVLKTTNAYFYWVTREQGSFDWF  531

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KG+M+E+AEMD++++IEMHNY TSVYEEGDARSALI MLQ+L+ AK+GVD+VSG
Sbjct  532  KGVMNEIAEMDQRNIIEMHNYLTSVYEEGDARSALITMLQALNHAKNGVDVVSG  585



>ref|XP_006413344.1| hypothetical protein EUTSA_v10024426mg [Eutrema salsugineum]
 gb|ESQ54797.1| hypothetical protein EUTSA_v10024426mg [Eutrema salsugineum]
Length=818

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/283 (69%), Positives = 222/283 (78%), Gaps = 15/283 (5%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YKKTTWMYLA+P+ LY  ERLIRAFRSSI+ VK+LK   Y GNVL L MS+P+ F+Y SG
Sbjct  481  YKKTTWMYLAVPITLYACERLIRAFRSSIRTVKVLKAPAYPGNVLNLHMSRPKNFKYMSG  540

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVC-QPPPNGKS  483
            QYMFVNC AVS FEWHPFSITSAP DDYLSVHI++LGDWT+ +K VF+EV  +PPP+G  
Sbjct  541  QYMFVNCPAVSQFEWHPFSITSAPQDDYLSVHIKSLGDWTKAIKRVFAEVTSKPPPDG--  598

Query  482  GLLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSN  303
                 D L G NNP FP++LIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISI+KDI++N
Sbjct  599  -----DMLHGANNPVFPKILIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIIKDIINN  653

Query  302  MKAME----NSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEM  135
              A E    N  E+G   +   S      FKTRRAYFYWVTREQGS+DWFK IM+E+AE 
Sbjct  654  TDAKEQGQLNQMEKG---SQKESQGKKERFKTRRAYFYWVTREQGSYDWFKNIMNEIAER  710

Query  134  DEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVS  6
            D   VIE+HNYCTSVYEE DARSALI MLQS+  AKSG DIVS
Sbjct  711  DRSKVIELHNYCTSVYEEDDARSALIHMLQSISYAKSGRDIVS  753



>ref|XP_006417613.1| hypothetical protein EUTSA_v10006793mg [Eutrema salsugineum]
 gb|ESQ35966.1| hypothetical protein EUTSA_v10006793mg [Eutrema salsugineum]
Length=838

 Score =   402 bits (1033),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 227/279 (81%), Gaps = 8/279 (3%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P++LY  ERLIR FRS  K VKILKVAVY GNVL+L MSKP+GF+Y SG
Sbjct  504  YVKTTWMYLAVPMILYACERLIRLFRSGSKAVKILKVAVYPGNVLSLYMSKPKGFKYTSG  563

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QY++VNC+ VSP +WHPFSITSA GDD+LS+HIRTLGDWT QLK++FS+VCQPP   +SG
Sbjct  564  QYIYVNCSDVSPLQWHPFSITSASGDDFLSIHIRTLGDWTSQLKSLFSKVCQPPLTSQSG  623

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            L  AD  Q  N   FPR+LIDGPYGAPAQDY+ Y+V+LLVGLGIGATP+ISI++D+++N+
Sbjct  624  LFIADKGQANNITRFPRLLIDGPYGAPAQDYRNYDVLLLVGLGIGATPLISILRDVLNNI  683

Query  299  KAMENSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHV  120
            K  + S EEG      RSN       T+RAYFYWVTREQGS +WF  +M+EVAE D + +
Sbjct  684  KN-QKSIEEGTSHYVHRSN-------TKRAYFYWVTREQGSLEWFSEVMNEVAEYDSEGI  735

Query  119  IEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            IE+HNYCTSVYEEGDARSALI MLQSLH AK+G+DIVSG
Sbjct  736  IELHNYCTSVYEEGDARSALITMLQSLHHAKNGIDIVSG  774



>gb|ACB56485.1| respiratory burst oxidase-like protein F2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ99223.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=963

 Score =   405 bits (1040),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/294 (66%), Positives = 231/294 (79%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYLA+P+ LY GER +R FRS    V+ILKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  609  YKRTTWMYLAVPVGLYVGERTLRFFRSGSYSVRILKVAIYPGNVLTLQMSKPPTFRYKSG  668

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDD+LS+H+R LGDWTR+LK VFS  C+PP NGKSG
Sbjct  669  QYMFVQCPAVSPFEWHPFSITSAPGDDFLSIHVRQLGDWTRELKRVFSAACEPPMNGKSG  728

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD         FP++LIDGPYG+PAQDY KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  729  LLRAD---ENTKKTFPKLLIDGPYGSPAQDYSKYDVLLLVGLGIGATPFISILKDLINNI  785

Query  299  KAMENSEEEGGGI--TTGRSNNNVN-------------NFKTRRAYFYWVTREQGSFDWF  165
              ME  +E    +    G S  +V+              FKT  AYFYWVTREQGSFDWF
Sbjct  786  IKMEEEDEASTDLYPPIGPSKASVDLDTLMRITSKPKRVFKTTNAYFYWVTREQGSFDWF  845

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KGIM+E+AE+D++++IEMHNY TSVYEEGDARSALI MLQ+L+ AK+GVD+VSG
Sbjct  846  KGIMNEIAELDQRNIIEMHNYLTSVYEEGDARSALITMLQALNHAKNGVDVVSG  899



>emb|CDY06348.1| BnaA09g48550D [Brassica napus]
Length=816

 Score =   400 bits (1029),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/275 (68%), Positives = 226/275 (82%), Gaps = 8/275 (3%)
 Frame = -1

Query  827  TWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSGQYMF  648
            TWMYLA+P +LY  ERLIR FRS  K V ILKVAVY GNVL+L MSKP+GF+Y+SGQY++
Sbjct  486  TWMYLAVPTILYACERLIRLFRSGSKAVTILKVAVYPGNVLSLYMSKPKGFKYRSGQYIY  545

Query  647  VNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSGLLRA  468
            VNC+ VSPF+WHPFSITSA GD++LS+HIRTLGDWT QLK +FS+VCQPP   +SGL  A
Sbjct  546  VNCSDVSPFQWHPFSITSASGDEFLSIHIRTLGDWTSQLKCLFSKVCQPPSTSQSGLFTA  605

Query  467  DCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNMKAME  288
            D +Q  N   FPR+LIDGPYGAPAQDY+ Y+V+LLVGLGIGATP+ISI+KD+++N+K   
Sbjct  606  DLVQANNITRFPRLLIDGPYGAPAQDYRNYDVLLLVGLGIGATPLISILKDVLNNIKN-H  664

Query  287  NSEEEGGGITTGRSNNNVNNFKTRRAYFYWVTREQGSFDWFKGIMDEVAEMDEKHVIEMH  108
             S EEG       +++NVN   T+RAYFYWVTREQGS +WF  +M+EVAE D + +IE+H
Sbjct  665  KSIEEG-------TSHNVNRSNTKRAYFYWVTREQGSLEWFSEVMNEVAEYDSEGIIELH  717

Query  107  NYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            NYCTSVYEEGDARSALI MLQSLH AK+G+DIVSG
Sbjct  718  NYCTSVYEEGDARSALITMLQSLHHAKNGIDIVSG  752



>emb|CAK22348.1| respiratory burst oxidase homologue A [Hordeum vulgare subsp. 
vulgare]
Length=963

 Score =   404 bits (1039),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 195/294 (66%), Positives = 231/294 (79%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYLA+P+ LY GER +R FRS    V+ILKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  609  YKRTTWMYLAVPVGLYVGERTLRFFRSGSYSVRILKVAIYPGNVLTLQMSKPPTFRYKSG  668

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDD+LS+H+R LGDWTR+LK VFS  C+PP NGKSG
Sbjct  669  QYMFVQCPAVSPFEWHPFSITSAPGDDFLSIHVRQLGDWTRELKRVFSAACEPPMNGKSG  728

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD         FP++LIDGPYG+PAQDY KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  729  LLRAD---ENTKKTFPKLLIDGPYGSPAQDYSKYDVLLLVGLGIGATPFISILKDLINNI  785

Query  299  KAMENSEEEGGGI--TTGRSNNNVN-------------NFKTRRAYFYWVTREQGSFDWF  165
              ME  +E    +    G S  +V+              FKT  AYFYWVTREQGSFDWF
Sbjct  786  IKMEEEDEASTDLYPPIGPSKASVDLDTLMRITSKPKRVFKTTNAYFYWVTREQGSFDWF  845

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KGIM+E+AE+D++++IEMHNY TSVYEEGDARSALI MLQ+L+ AK+GVD+VSG
Sbjct  846  KGIMNEIAELDQRNIIEMHNYLTSVYEEGDARSALITMLQALNHAKNGVDVVSG  899



>gb|EMS62912.1| Respiratory burst oxidase-like protein F [Triticum urartu]
Length=805

 Score =   400 bits (1028),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 193/294 (66%), Positives = 230/294 (78%), Gaps = 18/294 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            YK+TTWMYLA+P+ LY GER +R FRS    V+ILKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  408  YKRTTWMYLAVPVGLYVGERTLRFFRSGSYSVRILKVAIYPGNVLTLQMSKPPTFRYKSG  467

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C  VSPFEWHPFSITSAPGD++LS+H+R LGDWTR+LK VFS  C+PP NGKSG
Sbjct  468  QYMFVQCPDVSPFEWHPFSITSAPGDEFLSIHVRQLGDWTRELKRVFSAACEPPMNGKSG  527

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD         FP++LIDGPYG+PAQDY KY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  528  LLRAD---ENTKKTFPKLLIDGPYGSPAQDYSKYDVLLLVGLGIGATPFISILKDLINNI  584

Query  299  KAMENSEEEGGGI--TTGRSNNNVN-------------NFKTRRAYFYWVTREQGSFDWF  165
              ME  +E    +    G S  +V+              FKT  AYFYWVTREQGSFDWF
Sbjct  585  IKMEEEDEASTDLYPPIGPSKASVDLDTLMRITSKPKRVFKTTNAYFYWVTREQGSFDWF  644

Query  164  KGIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            KGIM+E+AE+D++++IEMHNY TSVYEEGDARSALI MLQ+L+ AK+GVD+VSG
Sbjct  645  KGIMNEIAELDQRNIIEMHNYLTSVYEEGDARSALITMLQALNHAKNGVDVVSG  698



>emb|CBI34401.3| unnamed protein product [Vitis vinifera]
Length=922

 Score =   403 bits (1036),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 194/293 (66%), Positives = 229/293 (78%), Gaps = 17/293 (6%)
 Frame = -1

Query  839  YKKTTWMYLAIPLLLYGGERLIRAFRSSIKPVKILKVAVYHGNVLTLQMSKPQGFRYKSG  660
            Y KTTWMYLA+P+ LY GER +R FRS    V++LKVA+Y GNVLTLQMSKP  FRYKSG
Sbjct  569  YLKTTWMYLAVPVCLYAGERTLRLFRSGFYAVRLLKVAIYPGNVLTLQMSKPPQFRYKSG  628

Query  659  QYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLKTVFSEVCQPPPNGKSG  480
            QYMFV C AVSPFEWHPFSITSAPGDD+LS+HIR LGDWT++LK VFSE C+ P  GKSG
Sbjct  629  QYMFVQCPAVSPFEWHPFSITSAPGDDFLSIHIRQLGDWTQELKRVFSEACEAPIAGKSG  688

Query  479  LLRADCLQGQNNPNFPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNM  300
            LLRAD        + P++LIDGPYGAPAQDYKKY+V+LLVGLGIGATP ISI+KD+++N+
Sbjct  689  LLRAD---ESTKKSLPKLLIDGPYGAPAQDYKKYDVLLLVGLGIGATPFISILKDLLNNI  745

Query  299  KAMENSE---------EEGGGITTGRSNNNVN-----NFKTRRAYFYWVTREQGSFDWFK  162
              ME  +         ++  G T   S N ++       KT  AYFYWVTREQGSFDWFK
Sbjct  746  VKMEEQDSVSDFSRISDQSAGTTDSPSLNRISPKRRKTLKTTNAYFYWVTREQGSFDWFK  805

Query  161  GIMDEVAEMDEKHVIEMHNYCTSVYEEGDARSALIAMLQSLHLAKSGVDIVSG  3
            G+M+EVAE+D++ VIEMHNY TSVYEEGDARSALI M+Q+L+ AK+GVDIVSG
Sbjct  806  GVMNEVAELDQRGVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGVDIVSG  858



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1615139213688