BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c44320_g1_i1 len=216 path=[194:0-215]

Length=216
                                                                      Score     E

ref|NP_001234258.1|  potassium channel                                  109   2e-25   
emb|CDP03401.1|  unnamed protein product                                104   6e-25   
ref|XP_011077973.1|  PREDICTED: potassium channel AKT1-like             107   6e-25   
ref|NP_001275347.1|  potassium channel AKT1-like                        106   2e-24   
ref|XP_009772048.1|  PREDICTED: potassium channel AKT1                  105   4e-24   
ref|XP_009601874.1|  PREDICTED: potassium channel AKT1-like isofo...    105   4e-24   
ref|XP_009601872.1|  PREDICTED: potassium channel AKT1-like isofo...    105   4e-24   
ref|XP_008464999.1|  PREDICTED: potassium channel AKT1 isoform X2       102   2e-23   
ref|XP_009799566.1|  PREDICTED: potassium channel AKT1-like isofo...    103   2e-23   
ref|XP_009799565.1|  PREDICTED: potassium channel AKT1-like isofo...    103   2e-23   
ref|XP_009400651.1|  PREDICTED: potassium channel AKT1-like             103   2e-23   
ref|XP_008787403.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    102   2e-23   
ref|XP_009601878.1|  PREDICTED: potassium channel AKT1-like isofo...    102   3e-23   
ref|XP_008464998.1|  PREDICTED: potassium channel AKT1 isoform X1       102   3e-23   
gb|KDP32353.1|  hypothetical protein JCGZ_13278                         102   3e-23   
ref|XP_011081924.1|  PREDICTED: potassium channel AKT1-like             102   3e-23   
ref|XP_009601875.1|  PREDICTED: potassium channel AKT1-like isofo...    102   4e-23   
ref|XP_009601877.1|  PREDICTED: potassium channel AKT1-like isofo...    102   4e-23   
ref|XP_009619489.1|  PREDICTED: potassium channel AKT1-like             102   4e-23   
ref|XP_011093723.1|  PREDICTED: potassium channel AKT1-like             102   4e-23   
ref|XP_008337414.1|  PREDICTED: potassium channel AKT1-like             100   1e-22   
ref|XP_007013809.1|  Shaker pollen inward K+ channel isoform 1          100   1e-22   
ref|XP_004163193.1|  PREDICTED: potassium channel AKT1-like           99.8    2e-22   
dbj|BAD81034.1|  potassium channel NKT1                                 100   2e-22   Nicotiana tabacum [American tobacco]
ref|XP_009621376.1|  PREDICTED: potassium channel AKT1-like             100   2e-22   
gb|KHN15126.1|  Potassium channel AKT1                                  100   2e-22   
ref|XP_003549784.1|  PREDICTED: potassium channel AKT1-like             100   2e-22   
gb|AIY55349.1|  potassium channel AKT1-like protein                     100   2e-22   
ref|XP_004149890.1|  PREDICTED: potassium channel AKT1-like             100   3e-22   
ref|XP_010249975.1|  PREDICTED: potassium channel AKT1-like           99.8    3e-22   
ref|XP_008352270.1|  PREDICTED: potassium channel AKT1-like           99.8    3e-22   
ref|XP_009601876.1|  PREDICTED: potassium channel AKT1-like isofo...  99.4    4e-22   
ref|XP_006364280.1|  PREDICTED: potassium channel AKT1-like           98.2    1e-21   
ref|XP_008219894.1|  PREDICTED: potassium channel AKT1-like           97.8    1e-21   
gb|KCW81436.1|  hypothetical protein EUGRSUZ_C02815                   97.8    2e-21   
ref|XP_010051190.1|  PREDICTED: potassium channel AKT1-like           97.8    2e-21   
ref|XP_002514366.1|  Potassium channel AKT6, putative                 97.4    2e-21   Ricinus communis
emb|CAG27094.1|  inwardly rectifying potassium channel subunit        97.1    3e-21   Daucus carota [carrots]
ref|XP_008809507.1|  PREDICTED: potassium channel AKT1-like isofo...  96.7    3e-21   
ref|XP_010925144.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...  96.7    3e-21   
ref|XP_008809491.1|  PREDICTED: potassium channel AKT1-like isofo...  96.7    4e-21   
ref|XP_007225029.1|  hypothetical protein PRUPE_ppa019987mg           96.7    4e-21   
ref|XP_008809499.1|  PREDICTED: potassium channel AKT1-like isofo...  96.7    4e-21   
ref|XP_010925255.1|  PREDICTED: potassium channel AKT1-like isofo...  96.7    4e-21   
ref|XP_011085793.1|  PREDICTED: potassium channel AKT1-like isofo...  96.3    4e-21   
ref|XP_010047779.1|  PREDICTED: potassium channel AKT1-like isofo...  96.3    5e-21   
ref|XP_010098980.1|  Potassium channel AKT1                           96.3    5e-21   
ref|XP_010047932.1|  PREDICTED: potassium channel AKT1-like isofo...  96.3    5e-21   
ref|XP_010925257.1|  PREDICTED: potassium channel AKT1-like isofo...  96.3    5e-21   
ref|XP_006451007.1|  hypothetical protein CICLE_v10007412mg           96.3    6e-21   
ref|XP_009386140.1|  PREDICTED: potassium channel AKT1                96.3    6e-21   
ref|XP_011085715.1|  PREDICTED: potassium channel AKT1-like isofo...  96.3    6e-21   
gb|KDP33617.1|  hypothetical protein JCGZ_07188                       95.9    7e-21   
gb|ABO15470.1|  AKT1-like K+ channel LilKT1                           95.5    9e-21   Lilium longiflorum [Easter lily]
ref|XP_008394036.1|  PREDICTED: potassium channel AKT1-like isofo...  95.5    1e-20   
ref|XP_007154951.1|  hypothetical protein PHAVU_003G160800g           95.1    1e-20   
ref|XP_002529373.1|  Potassium channel AKT1, putative                 95.1    1e-20   Ricinus communis
ref|XP_008394035.1|  PREDICTED: potassium channel AKT1-like isofo...  95.1    1e-20   
ref|XP_008392136.1|  PREDICTED: potassium channel AKT1                94.7    2e-20   
ref|XP_003609240.1|  Potassium channel                                94.4    2e-20   
ref|XP_009393618.1|  PREDICTED: potassium channel AKT1-like           94.4    3e-20   
ref|XP_010049960.1|  PREDICTED: potassium channel AKT1                94.0    3e-20   
gb|AAL25648.1|AF197332_1  inward-rectifying K+ channel                94.0    3e-20   Eucalyptus camaldulensis
gb|KCW82789.1|  hypothetical protein EUGRSUZ_C04163                   94.0    3e-20   
ref|XP_004508539.1|  PREDICTED: potassium channel AKT1-like isofo...  94.0    3e-20   
ref|XP_004508540.1|  PREDICTED: potassium channel AKT1-like isofo...  94.0    3e-20   
gb|EYU27297.1|  hypothetical protein MIMGU_mgv1a022010mg              94.0    4e-20   
gb|ACX37089.1|  potassium channel                                     94.0    4e-20   Zygophyllum xanthoxylon
ref|XP_009348193.1|  PREDICTED: potassium channel AKT1                94.0    4e-20   
gb|KHN27401.1|  Potassium channel AKT1                                94.0    4e-20   
ref|XP_003524528.2|  PREDICTED: potassium channel AKT1-like           94.0    4e-20   
ref|XP_006475780.1|  PREDICTED: potassium channel AKT1-like           94.0    4e-20   
gb|KHG16749.1|  Potassium channel AKT1 -like protein                  93.6    4e-20   
emb|CDP04802.1|  unnamed protein product                              93.6    4e-20   
ref|XP_007204288.1|  hypothetical protein PRUPE_ppa001241mg           92.8    8e-20   
ref|XP_004287371.1|  PREDICTED: potassium channel AKT1-like           92.8    8e-20   
ref|XP_010325113.1|  PREDICTED: potassium channel AKT1-like           92.8    8e-20   
ref|XP_002324845.2|  hypothetical protein POPTR_0018s01360g           92.4    9e-20   Populus trichocarpa [western balsam poplar]
gb|AAF81249.1|AF267753_1  putative potassium channel protein Mkt1p    92.8    9e-20   Mesembryanthemum crystallinum
gb|EYU28414.1|  hypothetical protein MIMGU_mgv1a001164mg              92.8    1e-19   
gb|ADA79674.1|  shaker-like potassium channel 1                       92.4    1e-19   Populus euphratica
ref|XP_011014911.1|  PREDICTED: potassium channel AKT1-like           92.4    1e-19   
gb|AAL25649.1|AF197333_1  inward-rectifying K+ channel                92.4    1e-19   Eucalyptus camaldulensis
gb|EYU29239.1|  hypothetical protein MIMGU_mgv1a001125mg              92.4    1e-19   
ref|XP_010656397.1|  PREDICTED: potassium channel AKT1-like isofo...  92.0    2e-19   
emb|CAN80462.1|  hypothetical protein VITISV_015412                   92.0    2e-19   Vitis vinifera
emb|CBI28150.3|  unnamed protein product                              91.7    2e-19   
ref|XP_002281787.1|  PREDICTED: potassium channel AKT1-like isofo...  91.7    2e-19   Vitis vinifera
emb|CAZ64538.1|  inward rectifying shaker-like K+ channel             91.7    2e-19   Vitis vinifera
ref|XP_009396647.1|  PREDICTED: potassium channel AKT1-like           91.3    3e-19   
gb|EYU21946.1|  hypothetical protein MIMGU_mgv1a001079mg              91.3    3e-19   
ref|XP_008242715.1|  PREDICTED: potassium channel AKT1                90.5    5e-19   
gb|KHG29670.1|  Potassium channel AKT1 -like protein                  90.5    5e-19   
ref|XP_006450501.1|  hypothetical protein CICLE_v10007406mg           90.5    6e-19   
ref|XP_006483310.1|  PREDICTED: potassium channel AKT6-like           90.5    6e-19   
ref|XP_006285898.1|  hypothetical protein CARUB_v10007410mg           89.0    2e-18   
ref|XP_011026492.1|  PREDICTED: potassium channel AKT1-like           88.2    3e-18   
gb|EMT06180.1|  Potassium channel AKT1                                88.2    3e-18   
gb|AAF36832.1|AF207745_1  AKT1-like potassium channel                 88.2    4e-18   Triticum aestivum [Canadian hard winter wheat]
gb|ADK93728.1|  inward-rectifying potassium channel                   87.8    5e-18   
gb|AAN78090.2|  putative AKT1-like potassium channel                  87.0    6e-18   Hordeum vulgare [barley]
gb|KHN32491.1|  Potassium channel AKT1                                87.4    6e-18   
ref|XP_010670702.1|  PREDICTED: potassium channel AKT1-like           87.4    7e-18   
ref|XP_003545498.1|  PREDICTED: potassium channel AKT1-like           87.4    7e-18   
ref|XP_004293012.1|  PREDICTED: potassium channel AKT6-like           87.4    7e-18   
ref|XP_004136471.1|  PREDICTED: potassium channel AKT1-like           87.0    1e-17   
ref|XP_004162061.1|  PREDICTED: potassium channel AKT1-like           86.7    1e-17   
gb|ABE99810.1|  inwardly rectifying potassium channel AKT1            86.7    1e-17   Hordeum vulgare [barley]
ref|XP_008466383.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...  86.7    1e-17   
gb|KHN07100.1|  Potassium channel AKT1                                86.3    2e-17   
ref|XP_006371939.1|  k transporter family protein                     85.9    3e-17   
ref|XP_006293431.1|  hypothetical protein CARUB_v10025578mg           85.5    4e-17   
ref|XP_003526425.1|  PREDICTED: potassium channel AKT1-like           84.7    5e-17   
ref|NP_001291230.1|  potassium channel AKT1-like                      84.7    5e-17   
ref|XP_007013335.1|  K+ transporter 1                                 84.7    6e-17   
gb|EMS61998.1|  Potassium channel AKT1                                84.7    6e-17   
ref|XP_010533190.1|  PREDICTED: potassium channel AKT1                84.7    7e-17   
ref|XP_006579054.1|  PREDICTED: potassium channel AKT1-like           84.3    7e-17   
ref|XP_006412470.1|  hypothetical protein EUTSA_v10024374mg           84.3    7e-17   
ref|XP_010417806.1|  PREDICTED: potassium channel AKT1                84.3    8e-17   
ref|XP_010474523.1|  PREDICTED: potassium channel AKT1-like           84.3    9e-17   
gb|KHN06658.1|  Potassium channel AKT1                                84.0    1e-16   
ref|XP_009125933.1|  PREDICTED: probable potassium channel AKT5       84.0    1e-16   
emb|CDX75249.1|  BnaA01g04530D                                        84.0    1e-16   
emb|CDX68851.1|  BnaC01g06020D                                        83.6    1e-16   
ref|NP_194976.1|  putative potassium channel AKT5                     83.6    1e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAB64728.1|  putative potassium channel                           83.6    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002309603.2|  hypothetical protein POPTR_0006s26600g           83.2    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011019760.1|  PREDICTED: potassium channel AKT6 isoform X3     83.2    2e-16   
ref|XP_010688091.1|  PREDICTED: potassium channel AKT1-like           83.2    2e-16   
ref|XP_011019758.1|  PREDICTED: potassium channel AKT1 isoform X1     83.2    2e-16   
ref|XP_011019759.1|  PREDICTED: potassium channel AKT1 isoform X2     83.2    2e-16   
ref|XP_006408729.1|  hypothetical protein EUTSA_v10001904mg           82.8    2e-16   
gb|AAP21250.1|  At2g26650                                             82.8    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510883.1|  PREDICTED: potassium channel AKT1-like           82.8    3e-16   
dbj|BAE99592.1|  K+ transporter                                       82.4    3e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAI77627.1|  potassium uptake channel                             82.4    3e-16   Zea mays [maize]
ref|NP_180233.1|  potassium channel AKT1                              82.4    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AHZ30618.1|  potassium channel AKT1                                82.4    3e-16   
tpg|DAA58342.1|  TPA: potassium channel 1                             82.4    3e-16   
ref|XP_002458234.1|  hypothetical protein SORBIDRAFT_03g029520        82.4    4e-16   Sorghum bicolor [broomcorn]
gb|AIB06354.1|  potassium channel                                     82.4    4e-16   
gb|KFK41169.1|  hypothetical protein AALP_AA2G094700                  82.4    4e-16   
dbj|BAD94501.1|  potassium channel - protein                          80.5    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008675279.1|  PREDICTED: potassium channel AKT1-like           82.4    4e-16   
ref|XP_004501299.1|  PREDICTED: potassium channel AKT1-like           82.4    4e-16   
ref|XP_009140622.1|  PREDICTED: potassium channel AKT1                82.0    4e-16   
emb|CDY55714.1|  BnaC04g37620D                                        82.0    4e-16   
emb|CDY35373.1|  BnaA04g14740D                                        82.0    5e-16   
ref|XP_006646148.1|  PREDICTED: potassium channel AKT1-like           80.9    1e-15   
ref|XP_010432708.1|  PREDICTED: probable potassium channel AKT5       80.9    1e-15   
ref|XP_010447376.1|  PREDICTED: probable potassium channel AKT5       80.5    2e-15   
ref|XP_004498652.1|  PREDICTED: potassium channel AKT1-like isofo...  79.7    3e-15   
ref|XP_004498651.1|  PREDICTED: potassium channel AKT1-like isofo...  79.7    3e-15   
ref|XP_010546590.1|  PREDICTED: potassium channel AKT6                79.7    4e-15   
gb|AAL40894.1|  AKT1-like potassium channel                           79.3    4e-15   Oryza sativa Indica Group [Indian rice]
gb|EEC71181.1|  hypothetical protein OsI_03064                        79.3    4e-15   Oryza sativa Indica Group [Indian rice]
sp|P0C550.1|AKT1_ORYSI  RecName: Full=Potassium channel AKT1; Sho...  79.3    4e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001043713.1|  Os01g0648000                                     79.3    5e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55080.1|  hypothetical protein OsJ_02815                        79.3    5e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969311.1|  PREDICTED: potassium channel AKT1-like           79.0    6e-15   
gb|KFK32558.1|  hypothetical protein AALP_AA6G258700                  78.6    7e-15   
ref|XP_002308313.1|  k transporter family protein                     78.2    9e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006296292.1|  hypothetical protein CARUB_v10025462mg           78.2    1e-14   
ref|XP_003603438.1|  Potassium channel                                77.8    1e-14   
ref|XP_006392335.1|  hypothetical protein EUTSA_v10023250mg           77.8    1e-14   
ref|XP_006392345.1|  hypothetical protein EUTSA_v10023251mg           77.8    2e-14   
emb|CAN78157.1|  hypothetical protein VITISV_032798                   77.8    2e-14   Vitis vinifera
ref|NP_001268010.1|  inward rectifying shaker-like K+ channel         77.8    2e-14   
gb|KCW79761.1|  hypothetical protein EUGRSUZ_C011052                  74.7    2e-14   
ref|XP_010423759.1|  PREDICTED: potassium channel AKT6                77.0    3e-14   
ref|XP_010472568.1|  PREDICTED: potassium channel AKT6-like           76.6    4e-14   
emb|CBI20997.3|  unnamed protein product                              75.9    7e-14   
ref|XP_003569453.1|  PREDICTED: potassium channel AKT1 isoform X1     75.9    7e-14   
ref|XP_010445001.1|  PREDICTED: probable potassium channel AKT5       75.9    8e-14   
ref|XP_010429557.1|  PREDICTED: potassium channel AKT6                75.1    1e-13   
ref|NP_001105480.1|  potassium channel5                               75.1    1e-13   Zea mays [maize]
gb|AFW83426.1|  hypothetical protein ZEAMMB73_660957                  74.7    2e-13   
gb|AFW83425.1|  potassium channel                                     74.7    2e-13   
gb|KEH39823.1|  inwardly rectifying potassium channel subunit         73.9    3e-13   
ref|XP_010670704.1|  PREDICTED: potassium channel AKT1-like           72.8    9e-13   
emb|CDX76746.1|  BnaC08g33320D                                        72.0    1e-12   
dbj|BAC42897.1|  putative potassium transporter/channel               70.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670705.1|  PREDICTED: potassium channel AKT1 isoform X1     71.2    3e-12   
ref|XP_010670706.1|  PREDICTED: potassium channel AKT1 isoform X2     71.2    3e-12   
ref|NP_180131.3|  potassium channel AKT6                              71.2    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117222.1|  PREDICTED: potassium channel AKT6                70.9    4e-12   
emb|CDY11516.1|  BnaA09g40820D                                        70.9    4e-12   
emb|CAA12645.1|  inward potassium channel alpha subunit               70.1    6e-12   Egeria densa
ref|XP_010419342.1|  PREDICTED: potassium channel AKT6-like           69.3    1e-11   
gb|KHG28816.1|  Potassium channel AKT1 -like protein                  69.3    1e-11   
gb|KHN08108.1|  Potassium channel AKT1                                67.0    3e-11   
ref|XP_006658326.1|  PREDICTED: potassium channel AKT3-like           67.4    5e-11   
ref|XP_006841929.1|  hypothetical protein AMTR_s00042p00201380        67.0    8e-11   
ref|XP_007161234.1|  hypothetical protein PHAVU_001G053200g           67.0    9e-11   
gb|EAZ02946.1|  hypothetical protein OsI_25085                        67.0    9e-11   Oryza sativa Indica Group [Indian rice]
gb|EEE66660.1|  hypothetical protein OsJ_23288                        66.6    1e-10   Oryza sativa Japonica Group [Japonica rice]
sp|Q8H569.1|AKT3_ORYSJ  RecName: Full=Potassium channel AKT3          66.6    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001175074.1|  Os07g0175400                                     66.6    1e-10   
ref|XP_002459406.1|  hypothetical protein SORBIDRAFT_02g004160        65.9    2e-10   Sorghum bicolor [broomcorn]
ref|XP_007137050.1|  hypothetical protein PHAVU_009G095700g           64.3    7e-10   
ref|XP_004958974.1|  PREDICTED: potassium channel AKT3-like           63.9    1e-09   
ref|XP_007137051.1|  hypothetical protein PHAVU_009G095700g           63.5    1e-09   
ref|XP_010230035.1|  PREDICTED: potassium channel AKT3-like           61.6    7e-09   
ref|XP_009770131.1|  PREDICTED: potassium channel AKT1-like           60.8    1e-08   
ref|XP_008653638.1|  PREDICTED: potassium channel AKT3-like           60.1    2e-08   
gb|EMT02357.1|  Potassium channel AKT1                                58.9    5e-08   
ref|NP_001183881.1|  hypothetical protein                             57.0    1e-07   
ref|XP_002317705.1|  Potassium channel SKOR family protein            57.8    1e-07   Populus trichocarpa [western balsam poplar]
ref|NP_001291244.1|  potassium channel SKOR-like                      55.1    9e-07   
ref|XP_011003761.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...  55.1    9e-07   
gb|EPS59603.1|  potassium channel                                     54.7    1e-06   
gb|KDP25819.1|  hypothetical protein JCGZ_22541                       53.5    3e-06   
ref|XP_006580390.1|  PREDICTED: potassium channel SKOR-like           52.0    1e-05   
gb|KHN10527.1|  Potassium channel SKOR                                52.0    1e-05   
ref|XP_009360048.1|  PREDICTED: potassium channel SKOR-like           51.6    1e-05   
gb|AEY75250.1|  potassium channel                                     51.6    1e-05   
ref|XP_010108959.1|  Potassium channel SKOR                           51.2    2e-05   
ref|XP_008367611.1|  PREDICTED: potassium channel SKOR-like           50.8    2e-05   
gb|KDP37417.1|  hypothetical protein JCGZ_07944                       50.4    3e-05   
ref|XP_008240285.1|  PREDICTED: potassium channel SKOR-like           50.4    3e-05   
ref|XP_008343077.1|  PREDICTED: potassium channel SKOR-like isofo...  50.1    5e-05   
ref|XP_008343076.1|  PREDICTED: potassium channel SKOR-like isofo...  50.1    5e-05   
ref|XP_008343075.1|  PREDICTED: potassium channel SKOR-like isofo...  50.1    5e-05   
ref|XP_006421368.1|  hypothetical protein CICLE_v10004332mg           49.7    7e-05   
gb|EPS72922.1|  hypothetical protein M569_01827                       49.3    8e-05   
ref|XP_004289583.1|  PREDICTED: potassium channel SKOR-like           49.3    9e-05   
ref|XP_002533481.1|  Potassium channel SKOR, putative                 48.5    1e-04   Ricinus communis
gb|KDO49853.1|  hypothetical protein CISIN_1g0101682mg                48.5    1e-04   
tpg|DAA59730.1|  TPA: hypothetical protein ZEAMMB73_881022            48.9    1e-04   
ref|XP_006286320.1|  hypothetical protein CARUB_v100041251mg          48.5    2e-04   
gb|KDO49855.1|  hypothetical protein CISIN_1g0101682mg                48.1    2e-04   
emb|CAC05488.1|  outward rectifying potassium channel                 48.5    2e-04   Populus tremula x Populus tremuloides
emb|CBI33453.3|  unnamed protein product                              48.5    2e-04   
ref|XP_010660282.1|  PREDICTED: shaker-like potassium channel iso...  48.5    2e-04   
ref|XP_008381509.1|  PREDICTED: potassium channel SKOR                48.1    2e-04   
gb|KDO49854.1|  hypothetical protein CISIN_1g0101682mg                47.8    2e-04   
ref|XP_007210318.1|  hypothetical protein PRUPE_ppa002150mg           48.1    2e-04   
ref|NP_001268087.1|  shaker-like potassium channel                    48.1    2e-04   
ref|XP_009370080.1|  PREDICTED: potassium channel SKOR isoform X3     48.1    2e-04   
ref|XP_009370078.1|  PREDICTED: potassium channel SKOR isoform X1     48.1    2e-04   
gb|KDO38427.1|  hypothetical protein CISIN_1g0156801mg                45.8    3e-04   
ref|XP_009378953.1|  PREDICTED: potassium channel SKOR-like isofo...  47.8    3e-04   
ref|XP_009378952.1|  PREDICTED: potassium channel SKOR-like isofo...  47.8    3e-04   
ref|XP_009378951.1|  PREDICTED: potassium channel SKOR-like isofo...  47.8    3e-04   
ref|XP_006494523.1|  PREDICTED: potassium channel SKOR-like           47.0    4e-04   
emb|CAN64951.1|  hypothetical protein VITISV_022830                   47.0    4e-04   Vitis vinifera
ref|XP_004240037.1|  PREDICTED: potassium channel SKOR-like           47.0    5e-04   
ref|XP_007036947.1|  STELAR K+ outward rectifier isoform 2            47.0    5e-04   
ref|XP_007036948.1|  STELAR K+ outward rectifier isoform 3            47.0    5e-04   
ref|XP_007036946.1|  STELAR K+ outward rectifier isoform 1            47.0    5e-04   
ref|XP_004301239.1|  PREDICTED: potassium channel SKOR-like           47.0    6e-04   
ref|XP_006360380.1|  PREDICTED: potassium channel SKOR-like           47.0    6e-04   
emb|CAC05489.1|  potassium channel 2                                  46.6    7e-04   Populus tremula x Populus tremuloides
ref|XP_008229353.1|  PREDICTED: potassium channel SKOR-like           46.6    8e-04   
dbj|GAA88459.1|  ankyrin repeat protein                               46.6    0.001   
ref|XP_008244385.1|  PREDICTED: potassium channel SKOR-like           46.2    0.001   



>ref|NP_001234258.1| potassium channel [Solanum lycopersicum]
 emb|CAA65254.1| potassium channel [Solanum lycopersicum]
Length=883

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 61/87 (70%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN R+AL                DFG DPNSRDS G+VPLWEAI+GKHESV +LL
Sbjct  553  PNESDNNGRSALHIAASKGIENCVVLLLDFGADPNSRDSEGNVPLWEAIMGKHESVIQLL  612

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGAKLS+GDVG F C   EQNNL L
Sbjct  613  VDNGAKLSAGDVGHFACVAVEQNNLSL  639



>emb|CDP03401.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 62/87 (71%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+ RTAL                DFG DPNSRDS G+VPLWEA+LG+HE V +LL
Sbjct  74   PNESDNDGRTALHIAASKGNENCVLLLLDFGADPNSRDSEGNVPLWEAMLGRHELVVKLL  133

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGAK++SGDVGQF CT +E NNL+L
Sbjct  134  SDNGAKITSGDVGQFACTAAEHNNLKL  160



>ref|XP_011077973.1| PREDICTED: potassium channel AKT1-like [Sesamum indicum]
Length=886

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 63/87 (72%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                DFG D NSRDS GSVPLWEA+LG+HE+V +LL
Sbjct  559  PNESDNNGRTALHIAASKGSANCVLLLLDFGADANSRDSEGSVPLWEAMLGRHEAVVKLL  618

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGAKL++GDVG F+CT +EQNNLEL
Sbjct  619  SDNGAKLTTGDVGLFSCTAAEQNNLEL  645



>ref|NP_001275347.1| potassium channel AKT1-like [Solanum tuberosum]
 emb|CAA60016.1| potassium channel [Solanum tuberosum]
Length=883

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 61/87 (70%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+DNN R+AL                DFG DPNSRDS G+VPLWEAI+GKHESV +LL
Sbjct  553  PNEADNNGRSALHIAASKGIENCVVLLLDFGADPNSRDSEGNVPLWEAIMGKHESVIQLL  612

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+NGAKLS+GDVG F C   EQNNL L
Sbjct  613  VNNGAKLSAGDVGHFACVAVEQNNLSL  639



>ref|XP_009772048.1| PREDICTED: potassium channel AKT1 [Nicotiana sylvestris]
Length=893

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN R+AL                DFG D NSRDS G+VPLWEAILGKHE V +LL
Sbjct  556  PNESDNNGRSALHVAAATGIESCVVLLIDFGADVNSRDSEGNVPLWEAILGKHEPVIKLL  615

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGAKLS+GDVG F C  +EQNNL L
Sbjct  616  VDNGAKLSAGDVGHFACIAAEQNNLNL  642



>ref|XP_009601874.1| PREDICTED: potassium channel AKT1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=933

 Score =   105 bits (261),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 53/87 (61%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD N R+AL                DFG +PN RDS G+VPLWEAILGKH+SV RLL
Sbjct  599  PNESDKNGRSALHIAASKGLDNCVLLLLDFGANPNIRDSEGNVPLWEAILGKHDSVMRLL  658

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+NGAKLS+GDV QF C  +EQNNL L
Sbjct  659  VNNGAKLSAGDVCQFACIAAEQNNLNL  685



>ref|XP_009601872.1| PREDICTED: potassium channel AKT1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=936

 Score =   105 bits (261),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 53/87 (61%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD N R+AL                DFG +PN RDS G+VPLWEAILGKH+SV RLL
Sbjct  602  PNESDKNGRSALHIAASKGLDNCVLLLLDFGANPNIRDSEGNVPLWEAILGKHDSVMRLL  661

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+NGAKLS+GDV QF C  +EQNNL L
Sbjct  662  VNNGAKLSAGDVCQFACIAAEQNNLNL  688



>ref|XP_008464999.1| PREDICTED: potassium channel AKT1 isoform X2 [Cucumis melo]
Length=704

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 61/87 (70%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+ RT+L                D+G DPNSRDS G VPLWEAILG HE+V++LL
Sbjct  385  PNESDNSGRTSLHIAASNGNENCVLLLLDYGADPNSRDSDGVVPLWEAILGGHEAVAQLL  444

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA L SGDVG F CT +EQNNL+L
Sbjct  445  MDNGANLRSGDVGHFACTAAEQNNLQL  471



>ref|XP_009799566.1| PREDICTED: potassium channel AKT1-like isoform X2 [Nicotiana 
sylvestris]
Length=881

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                DFG DPN +DS G+VPLW+A++GKHE+  +LL
Sbjct  557  PNESDNNGRTALHIAASNGNVECILLLLDFGADPNKKDSEGNVPLWDAMVGKHEAAIKLL  616

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGAK+SSGDVGQF C   EQ +L+L
Sbjct  617  VDNGAKISSGDVGQFACFAVEQGSLDL  643



>ref|XP_009799565.1| PREDICTED: potassium channel AKT1-like isoform X1 [Nicotiana 
sylvestris]
Length=881

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                DFG DPN +DS G+VPLW+A++GKHE+  +LL
Sbjct  557  PNESDNNGRTALHIAASNGNVECILLLLDFGADPNKKDSEGNVPLWDAMVGKHEAAIKLL  616

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGAK+SSGDVGQF C   EQ +L+L
Sbjct  617  VDNGAKISSGDVGQFACFAVEQGSLDL  643



>ref|XP_009400651.1| PREDICTED: potassium channel AKT1-like [Musa acuminata subsp. 
malaccensis]
Length=890

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            P+ESDNN  TAL                DFG DPNS DS GSVPLWEAILGKHE V +LL
Sbjct  546  PSESDNNGHTALHIAASKGNEHCVRLLLDFGADPNSLDSEGSVPLWEAILGKHEQVVKLL  605

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA LS+GD+G F CT + QNN+EL
Sbjct  606  IDNGAHLSAGDMGHFACTAAAQNNIEL  632



>ref|XP_008787403.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT1-like [Phoenix 
dactylifera]
Length=881

 Score =   102 bits (255),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+ NN RTAL                D+G DPNSRD  G+VPLWEAILGKHE+V RLL
Sbjct  545  PNEATNNGRTALHTAAAKGNENCVALLLDYGADPNSRDLEGNVPLWEAILGKHEAVIRLL  604

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA +S+GDV +F C  +EQN+LEL
Sbjct  605  IDNGADISTGDVARFACMAAEQNSLEL  631



>ref|XP_009601878.1| PREDICTED: potassium channel AKT1-like isoform X6 [Nicotiana 
tomentosiformis]
Length=706

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD N R+AL                DFG +PN RDS G+VPLWEAILGKH+SV RLL
Sbjct  372  PNESDKNGRSALHIAASKGLDNCVLLLLDFGANPNIRDSEGNVPLWEAILGKHDSVMRLL  431

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+NGAKLS+GDV QF C  +EQNNL L
Sbjct  432  VNNGAKLSAGDVCQFACIAAEQNNLNL  458



>ref|XP_008464998.1| PREDICTED: potassium channel AKT1 isoform X1 [Cucumis melo]
Length=873

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 61/87 (70%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+ RT+L                D+G DPNSRDS G VPLWEAILG HE+V++LL
Sbjct  554  PNESDNSGRTSLHIAASNGNENCVLLLLDYGADPNSRDSDGVVPLWEAILGGHEAVAQLL  613

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA L SGDVG F CT +EQNNL+L
Sbjct  614  MDNGANLRSGDVGHFACTAAEQNNLQL  640



>gb|KDP32353.1| hypothetical protein JCGZ_13278 [Jatropha curcas]
Length=635

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN R+AL                DFG DPN +DS G+VPLWEA++G HESV+RLL
Sbjct  301  PNESDNNGRSALHIAASKGSQNCVLILLDFGADPNCKDSEGNVPLWEAMVGGHESVTRLL  360

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++NGA L SGDVG F CT +EQNNL L
Sbjct  361  IENGASLKSGDVGHFACTAAEQNNLNL  387



>ref|XP_011081924.1| PREDICTED: potassium channel AKT1-like [Sesamum indicum]
Length=880

 Score =   102 bits (255),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE DNN R AL                D+G +PN++DS G+VPLW+AILGKHE+V R+L
Sbjct  553  PNELDNNGRNALHLAASKGFLECVLLLLDYGANPNTKDSEGNVPLWDAILGKHEAVIRVL  612

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGA LSSGDVG F C  +EQNN+EL
Sbjct  613  VDNGATLSSGDVGGFACYAAEQNNIEL  639



>ref|XP_009601875.1| PREDICTED: potassium channel AKT1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=883

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD N R+AL                DFG +PN RDS G+VPLWEAILGKH+SV RLL
Sbjct  549  PNESDKNGRSALHIAASKGLDNCVLLLLDFGANPNIRDSEGNVPLWEAILGKHDSVMRLL  608

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+NGAKLS+GDV QF C  +EQNNL L
Sbjct  609  VNNGAKLSAGDVCQFACIAAEQNNLNL  635



>ref|XP_009601877.1| PREDICTED: potassium channel AKT1-like isoform X5 [Nicotiana 
tomentosiformis]
Length=784

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD N R+AL                DFG +PN RDS G+VPLWEAILGKH+SV RLL
Sbjct  450  PNESDKNGRSALHIAASKGLDNCVLLLLDFGANPNIRDSEGNVPLWEAILGKHDSVMRLL  509

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+NGAKLS+GDV QF C  +EQNNL L
Sbjct  510  VNNGAKLSAGDVCQFACIAAEQNNLNL  536



>ref|XP_009619489.1| PREDICTED: potassium channel AKT1-like [Nicotiana tomentosiformis]
Length=892

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN R+AL                DFG D NSRDS G+VPLWEAI GKHE V +LL
Sbjct  556  PNESDNNGRSALHVAASTGIESCVVLLLDFGADVNSRDSEGNVPLWEAISGKHEPVIKLL  615

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGAKLS+GDVG F C  +EQNNL L
Sbjct  616  VDNGAKLSAGDVGHFACVAAEQNNLNL  642



>ref|XP_011093723.1| PREDICTED: potassium channel AKT1-like [Sesamum indicum]
Length=887

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN +TAL                DFG DPNSRDS GSVPLWE++LG H+SV +LL
Sbjct  558  PNESDNNGKTALHIAASKGNENCVLLLLDFGADPNSRDSEGSVPLWESMLGGHKSVIKLL  617

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGAKL+SGD+G F+CT +EQN+L+L
Sbjct  618  SDNGAKLTSGDIGLFSCTATEQNSLDL  644



>ref|XP_008337414.1| PREDICTED: potassium channel AKT1-like [Malus domestica]
Length=585

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN R+AL                D+G DP SRDS G+VPLWEAIL  HE +++LL
Sbjct  261  PNESDNNGRSALHIASSKGSENCVLLLLDYGADPKSRDSDGNVPLWEAILNGHEQIAKLL  320

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA L SGDVGQF CT +EQN L+L
Sbjct  321  LDNGANLXSGDVGQFACTAAEQNRLDL  347



>ref|XP_007013809.1| Shaker pollen inward K+ channel isoform 1 [Theobroma cacao]
 gb|EOY31428.1| Shaker pollen inward K+ channel isoform 1 [Theobroma cacao]
Length=908

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 59/86 (69%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE DN+ RTAL                ++G DPN RDS G+VPLWEAI+GKHESV +LL
Sbjct  565  PNEQDNDGRTALHIAASNGSEHCIVLLLEYGADPNIRDSEGNVPLWEAIMGKHESVIKLL  624

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
            VDNGA LSSGDVGQF C+  EQN L+
Sbjct  625  VDNGATLSSGDVGQFACSAVEQNRLD  650



>ref|XP_004163193.1| PREDICTED: potassium channel AKT1-like [Cucumis sativus]
Length=595

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN  RT+L                D+G DPNSRDS G VPLW+AILG HE+V++LL
Sbjct  271  PNESDNTGRTSLHIAASNGNENCVLLLLDYGADPNSRDSDGVVPLWDAILGGHEAVAQLL  330

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA L SGDVG F CT +EQN L+L
Sbjct  331  IDNGANLRSGDVGHFACTAAEQNKLQL  357



>dbj|BAD81034.1| potassium channel NKT1 [Nicotiana tabacum]
Length=879

 Score =   100 bits (249),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+N RTAL                DFG DPN +DS G+VPLW+A++GKHE+  +LL
Sbjct  555  PNESDSNGRTALHIAASNGNVECILLLLDFGADPNRKDSEGNVPLWDAMVGKHEAAIKLL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGAK+SSGDVGQF C   EQ +L+L
Sbjct  615  VDNGAKISSGDVGQFACFAVEQGSLDL  641



>ref|XP_009621376.1| PREDICTED: potassium channel AKT1-like [Nicotiana tomentosiformis]
Length=879

 Score =   100 bits (249),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+N RTAL                DFG DPN +DS G+VPLW+A++GKHE+  +LL
Sbjct  555  PNESDSNGRTALHIAASNGNVECILLLLDFGADPNRKDSEGNVPLWDAMVGKHEAAIKLL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGAK+SSGDVGQF C   EQ +L+L
Sbjct  615  VDNGAKISSGDVGQFACFAVEQGSLDL  641



>gb|KHN15126.1| Potassium channel AKT1 [Glycine soja]
Length=871

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNNRRTAL                D+G DPN RD  G+VPLWEAI+G HES+S+LL
Sbjct  536  PNESDNNRRTALHIAASQGKQNCVLLLLDYGADPNIRDLEGNVPLWEAIVGGHESMSKLL  595

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA L  GDVGQF CT +EQN+L L
Sbjct  596  SENGANLQCGDVGQFACTAAEQNSLNL  622



>ref|XP_003549784.1| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=875

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNNRRTAL                D+G DPN RD  G+VPLWEAI+G HES+S+LL
Sbjct  540  PNESDNNRRTALHIAASQGKQNCVLLLLDYGADPNIRDLEGNVPLWEAIVGGHESMSKLL  599

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA L  GDVGQF CT +EQN+L L
Sbjct  600  SENGANLQCGDVGQFACTAAEQNSLNL  626



>gb|AIY55349.1| potassium channel AKT1-like protein [Glycine max]
Length=875

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNNRRTAL                D+G DPN RD  G+VPLWEAI+G HES+S+LL
Sbjct  540  PNESDNNRRTALHIAASQGKQNCVLLLLDYGADPNIRDLEGNVPLWEAIVGGHESMSKLL  599

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA L  GDVGQF CT +EQN+L L
Sbjct  600  SENGANLQCGDVGQFACTAAEQNSLNL  626



>ref|XP_004149890.1| PREDICTED: potassium channel AKT1-like [Cucumis sativus]
 gb|KGN65294.1| hypothetical protein Csa_1G303700 [Cucumis sativus]
Length=873

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN  RT+L                D+G DPNSRDS G VPLW+AILG HE+V++LL
Sbjct  554  PNESDNTGRTSLHIAASNGNENCVLLLLDYGADPNSRDSDGVVPLWDAILGGHEAVAQLL  613

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA L SGDVG F CT +EQN L+L
Sbjct  614  IDNGANLRSGDVGHFACTAAEQNKLQL  640



>ref|XP_010249975.1| PREDICTED: potassium channel AKT1-like [Nelumbo nucifera]
Length=876

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN R+AL                D+G +PNSRDS G+VPLWEAI+G+HE V +LL
Sbjct  551  PNESDNNGRSALHIAASRGSDNCVLLLLDYGANPNSRDSEGNVPLWEAIMGRHEPVIKLL  610

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA + SGDVGQF CT +EQN L+L
Sbjct  611  KDNGANIVSGDVGQFACTAAEQNKLDL  637



>ref|XP_008352270.1| PREDICTED: potassium channel AKT1-like [Malus domestica]
Length=874

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN R+AL                D+G DP SRDS G+VPLWEAIL  HE +++LL
Sbjct  550  PNESDNNGRSALHIASSKGSENCVLLLLDYGADPKSRDSDGNVPLWEAILNGHEQIAKLL  609

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA L SGDVGQF CT +EQN L+L
Sbjct  610  LDNGANLXSGDVGQFACTAAEQNRLDL  636



>ref|XP_009601876.1| PREDICTED: potassium channel AKT1-like isoform X4 [Nicotiana 
tomentosiformis]
Length=871

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  202  DNNRRTALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTS  23
            DN     LDFG +PN RDS G+VPLWEAILGKH+SV RLLV+NGAKLS+GDV QF C  +
Sbjct  557  DNCVLLLLDFGANPNIRDSEGNVPLWEAILGKHDSVMRLLVNNGAKLSAGDVCQFACIAA  616

Query  22   EQNNLEL  2
            EQNNL L
Sbjct  617  EQNNLNL  623



>ref|XP_006364280.1| PREDICTED: potassium channel AKT1-like [Solanum tuberosum]
Length=847

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+N RT L                DFG  PN +DS G+VPLW+AI+GKHE+V +LL
Sbjct  530  PNESDSNGRTVLHIAASKGSVECILLLLDFGAHPNRKDSEGNVPLWDAIVGKHEAVVKLL  589

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGA +SSGDVGQF C   EQ +L+L
Sbjct  590  VDNGATISSGDVGQFACFAVEQGSLDL  616



>ref|XP_008219894.1| PREDICTED: potassium channel AKT1-like [Prunus mume]
Length=847

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTA----------------LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D+N RTA                L+FG DPN++DS G+VPLWEAI GKHES+ +LL
Sbjct  525  PNEMDDNGRTAMHIAASNGSEHCALLLLEFGADPNTQDSEGNVPLWEAISGKHESLIKLL  584

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA ++SG+VG F C   EQNNL+L
Sbjct  585  LDNGADITSGNVGSFACAAVEQNNLQL  611



>gb|KCW81436.1| hypothetical protein EUGRSUZ_C02815 [Eucalyptus grandis]
Length=882

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTA----------------LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D N RTA                L+FG DPN +DS GSVPLW+AI+GKHESV +LL
Sbjct  522  PNEVDKNGRTAMHIAASIGSQHCVTLLLEFGGDPNIKDSEGSVPLWDAIVGKHESVIKLL  581

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA +SSG+VG F CT  EQNNLEL
Sbjct  582  SDNGATISSGEVGHFACTAVEQNNLEL  608



>ref|XP_010051190.1| PREDICTED: potassium channel AKT1-like [Eucalyptus grandis]
Length=931

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTA----------------LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D N RTA                L+FG DPN +DS GSVPLW+AI+GKHESV +LL
Sbjct  571  PNEVDKNGRTAMHIAASIGSQHCVTLLLEFGGDPNIKDSEGSVPLWDAIVGKHESVIKLL  630

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA +SSG+VG F CT  EQNNLEL
Sbjct  631  SDNGATISSGEVGHFACTAVEQNNLEL  657



>ref|XP_002514366.1| Potassium channel AKT6, putative [Ricinus communis]
 gb|EEF48320.1| Potassium channel AKT6, putative [Ricinus communis]
Length=886

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 56/87 (64%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE DNN +TAL F                G DPN +DS G+VPLWEA+LGKHESV +LL
Sbjct  560  PNEWDNNEKTALHFAASNGSDHCVMLLLEYGADPNRKDSEGNVPLWEALLGKHESVVQLL  619

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA  SS DVGQF     EQNNL+L
Sbjct  620  LDNGASFSSADVGQFALAAIEQNNLDL  646



>emb|CAG27094.1| inwardly rectifying potassium channel subunit [Daucus carota]
Length=873

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                D+G DPNSRDS G+VPLWEA+L  HE V ++L
Sbjct  547  PNESDNNNRTALHIAASKGNENCVLLLLDYGADPNSRDSEGNVPLWEAMLSNHEQVVKVL  606

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA +SSGD G F C  +EQNNL+L
Sbjct  607  ADNGAVISSGDTGYFACIAAEQNNLDL  633



>ref|XP_008809507.1| PREDICTED: potassium channel AKT1-like isoform X3 [Phoenix dactylifera]
Length=759

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                D+G +PN RDS GSVPLWEAILGKH++ ++LL
Sbjct  418  PNESDNNGHTALHIAASQGSEHCIRLLLDYGANPNCRDSEGSVPLWEAILGKHDAAAKLL  477

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA LS+GD+G F C  +EQN+LEL
Sbjct  478  RDNGANLSAGDMGLFACIAAEQNSLEL  504



>ref|XP_010925144.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT1-like [Elaeis 
guineensis]
Length=894

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                D+G +PN RDS GSVPLWEA+LGKH++V +LL
Sbjct  555  PNESDNNGHTALHIAASKGSKHCVRLLLDYGANPNCRDSEGSVPLWEAVLGKHDAVVKLL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA LS+GD+G F C  +EQN+LEL
Sbjct  615  RDNGANLSAGDMGLFACIAAEQNSLEL  641



>ref|XP_008809491.1| PREDICTED: potassium channel AKT1-like isoform X1 [Phoenix dactylifera]
Length=897

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                D+G +PN RDS GSVPLWEAILGKH++ ++LL
Sbjct  556  PNESDNNGHTALHIAASQGSEHCIRLLLDYGANPNCRDSEGSVPLWEAILGKHDAAAKLL  615

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA LS+GD+G F C  +EQN+LEL
Sbjct  616  RDNGANLSAGDMGLFACIAAEQNSLEL  642



>ref|XP_007225029.1| hypothetical protein PRUPE_ppa019987mg [Prunus persica]
 gb|EMJ26228.1| hypothetical protein PRUPE_ppa019987mg [Prunus persica]
Length=874

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTA----------------LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D+N RTA                L+FG DPN++DS G+VPLWEAI GKHES+ +LL
Sbjct  552  PNETDDNGRTAMHIAASNGSEHCALLLLEFGADPNTQDSEGNVPLWEAISGKHESLIKLL  611

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++NGA ++SG+VG F C   EQNNL+L
Sbjct  612  LNNGAHITSGNVGSFACAAVEQNNLQL  638



>ref|XP_008809499.1| PREDICTED: potassium channel AKT1-like isoform X2 [Phoenix dactylifera]
Length=896

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                D+G +PN RDS GSVPLWEAILGKH++ ++LL
Sbjct  555  PNESDNNGHTALHIAASQGSEHCIRLLLDYGANPNCRDSEGSVPLWEAILGKHDAAAKLL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA LS+GD+G F C  +EQN+LEL
Sbjct  615  RDNGANLSAGDMGLFACIAAEQNSLEL  641



>ref|XP_010925255.1| PREDICTED: potassium channel AKT1-like isoform X1 [Elaeis guineensis]
Length=762

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+ NN RTAL                D+G DPNSRD  G++PLWEAI GKHE V RLL
Sbjct  436  PNEATNNGRTALHTAASKGNENCVALLLDYGADPNSRDLEGNIPLWEAISGKHEGVIRLL  495

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA +S+GDV  F C  +EQN+LEL
Sbjct  496  IDNGADISTGDVAHFACMAAEQNSLEL  522



>ref|XP_011085793.1| PREDICTED: potassium channel AKT1-like isoform X2 [Sesamum indicum]
Length=792

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D+N R+AL                D+G DPN RDS G+VPLW+A+LGKHE V + L
Sbjct  465  PNELDSNGRSALHLAAAKGNLECVLLLLDYGADPNRRDSEGNVPLWDALLGKHEPVIKAL  524

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGA LSSGDVGQF C  +EQN+L+L
Sbjct  525  VDNGATLSSGDVGQFACFAAEQNDLDL  551



>ref|XP_010047779.1| PREDICTED: potassium channel AKT1-like isoform X1 [Eucalyptus 
grandis]
Length=885

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+ RT+L                DF  DPN RDS GSVPLWEA+LG H+ V +LL
Sbjct  555  PNESDNSGRTSLHIAASKGSENCVLLLLDFEADPNRRDSEGSVPLWEAMLGGHDPVVKLL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA +SSGDVGQF CT +EQNNL L
Sbjct  615  AENGANISSGDVGQFACTAAEQNNLYL  641



>ref|XP_010098980.1| Potassium channel AKT1 [Morus notabilis]
 gb|EXB76282.1| Potassium channel AKT1 [Morus notabilis]
Length=794

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 59/86 (69%), Gaps = 16/86 (19%)
 Frame = -3

Query  211  NESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLLV  80
            NESDN+ RTAL                D+G DPNSRDS G+VP+WEAILG H++V++LL+
Sbjct  460  NESDNSGRTALHIAASKGSENCVLLLLDYGADPNSRDSDGNVPIWEAILGGHDTVAKLLL  519

Query  79   DNGAKLSSGDVGQFTCTTSEQNNLEL  2
            DNGA L SGDVG F C  +EQNNL L
Sbjct  520  DNGAVLDSGDVGHFACIAAEQNNLNL  545



>ref|XP_010047932.1| PREDICTED: potassium channel AKT1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW79958.1| hypothetical protein EUGRSUZ_C01286 [Eucalyptus grandis]
Length=885

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+ RT+L                DF  DPN RDS GSVPLWEA+LG H+ V +LL
Sbjct  555  PNESDNSGRTSLHIAASKGSENCVLLLLDFEADPNRRDSEGSVPLWEAMLGGHDPVVKLL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA +SSGDVGQF CT +EQNNL L
Sbjct  615  AENGANISSGDVGQFACTAAEQNNLYL  641



>ref|XP_010925257.1| PREDICTED: potassium channel AKT1-like isoform X2 [Elaeis guineensis]
Length=884

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+ NN RTAL                D+G DPNSRD  G++PLWEAI GKHE V RLL
Sbjct  558  PNEATNNGRTALHTAASKGNENCVALLLDYGADPNSRDLEGNIPLWEAISGKHEGVIRLL  617

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA +S+GDV  F C  +EQN+LEL
Sbjct  618  IDNGADISTGDVAHFACMAAEQNSLEL  644



>ref|XP_006451007.1| hypothetical protein CICLE_v10007412mg [Citrus clementina]
 gb|ESR64247.1| hypothetical protein CICLE_v10007412mg [Citrus clementina]
Length=885

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                D+  DPNSRDS G+VP+WEA+LG HE+V +LL
Sbjct  557  PNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSRDSDGNVPIWEAMLGGHENVIKLL  616

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++N A ++SGDVG F CT +EQNNLEL
Sbjct  617  MENHADINSGDVGHFACTAAEQNNLEL  643



>ref|XP_009386140.1| PREDICTED: potassium channel AKT1 [Musa acuminata subsp. malaccensis]
Length=891

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                D G DPN RDS GSVPLWEAILG+HE V+++L
Sbjct  555  PNESDNNGHTALHIAASKGNEHCVCLLLDKGADPNRRDSEGSVPLWEAILGRHEQVAKVL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA+L SGD+G F CT +EQN+LEL
Sbjct  615  RENGAQLLSGDMGLFACTAAEQNSLEL  641



>ref|XP_011085715.1| PREDICTED: potassium channel AKT1-like isoform X1 [Sesamum indicum]
Length=886

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D+N R+AL                D+G DPN RDS G+VPLW+A+LGKHE V + L
Sbjct  559  PNELDSNGRSALHLAAAKGNLECVLLLLDYGADPNRRDSEGNVPLWDALLGKHEPVIKAL  618

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGA LSSGDVGQF C  +EQN+L+L
Sbjct  619  VDNGATLSSGDVGQFACFAAEQNDLDL  645



>gb|KDP33617.1| hypothetical protein JCGZ_07188 [Jatropha curcas]
Length=889

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE DNN RTAL                ++G DPN +DS G++PLWEA++G HESV +LL
Sbjct  563  PNELDNNGRTALHIAASSGSEHCVVLLLEYGADPNKKDSEGNIPLWEALMGNHESVIKLL  622

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGA LS GDV Q+    +EQNNL+L
Sbjct  623  VDNGATLSCGDVSQYALAATEQNNLDL  649



>gb|ABO15470.1| AKT1-like K+ channel LilKT1 [Lilium longiflorum]
Length=862

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  +AL                DFG DPN RDS G VPL EAILGKH+SV R+L
Sbjct  540  PNESDNNGWSALHIAASKGNESCVVLLLDFGADPNCRDSEGRVPLLEAILGKHDSVVRVL  599

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VD+GA LSSGD  Q+ C  +EQNNLEL
Sbjct  600  VDHGADLSSGDAAQYACIAAEQNNLEL  626



>ref|XP_008394036.1| PREDICTED: potassium channel AKT1-like isoform X2 [Malus domestica]
Length=880

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTA----------------LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE DNN RTA                L++  DPN +DS G+VP+WEAI GKHES+ +LL
Sbjct  553  PNEMDNNGRTAMHIAASNGNEHCALLLLEYEADPNIQDSEGNVPIWEAISGKHESLIKLL  612

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGAK++SG+VG F C   EQNNLEL
Sbjct  613  LDNGAKINSGNVGNFACAAVEQNNLEL  639



>ref|XP_007154951.1| hypothetical protein PHAVU_003G160800g [Phaseolus vulgaris]
 gb|ESW26945.1| hypothetical protein PHAVU_003G160800g [Phaseolus vulgaris]
Length=875

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNNRRTAL                D+G DPN +D  G+V LWEAI+G HESVS++L
Sbjct  540  PNESDNNRRTALHIAASHGKENCVLLLLDYGADPNIKDLDGNVALWEAIVGGHESVSKVL  599

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA L  GDVGQF CT  EQN L+L
Sbjct  600  EENGANLQCGDVGQFACTAVEQNKLKL  626



>ref|XP_002529373.1| Potassium channel AKT1, putative [Ricinus communis]
 gb|EEF33040.1| Potassium channel AKT1, putative [Ricinus communis]
Length=901

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN  R+AL                D+G DPNS+DS G+VPLWEA++G HE V++LL
Sbjct  553  PNESDNTGRSALHIAASKGSENCVLVLLDYGADPNSKDSEGNVPLWEAMVGGHEGVTKLL  612

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++NGA + SGDVG F CT +EQNNL L
Sbjct  613  MENGANIQSGDVGHFACTAAEQNNLNL  639



>ref|XP_008394035.1| PREDICTED: potassium channel AKT1-like isoform X1 [Malus domestica]
Length=891

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTA----------------LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE DNN RTA                L++  DPN +DS G+VP+WEAI GKHES+ +LL
Sbjct  564  PNEMDNNGRTAMHIAASNGNEHCALLLLEYEADPNIQDSEGNVPIWEAISGKHESLIKLL  623

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGAK++SG+VG F C   EQNNLEL
Sbjct  624  LDNGAKINSGNVGNFACAAVEQNNLEL  650



>ref|XP_008392136.1| PREDICTED: potassium channel AKT1 [Malus domestica]
Length=890

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTA----------------LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D+N RTA                L++  DPN +DS G+VPLWEAI GKHES+ +LL
Sbjct  563  PNEMDDNGRTAMHIAASNGNEHCALLLLEYEADPNIQDSEGNVPLWEAISGKHESLIKLL  622

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGAK++SG+VG F C+  EQNNLEL
Sbjct  623  LDNGAKINSGNVGNFACSAVEQNNLEL  649



>ref|XP_003609240.1| Potassium channel [Medicago truncatula]
 gb|AES91437.1| inwardly rectifying potassium channel subunit [Medicago truncatula]
Length=888

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 56/87 (64%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                D+G +PN RDS G+V LWEAILG HESV++LL
Sbjct  544  PNESDNNGRTALHIAACKGKENCVLLLLDYGANPNIRDSDGNVALWEAILGGHESVTKLL  603

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA L  GDVGQ+ CT  EQNN  L
Sbjct  604  AENGATLQIGDVGQYACTAVEQNNFNL  630



>ref|XP_009393618.1| PREDICTED: potassium channel AKT1-like [Musa acuminata subsp. 
malaccensis]
Length=897

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+N  T L                ++G DPNS DS GSVPLW+A++GKHE V  LL
Sbjct  572  PNESDSNGHTVLHIAASKGNEHCVCLLLEYGADPNSTDSEGSVPLWQAMVGKHEDVVNLL  631

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            + NGA LSSGD+G F CT +EQNNLEL
Sbjct  632  IKNGAALSSGDMGSFACTAAEQNNLEL  658



>ref|XP_010049960.1| PREDICTED: potassium channel AKT1 [Eucalyptus grandis]
Length=873

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+ RT                 LD+G DPNSRDS G+VPLWEAI G  E V +LL
Sbjct  555  PNESDNSGRTPLHIAASKGSENCALLLLDYGADPNSRDSEGNVPLWEAIKGGSEPVVKLL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA L SGDVGQF+CT +EQNNL+L
Sbjct  615  AENGANLVSGDVGQFSCTAAEQNNLDL  641



>gb|AAL25648.1|AF197332_1 inward-rectifying K+ channel [Eucalyptus camaldulensis]
Length=873

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+ RT L                D+G DPNSRDS G+VPLWEAI G  E V +LL
Sbjct  555  PNESDNSGRTPLHIAASKGSENCALLLMDYGADPNSRDSEGNVPLWEAIKGGSEPVVKLL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA L SGDVGQF+CT +EQNNL+L
Sbjct  615  AENGANLVSGDVGQFSCTAAEQNNLDL  641



>gb|KCW82789.1| hypothetical protein EUGRSUZ_C04163 [Eucalyptus grandis]
Length=892

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+ RT                 LD+G DPNSRDS G+VPLWEAI G  E V +LL
Sbjct  574  PNESDNSGRTPLHIAASKGSENCALLLLDYGADPNSRDSEGNVPLWEAIKGGSEPVVKLL  633

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA L SGDVGQF+CT +EQNNL+L
Sbjct  634  AENGANLVSGDVGQFSCTAAEQNNLDL  660



>ref|XP_004508539.1| PREDICTED: potassium channel AKT1-like isoform X1 [Cicer arietinum]
Length=891

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                D+G +PN +DS G+V LWEAILG HE V +LL
Sbjct  544  PNESDNNGRTALHIAASKGKENCVLLLLDYGANPNIKDSDGNVALWEAILGGHELVGKLL  603

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++NGA L +GDVGQ+ CT +EQNNL L
Sbjct  604  IENGATLQNGDVGQYACTAAEQNNLNL  630



>ref|XP_004508540.1| PREDICTED: potassium channel AKT1-like isoform X2 [Cicer arietinum]
Length=889

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                D+G +PN +DS G+V LWEAILG HE V +LL
Sbjct  542  PNESDNNGRTALHIAASKGKENCVLLLLDYGANPNIKDSDGNVALWEAILGGHELVGKLL  601

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++NGA L +GDVGQ+ CT +EQNNL L
Sbjct  602  IENGATLQNGDVGQYACTAAEQNNLNL  628



>gb|EYU27297.1| hypothetical protein MIMGU_mgv1a022010mg [Erythranthe guttata]
Length=900

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 59/86 (69%), Gaps = 16/86 (19%)
 Frame = -3

Query  211  NESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLLV  80
            NESDN  +TAL                D G DPNSRDS GSVPLWEA+LG H+SV +LL 
Sbjct  561  NESDNIGKTALHIAASQGNENCVLLLLDAGADPNSRDSEGSVPLWEAMLGGHKSVIKLLS  620

Query  79   DNGAKLSSGDVGQFTCTTSEQNNLEL  2
            DNGAK++ GDVG F+CT +EQNNL+L
Sbjct  621  DNGAKITGGDVGLFSCTAAEQNNLDL  646



>gb|ACX37089.1| potassium channel [Zygophyllum xanthoxylum]
Length=869

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 57/86 (66%), Gaps = 16/86 (19%)
 Frame = -3

Query  211  NESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLLV  80
            NESDNN RTAL                D+G DPNSRDS G+VPLWEA+   HE V +LL+
Sbjct  551  NESDNNGRTALHIAASKGSENCVLLLLDYGADPNSRDSEGNVPLWEAMSAGHEQVVKLLI  610

Query  79   DNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +NGA+LS GDVGQF C+ +E NNL L
Sbjct  611  ENGARLSVGDVGQFACSAAEANNLNL  636



>ref|XP_009348193.1| PREDICTED: potassium channel AKT1 [Pyrus x bretschneideri]
Length=881

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN R+AL                D G DPNSRDS G+VPLW AIL  HE +++LL
Sbjct  550  PNESDNNGRSALHIASLKGSENCVLLLLDDGADPNSRDSDGNVPLWAAILNGHEQIAKLL  609

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA L+SGD+G+F CT +EQN L+L
Sbjct  610  LDNGANLNSGDIGEFACTAAEQNRLDL  636



>gb|KHN27401.1| Potassium channel AKT1 [Glycine soja]
Length=882

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 56/87 (64%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNNRRTAL                D+G DPN RD  G+VPLWEAI+  HES+S+LL
Sbjct  533  PNESDNNRRTALHIAASQGKENCVSLLLDYGADPNIRDLEGNVPLWEAIVEGHESMSKLL  592

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA L  GDVGQF C   EQN+L L
Sbjct  593  SENGANLQCGDVGQFACNAVEQNSLNL  619



>ref|XP_003524528.2| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=893

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 56/87 (64%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNNRRTAL                D+G DPN RD  G+VPLWEAI+  HES+S+LL
Sbjct  544  PNESDNNRRTALHIAASQGKENCVSLLLDYGADPNIRDLEGNVPLWEAIVEGHESMSKLL  603

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA L  GDVGQF C   EQN+L L
Sbjct  604  SENGANLQCGDVGQFACNAVEQNSLNL  630



>ref|XP_006475780.1| PREDICTED: potassium channel AKT1-like [Citrus sinensis]
 gb|KDO80354.1| hypothetical protein CISIN_1g002763mg [Citrus sinensis]
Length=883

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                D+  DPNS DS G+VPLWEA+LG HE+V +LL
Sbjct  555  PNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKLL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++N A ++SGDVG F CT +EQNNLEL
Sbjct  615  MENHADINSGDVGHFACTAAEQNNLEL  641



>gb|KHG16749.1| Potassium channel AKT1 -like protein [Gossypium arboreum]
Length=821

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+ RTAL                D+G DPN +DS GSVPLWEA+L +H+ V++LL
Sbjct  496  PNESDNSGRTALHIAASKGSENCVLLLLDYGADPNGKDSEGSVPLWEAMLARHDKVAQLL  555

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNG  +++GDVG F CT +EQNNL L
Sbjct  556  KDNGGNINAGDVGHFACTAAEQNNLNL  582



>emb|CDP04802.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D++ RTAL                D+G DPN +DS G+VPLW+AIL KHE+V +LL
Sbjct  564  PNELDSSGRTALHIGASKGSLECVLLLLDYGADPNRKDSDGNVPLWDAILNKHEAVIKLL  623

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA +SSGDVG F C   EQNNLEL
Sbjct  624  IDNGANISSGDVGGFACFAVEQNNLEL  650



>ref|XP_007204288.1| hypothetical protein PRUPE_ppa001241mg [Prunus persica]
 gb|EMJ05487.1| hypothetical protein PRUPE_ppa001241mg [Prunus persica]
Length=874

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                DFG DPNS+D+ G+ PLWEAIL  HE +++LL
Sbjct  549  PNESDNNGRTALHIASAKGSENCVLLLLDFGADPNSKDTDGNSPLWEAILNGHEPIAKLL  608

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA  +SGDVGQF CT +EQ+ ++L
Sbjct  609  QDNGADFNSGDVGQFACTAAEQSRVDL  635



>ref|XP_004287371.1| PREDICTED: potassium channel AKT1-like [Fragaria vesca subsp. 
vesca]
Length=893

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                D+G  PNSRDS G+VPLWEAI   HE++++LL
Sbjct  547  PNESDNNGRTALHIAASQGSENCVLLLLDYGALPNSRDSEGNVPLWEAIQKDHETIAKLL  606

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGA L++GDVG F C  +E+N L+L
Sbjct  607  VDNGATLNAGDVGHFACIATEENRLDL  633



>ref|XP_010325113.1| PREDICTED: potassium channel AKT1-like [Solanum lycopersicum]
Length=862

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD++ RT L                DFG  PN +DS G+VPLW+A++GKHE+V +LL
Sbjct  545  PNESDSSGRTVLHIAASKGSVECILLLLDFGAHPNRKDSEGNVPLWDAMVGKHEAVIKLL  604

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGAK+SSGDVGQF     EQ +L+L
Sbjct  605  VDNGAKISSGDVGQFASFAVEQGSLDL  631



>ref|XP_002324845.2| hypothetical protein POPTR_0018s01360g [Populus trichocarpa]
 gb|EEF03410.2| hypothetical protein POPTR_0018s01360g [Populus trichocarpa]
Length=714

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD N RTAL                ++GVDPN +DS G+VPLWEA+ G H+SV +LL
Sbjct  386  PNESDENGRTALHIAASNGNEHCVVLLLEYGVDPNIKDSEGNVPLWEALQGNHKSVFKLL  445

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA ++SGDVGQF  T +EQNNL+L
Sbjct  446  SDNGATITSGDVGQFAYTAAEQNNLDL  472



>gb|AAF81249.1|AF267753_1 putative potassium channel protein Mkt1p [Mesembryanthemum crystallinum]
Length=870

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALD----------------FGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                 +G DPN++DS G+VPLWEAI+G+HES+ +LL
Sbjct  551  PNEADMNGRTALHISAANGNDNCAVVLLAYGADPNAKDSEGNVPLWEAIMGRHESLIKLL  610

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +D GA L+SGDV Q+ C   EQ+NLEL
Sbjct  611  IDQGATLASGDVPQYACYAVEQDNLEL  637



>gb|EYU28414.1| hypothetical protein MIMGU_mgv1a001164mg [Erythranthe guttata]
Length=874

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 58/86 (67%), Gaps = 16/86 (19%)
 Frame = -3

Query  211  NESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLLV  80
            NESD+N RTAL                DF  D NSRDS GSVPLWEA+LG+H+ V +LL 
Sbjct  563  NESDSNGRTALHIAASKGSENCVLLLLDFDADANSRDSEGSVPLWEAMLGRHQPVIKLLS  622

Query  79   DNGAKLSSGDVGQFTCTTSEQNNLEL  2
            DNGAKL++GD+  F+C  +EQNNLEL
Sbjct  623  DNGAKLTNGDIALFSCIAAEQNNLEL  648



>gb|ADA79674.1| shaker-like potassium channel 1 [Populus euphratica]
Length=880

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 56/87 (64%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTA----------------LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN R+A                LD G DPN RDS G+VPLWEA+LG HE+V+ LL
Sbjct  553  PNESDNNGRSAMHIAASKGSENCVLLLLDHGADPNCRDSDGNVPLWEAMLGGHEAVAVLL  612

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            + NGA +  GDVG F CT +E+NNL L
Sbjct  613  IQNGASIRHGDVGHFACTAAEKNNLNL  639



>ref|XP_011014911.1| PREDICTED: potassium channel AKT1-like [Populus euphratica]
Length=880

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 56/87 (64%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTA----------------LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN R+A                LD G DPN RDS G+VPLWEA+LG HE+V+ LL
Sbjct  553  PNESDNNGRSAMHIAASKGSENCVLLLLDHGADPNCRDSDGNVPLWEAMLGGHEAVAILL  612

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            + NGA +  GDVG F CT +E+NNL L
Sbjct  613  IQNGASIRHGDVGHFACTAAEKNNLNL  639



>gb|AAL25649.1|AF197333_1 inward-rectifying K+ channel [Eucalyptus camaldulensis]
Length=873

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+ RT L                D+G DPNSRDS G+VPLWEAI G  E V +LL
Sbjct  555  PNESDNSGRTPLHIAASKGSENCALLLMDYGADPNSRDSEGNVPLWEAIKGGSEPVVKLL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
              NGA L SGDVGQF+CT +EQNNL+L
Sbjct  615  ALNGANLVSGDVGQFSCTAAEQNNLDL  641



>gb|EYU29239.1| hypothetical protein MIMGU_mgv1a001125mg [Erythranthe guttata]
Length=882

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D+N R AL                D+G +PN RDS G+VPLW+A+LG HE V + L
Sbjct  559  PNELDSNGRNALNISASKGSLECVLQLLDYGANPNRRDSEGNVPLWDALLGDHEPVIKAL  618

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGA LSSGDVGQ+ C  +EQNN+EL
Sbjct  619  VDNGATLSSGDVGQYACHAAEQNNIEL  645



>ref|XP_010656397.1| PREDICTED: potassium channel AKT1-like isoform X2 [Vitis vinifera]
Length=853

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+N RTAL                D+G  PN+RDS G VPLWEA++G HESV +LL
Sbjct  533  PNESDSNGRTALHIAASKGSESCVLLLLDYGAGPNNRDSEGVVPLWEAMVGGHESVIQLL  592

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGA ++SGDVG F CT +E  NL L
Sbjct  593  VDNGANINSGDVGHFACTAAELKNLNL  619



>emb|CAN80462.1| hypothetical protein VITISV_015412 [Vitis vinifera]
Length=840

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+N RTAL                D+G  PN+RDS G VPLWEA++G HESV +LL
Sbjct  520  PNESDSNGRTALHIAASKGSESCVLLLLDYGAGPNNRDSEGVVPLWEAMVGGHESVIQLL  579

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGA ++SGDVG F CT +E  NL L
Sbjct  580  VDNGANINSGDVGHFACTAAELKNLNL  606



>emb|CBI28150.3| unnamed protein product [Vitis vinifera]
Length=872

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+N RTAL                D+G  PN+RDS G VPLWEA++G HESV +LL
Sbjct  552  PNESDSNGRTALHIAASKGSESCVLLLLDYGAGPNNRDSEGVVPLWEAMVGGHESVIQLL  611

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGA ++SGDVG F CT +E  NL L
Sbjct  612  VDNGANINSGDVGHFACTAAELKNLNL  638



>ref|XP_002281787.1| PREDICTED: potassium channel AKT1-like isoform X1 [Vitis vinifera]
Length=872

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+N RTAL                D+G  PN+RDS G VPLWEA++G HESV +LL
Sbjct  552  PNESDSNGRTALHIAASKGSESCVLLLLDYGAGPNNRDSEGVVPLWEAMVGGHESVIQLL  611

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGA ++SGDVG F CT +E  NL L
Sbjct  612  VDNGANINSGDVGHFACTAAELKNLNL  638



>emb|CAZ64538.1| inward rectifying shaker-like K+ channel [Vitis vinifera]
Length=872

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+N RTAL                D+G  PN+RDS G VPLWEA++G HESV +LL
Sbjct  552  PNESDSNGRTALHIAASKGSESCVLLLLDYGAGPNNRDSEGVVPLWEAMVGGHESVIQLL  611

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VDNGA ++SGDVG F CT +E  NL L
Sbjct  612  VDNGANINSGDVGHFACTAAELKNLNL  638



>ref|XP_009396647.1| PREDICTED: potassium channel AKT1-like [Musa acuminata subsp. 
malaccensis]
Length=888

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+N +TAL                D+G DPNS+DS GSVPLWEA+ GKH +V +LL
Sbjct  556  PNESDSNGQTALHIAASKGNENCVHLLLDYGADPNSQDSEGSVPLWEAMAGKHGNVVKLL  615

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++NGA LSSGD+G F  T +EQN+LEL
Sbjct  616  IENGANLSSGDMGLFASTAAEQNSLEL  642



>gb|EYU21946.1| hypothetical protein MIMGU_mgv1a001079mg [Erythranthe guttata]
Length=894

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 56/87 (64%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D N R+AL                +FG +PN +DS G+VPLW+AILG HE V R+L
Sbjct  558  PNELDTNGRSALHLAAAKGFLDCILLLLEFGSNPNKKDSEGNVPLWDAILGNHEPVIRVL  617

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA LSSGDVG F C  SEQN++EL
Sbjct  618  TDNGATLSSGDVGHFACFASEQNDIEL  644



>ref|XP_008242715.1| PREDICTED: potassium channel AKT1 [Prunus mume]
Length=889

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                DFG DPNS+D+ G+ PLWEAI   HE +++LL
Sbjct  549  PNESDNNGRTALHIASAKGSENCVLLLLDFGADPNSKDTDGNSPLWEAIQNGHEPIAKLL  608

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA  +SGDVGQF C+ +EQN ++L
Sbjct  609  QDNGADFNSGDVGQFACSAAEQNRVDL  635



>gb|KHG29670.1| Potassium channel AKT1 -like protein [Gossypium arboreum]
Length=872

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 56/87 (64%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALD----------------FGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                 +G DPN +DS G VPLWEA+LG H  V++LL
Sbjct  554  PNESDNNGRTALHIAASKGSENCILLLLYYGADPNYKDSEGIVPLWEALLGGHNKVAKLL  613

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA +++GDVG + CT +EQNNL L
Sbjct  614  KENGANINAGDVGHYACTAAEQNNLTL  640



>ref|XP_006450501.1| hypothetical protein CICLE_v10007406mg [Citrus clementina]
 gb|ESR63741.1| hypothetical protein CICLE_v10007406mg [Citrus clementina]
Length=887

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE DNN RTAL                ++G D N RDS GSVPLWEA+LGKHE V R+L
Sbjct  568  PNELDNNGRTALHIAASRGHEHCVVLLLEYGADLNIRDSEGSVPLWEAMLGKHEPVVRIL  627

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA +SS DVG F CT  EQN+L L
Sbjct  628  AENGALISSSDVGHFACTAIEQNDLLL  654



>ref|XP_006483310.1| PREDICTED: potassium channel AKT6-like [Citrus sinensis]
 gb|KDO61656.1| hypothetical protein CISIN_1g002728mg [Citrus sinensis]
Length=887

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE DNN RTAL                ++G D N RDS GSVPLWEA+LGKHE V R+L
Sbjct  568  PNELDNNGRTALHIAASRGHEHCVVLLLEYGADLNIRDSEGSVPLWEAMLGKHEPVVRIL  627

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA +SS DVG F CT  EQN+L L
Sbjct  628  AENGALISSSDVGHFACTAIEQNDLLL  654



>ref|XP_006285898.1| hypothetical protein CARUB_v10007410mg [Capsella rubella]
 gb|EOA18796.1| hypothetical protein CARUB_v10007410mg [Capsella rubella]
Length=880

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 55/86 (64%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                + G DPN RDS G+VPLWEAI+G+HE +++LL
Sbjct  568  PNETDTNGRTALHIAASKGKQYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHEEIAKLL  627

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             +NGA LS   VGQF+C   EQN+L+
Sbjct  628  SENGATLSFDTVGQFSCLAVEQNSLD  653



>ref|XP_011026492.1| PREDICTED: potassium channel AKT1-like [Populus euphratica]
Length=897

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD N RTAL                ++GVDPN +DS G+VPLWEA+ G H+SV +LL
Sbjct  569  PNESDENGRTALHIAASNGNEHCVVLLLEYGVDPNIKDSEGNVPLWEALQGNHKSVFKLL  628

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             DNGA ++SGDVGQF  T + QNN++L
Sbjct  629  SDNGATITSGDVGQFAYTAAGQNNVDL  655



>gb|EMT06180.1| Potassium channel AKT1 [Aegilops tauschii]
Length=884

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD + RTAL                ++G DPN+RDS G VPLWEA+  KH++V +LL
Sbjct  508  PNESDQDGRTALHIAASKGNEQCVKLLLEYGADPNARDSEGKVPLWEAVYAKHDTVVQLL  567

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V  GA+LSSGD   + CT  EQNN+EL
Sbjct  568  VKGGAELSSGDTSLYACTAVEQNNIEL  594



>gb|AAF36832.1|AF207745_1 AKT1-like potassium channel [Triticum aestivum]
Length=897

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD + RTAL                ++G DPN+RDS G VPLWEA+  KH++V +LL
Sbjct  567  PNESDQDGRTALHIAASKGNEQCVKLLLEYGADPNARDSEGKVPLWEAVYAKHDTVVQLL  626

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V  GA+LSSGD   + CT  EQNN+EL
Sbjct  627  VKGGAELSSGDTSLYACTAVEQNNIEL  653



>gb|ADK93728.1| inward-rectifying potassium channel [Puccinellia tenuiflora]
Length=897

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD + RTAL                D+G DPN+RDS G VPLWEA+  KH++V +LL
Sbjct  566  PNESDQDGRTALHIAASTGNEQCVKLLLDYGADPNARDSEGKVPLWEAMYAKHDTVVQLL  625

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V  GA LS GD G + C   EQNN+EL
Sbjct  626  VKGGADLSLGDTGLYCCLAIEQNNIEL  652



>gb|AAN78090.2| putative AKT1-like potassium channel [Hordeum vulgare]
Length=593

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD + RTAL                D+G DPN+RDS G VPLWEA+  KH++V +LL
Sbjct  263  PNESDQDGRTALHIAASKGNEQCVKLLLDYGADPNARDSEGKVPLWEAVYAKHDTVVQLL  322

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +  GA+LS+GD   + CT  EQN++EL
Sbjct  323  IKGGAELSAGDTSLYACTAVEQNDIEL  349



>gb|KHN32491.1| Potassium channel AKT1 [Glycine soja]
Length=864

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D N +TAL                + G +PN +D  G+VPLWEAI G H+SV +LL
Sbjct  555  PNEPDKNGKTALHITASKGRDHCVALLLEHGANPNIKDLDGNVPLWEAIKGGHDSVMKLL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA +SSGDVG   C   EQNNLEL
Sbjct  615  IDNGADISSGDVGSLACVGVEQNNLEL  641



>ref|XP_010670702.1| PREDICTED: potassium channel AKT1-like [Beta vulgaris subsp. 
vulgaris]
Length=880

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALD----------------FGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                 +G DPN++DS G+VPLW+AI+G+HE++ +LL
Sbjct  561  PNEADMNGRTALHIAAANGSEHCAIVLLAYGADPNTKDSEGNVPLWDAIMGRHEALIKLL  620

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VD GA L+SGDV Q+ C   E++N EL
Sbjct  621  VDQGATLASGDVPQYACHAVEEDNFEL  647



>ref|XP_003545498.1| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=875

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D N +TAL                + G +PN +D  G+VPLWEAI G H+SV +LL
Sbjct  566  PNEPDKNGKTALHITASKGRDHCVALLLEHGANPNIKDLDGNVPLWEAIKGGHDSVMKLL  625

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA +SSGDVG   C   EQNNLEL
Sbjct  626  IDNGADISSGDVGSLACVGVEQNNLEL  652



>ref|XP_004293012.1| PREDICTED: potassium channel AKT6-like [Fragaria vesca subsp. 
vesca]
Length=880

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTA----------------LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D+N RTA                L++G DPN +D   +VPLWEAI+GKHES+ +LL
Sbjct  557  PNETDHNGRTAMHIAASIGSKHCVTLLLEYGGDPNIKDCEENVPLWEAIIGKHESLIKLL  616

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++NGA++S+G VG + CT  EQN+LEL
Sbjct  617  LENGAEISAGGVGHYACTAVEQNSLEL  643



>ref|XP_004136471.1| PREDICTED: potassium channel AKT1-like [Cucumis sativus]
Length=890

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -3

Query  181  LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            L++G DPN RD  G+VP+W+AI GKHES+ ++L+DNGA +SSGDV QF CT +E+N+L++
Sbjct  594  LEYGADPNQRDFEGNVPVWQAIQGKHESIVKVLMDNGANISSGDVAQFACTAAEKNSLDM  653



>ref|XP_004162061.1| PREDICTED: potassium channel AKT1-like [Cucumis sativus]
 gb|KGN60116.1| Potassium channel AKT1 [Cucumis sativus]
Length=896

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -3

Query  181  LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            L++G DPN RD  G+VP+W+AI GKHES+ ++L+DNGA +SSGDV QF CT +E+N+L++
Sbjct  594  LEYGADPNQRDFEGNVPVWQAIQGKHESIVKVLMDNGANISSGDVAQFACTAAEKNSLDM  653



>gb|ABE99810.1| inwardly rectifying potassium channel AKT1 [Hordeum vulgare]
 dbj|BAJ96585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=898

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD + RTAL                D+G DPN+RDS G VPLWEA+  KH++V +LL
Sbjct  568  PNESDQDGRTALHIAASKGNEQCVKLLLDYGADPNARDSEGKVPLWEAVYAKHDTVVQLL  627

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +  GA+LS+GD   + CT  EQN++EL
Sbjct  628  IKGGAELSAGDTSLYACTAVEQNDIEL  654



>ref|XP_008466383.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT1 [Cucumis 
melo]
Length=899

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -3

Query  181  LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            L++G +PN RD  G+VP+W+AI GKHES+ +LL+DNGAK+SSG+V QF CT +EQN++++
Sbjct  597  LEYGANPNQRDFEGNVPVWQAIQGKHESIVKLLMDNGAKISSGNVAQFACTAAEQNSIDM  656



>gb|KHN07100.1| Potassium channel AKT1 [Glycine soja]
Length=880

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D + +TAL                ++G DPNS+D  GSVPLWEA+ G+HESV ++L
Sbjct  565  PNELDRSGKTALHIAASKGNEHCVNLLLEYGADPNSKDMDGSVPLWEAMKGRHESVMKIL  624

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA +S  D G   C+  EQNN+EL
Sbjct  625  IDNGADISFADAGHLACSAVEQNNMEL  651



>ref|XP_006371939.1| k transporter family protein [Populus trichocarpa]
 gb|ERP49736.1| k transporter family protein [Populus trichocarpa]
Length=877

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 16/80 (20%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D+N R+AL                D+GVDPN RDS G+VPLWEA+LG HES+++LL
Sbjct  554  PNEADHNGRSALHIAASKGSENCVLLLLDYGVDPNCRDSEGNVPLWEAMLGGHESLTKLL  613

Query  82   VDNGAKLSSGDVGQFTCTTS  23
            ++NGA +  G+VG F CT +
Sbjct  614  IENGASIHHGEVGHFACTAA  633



>ref|XP_006293431.1| hypothetical protein CARUB_v10025578mg [Capsella rubella]
 gb|EOA26329.1| hypothetical protein CARUB_v10025578mg [Capsella rubella]
Length=862

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RT                 L+F  DPN RD+ GSVPLWEA++  HE V +LL
Sbjct  546  PNESDNNGRTPLHIAASKGSLNCVLLLLEFNADPNCRDAEGSVPLWEAMVEGHEKVVKLL  605

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +++G+ + +GDVG F CT +EQ NL+L
Sbjct  606  LEHGSTIDAGDVGHFACTAAEQGNLKL  632



>ref|XP_003526425.1| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=879

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D + +TAL                ++G DPNS+D  GSVPLWEA+ G+HESV ++L
Sbjct  564  PNELDRSGKTALHIAASKGNEHCVNLLLEYGADPNSKDMDGSVPLWEAMKGRHESVMKIL  623

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA +S  D G   C+  EQNN+EL
Sbjct  624  IDNGADISFADAGHLACSAVEQNNMEL  650



>ref|NP_001291230.1| potassium channel AKT1-like [Populus euphratica]
 gb|ADA79675.1| shaker-like potassium channel 2 [Populus euphratica]
Length=877

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 16/80 (20%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+DNN R+AL                D+G DPN RDS G++PLWEA+LG HES+++LL
Sbjct  554  PNEADNNGRSALHIAASKGSENCVLLLLDYGADPNCRDSEGNIPLWEAMLGGHESLTKLL  613

Query  82   VDNGAKLSSGDVGQFTCTTS  23
            ++NGA +  G+VG F CT +
Sbjct  614  IENGASIHHGEVGHFACTAA  633



>ref|XP_007013335.1| K+ transporter 1 [Theobroma cacao]
 gb|EOY30954.1| K+ transporter 1 [Theobroma cacao]
Length=885

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 54/87 (62%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RTAL                D+G DPN +DS G VPLWEA+   H   ++LL
Sbjct  553  PNESDNNGRTALHIAAMKGSENCVLLLLDYGADPNCKDSEGIVPLWEAMSAGHNKATKLL  612

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA +++GDVG + CT +EQNN+ L
Sbjct  613  KENGANINTGDVGHYACTAAEQNNIVL  639



>gb|EMS61998.1| Potassium channel AKT1 [Triticum urartu]
Length=742

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 44/103 (43%), Positives = 55/103 (53%), Gaps = 32/103 (31%)
 Frame = -3

Query  214  PNESDNNRRTAL--------------------------------DFGVDPNSRDS*GSVP  131
            PNESD + RTAL                                ++G DPN+RDS G VP
Sbjct  415  PNESDQDGRTALIFVKQESDRVHFYDQQHIAASKGNEQCVKLLLEYGADPNARDSEGKVP  474

Query  130  LWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            LWEA+  KH++V +LLV  GA+LSSGD   + CT  EQNN+EL
Sbjct  475  LWEAVYAKHDTVVQLLVKGGAELSSGDTSLYACTAVEQNNIEL  517



>ref|XP_010533190.1| PREDICTED: potassium channel AKT1 [Tarenaya hassleriana]
Length=888

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 54/87 (62%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RT                 LD   DPN RD+ G+VPLWEA+ G HE V++ L
Sbjct  546  PNESDNNGRTPLHIAASKGSLNCVLLLLDHHADPNCRDNEGNVPLWEAMQGWHEKVAKAL  605

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++NGA + +GDVG F CT +EQN L+L
Sbjct  606  LENGATIEAGDVGHFACTAAEQNKLDL  632



>ref|XP_006579054.1| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=878

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 40/87 (46%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D N +T L                ++G DPNS+D  GSVPLWEA+ G+HESV ++L
Sbjct  565  PNELDKNGKTTLHIAASKGNEHCVNLLLEYGADPNSKDMDGSVPLWEAMKGRHESVMKIL  624

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA +S  + G   C+  EQNN+EL
Sbjct  625  IDNGADISLANAGHLACSAVEQNNMEL  651



>ref|XP_006412470.1| hypothetical protein EUTSA_v10024374mg [Eutrema salsugineum]
 gb|ESQ53923.1| hypothetical protein EUTSA_v10024374mg [Eutrema salsugineum]
Length=875

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                + G DPN RDS G+VPLWEAI+G+HE +++LL
Sbjct  564  PNETDKNGRTALHIAASKGSQYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHEEIAKLL  623

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             DNGA LS   VG F+C   EQN+L+
Sbjct  624  SDNGATLSFDTVGYFSCLAVEQNSLD  649



>ref|XP_010417806.1| PREDICTED: potassium channel AKT1 [Camelina sativa]
Length=864

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RT                 L++  DPN RD+ GSVPLWEA++  HE V ++L
Sbjct  547  PNESDNNGRTPLHIAASKGSLNCVLLLLEYNADPNCRDTEGSVPLWEAMVEGHEKVVKVL  606

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++NG+ + +GDVG F CT +EQ NL+L
Sbjct  607  LENGSSIDAGDVGHFACTAAEQGNLKL  633



>ref|XP_010474523.1| PREDICTED: potassium channel AKT1-like [Camelina sativa]
Length=1253

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RT                 L++  DPN RD+ GSVPLWEA++  HE V ++L
Sbjct  547  PNESDNNGRTPLHIAASKGSLNCVLLLLEYNADPNCRDTEGSVPLWEAMVEGHEKVVKVL  606

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++NG+ + +GDVG F CT +EQ NL+L
Sbjct  607  LENGSTIDAGDVGHFACTAAEQGNLKL  633


 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214   PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
             PNESDNN RT                 L++  DPN RD+ GSVPLWEA++  HE V ++L
Sbjct  936   PNESDNNGRTPLHIAASKGSLNCVLLLLEYNADPNCRDTEGSVPLWEAMVEGHEKVVKVL  995

Query  82    VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             ++NG+ + +GDVG F CT +EQ NL+L
Sbjct  996   LENGSTIDAGDVGHFACTAAEQGNLKL  1022



>gb|KHN06658.1| Potassium channel AKT1 [Glycine soja]
Length=850

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D + +TAL                + G +PN +D  G+VPLWEAI G H+SV +LL
Sbjct  541  PNEPDKDGKTALHIAASKGKDHCVALLLEHGANPNIKDLDGNVPLWEAIKGGHDSVMKLL  600

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGA +SSGDVG   C +  QNNLEL
Sbjct  601  IDNGADISSGDVGSLACISVAQNNLEL  627



>ref|XP_009125933.1| PREDICTED: probable potassium channel AKT5 [Brassica rapa]
Length=876

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                + G DPN +DS GSVPLWEAI G+HE +S+LL
Sbjct  566  PNETDKNGRTALHIAASKGCHYCVVLLLEHGADPNIKDSEGSVPLWEAIFGRHEEISKLL  625

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             DNGAKLS   V  F+C   EQ++L+
Sbjct  626  WDNGAKLSPDTVAHFSCLAVEQSSLD  651



>emb|CDX75249.1| BnaA01g04530D [Brassica napus]
Length=876

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                + G DPN +DS GSVPLWEAI G+HE +S+LL
Sbjct  566  PNETDKNGRTALHIAASKGCHYCVVLLLEHGADPNIKDSEGSVPLWEAIFGRHEEISKLL  625

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             DNGAKLS   V  F+C   EQ++L+
Sbjct  626  WDNGAKLSPDTVAHFSCLAVEQSSLD  651



>emb|CDX68851.1| BnaC01g06020D [Brassica napus]
Length=857

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 52/86 (60%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                + G DPN +DS GSVPLWEAI G+HE +S+LL
Sbjct  547  PNETDKNGRTALHIAASKGCHYCVVLLLEHGADPNIKDSEGSVPLWEAIFGRHEEISKLL  606

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             DNGAKLS   V  F+C   E N+L+
Sbjct  607  WDNGAKLSPDTVSHFSCLAVEHNSLD  632



>ref|NP_194976.1| putative potassium channel AKT5 [Arabidopsis thaliana]
 sp|Q9SCX5.2|AKT5_ARATH RecName: Full=Probable potassium channel AKT5 [Arabidopsis thaliana]
 emb|CAA22577.2| potassium channel-protein [Arabidopsis thaliana]
 emb|CAB79967.1| potassium channel-protein [Arabidopsis thaliana]
 gb|AEE86069.1| putative potassium channel AKT5 [Arabidopsis thaliana]
Length=880

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 51/85 (60%), Gaps = 16/85 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                + G DPN RDS GSVPLWEAI+G+HE  ++LL
Sbjct  568  PNETDKNGRTALHIAASKGSQYCVVLLLEHGADPNIRDSEGSVPLWEAIIGRHEENAKLL  627

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNL  8
             +NGA LS   VG F+C    QNNL
Sbjct  628  SENGATLSFDTVGYFSCLAVGQNNL  652



>emb|CAB64728.1| putative potassium channel [Arabidopsis thaliana]
Length=880

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 51/85 (60%), Gaps = 16/85 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                + G DPN RDS GSVPLWEAI+G+HE  ++LL
Sbjct  568  PNETDKNGRTALHIAASKGSQYCVVLLLEHGADPNIRDSEGSVPLWEAIIGRHEENAKLL  627

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNL  8
             +NGA LS   VG F+C    QNNL
Sbjct  628  SENGATLSFDTVGYFSCLAVGQNNL  652



>ref|XP_002309603.2| hypothetical protein POPTR_0006s26600g [Populus trichocarpa]
 gb|EEE93126.2| hypothetical protein POPTR_0006s26600g [Populus trichocarpa]
Length=706

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D+N RTAL                ++G DPN +DS G+VP+WEA+ G H++V +LL
Sbjct  388  PNELDDNGRTALHIAASNGNEHCVVLLLEYGADPNIKDSEGNVPVWEALQGNHKNVIKLL  447

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA ++SGDVGQF  T  EQNN++L
Sbjct  448  SENGAAITSGDVGQFALTAVEQNNIDL  474



>ref|XP_011019760.1| PREDICTED: potassium channel AKT6 isoform X3 [Populus euphratica]
Length=812

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D+N RTAL                ++G DPN +DS G+VP+WEA+ G H++V +LL
Sbjct  494  PNELDDNGRTALHIAASNGNEHCVVLLLEYGADPNIKDSEGNVPVWEALQGNHKNVIKLL  553

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA ++SGDVGQF  T  EQNN++L
Sbjct  554  SENGAAITSGDVGQFALTAVEQNNIDL  580



>ref|XP_010688091.1| PREDICTED: potassium channel AKT1-like [Beta vulgaris subsp. 
vulgaris]
Length=912

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 56/87 (64%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNES+++ RTAL                D+G DP+ RD  GS+PLW+A+ G HE+V +LL
Sbjct  560  PNESEDSGRTALHIAASNGSEKCVNLLLDYGADPDCRDQEGSIPLWDAMQGGHEAVVKLL  619

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             ++GA++  GDVGQ+ C  +EQNNL L
Sbjct  620  REHGARICVGDVGQYACLATEQNNLNL  646



>ref|XP_011019758.1| PREDICTED: potassium channel AKT1 isoform X1 [Populus euphratica]
Length=894

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D+N RTAL                ++G DPN +DS G+VP+WEA+ G H++V +LL
Sbjct  576  PNELDDNGRTALHIAASNGNEHCVVLLLEYGADPNIKDSEGNVPVWEALQGNHKNVIKLL  635

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA ++SGDVGQF  T  EQNN++L
Sbjct  636  SENGAAITSGDVGQFALTAVEQNNIDL  662



>ref|XP_011019759.1| PREDICTED: potassium channel AKT1 isoform X2 [Populus euphratica]
Length=881

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D+N RTAL                ++G DPN +DS G+VP+WEA+ G H++V +LL
Sbjct  576  PNELDDNGRTALHIAASNGNEHCVVLLLEYGADPNIKDSEGNVPVWEALQGNHKNVIKLL  635

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA ++SGDVGQF  T  EQNN++L
Sbjct  636  SENGAAITSGDVGQFALTAVEQNNIDL  662



>ref|XP_006408729.1| hypothetical protein EUTSA_v10001904mg [Eutrema salsugineum]
 gb|ESQ50182.1| hypothetical protein EUTSA_v10001904mg [Eutrema salsugineum]
Length=856

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN+SDNN RT                 LD+  DPN RD+ G+VPLWEA++  HE V ++L
Sbjct  544  PNDSDNNGRTPLHISASKGSLNCVLLLLDYHADPNCRDAEGNVPLWEAMVEGHERVVKVL  603

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++NG  + +GDVG F CT +EQ+NL+L
Sbjct  604  LENGGTIKAGDVGHFACTAAEQSNLKL  630



>gb|AAP21250.1| At2g26650 [Arabidopsis thaliana]
Length=752

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RT                 L++  DPN RD+ GSVPLWEA++  HE V ++L
Sbjct  439  PNESDNNGRTPLHIAASKGTLNCVLLLLEYHADPNCRDAEGSVPLWEAMVEGHEKVVKVL  498

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +++G+ + +GDVG F CT +EQ NL+L
Sbjct  499  LEHGSTIDAGDVGHFACTAAEQGNLKL  525



>ref|XP_010510883.1| PREDICTED: potassium channel AKT1-like [Camelina sativa]
Length=864

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RT                 L++  DPN RD+ GSVPLWEA++  HE V ++L
Sbjct  547  PNESDNNGRTPLHIAASKGSLNCVLLLLEYNADPNCRDTEGSVPLWEAMVEGHEKVVKVL  606

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            ++NG+ + +GDVG F CT +EQ +L+L
Sbjct  607  LENGSTIDAGDVGHFACTAAEQGHLKL  633



>dbj|BAE99592.1| K+ transporter [Arabidopsis thaliana]
Length=779

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RT                 L++  DPN RD+ GSVPLWEA++  HE V ++L
Sbjct  466  PNESDNNGRTPLHIAASKGTLNCVLLLLEYHADPNCRDAEGSVPLWEAMVEGHEKVVKVL  525

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +++G+ + +GDVG F CT +EQ NL+L
Sbjct  526  LEHGSTIDAGDVGHFACTAAEQGNLKL  552



>emb|CAI77627.1| potassium uptake channel [Zea mays]
Length=885

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                D+G DPN+RDS G VPLWEA+  KH +V  LL
Sbjct  555  PNESDNNGHTALHIAASKGDEQCVKLLLDYGADPNARDSEGKVPLWEALCEKHNAVVELL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V++GA+LSSGD   + C   E+N+ EL
Sbjct  615  VESGAELSSGDTALYACIAVEENDAEL  641



>ref|NP_180233.1| potassium channel AKT1 [Arabidopsis thaliana]
 sp|Q38998.2|AKT1_ARATH RecName: Full=Potassium channel AKT1 [Arabidopsis thaliana]
 gb|AAA96810.1| AKT1 [Arabidopsis thaliana]
 emb|CAA44693.1| Potassium tranporter [Arabidopsis thaliana]
 gb|AAB95299.1| K+ transporter, AKT1 [Arabidopsis thaliana]
 dbj|BAH20386.1| AT2G26650 [Arabidopsis thaliana]
 gb|AEC07870.1| potassium channel AKT1 [Arabidopsis thaliana]
Length=857

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RT                 L++  DPN RD+ GSVPLWEA++  HE V ++L
Sbjct  544  PNESDNNGRTPLHIAASKGTLNCVLLLLEYHADPNCRDAEGSVPLWEAMVEGHEKVVKVL  603

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +++G+ + +GDVG F CT +EQ NL+L
Sbjct  604  LEHGSTIDAGDVGHFACTAAEQGNLKL  630



>gb|AHZ30618.1| potassium channel AKT1 [Gossypium hirsutum]
Length=875

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 16/86 (19%)
 Frame = -3

Query  211  NESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLV  80
            NESD+N RT                 LD   DPN +DS GSVPLWEAILG H+++++LL 
Sbjct  547  NESDDNGRTPLHIAASKGSENCVLILLDHNADPNIKDSEGSVPLWEAILGGHDNIAKLLK  606

Query  79   DNGAKLSSGDVGQFTCTTSEQNNLEL  2
            DNGA ++ GDVG F C  +EQN+L L
Sbjct  607  DNGANINVGDVGHFACIAAEQNDLNL  632



>tpg|DAA58342.1| TPA: potassium channel 1 [Zea mays]
Length=790

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                D+G DPN+RDS G VPLWEA+  KH +V  LL
Sbjct  462  PNESDNNGHTALHIAASKGDEQCVKLLLDYGADPNARDSEGKVPLWEALCEKHNAVIELL  521

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V++GA+LSSGD   + C   E+N+ EL
Sbjct  522  VESGAELSSGDTALYACIAVEENDAEL  548



>ref|XP_002458234.1| hypothetical protein SORBIDRAFT_03g029520 [Sorghum bicolor]
 gb|EES03354.1| hypothetical protein SORBIDRAFT_03g029520 [Sorghum bicolor]
Length=885

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                D+G DPN+RDS G VPLWEA+  KH +V  LL
Sbjct  555  PNESDNNGHTALHIAASKGDEQCVKLLLDYGADPNARDSEGKVPLWEALCEKHNAVIELL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V++GA+LSSGD   + C   E+N+ EL
Sbjct  615  VESGAELSSGDTALYACIAVEENDAEL  641



>gb|AIB06354.1| potassium channel [Saccharum hybrid cultivar]
Length=885

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                D+G DPN+RDS G VPLWEA+  KH +V  LL
Sbjct  555  PNESDNNGHTALHIAASKGDEQCVKLLLDYGADPNARDSEGKVPLWEALCEKHNAVIELL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V++GA+LSSGD   + C   E+N+ EL
Sbjct  615  VESGAELSSGDTALYACIAVEENDAEL  641



>gb|KFK41169.1| hypothetical protein AALP_AA2G094700 [Arabis alpina]
Length=857

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN+SDNN RT                 L++  DPN RD+ G+VPLWEA++  HE V ++L
Sbjct  541  PNDSDNNGRTPLHIAASKGSVNCVLLLLEYHADPNCRDAEGNVPLWEAMVEGHEKVVKVL  600

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +++GA + +GDVG F CT +EQNN++L
Sbjct  601  MESGATIDAGDVGHFACTAAEQNNMKL  627



>dbj|BAD94501.1| potassium channel - protein [Arabidopsis thaliana]
Length=372

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 51/85 (60%), Gaps = 16/85 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                + G DPN RDS GSVPLWEAI+G+HE  ++LL
Sbjct  60   PNETDKNGRTALHIAASKGSQYCVVLLLEHGADPNIRDSEGSVPLWEAIIGRHEENAKLL  119

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNL  8
             +NGA LS   VG F+C    QNNL
Sbjct  120  SENGATLSFDTVGYFSCLAVGQNNL  144



>ref|XP_008675279.1| PREDICTED: potassium channel AKT1-like [Zea mays]
Length=883

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                D+G DPN+RDS G VPLWEA+  KH +V  LL
Sbjct  555  PNESDNNGHTALHIAASKGDEQCVKLLLDYGADPNARDSEGKVPLWEALCEKHNAVIELL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V++GA+LSSGD   + C   E+N+ EL
Sbjct  615  VESGAELSSGDTALYACIAVEENDAEL  641



>ref|XP_004501299.1| PREDICTED: potassium channel AKT1-like [Cicer arietinum]
Length=891

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/87 (45%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTA----------------LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N +TA                L FG DPNS+D  GSVPLWEA++G H+S+ ++L
Sbjct  566  PNEADKNGKTAMHIAAFNGNEHCITLLLQFGADPNSKDLDGSVPLWEAMVGGHKSIKKIL  625

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +D+GA +   DVG   C  +E NN+EL
Sbjct  626  IDSGADIFCTDVGHLACHAAENNNIEL  652



>ref|XP_009140622.1| PREDICTED: potassium channel AKT1 [Brassica rapa]
Length=860

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RT                 L++  DPN RD+ G++PLWEA++  HE + ++L
Sbjct  544  PNESDNNGRTPLHIAASKGSLNCVLHLLEYHADPNCRDAEGNIPLWEAMVEGHEKIVKVL  603

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +++GA + +GDVG F CT +EQ NL+L
Sbjct  604  LEHGATIEAGDVGHFACTAAEQGNLKL  630



>emb|CDY55714.1| BnaC04g37620D [Brassica napus]
Length=861

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RT                 L++  DPN RD+ G++PLWEA++  HE + ++L
Sbjct  545  PNESDNNGRTPLHIAASKGSLNCVLHLLEYHADPNCRDAEGNIPLWEAMVEGHEKIVKVL  604

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +++GA + +GDVG F CT +EQ NL+L
Sbjct  605  LEHGATIEAGDVGHFACTAAEQGNLKL  631



>emb|CDY35373.1| BnaA04g14740D [Brassica napus]
Length=860

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRT----------------ALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN RT                 L++  DPN RD+ G++PLWEA++  HE + ++L
Sbjct  544  PNESDNNGRTPLHIAASKGSLNCVLHLLEYHADPNCRDAEGNIPLWEAMVEGHEKIVKVL  603

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +++GA + +GDVG F CT +EQ NL+L
Sbjct  604  LEHGATIEAGDVGHFACTAAEQGNLKL  630



>ref|XP_006646148.1| PREDICTED: potassium channel AKT1-like [Oryza brachyantha]
Length=890

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+  TAL                ++G DPN+RDS G VPLWEA+  KH +V +LL
Sbjct  557  PNESDNDGHTALHIAASKGNEQCVRLLLEYGADPNARDSEGKVPLWEALCEKHAAVVQLL  616

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+ GA LSSGD G + C   E++N EL
Sbjct  617  VEGGADLSSGDTGLYACIAVEESNAEL  643



>ref|XP_010432708.1| PREDICTED: probable potassium channel AKT5 [Camelina sativa]
Length=882

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 51/86 (59%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                  G DPN RDS G+VPLWEAI G+HE +++LL
Sbjct  569  PNETDTNGRTALHIAASKGNQYCVVLLLEKGADPNIRDSEGNVPLWEAISGRHEEIAKLL  628

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             +NGA LS   VG F+C    QN+L+
Sbjct  629  SENGATLSFDTVGHFSCLAVGQNSLD  654



>ref|XP_010447376.1| PREDICTED: probable potassium channel AKT5 [Camelina sativa]
Length=883

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 51/86 (59%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                  G DPN RDS G+VPLWEAI G+HE +++LL
Sbjct  570  PNETDTNGRTALHIAASKGNQYCVALLLEKGADPNIRDSEGNVPLWEAISGRHEGIAKLL  629

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             +NGA LS   VG F+C    QN+L+
Sbjct  630  SENGATLSLDTVGHFSCLAVGQNSLD  655



>ref|XP_004498652.1| PREDICTED: potassium channel AKT1-like isoform X2 [Cicer arietinum]
Length=886

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  181  LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            L+FG DPN +DS G +PLWE+I+GKHE V++LL+DNG  +SS DVG+  C   E+N ++L
Sbjct  589  LEFGADPNIQDSNGIIPLWESIMGKHELVTKLLMDNGGDISSADVGRLACYAVEKNEIKL  648



>ref|XP_004498651.1| PREDICTED: potassium channel AKT1-like isoform X1 [Cicer arietinum]
Length=888

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  181  LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            L+FG DPN +DS G +PLWE+I+GKHE V++LL+DNG  +SS DVG+  C   E+N ++L
Sbjct  589  LEFGADPNIQDSNGIIPLWESIMGKHELVTKLLMDNGGDISSADVGRLACYAVEKNEIKL  648



>ref|XP_010546590.1| PREDICTED: potassium channel AKT6 [Tarenaya hassleriana]
Length=884

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+DNN RTAL                + G DPN RDS GSVPLWEAI+G+H  +++LL
Sbjct  564  PNETDNNGRTALHVAASRGSQYCVVLLLEHGADPNIRDSEGSVPLWEAIIGRHGEIAQLL  623

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             +NGA+LS    G F+C   E N+++
Sbjct  624  AENGARLSPDMAGHFSCLAVELNSID  649



>gb|AAL40894.1| AKT1-like potassium channel, partial [Oryza sativa]
Length=860

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+  TAL                ++G DPN+RDS G VPLWEA+  KH +V +LL
Sbjct  517  PNESDNDGHTALHIAASKGNEQCVRLLLEYGADPNARDSEGKVPLWEALCEKHAAVVQLL  576

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+ GA LSSGD G + C   E+++ EL
Sbjct  577  VEGGADLSSGDTGLYACIAVEESDTEL  603



>gb|EEC71181.1| hypothetical protein OsI_03064 [Oryza sativa Indica Group]
Length=894

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+  TAL                ++G DPN+RDS G VPLWEA+  KH +V +LL
Sbjct  551  PNESDNDGHTALHIAASKGNEQCVRLLLEYGADPNARDSEGKVPLWEALCEKHAAVVQLL  610

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+ GA LSSGD G + C   E+++ EL
Sbjct  611  VEGGADLSSGDTGLYACIAVEESDTEL  637



>sp|P0C550.1|AKT1_ORYSI RecName: Full=Potassium channel AKT1; Short=OsAKT1 [Oryza sativa 
Indica Group]
Length=935

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+  TAL                ++G DPN+RDS G VPLWEA+  KH +V +LL
Sbjct  592  PNESDNDGHTALHIAASKGNEQCVRLLLEYGADPNARDSEGKVPLWEALCEKHAAVVQLL  651

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+ GA LSSGD G + C   E+++ EL
Sbjct  652  VEGGADLSSGDTGLYACIAVEESDTEL  678



>ref|NP_001043713.1| Os01g0648000 [Oryza sativa Japonica Group]
 sp|Q0JKV1.1|AKT1_ORYSJ RecName: Full=Potassium channel AKT1; Short=OsAKT1 [Oryza sativa 
Japonica Group]
 dbj|BAF05627.1| Os01g0648000 [Oryza sativa Japonica Group]
Length=935

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+  TAL                ++G DPN+RDS G VPLWEA+  KH +V +LL
Sbjct  592  PNESDNDGHTALHIAASKGNEQCVRLLLEYGADPNARDSEGKVPLWEALCEKHAAVVQLL  651

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+ GA LSSGD G + C   E+++ EL
Sbjct  652  VEGGADLSSGDTGLYACIAVEESDTEL  678



>gb|EEE55080.1| hypothetical protein OsJ_02815 [Oryza sativa Japonica Group]
Length=884

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN+  TAL                ++G DPN+RDS G VPLWEA+  KH +V +LL
Sbjct  575  PNESDNDGHTALHIAASKGNEQCVRLLLEYGADPNARDSEGKVPLWEALCEKHAAVVQLL  634

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+ GA LSSGD G + C   E+++ EL
Sbjct  635  VEGGADLSSGDTGLYACIAVEESDTEL  661



>ref|XP_004969311.1| PREDICTED: potassium channel AKT1-like [Setaria italica]
Length=885

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 48/87 (55%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                D G DPN+RD  G VPLWEA+  KH +V  LL
Sbjct  553  PNESDNNGHTALHIAASKGNEQCVKLLLDHGADPNARDDQGKVPLWEALCEKHAAVVELL  612

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+NGA LSSGD   + C   E N  EL
Sbjct  613  VENGADLSSGDTALYACVAVEDNKTEL  639



>gb|KFK32558.1| hypothetical protein AALP_AA6G258700 [Arabis alpina]
Length=885

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (63%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D + RTAL                + G DPN +DS G+VPLWEAI+G+H  +++LL
Sbjct  565  PNEMDKDGRTALHIAASKGSHYCVVLLLEHGADPNIKDSEGNVPLWEAIIGRHGGIAKLL  624

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             +NGAK+SS  VG F+C   E+N+L+
Sbjct  625  AENGAKMSSDTVGYFSCLAVEKNSLD  650



>ref|XP_002308313.1| k transporter family protein [Populus trichocarpa]
 gb|EEE91836.1| k transporter family protein [Populus trichocarpa]
Length=848

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 6/71 (8%)
 Frame = -3

Query  214  PNESDNNRRTALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFT  35
            PNESDNN R+A+         DS G+VPL EA+LG HE+V++LL+ NGA +  GDVG F 
Sbjct  542  PNESDNNGRSAMVHA------DSDGNVPLLEAMLGGHEAVAKLLIQNGASIHHGDVGHFA  595

Query  34   CTTSEQNNLEL  2
            CT +E+NNL L
Sbjct  596  CTAAEKNNLNL  606



>ref|XP_006296292.1| hypothetical protein CARUB_v10025462mg [Capsella rubella]
 gb|EOA29190.1| hypothetical protein CARUB_v10025462mg [Capsella rubella]
Length=889

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 51/86 (59%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                + G DPN RDS G+VPLWEAI+G+H  V++LL
Sbjct  569  PNETDKNGRTALHIAASKGSHYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHSGVAKLL  628

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             +NGAKL    V  F C   E+N+L+
Sbjct  629  AENGAKLCVDSVSYFACLAVEKNSLD  654



>ref|XP_003603438.1| Potassium channel [Medicago truncatula]
 gb|AES73689.1| inwardly rectifying potassium channel subunit [Medicago truncatula]
Length=884

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                 FG DPN++D  G++PLWEA++G HESV ++L
Sbjct  562  PNETDRNGRTALHISASNGNESFVTLLLKFGADPNAKDLDGNIPLWEAMIGGHESVKKML  621

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +D GA +   D G   C+  ++N++EL
Sbjct  622  IDKGADIFCVDAGHLACSAVDKNSIEL  648



>ref|XP_006392335.1| hypothetical protein EUTSA_v10023250mg [Eutrema salsugineum]
 gb|ESQ29621.1| hypothetical protein EUTSA_v10023250mg [Eutrema salsugineum]
Length=889

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D N RTAL                + G DPN RDS G+VPLWEAI+G+H  +++LL
Sbjct  568  PNEMDKNGRTALHIAASKGSHYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHGGIAKLL  627

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             +NGAKLS   V  F+C   E+N+L+
Sbjct  628  AENGAKLSLDSVSYFSCLAVEKNSLD  653



>ref|XP_006392345.1| hypothetical protein EUTSA_v10023251mg [Eutrema salsugineum]
 gb|ESQ29631.1| hypothetical protein EUTSA_v10023251mg [Eutrema salsugineum]
Length=889

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D N RTAL                + G DPN RDS G+VPLWEAI+G+H  +++LL
Sbjct  568  PNEMDKNGRTALHIAASKGSHYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHGGIAKLL  627

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             +NGAKLS   V  F+C   E+N+L+
Sbjct  628  AENGAKLSLDSVSYFSCLAVEKNSLD  653



>emb|CAN78157.1| hypothetical protein VITISV_032798 [Vitis vinifera]
Length=898

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D+N RT L                ++G +PN +DS G VPLW+AIL + ES+ +LL
Sbjct  558  PNELDSNGRTPLHIAASKGREQCAHLLLEYGANPNGKDSEGIVPLWDAILERDESMIKLL  617

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGAK+   +VGQ+ CT  E+NNL+L
Sbjct  618  MDNGAKIPLSNVGQYACTAVERNNLDL  644



>ref|NP_001268010.1| inward rectifying shaker-like K+ channel [Vitis vinifera]
 emb|CBW30481.1| inward rectifying shaker-like K+ channel [Vitis vinifera]
 emb|CBW30482.1| inward rectifying shaker-like K+ channel [Vitis vinifera]
Length=898

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D+N RT L                ++G +PN +DS G VPLW+AIL + ES+ +LL
Sbjct  558  PNELDSNGRTPLHIAASKGREQCAHLLLEYGANPNGKDSEGIVPLWDAILERDESMIKLL  617

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGAK+   +VGQ+ CT  E+NNL+L
Sbjct  618  MDNGAKIPLSNVGQYACTAVERNNLDL  644



>gb|KCW79761.1| hypothetical protein EUGRSUZ_C011052, partial [Eucalyptus grandis]
Length=293

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  142  GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            GSVPLWEA+LG H+ V +LL +NGA +SSGDVGQF CT +EQNNL L
Sbjct  3    GSVPLWEAMLGGHDPVVKLLAENGANISSGDVGQFACTAAEQNNLYL  49



>ref|XP_010423759.1| PREDICTED: potassium channel AKT6 [Camelina sativa]
Length=887

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 51/87 (59%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D + RTAL                  G DPN RDS G+VPLWEAI+G+H  +++LL
Sbjct  566  PNEMDKDGRTALHIAASKGSHYCAVLLLENGADPNIRDSEGNVPLWEAIIGRHSGIAKLL  625

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGAKLS   V  F C   E+N+L++
Sbjct  626  AENGAKLSLDSVSYFACLAVERNSLDI  652



>ref|XP_010472568.1| PREDICTED: potassium channel AKT6-like [Camelina sativa]
Length=889

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 51/87 (59%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D + RTAL                  G DPN RDS G+VPLWEAI+G+H  +++LL
Sbjct  566  PNEIDKDGRTALHIAASKGSHYCAVLLLENGADPNIRDSEGNVPLWEAIIGRHSGIAKLL  625

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGAKLS   V  F C   E+N+L++
Sbjct  626  AENGAKLSLDSVSYFACLAVERNSLDI  652



>emb|CBI20997.3| unnamed protein product [Vitis vinifera]
Length=898

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 55/87 (63%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D+N RT L                ++G +PN +DS G VPLW+AIL + ES+ +LL
Sbjct  558  PNELDSNGRTPLHIAASKGREQCAHLLLEYGANPNGKDSEGIVPLWDAILERDESMIKLL  617

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +DNGAK+   +VGQ+ CT  E+N+L+L
Sbjct  618  MDNGAKIPLSNVGQYACTAVERNDLDL  644



>ref|XP_003569453.1| PREDICTED: potassium channel AKT1 isoform X1 [Brachypodium distachyon]
Length=898

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 16/77 (21%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+DN+ RTAL                D+G DPN+RD  G VPLWEA+  KH++V +LL
Sbjct  565  PNETDNDGRTALHIAASKGNEQCIRLLLDYGADPNARDPEGKVPLWEAVYAKHDAVVQLL  624

Query  82   VDNGAKLSSGDVGQFTC  32
            ++ GA LS GD G + C
Sbjct  625  LEGGADLSLGDTGLYAC  641



>ref|XP_010445001.1| PREDICTED: probable potassium channel AKT5 [Camelina sativa]
Length=837

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D N RTAL                  G DPN RDS G+VPLWEAI G+HE +++LL
Sbjct  523  PNETDTNGRTALHIAASKGNQYCVVLLLEKGADPNIRDSEGNVPLWEAISGRHEGIAKLL  582

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             +NGA LS   VG F+     +N+L+
Sbjct  583  SENGATLSFDTVGHFSLLAVGKNSLD  608



>ref|XP_010429557.1| PREDICTED: potassium channel AKT6 [Camelina sativa]
Length=888

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 50/87 (57%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D + RTAL                  G DPN RDS G+VPLWEAI+G H  +++LL
Sbjct  566  PNEMDKDGRTALHIAASKGSHYCVVLLLENGADPNIRDSEGNVPLWEAIIGGHSGIAKLL  625

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGAKLS   V  F C   E+N+L++
Sbjct  626  AENGAKLSLDSVSYFACLAVERNSLDI  652



>ref|NP_001105480.1| potassium channel5 [Zea mays]
 emb|CAA68912.1| potassium channel [Zea mays]
Length=887

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 50/87 (57%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                + G DPN+RDS G VPLWEA+  K   V  LL
Sbjct  555  PNESDNNGHTALHIAASKGDEQCVKLLLEHGADPNARDSEGKVPLWEALCEKQNPVVELL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V +GA LSSGDV  ++C   E+N+ EL
Sbjct  615  VQSGAGLSSGDVALYSCVAVEENDPEL  641



>gb|AFW83426.1| hypothetical protein ZEAMMB73_660957 [Zea mays]
Length=913

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 49/87 (56%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                + G DPN+RDS G VPLWEA+  K   V  LL
Sbjct  581  PNESDNNGHTALHIAASKGDEQCVKLLLEHGADPNARDSEGKVPLWEALCEKQNPVVELL  640

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V +GA LSSGDV  + C   E+N+ EL
Sbjct  641  VQSGAGLSSGDVALYACVAVEENDPEL  667



>gb|AFW83425.1| potassium channel [Zea mays]
Length=887

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 49/87 (56%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDNN  TAL                + G DPN+RDS G VPLWEA+  K   V  LL
Sbjct  555  PNESDNNGHTALHIAASKGDEQCVKLLLEHGADPNARDSEGKVPLWEALCEKQNPVVELL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V +GA LSSGDV  + C   E+N+ EL
Sbjct  615  VQSGAGLSSGDVALYACVAVEENDPEL  641



>gb|KEH39823.1| inwardly rectifying potassium channel subunit [Medicago truncatula]
Length=838

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 50/88 (57%), Gaps = 17/88 (19%)
 Frame = -3

Query  214  PNESDNNR-RTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRL  86
            PNE DN   RTAL                +FG DPN +D  G +PLWEAI G HES+ +L
Sbjct  537  PNEIDNKTGRTALHIAASKGNNHCAVLLLEFGADPNIQDFEGDIPLWEAIKGGHESMIKL  596

Query  85   LVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            L+DNGA +SS ++    C   E+NN++ 
Sbjct  597  LMDNGADISSANIASLACFAVEKNNIQF  624



>ref|XP_010670704.1| PREDICTED: potassium channel AKT1-like [Beta vulgaris subsp. 
vulgaris]
Length=876

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 51/88 (58%), Gaps = 17/88 (19%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKH-ESVSRL  86
            PNE     RTAL                  G DPN  DS G VPLW+ I+GKH ES+ +L
Sbjct  554  PNERGIKDRTALHIAVANGNENCVAILLANGADPNIIDSEGHVPLWDLIMGKHSESLIKL  613

Query  85   LVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            LVD+GA L+SGDV Q+ C   EQ++L+L
Sbjct  614  LVDHGATLASGDVPQYACYAVEQDDLKL  641



>emb|CDX76746.1| BnaC08g33320D [Brassica napus]
Length=879

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 50/85 (59%), Gaps = 16/85 (19%)
 Frame = -3

Query  211  NESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLLV  80
            NE D N RTAL                + G DPN RDS G+VPLWEAI+G H  +++LL 
Sbjct  563  NEMDKNGRTALHIAASRGSQYCVVLLLEHGADPNIRDSEGNVPLWEAIIGGHGEIAKLLA  622

Query  79   DNGAKLSSGDVGQFTCTTSEQNNLE  5
            +NGAKLS   V  ++C   E+++LE
Sbjct  623  ENGAKLSLDSVSYYSCLAVEKHSLE  647



>dbj|BAC42897.1| putative potassium transporter/channel [Arabidopsis thaliana]
Length=475

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D + RTAL                + G DPN RDS G+VPLWEAI+G+H  +++LL
Sbjct  157  PNEMDKDGRTALHIAASKGSHYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHREIAKLL  216

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             +NGAKLS   V  F+    E+N L+
Sbjct  217  AENGAKLSLDSVSYFSGLAVEKNCLD  242



>ref|XP_010670705.1| PREDICTED: potassium channel AKT1 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=871

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            P+E D N RTAL                  G +PN +DS G++PLW+AILGKH+S+ +LL
Sbjct  554  PDERDMNGRTALHIAAANGNETIASILLAHGAEPNVKDSEGNIPLWDAILGKHDSLIKLL  613

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             D GA L+ GDV ++     EQ+NL+L
Sbjct  614  RDRGADLALGDVPRYASHAIEQDNLQL  640



>ref|XP_010670706.1| PREDICTED: potassium channel AKT1 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=867

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            P+E D N RTAL                  G +PN +DS G++PLW+AILGKH+S+ +LL
Sbjct  550  PDERDMNGRTALHIAAANGNETIASILLAHGAEPNVKDSEGNIPLWDAILGKHDSLIKLL  609

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             D GA L+ GDV ++     EQ+NL+L
Sbjct  610  RDRGADLALGDVPRYASHAIEQDNLQL  636



>ref|NP_180131.3| potassium channel AKT6 [Arabidopsis thaliana]
 sp|Q8GXE6.2|AKT6_ARATH RecName: Full=Potassium channel AKT6; AltName: Full=Potassium 
channel SPIK; AltName: Full=Shaker pollen inward rectifier 
K(+) channel [Arabidopsis thaliana]
 gb|AAD31377.1| putative potassium transporter/channel [Arabidopsis thaliana]
 emb|CAC85283.1| shaker pollen inward rectifier K+ channel [Arabidopsis thaliana]
 gb|AEC07722.1| potassium channel AKT6 [Arabidopsis thaliana]
Length=888

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 16/86 (19%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D + RTAL                + G DPN RDS G+VPLWEAI+G+H  +++LL
Sbjct  570  PNEMDKDGRTALHIAASKGSHYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHREIAKLL  629

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLE  5
             +NGAKLS   V  F+    E+N L+
Sbjct  630  AENGAKLSLDSVSYFSGLAVEKNCLD  655



>ref|XP_009117222.1| PREDICTED: potassium channel AKT6 [Brassica rapa]
Length=877

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 50/85 (59%), Gaps = 16/85 (19%)
 Frame = -3

Query  211  NESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLLV  80
            NE D N RTAL                + G DPN +DS G+VPLWEAI+G H  +++LL 
Sbjct  562  NEMDKNGRTALHIAASRGSHYCVVLLLEHGADPNIKDSEGNVPLWEAIIGGHGEIAKLLA  621

Query  79   DNGAKLSSGDVGQFTCTTSEQNNLE  5
            +NGAKLS   V  ++C   E+++LE
Sbjct  622  ENGAKLSLDSVSYYSCLAVEKHSLE  646



>emb|CDY11516.1| BnaA09g40820D [Brassica napus]
Length=877

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 50/85 (59%), Gaps = 16/85 (19%)
 Frame = -3

Query  211  NESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLLV  80
            NE D N RTAL                + G DPN +DS G+VPLWEAI+G H  +++LL 
Sbjct  562  NEMDKNGRTALHIAASRGSHYCVVLLLEHGADPNIKDSEGNVPLWEAIIGGHGEIAKLLA  621

Query  79   DNGAKLSSGDVGQFTCTTSEQNNLE  5
            +NGAKLS   V  ++C   E+++LE
Sbjct  622  ENGAKLSLDSVSYYSCLAVEKHSLE  646



>emb|CAA12645.1| inward potassium channel alpha subunit [Egeria densa]
Length=770

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 50/87 (57%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE+D+  RTAL                D G +PNS+DS GS PLWEAI  +H  V  LL
Sbjct  449  PNEADSKGRTALHIAARNGSERCALLLLDRGANPNSKDSDGSTPLWEAIRSRHNIVIELL  508

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
               GA L+  D+G++ C  +EQ++L++
Sbjct  509  ASRGASLAHDDIGEYACVATEQSSLDI  535



>ref|XP_010419342.1| PREDICTED: potassium channel AKT6-like [Camelina sativa]
Length=829

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  181  LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            L+ G DPN  DS G+VPLWEAI+G+H  +++LL +NGAKLS   V  F C   E+N+L++
Sbjct  535  LENGADPNISDSEGNVPLWEAIIGRHSGIAKLLAENGAKLSLDSVSYFACLAVERNSLDI  594



>gb|KHG28816.1| Potassium channel AKT1 -like protein [Gossypium arboreum]
Length=771

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -3

Query  166  DPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            D  S+ S G+VPLWEA+L  H+ V++LL +NGA ++ GDVG + CT +EQNNL L
Sbjct  473  DDLSKHSEGNVPLWEAMLAGHDKVAKLLKENGASINVGDVGHYACTAAEQNNLNL  527



>gb|KHN08108.1| Potassium channel AKT1 [Glycine soja]
Length=346

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 7/65 (11%)
 Frame = -3

Query  196  NRRTALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQ  17
            +RRT L   +D       GSVPLWEA+ G+HESV ++L+DNGA +S  + G   C+  EQ
Sbjct  62   SRRTTLVTDMD-------GSVPLWEAMKGRHESVMKILIDNGADISLANAGHLACSAVEQ  114

Query  16   NNLEL  2
            NN+EL
Sbjct  115  NNMEL  119



>ref|XP_006658326.1| PREDICTED: potassium channel AKT3-like, partial [Oryza brachyantha]
Length=606

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 37/87 (43%), Positives = 45/87 (52%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+  RTAL                  G D NSRD  G VPLWEA+  +H++V +LL
Sbjct  497  PNESDHYGRTALHIAASNGNEKCVRLLLENGADSNSRDPEGRVPLWEALCRRHQAVVQLL  556

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VD G  LS GD   +     EQN+  L
Sbjct  557  VDAGGDLSGGDAAPYARVAVEQNDAAL  583



>ref|XP_006841929.1| hypothetical protein AMTR_s00042p00201380 [Amborella trichopoda]
 gb|ERN03604.1| hypothetical protein AMTR_s00042p00201380 [Amborella trichopoda]
Length=852

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -3

Query  190  RTALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNN  11
            R  LD G DPN +D  G VPLWEA+LG HE V  L+ + GA+L+  D G + C   E+N 
Sbjct  568  RLLLDQGADPNIKDFEGRVPLWEAMLGGHEEVKTLMFEKGARLNQSDAGLYACMAVEKNC  627

Query  10   LE  5
            L+
Sbjct  628  LD  629



>ref|XP_007161234.1| hypothetical protein PHAVU_001G053200g [Phaseolus vulgaris]
 gb|ESW33228.1| hypothetical protein PHAVU_001G053200g [Phaseolus vulgaris]
Length=873

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 36/87 (41%), Positives = 50/87 (57%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTA----------------LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D N +TA                L+ G +PN +D  G+  LWEAI G HE+V R+L
Sbjct  563  PNEPDKNGKTAMHIAACKGNKHCVIVLLEHGANPNMKDMEGNSALWEAIKGGHETVMRIL  622

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+NGA++SS +V  +     E+NNLE+
Sbjct  623  VENGAEISSNNVVDYARLAIEKNNLEI  649



>gb|EAZ02946.1| hypothetical protein OsI_25085 [Oryza sativa Indica Group]
Length=882

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 46/87 (53%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+  RTAL                  G D NSRD  G VPLWEA+  +H++V +LL
Sbjct  541  PNESDHYGRTALHIAASNGNEQCVRLLLENGADSNSRDPEGRVPLWEALCRRHQTVVQLL  600

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VD GA LS GD   +     EQN+  L
Sbjct  601  VDAGADLSGGDAAPYARVAVEQNDAAL  627



>gb|EEE66660.1| hypothetical protein OsJ_23288 [Oryza sativa Japonica Group]
Length=861

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 46/87 (53%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+  RTAL                  G D NSRD  G VPLWEA+  +H++V +LL
Sbjct  550  PNESDHYGRTALHIAASNGNEQCVRLLLENGADSNSRDPEGRVPLWEALCRRHQTVVQLL  609

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VD GA LS GD   +     EQN+  L
Sbjct  610  VDAGADLSGGDAAPYARVAVEQNDAAL  636



>sp|Q8H569.1|AKT3_ORYSJ RecName: Full=Potassium channel AKT3 [Oryza sativa Japonica Group]
 dbj|BAC24865.1| putative AKT1-like potassium channel [Oryza sativa Japonica Group]
Length=907

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 46/87 (53%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+  RTAL                  G D NSRD  G VPLWEA+  +H++V +LL
Sbjct  566  PNESDHYGRTALHIAASNGNEQCVRLLLENGADSNSRDPEGRVPLWEALCRRHQTVVQLL  625

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VD GA LS GD   +     EQN+  L
Sbjct  626  VDAGADLSGGDAAPYARVAVEQNDAAL  652



>ref|NP_001175074.1| Os07g0175400 [Oryza sativa Japonica Group]
 dbj|BAH93802.1| Os07g0175400 [Oryza sativa Japonica Group]
Length=891

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 46/87 (53%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESD+  RTAL                  G D NSRD  G VPLWEA+  +H++V +LL
Sbjct  550  PNESDHYGRTALHIAASNGNEQCVRLLLENGADSNSRDPEGRVPLWEALCRRHQTVVQLL  609

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VD GA LS GD   +     EQN+  L
Sbjct  610  VDAGADLSGGDAAPYARVAVEQNDAAL  636



>ref|XP_002459406.1| hypothetical protein SORBIDRAFT_02g004160 [Sorghum bicolor]
 gb|EER95927.1| hypothetical protein SORBIDRAFT_02g004160 [Sorghum bicolor]
Length=908

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 47/87 (54%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN   TAL                + G DPN+ D+ G VPLWEA+  +H + +RLL
Sbjct  542  PNESDNYWHTALHISASSGHDQCVKLLLEHGADPNATDAQGRVPLWEALSRRHRAAARLL  601

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            VD GA LS+GD   +     E +++ L
Sbjct  602  VDAGADLSAGDAALYARAAVEADDVAL  628



>ref|XP_007137050.1| hypothetical protein PHAVU_009G095700g [Phaseolus vulgaris]
 gb|ESW09044.1| hypothetical protein PHAVU_009G095700g [Phaseolus vulgaris]
Length=647

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 45/87 (52%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D   +TAL                ++G DPNS+D  G VPL EA  G H+SV +LL
Sbjct  331  PNEGDKKGKTALHIAASKGSEQCVSLLLEYGADPNSKDFNGIVPLLEARKGDHKSVIKLL  390

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             + GA  +S D G   C   EQNN EL
Sbjct  391  REKGAIFTSADEGNLACRAVEQNNKEL  417



>ref|XP_004958974.1| PREDICTED: potassium channel AKT3-like [Setaria italica]
Length=903

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 45/87 (52%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN   TAL                + G DPN+RD+ G VPLWEA+  +H + ++LL
Sbjct  555  PNESDNYWHTALHVAASGGHEQCVRLLLEHGADPNARDAQGRVPLWEALSRRHHAAAQLL  614

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             D GA LSSGD   +     E  +  L
Sbjct  615  ADAGADLSSGDAALYARAAVEAGDAAL  641



>ref|XP_007137051.1| hypothetical protein PHAVU_009G095700g [Phaseolus vulgaris]
 gb|ESW09045.1| hypothetical protein PHAVU_009G095700g [Phaseolus vulgaris]
Length=865

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 45/87 (52%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE D   +TAL                ++G DPNS+D  G VPL EA  G H+SV +LL
Sbjct  549  PNEGDKKGKTALHIAASKGSEQCVSLLLEYGADPNSKDFNGIVPLLEARKGDHKSVIKLL  608

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             + GA  +S D G   C   EQNN EL
Sbjct  609  REKGAIFTSADEGNLACRAVEQNNKEL  635



>ref|XP_010230035.1| PREDICTED: potassium channel AKT3-like [Brachypodium distachyon]
Length=916

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE++N+ RTAL                  G DPN+RD  G VPLWEA+  KHE  ++LL
Sbjct  556  PNETNNDGRTALHIAASGGSEQCVKLLLENGADPNARDPEGRVPLWEAMSRKHERAAQLL  615

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             + G  LS+GD   +     E+++  L
Sbjct  616  AEAGGSLSAGDSAAYARFAVEEDDAAL  642



>ref|XP_009770131.1| PREDICTED: potassium channel AKT1-like, partial [Nicotiana sylvestris]
Length=558

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 35/56 (63%), Gaps = 16/56 (29%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESV  95
            PNESD N R+AL                DFG +PN+RDS G+VPLWEAILGKH+ V
Sbjct  497  PNESDKNGRSALHIAASKGLDNCVLWLLDFGANPNNRDSEGNVPLWEAILGKHDVV  552



>ref|XP_008653638.1| PREDICTED: potassium channel AKT3-like [Zea mays]
Length=906

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 43/87 (49%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN   TAL                + G DPN+ D+ G VPLWEA+   H   ++LL
Sbjct  547  PNESDNYWHTALHVSASGGHEQCIKLLLEHGADPNASDAQGRVPLWEALSRGHRGAAQLL  606

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             D GA L+SGD   +     E  ++ L
Sbjct  607  ADGGADLASGDAALYARAAVEAGDVAL  633



>gb|EMT02357.1| Potassium channel AKT1 [Aegilops tauschii]
Length=932

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNE DN  RTAL                  G D N+RD  G VPLWEA+  +H+ V +LL
Sbjct  583  PNEIDNCGRTALHIAASNGSEQCVRRLLENGADANARDPEGKVPLWEALCRRHQPVVQLL  642

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+ GA LS+GD   +     E+++  L
Sbjct  643  VEAGAVLSAGDGAMYARVAVEEDDAVL  669



>ref|NP_001183881.1| hypothetical protein [Zea mays]
 gb|ACR38653.1| unknown [Zea mays]
 tpg|DAA59733.1| TPA: hypothetical protein ZEAMMB73_112632 [Zea mays]
Length=372

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 43/87 (49%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PNESDN   TAL                + G DPN+ D+ G VPLWEA+   H   ++LL
Sbjct  11   PNESDNYWHTALHVSASGGHEQCIKLLLEHGADPNASDAQGRVPLWEALSRGHRGAAQLL  70

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             D GA L+SGD   +     E  ++ L
Sbjct  71   ADGGADLASGDAELYARAAVEAGDVAL  97



>ref|XP_002317705.1| Potassium channel SKOR family protein [Populus trichocarpa]
 gb|EEE95925.1| Potassium channel SKOR family protein [Populus trichocarpa]
Length=820

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D +RR+ L                + GVD N  D  G+ PL EA+ G H+ V+ LL
Sbjct  577  PNKADYDRRSPLHVAASKGDGDISQLLIEHGVDVNISDKFGNTPLLEAVKGGHDEVASLL  636

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V  GA L+  D G F CTT  + +L L
Sbjct  637  VKAGASLAIDDAGGFLCTTVVKRDLNL  663



>ref|NP_001291244.1| potassium channel SKOR-like [Populus euphratica]
 gb|ABY86890.1| outward rectifying potassium channel [Populus euphratica]
Length=819

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 32/87 (37%), Positives = 44/87 (51%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                + GVD N  D  G+ PL EA+ G H+ V+ LL
Sbjct  576  PNKADYDGRSPLHVAASKGDGDISLLLIEHGVDVNISDKFGNTPLLEAVKGGHDEVASLL  635

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V  GA L+  D G F CTT  + +L L
Sbjct  636  VKAGASLAIDDAGGFLCTTVAKRDLNL  662



>ref|XP_011003761.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel SKOR-like [Populus 
euphratica]
Length=824

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 32/87 (37%), Positives = 44/87 (51%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                + GVD N  D  G+ PL EA+ G H+ V+ LL
Sbjct  581  PNKADYDGRSPLHVAASKGDGDISLLLIEHGVDVNISDKFGNTPLLEAVKGGHDEVASLL  640

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V  GA L+  D G F CTT  + +L L
Sbjct  641  VKAGASLAIDDAGGFLCTTVAKRDLNL  667



>gb|EPS59603.1| potassium channel, partial [Genlisea aurea]
Length=602

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 16/50 (32%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAIL  113
            PNESDNN RTAL                +FG DPN+RDS G+VPLWEA+L
Sbjct  553  PNESDNNGRTALHVASSKGYEKCDLLLLEFGADPNARDSEGNVPLWEAML  602



>gb|KDP25819.1| hypothetical protein JCGZ_22541 [Jatropha curcas]
Length=834

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/87 (36%), Positives = 43/87 (49%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN +D + R+ L                  GVD N +D  G+ PL+EAI   H+ V+ LL
Sbjct  576  PNRTDYDGRSPLHLAASRGDEDITLFLIQEGVDINIKDKFGNTPLFEAIKNGHDHVASLL  635

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V  GA LS  D G F C+T  + + +L
Sbjct  636  VKQGAHLSLDDAGSFLCSTVSKGDSDL  662



>ref|XP_006580390.1| PREDICTED: potassium channel SKOR-like [Glycine max]
Length=773

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/87 (36%), Positives = 42/87 (48%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + RT L                  GV+ N  D  G+ PL EAI   HE V+ +L
Sbjct  511  PNKTDYDGRTPLHISASKGYVDISSYLVEQGVNINCADKFGTTPLLEAIKNGHEEVASIL  570

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+ GA  +  DVG F C T  +  L+L
Sbjct  571  VNAGAIFTIDDVGNFLCMTVAKKELDL  597



>gb|KHN10527.1| Potassium channel SKOR, partial [Glycine soja]
Length=777

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/87 (36%), Positives = 42/87 (48%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + RT L                  GV+ N  D  G+ PL EAI   HE V+ +L
Sbjct  515  PNKTDYDGRTPLHISASKGYVDISSYLVEQGVNINCADKFGTTPLLEAIKNGHEEVASIL  574

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+ GA  +  DVG F C T  +  L+L
Sbjct  575  VNAGAIFTIDDVGNFLCMTVAKKELDL  601



>ref|XP_009360048.1| PREDICTED: potassium channel SKOR-like [Pyrus x bretschneideri]
Length=763

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = -3

Query  190  RTALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNN  11
            R  ++ G      D  G+ PL EAI   H+ V+ LLV  GA L+  D G F CTT+ + N
Sbjct  612  RFLIEQGAAAEMSDKYGNTPLLEAIKNGHDEVASLLVKAGASLAVDDAGDFLCTTAARRN  671

Query  10   LEL  2
            +EL
Sbjct  672  MEL  674



>gb|AEY75250.1| potassium channel [Malus hupehensis]
Length=763

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = -3

Query  190  RTALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNN  11
            R  ++ G      D  G+ PL EAI   H+ V+ LLV  GA L+  D G F CTT+ + N
Sbjct  612  RFLIEQGAAAEMSDKYGNTPLLEAIKNGHDEVASLLVKAGASLAVDDAGDFLCTTAARRN  671

Query  10   LEL  2
            +EL
Sbjct  672  MEL  674



>ref|XP_010108959.1| Potassium channel SKOR [Morus notabilis]
 gb|EXC20599.1| Potassium channel SKOR [Morus notabilis]
Length=858

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 16/78 (21%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N++DS G+ PL EA+   H+ VS LL
Sbjct  597  PNKTDYDGRSPLHLAASRGYEDITLFLIQEGVDVNTKDSFGNTPLLEALKNGHDRVSSLL  656

Query  82   VDNGAKLSSGDVGQFTCT  29
            V  GA L   + G F CT
Sbjct  657  VKEGASLKIDNAGSFLCT  674



>ref|XP_008367611.1| PREDICTED: potassium channel SKOR-like [Malus domestica]
Length=763

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 34/63 (54%), Gaps = 0/63 (0%)
 Frame = -3

Query  190  RTALDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNN  11
            R  ++ G      D  G+ PL EAI   H+ V  LLV  GA L+  D G F CTT+ + N
Sbjct  612  RFLIEQGAAAEMSDKYGNTPLLEAIKNGHDEVGSLLVKAGASLAVDDAGDFLCTTAARRN  671

Query  10   LEL  2
            +EL
Sbjct  672  MEL  674



>gb|KDP37417.1| hypothetical protein JCGZ_07944 [Jatropha curcas]
Length=672

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/87 (36%), Positives = 42/87 (48%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                D GVD N  D  G+ PL EA+   H+ V+ LL
Sbjct  429  PNKTDYDGRSPLHIAASKGYEDITHLLIDHGVDVNLSDKFGNTPLLEALRNGHDEVASLL  488

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V  GA L+  D G F C T  + +L L
Sbjct  489  VRAGATLAIDDAGGFLCMTVAKRDLGL  515



>ref|XP_008240285.1| PREDICTED: potassium channel SKOR-like [Prunus mume]
Length=765

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -3

Query  181  LDFGVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +D G D    D  G+ PL EAI   H+ V+ LLV  GA L+  D G F C T  + NL+L
Sbjct  612  IDQGADAEISDKFGNTPLLEAIKHGHDQVASLLVKAGASLTIDDAGDFLCITVARRNLDL  671



>ref|XP_008343077.1| PREDICTED: potassium channel SKOR-like isoform X3 [Malus domestica]
 ref|XP_008353842.1| PREDICTED: potassium channel SKOR-like isoform X3 [Malus domestica]
Length=768

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 44/87 (51%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D+ GS PL EAI   ++ VS LL
Sbjct  508  PNKADYDGRSPLHLAALKGHEDITLFLIQEGVDINIKDNFGSTPLLEAIKNGNDRVSSLL  567

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +  GA L+  + G F CT+  + + +L
Sbjct  568  IQEGASLNMDNAGSFICTSVARGDTDL  594



>ref|XP_008343076.1| PREDICTED: potassium channel SKOR-like isoform X2 [Malus domestica]
 ref|XP_008353841.1| PREDICTED: potassium channel SKOR-like isoform X2 [Malus domestica]
Length=840

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 44/87 (51%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D+ GS PL EAI   ++ VS LL
Sbjct  581  PNKADYDGRSPLHLAALKGHEDITLFLIQEGVDINIKDNFGSTPLLEAIKNGNDRVSSLL  640

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +  GA L+  + G F CT+  + + +L
Sbjct  641  IQEGASLNMDNAGSFICTSVARGDTDL  667



>ref|XP_008343075.1| PREDICTED: potassium channel SKOR-like isoform X1 [Malus domestica]
 ref|XP_008353840.1| PREDICTED: potassium channel SKOR-like isoform X1 [Malus domestica]
Length=841

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 44/87 (51%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D+ GS PL EAI   ++ VS LL
Sbjct  581  PNKADYDGRSPLHLAALKGHEDITLFLIQEGVDINIKDNFGSTPLLEAIKNGNDRVSSLL  640

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +  GA L+  + G F CT+  + + +L
Sbjct  641  IQEGASLNMDNAGSFICTSVARGDTDL  667



>ref|XP_006421368.1| hypothetical protein CICLE_v10004332mg [Citrus clementina]
 gb|ESR34608.1| hypothetical protein CICLE_v10004332mg [Citrus clementina]
Length=816

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 38/78 (49%), Gaps = 16/78 (21%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D  G+ PL EAI   H+ V+ LL
Sbjct  561  PNKTDYDGRSPLHLATSRGYEDITLFLIKKGVDINIKDKFGNTPLLEAIKCGHDGVTSLL  620

Query  82   VDNGAKLSSGDVGQFTCT  29
            V  GA L+  D G F CT
Sbjct  621  VKEGASLNVDDAGSFLCT  638



>gb|EPS72922.1| hypothetical protein M569_01827, partial [Genlisea aurea]
Length=715

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN+SD + R+ L                  GVD N  D  G+ PL EA+   HE V+ +L
Sbjct  552  PNKSDYDERSPLHIAASRGYDDITLFLIQQGVDINCEDCFGNTPLHEAVKNGHEKVASML  611

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             +NGA L   +VG   C  + + + EL
Sbjct  612  AENGALLKIKNVGNHLCAMAARGDSEL  638



>ref|XP_004289583.1| PREDICTED: potassium channel SKOR-like [Fragaria vesca subsp. 
vesca]
Length=838

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 39/78 (50%), Gaps = 16/78 (21%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D+ G+ PL EAI   H+ VS LL
Sbjct  581  PNKTDYDGRSPLHLAALRGHEDITLFLIQQGVDINIKDNFGNTPLLEAIKNAHDRVSSLL  640

Query  82   VDNGAKLSSGDVGQFTCT  29
            +  GA L+  + G F CT
Sbjct  641  IKEGASLNIDNAGSFLCT  658



>ref|XP_002533481.1| Potassium channel SKOR, putative [Ricinus communis]
 gb|EEF28913.1| Potassium channel SKOR, putative [Ricinus communis]
Length=445

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 42/87 (48%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN +D + R+ L                  GVD N +D  G+ PL EAI   H+ V+ LL
Sbjct  188  PNRTDYDGRSPLHLAASRGYEDIACFLIQEGVDINIKDKFGNTPLLEAIKSGHDHVASLL  247

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V  GA+L   D G F C+T  + + +L
Sbjct  248  VKEGAELRMDDAGSFLCSTVLKGDSDL  274



>gb|KDO49853.1| hypothetical protein CISIN_1g0101682mg, partial [Citrus sinensis]
Length=367

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 38/78 (49%), Gaps = 16/78 (21%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D  G+ PL EAI   H+ V+ LL
Sbjct  112  PNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLL  171

Query  82   VDNGAKLSSGDVGQFTCT  29
            V  GA L+  D G F CT
Sbjct  172  VKEGASLNVDDAGSFLCT  189



>tpg|DAA59730.1| TPA: hypothetical protein ZEAMMB73_881022 [Zea mays]
Length=914

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 43/106 (41%), Gaps = 35/106 (33%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSR-------------------DS*G  140
            PNESDN   TAL                + G DPN+                    D+ G
Sbjct  536  PNESDNYWHTALHVSASGGHEQCIKLLLEHGADPNASGACDWGHQPNLALIVIQCPDAQG  595

Query  139  SVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
             VPLWEA+   H   ++LL D GA L+SGD   +     E  ++ L
Sbjct  596  RVPLWEALSRGHRGAAQLLADGGADLASGDAALYARAAVEAGDVAL  641



>ref|XP_006286320.1| hypothetical protein CARUB_v100041251mg, partial [Capsella rubella]
 gb|EOA19218.1| hypothetical protein CARUB_v100041251mg, partial [Capsella rubella]
Length=752

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 36/79 (46%), Gaps = 16/79 (20%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D  G+ PL+EA+    E V RLL
Sbjct  494  PNKTDYDGRSPLHLAACRGYEDITSFLIQEGVDINQKDKFGNTPLFEAVKAGQEGVIRLL  553

Query  82   VDNGAKLSSGDVGQFTCTT  26
            V  GA     D G F C T
Sbjct  554  VKEGASFDLEDSGNFLCAT  572



>gb|KDO49855.1| hypothetical protein CISIN_1g0101682mg, partial [Citrus sinensis]
Length=373

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 38/79 (48%), Gaps = 16/79 (20%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D  G+ PL EAI   H+ V+ LL
Sbjct  186  PNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLL  245

Query  82   VDNGAKLSSGDVGQFTCTT  26
            V  GA L+  D G F CT 
Sbjct  246  VKEGASLNVDDAGSFLCTA  264



>emb|CAC05488.1| outward rectifying potassium channel [Populus tremula x Populus 
tremuloides]
Length=820

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 40/88 (45%), Gaps = 17/88 (19%)
 Frame = -3

Query  214  PNESDNNRRTALDFGVD-----------------PNSRDS*GSVPLWEAILGKHESVSRL  86
            PN++D +RR+ L                       N  D  G+ PL EA+ G H+ V+ L
Sbjct  576  PNKADYDRRSPLHVAASKGDVDISLLLIETWEWTSNISDKFGNTPLLEAVKGGHDEVASL  635

Query  85   LVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            LV  GA L+  D G F CT   + +L L
Sbjct  636  LVKAGASLAIDDAGGFLCTIVVKRDLNL  663



>emb|CBI33453.3| unnamed protein product [Vitis vinifera]
Length=794

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 38/79 (48%), Gaps = 16/79 (20%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N  D+ G+ PL EAI   H+ V+ LL
Sbjct  537  PNKTDYDGRSPLHLASARGFEDIVTFLIQEGVDVNISDNFGNTPLLEAIKNAHDRVASLL  596

Query  82   VDNGAKLSSGDVGQFTCTT  26
            V+ GA L   D G F C T
Sbjct  597  VNKGALLKIDDAGGFLCAT  615



>ref|XP_010660282.1| PREDICTED: shaker-like potassium channel isoform X1 [Vitis vinifera]
Length=821

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 38/79 (48%), Gaps = 16/79 (20%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N  D+ G+ PL EAI   H+ V+ LL
Sbjct  564  PNKTDYDGRSPLHLASARGFEDIVTFLIQEGVDVNISDNFGNTPLLEAIKNAHDRVASLL  623

Query  82   VDNGAKLSSGDVGQFTCTT  26
            V+ GA L   D G F C T
Sbjct  624  VNKGALLKIDDAGGFLCAT  642



>ref|XP_008381509.1| PREDICTED: potassium channel SKOR [Malus domestica]
Length=773

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 44/87 (51%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D+ G+ PL EAI   ++ VS LL
Sbjct  514  PNKTDYDGRSPLHLAALKGHEDITLFLIQEGVDINIKDNFGNTPLLEAIKNGNDRVSSLL  573

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +  GA L+  + G F CT+  + + +L
Sbjct  574  IQQGASLNIDNAGSFICTSIARGDADL  600



>gb|KDO49854.1| hypothetical protein CISIN_1g0101682mg, partial [Citrus sinensis]
Length=441

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 38/79 (48%), Gaps = 16/79 (20%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D  G+ PL EAI   H+ V+ LL
Sbjct  186  PNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLL  245

Query  82   VDNGAKLSSGDVGQFTCTT  26
            V  GA L+  D G F CT 
Sbjct  246  VKEGASLNVDDAGSFLCTA  264



>ref|XP_007210318.1| hypothetical protein PRUPE_ppa002150mg [Prunus persica]
 gb|EMJ11517.1| hypothetical protein PRUPE_ppa002150mg [Prunus persica]
Length=708

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTAL----------------DFGVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                D G +    D  G+ PL EAI   H+ V+ LL
Sbjct  544  PNKTDYDGRSPLLVAASKGYEDIIGFLIDQGANAEISDKFGNTPLLEAIKNGHDQVASLL  603

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V  GA L+  D G+F C T  + +L L
Sbjct  604  VKAGASLTIDDAGEFLCITVARRSLNL  630



>ref|NP_001268087.1| shaker-like potassium channel [Vitis vinifera]
 emb|CAD35400.1| shaker-like potassium channel [Vitis vinifera]
Length=795

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 38/79 (48%), Gaps = 16/79 (20%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N  D+ G+ PL EAI   H+ V+ LL
Sbjct  537  PNKTDYDGRSPLHLASARGFEDIVTFLIQEGVDVNISDNFGNTPLLEAIKNAHDRVASLL  596

Query  82   VDNGAKLSSGDVGQFTCTT  26
            V+ GA L   D G F C T
Sbjct  597  VNKGALLKIDDAGGFLCCT  615



>ref|XP_009370080.1| PREDICTED: potassium channel SKOR isoform X3 [Pyrus x bretschneideri]
Length=839

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 44/87 (51%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D+ G+ PL EAI   ++ VS LL
Sbjct  580  PNKTDYDGRSPLHLAALKGHEDITLFLIQEGVDINIKDNFGNTPLLEAIKNGNDRVSSLL  639

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +  GA L+  + G F CT+  + + +L
Sbjct  640  IQQGASLNIDNAGSFICTSIARGDADL  666



>ref|XP_009370078.1| PREDICTED: potassium channel SKOR isoform X1 [Pyrus x bretschneideri]
 ref|XP_009370079.1| PREDICTED: potassium channel SKOR isoform X2 [Pyrus x bretschneideri]
Length=840

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 44/87 (51%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D+ G+ PL EAI   ++ VS LL
Sbjct  580  PNKTDYDGRSPLHLAALKGHEDITLFLIQEGVDINIKDNFGNTPLLEAIKNGNDRVSSLL  639

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +  GA L+  + G F CT+  + + +L
Sbjct  640  IQQGASLNIDNAGSFICTSIARGDADL  666



>gb|KDO38427.1| hypothetical protein CISIN_1g0156801mg, partial [Citrus sinensis]
 gb|KDO38428.1| hypothetical protein CISIN_1g0156801mg, partial [Citrus sinensis]
Length=176

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = -3

Query  172  GVDPNSRDS*GSVPLWEAILGKHESVSRLLVDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            GVD N +D  G+ PL EAI   H+ V+ LLV  GA L+  D G F C    + + +L
Sbjct  19   GVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCIAVARGDSDL  75



>ref|XP_009378953.1| PREDICTED: potassium channel SKOR-like isoform X3 [Pyrus x bretschneideri]
Length=768

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 44/87 (51%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D+ G+ PL EAI   ++ VS LL
Sbjct  508  PNKADYDGRSPLHLAALKGHEDITLFLIQEGVDINIKDNFGNTPLLEAIKNGNDRVSSLL  567

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +  GA L+  + G F CT+  + + +L
Sbjct  568  IQEGASLNIENAGSFICTSIARGDADL  594



>ref|XP_009378952.1| PREDICTED: potassium channel SKOR-like isoform X2 [Pyrus x bretschneideri]
Length=839

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 44/87 (51%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D+ G+ PL EAI   ++ VS LL
Sbjct  580  PNKADYDGRSPLHLAALKGHEDITLFLIQEGVDINIKDNFGNTPLLEAIKNGNDRVSSLL  639

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +  GA L+  + G F CT+  + + +L
Sbjct  640  IQEGASLNIENAGSFICTSIARGDADL  666



>ref|XP_009378951.1| PREDICTED: potassium channel SKOR-like isoform X1 [Pyrus x bretschneideri]
Length=840

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 44/87 (51%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D+ G+ PL EAI   ++ VS LL
Sbjct  580  PNKADYDGRSPLHLAALKGHEDITLFLIQEGVDINIKDNFGNTPLLEAIKNGNDRVSSLL  639

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            +  GA L+  + G F CT+  + + +L
Sbjct  640  IQEGASLNIENAGSFICTSIARGDADL  666



>ref|XP_006494523.1| PREDICTED: potassium channel SKOR-like, partial [Citrus sinensis]
Length=404

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N +D  G+ PL EAI   H+ V+ LL
Sbjct  159  PNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLL  218

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V  GA L+  D G F C    + + +L
Sbjct  219  VKEGASLNVDDAGSFLCIAVARGDSDL  245



>emb|CAN64951.1| hypothetical protein VITISV_022830 [Vitis vinifera]
Length=559

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 38/79 (48%), Gaps = 16/79 (20%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                  GVD N  D+ G+ PL EAI   H+ V+ LL
Sbjct  302  PNKTDYDGRSPLHLASARGFEDIVTFLIQEGVDVNISDNFGNTPLLEAIKNAHDRVASLL  361

Query  82   VDNGAKLSSGDVGQFTCTT  26
            V+ GA L   D G F C T
Sbjct  362  VNKGALLKIDDAGGFLCAT  380



>ref|XP_004240037.1| PREDICTED: potassium channel SKOR-like [Solanum lycopersicum]
Length=824

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDF----------------GVDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN+ D + R+ L                  GVD N+ D+ G+ PL+EAI   H+ V+ LL
Sbjct  569  PNKKDYDGRSPLHLSASRGYEDISIFLIKEGVDFNASDNFGNTPLFEAIKNGHDRVASLL  628

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V  GA L   + G F CT   + + +L
Sbjct  629  VKEGAFLKIENAGSFLCTLVTKGDSDL  655



>ref|XP_007036947.1| STELAR K+ outward rectifier isoform 2 [Theobroma cacao]
 gb|EOY21448.1| STELAR K+ outward rectifier isoform 2 [Theobroma cacao]
Length=721

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDFG----------------VDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                   VD N  D  G+ PL E+I   H+ V+ LL
Sbjct  570  PNKTDYDGRSPLHIAASKGYEDITSFLIEQNVDINISDKFGNTPLLESIKHGHDQVASLL  629

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+ GA L+  D G F C T  + +L+L
Sbjct  630  VNAGALLAMDDAGGFLCMTVARRDLDL  656



>ref|XP_007036948.1| STELAR K+ outward rectifier isoform 3, partial [Theobroma cacao]
 gb|EOY21449.1| STELAR K+ outward rectifier isoform 3, partial [Theobroma cacao]
Length=781

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 16/87 (18%)
 Frame = -3

Query  214  PNESDNNRRTALDFG----------------VDPNSRDS*GSVPLWEAILGKHESVSRLL  83
            PN++D + R+ L                   VD N  D  G+ PL E+I   H+ V+ LL
Sbjct  570  PNKTDYDGRSPLHIAASKGYEDITSFLIEQNVDINISDKFGNTPLLESIKHGHDQVASLL  629

Query  82   VDNGAKLSSGDVGQFTCTTSEQNNLEL  2
            V+ GA L+  D G F C T  + +L+L
Sbjct  630  VNAGALLAMDDAGGFLCMTVARRDLDL  656



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509447715952