BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4427_g1_i1 len=1378 path=[41:0-423 40:424-1377]

Length=1378
                                                                      Score     E

ref|XP_006343754.1|  PREDICTED: WAT1-related protein At2g39510-like     466   1e-158   
ref|XP_009798285.1|  PREDICTED: WAT1-related protein At2g39510-like     461   1e-156   
ref|XP_004240770.1|  PREDICTED: WAT1-related protein At2g39510          458   1e-155   
ref|XP_009625314.1|  PREDICTED: WAT1-related protein At2g39510-like     458   2e-155   
ref|XP_009601954.1|  PREDICTED: WAT1-related protein At2g39510-li...    457   4e-155   
ref|XP_009798400.1|  PREDICTED: WAT1-related protein At2g39510          452   3e-153   
ref|XP_011072605.1|  PREDICTED: WAT1-related protein At2g39510-li...    452   4e-153   
ref|XP_011072598.1|  PREDICTED: WAT1-related protein At2g39510-li...    446   2e-150   
ref|XP_006365719.1|  PREDICTED: WAT1-related protein At2g39510-like     437   3e-147   
gb|EYU38348.1|  hypothetical protein MIMGU_mgv1a009263mg                436   3e-147   
ref|XP_004236759.1|  PREDICTED: WAT1-related protein At2g39510          437   3e-147   
ref|XP_009601955.1|  PREDICTED: WAT1-related protein At2g39510-li...    427   6e-144   
emb|CDP05672.1|  unnamed protein product                                428   1e-143   
ref|XP_010253282.1|  PREDICTED: WAT1-related protein At2g39510-like     426   6e-143   
ref|XP_008447554.1|  PREDICTED: WAT1-related protein At2g37460-like     419   4e-140   
ref|XP_004142085.1|  PREDICTED: auxin-induced protein 5NG4-like         415   1e-138   
ref|XP_008369847.1|  PREDICTED: WAT1-related protein At2g37460-like     414   2e-138   
ref|XP_002315243.2|  hypothetical protein POPTR_0010s21630g             411   7e-137   Populus trichocarpa [western balsam poplar]
ref|XP_002528467.1|  Auxin-induced protein 5NG4, putative               411   7e-137   Ricinus communis
ref|XP_010260186.1|  PREDICTED: WAT1-related protein At2g39510-like     409   5e-136   
ref|XP_009377106.1|  PREDICTED: WAT1-related protein At2g37460-like     407   1e-135   
ref|XP_011027136.1|  PREDICTED: WAT1-related protein At2g39510-like     407   2e-135   
ref|XP_002274909.2|  PREDICTED: WAT1-related protein At2g37460-like     407   5e-135   Vitis vinifera
ref|XP_004161682.1|  PREDICTED: auxin-induced protein 5NG4-like         405   8e-135   
ref|XP_004307548.1|  PREDICTED: auxin-induced protein 5NG4-like         403   2e-134   
ref|XP_008461645.1|  PREDICTED: WAT1-related protein At2g39510-like     404   2e-134   
ref|XP_011080962.1|  PREDICTED: WAT1-related protein At2g39510-like     403   8e-134   
emb|CDP00045.1|  unnamed protein product                                403   9e-134   
ref|XP_008371417.1|  PREDICTED: WAT1-related protein At2g39510-like     400   5e-133   
ref|XP_007205382.1|  hypothetical protein PRUPE_ppa007333mg             400   6e-133   
emb|CBI32681.3|  unnamed protein product                                400   7e-133   
ref|XP_008241503.1|  PREDICTED: WAT1-related protein At2g37460-like     400   8e-133   
ref|XP_004302750.1|  PREDICTED: auxin-induced protein 5NG4-like         400   8e-133   
ref|XP_009347454.1|  PREDICTED: WAT1-related protein At2g39510-like     397   4e-132   
ref|XP_008233581.1|  PREDICTED: WAT1-related protein At2g39510-li...    397   8e-132   
ref|XP_009778852.1|  PREDICTED: WAT1-related protein At2g37460-li...    395   1e-130   
ref|XP_009614496.1|  PREDICTED: WAT1-related protein At2g37460-li...    394   2e-130   
ref|XP_002312071.1|  nodulin MtN21 family protein                       394   2e-130   Populus trichocarpa [western balsam poplar]
ref|XP_007009428.1|  Nodulin MtN21 /EamA-like transporter family ...    393   4e-130   
ref|XP_009347451.1|  PREDICTED: WAT1-related protein At2g39510-like     392   5e-130   
ref|XP_009357771.1|  PREDICTED: WAT1-related protein At2g39510-like     390   2e-129   
ref|XP_010669871.1|  PREDICTED: WAT1-related protein At2g39510          391   2e-129   
ref|XP_008371332.1|  PREDICTED: WAT1-related protein At2g39510-like     390   2e-129   
ref|NP_181483.1|  nodulin MtN21-like transporter family protein         391   4e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004147717.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    390   5e-129   
ref|XP_010505629.1|  PREDICTED: WAT1-related protein At2g39510-like     390   6e-129   
ref|XP_004167778.1|  PREDICTED: auxin-induced protein 5NG4-like         390   7e-129   
ref|XP_007218251.1|  hypothetical protein PRUPE_ppa008064mg             389   1e-128   
ref|XP_002284091.1|  PREDICTED: WAT1-related protein At2g39510          390   1e-128   Vitis vinifera
gb|KDP29854.1|  hypothetical protein JCGZ_18429                         389   1e-128   
ref|XP_010517305.1|  PREDICTED: WAT1-related protein At2g39510          389   1e-128   
ref|XP_004246473.1|  PREDICTED: WAT1-related protein At2g37460-like     389   3e-128   
ref|XP_006341065.1|  PREDICTED: WAT1-related protein At2g37460-like     388   4e-128   
ref|XP_009141815.1|  PREDICTED: WAT1-related protein At2g39510          388   4e-128   
ref|XP_006411179.1|  hypothetical protein EUTSA_v10016823mg             388   4e-128   
ref|XP_010509005.1|  PREDICTED: WAT1-related protein At2g39510-like     388   7e-128   
ref|XP_003521346.1|  PREDICTED: WAT1-related protein At2g37460-like     387   1e-127   
ref|XP_009143306.1|  PREDICTED: WAT1-related protein At2g39510-like     386   2e-127   
emb|CDY20446.1|  BnaC04g05980D                                          385   4e-127   
ref|XP_007162672.1|  hypothetical protein PHAVU_001G170400g             385   9e-127   
ref|XP_007009430.1|  Nodulin MtN21 /EamA-like transporter family ...    385   1e-126   
ref|XP_002881660.1|  nodulin MtN21 family protein                       384   1e-126   
ref|XP_010037869.1|  PREDICTED: WAT1-related protein At2g37460-like     385   1e-126   
gb|KHN09434.1|  Auxin-induced protein 5NG4                              384   2e-126   
emb|CDY53594.1|  BnaA05g34670D                                          384   2e-126   
gb|KCW49646.1|  hypothetical protein EUGRSUZ_K03164                     386   3e-126   
ref|XP_006296517.1|  hypothetical protein CARUB_v10025706mg             383   3e-126   
emb|CDY07016.1|  BnaA04g22990D                                          383   5e-126   
ref|XP_011023754.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    381   8e-126   
gb|KHN02414.1|  Auxin-induced protein 5NG4-like protein                 382   1e-125   
gb|KHG26265.1|  Auxin-induced 5NG4                                      382   1e-125   
ref|XP_003553527.1|  PREDICTED: WAT1-related protein At2g37460-like     382   1e-125   
gb|KFK36842.1|  hypothetical protein AALP_AA4G179000                    380   3e-125   
ref|XP_011094815.1|  PREDICTED: WAT1-related protein At2g37460-like     380   6e-125   
emb|CDX93255.1|  BnaC04g46410D                                          380   7e-125   
ref|XP_008370940.1|  PREDICTED: WAT1-related protein At2g39510-like     379   7e-125   
ref|XP_004141853.1|  PREDICTED: auxin-induced protein 5NG4-like         379   1e-124   
ref|XP_006436050.1|  hypothetical protein CICLE_v10031857mg             379   1e-124   
ref|XP_010554433.1|  PREDICTED: WAT1-related protein At2g39510-like     379   1e-124   
gb|EYU28266.1|  hypothetical protein MIMGU_mgv1a008729mg                379   2e-124   
ref|XP_008461650.1|  PREDICTED: WAT1-related protein At2g39510-li...    379   3e-124   
ref|XP_009337582.1|  PREDICTED: WAT1-related protein At2g39510          375   1e-123   
ref|XP_010067380.1|  PREDICTED: WAT1-related protein At2g39510-like     377   2e-123   
ref|XP_010039216.1|  PREDICTED: WAT1-related protein At2g37460-like     376   4e-123   
ref|XP_004166081.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    375   5e-123   
ref|XP_003625520.1|  Auxin-induced protein 5NG4                         375   6e-123   
gb|AFK37217.1|  unknown                                                 375   8e-123   
gb|KCW49650.1|  hypothetical protein EUGRSUZ_K03168                     377   1e-122   
ref|XP_010684183.1|  PREDICTED: WAT1-related protein At2g37460-like     374   2e-122   
ref|XP_010534481.1|  PREDICTED: WAT1-related protein At2g39510-like     374   2e-122   
gb|KDO67718.1|  hypothetical protein CISIN_1g043160mg                   372   2e-122   
ref|XP_011019904.1|  PREDICTED: WAT1-related protein At2g37460-li...    372   4e-122   
ref|XP_010529854.1|  PREDICTED: WAT1-related protein At2g37460-like     373   4e-122   
ref|XP_010039215.1|  PREDICTED: WAT1-related protein At2g37460-like     373   4e-122   
ref|XP_007027104.1|  Nodulin MtN21 /EamA-like transporter family ...    372   1e-121   
ref|XP_003590513.1|  Auxin-induced protein 5NG4                         371   2e-121   
gb|KGN51272.1|  hypothetical protein Csa_5G505820                       371   2e-121   
gb|KHG11891.1|  Auxin-induced 5NG4                                      371   3e-121   
ref|XP_002308146.2|  hypothetical protein POPTR_0006s08270g             372   3e-121   Populus trichocarpa [western balsam poplar]
ref|XP_004142736.1|  PREDICTED: auxin-induced protein 5NG4-like         370   3e-121   
ref|XP_004149823.1|  PREDICTED: auxin-induced protein 5NG4-like         371   4e-121   
ref|XP_006410933.1|  hypothetical protein EUTSA_v10016799mg             370   5e-121   
gb|KCW65509.1|  hypothetical protein EUGRSUZ_G02914                     370   6e-121   
ref|XP_008461649.1|  PREDICTED: WAT1-related protein At2g39510-li...    370   6e-121   
gb|KCW49647.1|  hypothetical protein EUGRSUZ_K03165                     373   9e-121   
ref|XP_010939363.1|  PREDICTED: WAT1-related protein At1g21890 is...    369   1e-120   
ref|XP_006436052.1|  hypothetical protein CICLE_v10031808mg             369   2e-120   
ref|XP_011077436.1|  PREDICTED: WAT1-related protein At2g37460-like     369   2e-120   
gb|KDO67719.1|  hypothetical protein CISIN_1g042257mg                   369   2e-120   
ref|XP_008463583.1|  PREDICTED: WAT1-related protein At2g39510-like     370   3e-120   
gb|KHG24903.1|  Auxin-induced 5NG4                                      368   4e-120   
ref|XP_004493898.1|  PREDICTED: WAT1-related protein At2g37460-li...    367   1e-119   
gb|KFK36632.1|  hypothetical protein AALP_AA4G149800                    366   1e-119   
ref|XP_006294412.1|  hypothetical protein CARUB_v10023430mg             366   2e-119   
emb|CDY18444.1|  BnaA04g21430D                                          365   4e-119   
emb|CDX93378.1|  BnaC04g45180D                                          365   4e-119   
ref|XP_008463490.1|  PREDICTED: WAT1-related protein At2g39510-li...    365   5e-119   
emb|CDP06652.1|  unnamed protein product                                363   7e-119   
ref|XP_010517017.1|  PREDICTED: WAT1-related protein At2g37460          365   7e-119   
ref|NP_181282.1|  nodulin MtN21-like transporter family protein         365   7e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509331.1|  PREDICTED: WAT1-related protein At2g37460-like     364   1e-118   
ref|XP_007009429.1|  Nodulin MtN21 /EamA-like transporter family ...    366   2e-118   
ref|XP_010505334.1|  PREDICTED: WAT1-related protein At2g37460-like     363   2e-118   
emb|CDY07788.1|  BnaA03g17230D                                          363   2e-118   
gb|AFK37263.1|  unknown                                                 363   2e-118   
ref|XP_009133180.1|  PREDICTED: WAT1-related protein At2g37460-like     363   2e-118   
ref|XP_010554592.1|  PREDICTED: WAT1-related protein At2g39510-like     363   3e-118   
emb|CDX79734.1|  BnaC03g20700D                                          362   3e-118   
ref|XP_010553301.1|  PREDICTED: WAT1-related protein At2g37460-like     363   3e-118   
ref|XP_009141663.1|  PREDICTED: WAT1-related protein At2g37460          362   4e-118   
ref|XP_009143490.1|  PREDICTED: WAT1-related protein At2g37460-like     362   6e-118   
ref|XP_007144467.1|  hypothetical protein PHAVU_007G158600g             360   3e-117   
gb|KDP35589.1|  hypothetical protein JCGZ_09027                         360   3e-117   
gb|AAM62850.1|  nodulin-like protein                                    357   5e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004167845.1|  PREDICTED: auxin-induced protein 5NG4-like         355   2e-115   
emb|CDX75163.1|  BnaC09g25190D                                          355   4e-115   
ref|XP_010421738.1|  PREDICTED: WAT1-related protein At4g08290          355   7e-115   
ref|XP_007009431.1|  Nodulin MtN21 /EamA-like transporter family ...    353   1e-114   
ref|XP_008233582.1|  PREDICTED: WAT1-related protein At2g39510-li...    352   1e-114   
ref|XP_009151422.1|  PREDICTED: WAT1-related protein At4g08290          354   1e-114   
emb|CDY29141.1|  BnaA09g53940D                                          353   2e-114   
ref|XP_009614497.1|  PREDICTED: WAT1-related protein At2g37460-li...    353   2e-114   
ref|XP_009778858.1|  PREDICTED: WAT1-related protein At2g37460-li...    352   2e-114   
ref|XP_006436051.1|  hypothetical protein CICLE_v10033577mg             350   9e-114   
ref|XP_006486497.1|  PREDICTED: WAT1-related protein At2g39510-like     349   2e-113   
ref|XP_004494995.1|  PREDICTED: WAT1-related protein At2g37460-li...    348   3e-113   
gb|KHG03072.1|  Auxin-induced 5NG4                                      350   3e-113   
gb|EMS60728.1|  Auxin-induced protein 5NG4                              350   5e-113   
ref|XP_010534299.1|  PREDICTED: WAT1-related protein At2g39510-like     349   8e-113   
ref|XP_002312070.1|  hypothetical protein POPTR_0008s05130g             348   1e-112   Populus trichocarpa [western balsam poplar]
emb|CDX91104.1|  BnaC02g04930D                                          348   1e-112   
ref|XP_011019905.1|  PREDICTED: WAT1-related protein At2g37460-li...    346   2e-112   
gb|EMT04611.1|  Auxin-induced protein 5NG4                              348   3e-112   
ref|XP_008785769.1|  PREDICTED: WAT1-related protein At1g21890-like     356   5e-112   
gb|KHN05928.1|  Auxin-induced protein 5NG4                              347   6e-112   
ref|XP_008461651.1|  PREDICTED: WAT1-related protein At2g39510-li...    346   6e-112   
ref|XP_003537193.1|  PREDICTED: WAT1-related protein At2g37460-li...    347   6e-112   
emb|CDY65991.1|  BnaA10g29860D                                          347   7e-112   
ref|XP_006397315.1|  hypothetical protein EUTSA_v10028726mg             347   8e-112   
gb|EYU41683.1|  hypothetical protein MIMGU_mgv1a009185mg                345   1e-111   
ref|XP_010455250.1|  PREDICTED: WAT1-related protein At4g08290-like     346   2e-111   
ref|XP_011023643.1|  PREDICTED: WAT1-related protein At5g13670-like     345   2e-111   
ref|XP_006655900.1|  PREDICTED: WAT1-related protein At1g21890-like     345   3e-111   
ref|XP_010419331.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    345   3e-111   
ref|XP_002872388.1|  hypothetical protein ARALYDRAFT_489740             345   3e-111   
emb|CDY18443.1|  BnaA04g21440D                                          345   3e-111   
ref|XP_010664224.1|  PREDICTED: WAT1-related protein At1g21890          345   6e-111   
ref|XP_009141664.1|  PREDICTED: WAT1-related protein At2g37460-li...    343   1e-110   
ref|XP_009121742.1|  PREDICTED: WAT1-related protein At5g13670          345   1e-110   
ref|XP_010274315.1|  PREDICTED: WAT1-related protein At1g21890          343   1e-110   
gb|AAM65570.1|  nodulin-like protein                                    343   1e-110   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93377.1|  BnaC04g45190D                                          343   2e-110   
emb|CDY09817.1|  BnaC09g43440D                                          342   2e-110   
ref|XP_007220060.1|  hypothetical protein PRUPE_ppa025780mg             343   2e-110   
ref|XP_006294396.1|  hypothetical protein CARUB_v10023413mg             343   2e-110   
ref|NP_192569.1|  nodulin MtN21 /EamA-like transporter family pro...    343   2e-110   Arabidopsis thaliana [mouse-ear cress]
gb|EEC66707.1|  hypothetical protein OsI_33030                          342   2e-110   Oryza sativa Indica Group [Indian rice]
ref|XP_002454615.1|  hypothetical protein SORBIDRAFT_04g034330          343   3e-110   Sorghum bicolor [broomcorn]
ref|XP_010272782.1|  PREDICTED: WAT1-related protein At1g21890-like     343   3e-110   
ref|XP_006289117.1|  hypothetical protein CARUB_v10002538mg             343   3e-110   
ref|XP_006429015.1|  hypothetical protein CICLE_v10012001mg             342   4e-110   
gb|KDP32785.1|  hypothetical protein JCGZ_12077                         341   1e-109   
ref|XP_010438422.1|  PREDICTED: WAT1-related protein At4g08290-like     341   1e-109   
gb|KFK32145.1|  hypothetical protein AALP_AA6G204100                    341   1e-109   
ref|XP_006399861.1|  hypothetical protein EUTSA_v10013837mg             341   2e-109   
gb|EMS46274.1|  Auxin-induced protein 5NG4                              341   2e-109   
ref|XP_010096638.1|  Auxin-induced protein 5NG4                         340   2e-109   
ref|XP_008233580.1|  PREDICTED: WAT1-related protein At2g39510-like     340   3e-109   
ref|XP_011070079.1|  PREDICTED: WAT1-related protein At5g07050-like     341   4e-109   
ref|XP_010492135.1|  PREDICTED: WAT1-related protein At5g13670 is...    340   5e-109   
ref|XP_010492134.1|  PREDICTED: WAT1-related protein At5g13670 is...    340   5e-109   
ref|XP_010558786.1|  PREDICTED: WAT1-related protein At5g13670          339   6e-109   
dbj|BAC43205.1|  putative nodulin                                       339   8e-109   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001064323.1|  Os10g0210500                                       338   2e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010063373.1|  PREDICTED: WAT1-related protein At4g08300-like     338   2e-108   
ref|XP_010097389.1|  Auxin-induced protein 5NG4                         337   4e-108   
ref|XP_006661686.1|  PREDICTED: WAT1-related protein At4g08290-like     337   4e-108   
ref|XP_006289509.1|  hypothetical protein CARUB_v10003044mg             337   4e-108   
gb|EYU28757.1|  hypothetical protein MIMGU_mgv1a023410mg                333   1e-107   
ref|XP_006649078.1|  PREDICTED: WAT1-related protein At1g21890-like     335   2e-107   
ref|XP_010453454.1|  PREDICTED: WAT1-related protein At5g13670-like     335   2e-107   
dbj|BAJ98418.1|  predicted protein                                      335   3e-107   
ref|XP_004290852.1|  PREDICTED: auxin-induced protein 5NG4-like         334   4e-107   
gb|KCW65508.1|  hypothetical protein EUGRSUZ_G02912                     334   5e-107   
ref|XP_009620098.1|  PREDICTED: WAT1-related protein At5g07050-like     334   6e-107   
ref|NP_196871.1|  nodulin MtN21-like transporter UMAMIT 15              333   1e-106   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD35697.1|  putative MtN21                                         333   1e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009800321.1|  PREDICTED: WAT1-related protein At5g07050-like     334   1e-106   
ref|XP_004983289.1|  PREDICTED: WAT1-related protein At4g08290-like     333   1e-106   
ref|XP_003542469.1|  PREDICTED: WAT1-related protein At2g37460-like     333   2e-106   
ref|XP_006349970.1|  PREDICTED: WAT1-related protein At2g37460-like     335   2e-106   
gb|EMT33815.1|  Auxin-induced protein 5NG4                              333   2e-106   
gb|EAZ00107.1|  hypothetical protein OsI_22111                          333   2e-106   Oryza sativa Indica Group [Indian rice]
gb|KGN54575.1|  hypothetical protein Csa_4G365050                       332   2e-106   
ref|XP_008802062.1|  PREDICTED: WAT1-related protein At1g21890-like     332   3e-106   
ref|NP_001048238.1|  Os02g0768300                                       333   3e-106   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74071.1|  hypothetical protein OsI_09081                          332   3e-106   Oryza sativa Indica Group [Indian rice]
gb|EAZ36228.1|  hypothetical protein OsJ_20548                          333   3e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008391905.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    332   4e-106   
ref|XP_003570554.1|  PREDICTED: WAT1-related protein At1g44800-like     333   4e-106   
ref|XP_002302243.2|  nodulin MtN21 family protein                       332   4e-106   Populus trichocarpa [western balsam poplar]
ref|XP_006482028.1|  PREDICTED: WAT1-related protein At5g07050-like     333   5e-106   
ref|XP_006364778.1|  PREDICTED: WAT1-related protein At5g07050-like     331   7e-106   
dbj|BAK04730.1|  predicted protein                                      331   8e-106   
ref|XP_002517269.1|  Auxin-induced protein 5NG4, putative               331   9e-106   Ricinus communis
ref|XP_009340894.1|  PREDICTED: WAT1-related protein At1g21890-like     330   1e-105   
gb|KHN48995.1|  Auxin-induced protein 5NG4                              331   1e-105   
ref|XP_010916579.1|  PREDICTED: WAT1-related protein At1g21890-like     330   1e-105   
ref|XP_010544709.1|  PREDICTED: WAT1-related protein At4g08290 is...    330   3e-105   
ref|XP_002489200.1|  hypothetical protein SORBIDRAFT_0012s002110        330   3e-105   Sorghum bicolor [broomcorn]
ref|XP_008646318.1|  PREDICTED: WAT1-related protein At1g44800-like     330   3e-105   
gb|EYU20823.1|  hypothetical protein MIMGU_mgv1a008005mg                330   3e-105   
emb|CDP06236.1|  unnamed protein product                                330   3e-105   
ref|XP_004249118.1|  PREDICTED: WAT1-related protein At5g07050          330   3e-105   
ref|XP_008444144.1|  PREDICTED: WAT1-related protein At1g44800-like     329   4e-105   
ref|XP_009125930.1|  PREDICTED: WAT1-related protein At5g13670-like     329   4e-105   
emb|CDX85633.1|  BnaA02g01800D                                          329   4e-105   
ref|XP_009621489.1|  PREDICTED: WAT1-related protein At5g07050-li...    330   5e-105   
ref|XP_009344114.1|  PREDICTED: WAT1-related protein At4g08300-like     328   5e-105   
ref|XP_010096633.1|  Auxin-induced protein 5NG4                         329   6e-105   
ref|XP_009610629.1|  PREDICTED: WAT1-related protein At5g07050-li...    329   7e-105   
ref|NP_001148990.1|  nodulin protein                                    329   8e-105   Zea mays [maize]
ref|XP_009409675.1|  PREDICTED: WAT1-related protein At1g21890-like     328   1e-104   
ref|XP_010999362.1|  PREDICTED: WAT1-related protein At4g08290 is...    327   1e-104   
ref|XP_006339335.1|  PREDICTED: WAT1-related protein At5g07050-like     327   1e-104   
ref|XP_009790909.1|  PREDICTED: WAT1-related protein At5g07050-li...    328   2e-104   
ref|XP_009788498.1|  PREDICTED: WAT1-related protein At5g07050-like     328   2e-104   
ref|XP_004494994.1|  PREDICTED: WAT1-related protein At2g37460-li...    325   3e-104   
ref|XP_011041376.1|  PREDICTED: WAT1-related protein At5g07050          328   3e-104   
ref|XP_007019030.1|  Nodulin MtN21 /EamA-like transporter family ...    327   3e-104   
ref|XP_009620096.1|  PREDICTED: WAT1-related protein At5g07050-like     328   4e-104   
ref|XP_004493899.1|  PREDICTED: WAT1-related protein At2g37460-li...    326   4e-104   
ref|XP_010926422.1|  PREDICTED: WAT1-related protein At1g21890-like     327   4e-104   
ref|XP_010673090.1|  PREDICTED: WAT1-related protein At5g07050          328   5e-104   
ref|XP_004253170.1|  PREDICTED: WAT1-related protein At2g37460-like     328   5e-104   
gb|KDO40045.1|  hypothetical protein CISIN_1g019311mg                   325   5e-104   
ref|NP_001137108.1|  hypothetical protein                               326   5e-104   Zea mays [maize]
gb|AFK34273.1|  unknown                                                 327   6e-104   
ref|XP_007223359.1|  hypothetical protein PRUPE_ppa007464mg             326   6e-104   
emb|CAH58631.1|  nodulin-like protein                                   326   7e-104   Plantago major [cart-track plant]
ref|XP_004249327.1|  PREDICTED: WAT1-related protein At5g07050-li...    327   7e-104   
ref|XP_004294697.1|  PREDICTED: auxin-induced protein 5NG4-like         326   8e-104   
ref|XP_011027560.1|  PREDICTED: WAT1-related protein At4g08300-like     326   1e-103   
ref|XP_009390255.1|  PREDICTED: WAT1-related protein At1g21890-like     325   1e-103   
gb|KHG29659.1|  Auxin-induced 5NG4                                      325   1e-103   
gb|EMS60727.1|  Auxin-induced protein 5NG4                              325   1e-103   
ref|XP_003601058.1|  Auxin-induced protein 5NG4                         325   2e-103   
ref|XP_006472756.1|  PREDICTED: WAT1-related protein At1g21890-like     325   2e-103   
ref|XP_008466700.1|  PREDICTED: WAT1-related protein At4g08290          325   2e-103   
gb|EMS57240.1|  Auxin-induced protein 5NG4                              323   2e-103   
ref|XP_006434165.1|  hypothetical protein CICLE_v10001460mg             325   2e-103   
ref|XP_010111209.1|  Auxin-induced protein 5NG4                         325   3e-103   
ref|XP_009340891.1|  PREDICTED: WAT1-related protein At4g08290-like     325   4e-103   
ref|XP_010244423.1|  PREDICTED: WAT1-related protein At5g07050          325   4e-103   
gb|AFK39842.1|  unknown                                                 323   4e-103   
ref|XP_010938846.1|  PREDICTED: WAT1-related protein At5g07050-like     325   5e-103   
ref|XP_006430497.1|  hypothetical protein CICLE_v10012013mg             323   5e-103   
gb|ABR18253.1|  unknown                                                 326   5e-103   Picea sitchensis
ref|XP_010669710.1|  PREDICTED: WAT1-related protein At4g08300-like     325   5e-103   
gb|ABK25095.1|  unknown                                                 324   6e-103   
ref|XP_008810183.1|  PREDICTED: WAT1-related protein At5g07050-like     325   6e-103   
gb|KHG29332.1|  Auxin-induced 5NG4                                      323   8e-103   
ref|NP_001242267.1|  uncharacterized protein LOC100811617               324   9e-103   
ref|XP_004955229.1|  PREDICTED: WAT1-related protein At1g21890-like     324   1e-102   
ref|XP_007019027.1|  Nodulin MtN21 /EamA-like transporter family ...    323   1e-102   
ref|XP_006604312.1|  PREDICTED: WAT1-related protein At5g07050-like     323   1e-102   
gb|ABR16695.1|  unknown                                                 323   2e-102   
ref|XP_002306625.2|  hypothetical protein POPTR_0005s15820g             322   2e-102   
ref|XP_002306626.2|  hypothetical protein POPTR_0005s15810g             322   2e-102   
ref|XP_010091381.1|  Auxin-induced protein 5NG4                         322   3e-102   
gb|AFK47115.1|  unknown                                                 321   9e-102   
ref|XP_008219763.1|  PREDICTED: WAT1-related protein At4g08300          320   1e-101   
ref|XP_007162036.1|  hypothetical protein PHAVU_001G118300g             322   1e-101   
ref|XP_008788560.1|  PREDICTED: WAT1-related protein At5g07050-like     320   2e-101   
gb|AFK35679.1|  unknown                                                 320   3e-101   
gb|KHN09198.1|  Auxin-induced protein 5NG4                              320   3e-101   
ref|XP_010906409.1|  PREDICTED: WAT1-related protein At5g07050-like     320   3e-101   
ref|XP_006581581.1|  PREDICTED: WAT1-related protein At4g08300          320   3e-101   
ref|XP_009391606.1|  PREDICTED: WAT1-related protein At5g07050-like     320   3e-101   
ref|XP_009390894.1|  PREDICTED: WAT1-related protein At1g21890-like     319   4e-101   
ref|XP_002323220.2|  hypothetical protein POPTR_0016s03120g             320   5e-101   
ref|XP_010419959.1|  PREDICTED: WAT1-related protein At5g13670-like     319   6e-101   
gb|ACJ84735.1|  unknown                                                 318   6e-101   
gb|KDP22890.1|  hypothetical protein JCGZ_01964                         318   7e-101   
ref|XP_004290853.1|  PREDICTED: auxin-induced protein 5NG4-like         318   7e-101   
gb|AGZ85011.1|  hypothetical protein 6                                  319   7e-101   
ref|XP_002436678.1|  hypothetical protein SORBIDRAFT_10g006950          319   9e-101   
ref|NP_001240202.1|  uncharacterized protein LOC100811114               318   9e-101   
ref|NP_001141126.1|  uncharacterized protein LOC100273211               318   1e-100   
ref|XP_003601053.1|  Auxin-induced protein 5NG4                         318   1e-100   
ref|XP_008795134.1|  PREDICTED: WAT1-related protein At5g07050-like     318   1e-100   
ref|XP_004493327.1|  PREDICTED: WAT1-related protein At5g07050-li...    318   2e-100   
gb|KHN47031.1|  Auxin-induced protein 5NG4-like protein                 318   2e-100   
ref|XP_004145365.1|  PREDICTED: auxin-induced protein 5NG4-like         317   3e-100   
gb|ABB47055.1|  nodulin MtN21 family protein, putative, expressed       314   4e-100   
ref|XP_002284452.2|  PREDICTED: WAT1-related protein At4g08290          317   4e-100   
ref|XP_009388785.1|  PREDICTED: WAT1-related protein At1g21890-like     316   5e-100   
ref|XP_011015432.1|  PREDICTED: WAT1-related protein At5g07050-like     317   5e-100   
gb|KGN61714.1|  hypothetical protein Csa_2G231960                       317   6e-100   
ref|XP_002441090.1|  hypothetical protein SORBIDRAFT_09g020200          317   7e-100   
ref|XP_010055591.1|  PREDICTED: WAT1-related protein At5g07050-like     317   7e-100   
ref|XP_004151540.1|  PREDICTED: auxin-induced protein 5NG4-like         316   7e-100   
ref|XP_009398157.1|  PREDICTED: WAT1-related protein At1g21890-like     316   7e-100   
ref|XP_010534673.1|  PREDICTED: WAT1-related protein At1g21890 is...    317   1e-99    
ref|XP_006399183.1|  hypothetical protein EUTSA_v10015938mg             316   1e-99    
ref|XP_010064999.1|  PREDICTED: WAT1-related protein At4g08300-like     315   1e-99    
ref|XP_007137403.1|  hypothetical protein PHAVU_009G124100g             315   2e-99    
emb|CDX70003.1|  BnaA10g23520D                                          315   2e-99    
gb|KFK25097.1|  hypothetical protein AALP_AA8G066000                    315   2e-99    
ref|XP_009403831.1|  PREDICTED: WAT1-related protein At5g07050-like     316   3e-99    
ref|XP_004167156.1|  PREDICTED: auxin-induced protein 5NG4-like         315   3e-99    
ref|XP_004249326.1|  PREDICTED: WAT1-related protein At5g07050          314   3e-99    
ref|XP_008219662.1|  PREDICTED: WAT1-related protein At1g21890-like     314   3e-99    
emb|CDP15800.1|  unnamed protein product                                314   3e-99    
ref|XP_010055600.1|  PREDICTED: WAT1-related protein At5g07050-like     315   4e-99    
gb|KGN59418.1|  hypothetical protein Csa_3G818270                       315   4e-99    
ref|XP_010682440.1|  PREDICTED: WAT1-related protein At4g08300-like     315   4e-99    
ref|XP_004136769.1|  PREDICTED: auxin-induced protein 5NG4-like         314   5e-99    
gb|ACD56621.1|  putative nodulin-like protein                           314   5e-99    
ref|XP_011069552.1|  PREDICTED: WAT1-related protein At1g21890-like     314   5e-99    
ref|XP_010999364.1|  PREDICTED: WAT1-related protein At4g08300-like     314   5e-99    
ref|XP_002873622.1|  nodulin MtN21 family protein                       313   6e-99    
emb|CDM84603.1|  unnamed protein product                                313   8e-99    
ref|XP_002308862.2|  hypothetical protein POPTR_0006s03200g             314   1e-98    
ref|XP_009122385.1|  PREDICTED: WAT1-related protein At5g07050          313   1e-98    
ref|XP_011040724.1|  PREDICTED: WAT1-related protein At5g07050          314   1e-98    
gb|KDP40571.1|  hypothetical protein JCGZ_24570                         314   1e-98    
gb|KHG09563.1|  Auxin-induced 5NG4                                      313   2e-98    
ref|XP_004962102.1|  PREDICTED: WAT1-related protein At5g07050-like     313   2e-98    
ref|XP_002873292.1|  hypothetical protein ARALYDRAFT_487525             313   3e-98    
ref|XP_008655310.1|  PREDICTED: uncharacterized protein LOC100384...    313   3e-98    
ref|XP_007019025.1|  Nodulin MtN21 /EamA-like transporter family ...    311   3e-98    
gb|KHG10291.1|  Auxin-induced 5NG4                                      311   4e-98    
gb|ABS52574.1|  nodulin family protein                                  311   4e-98    
ref|XP_011085946.1|  PREDICTED: WAT1-related protein At5g07050          312   4e-98    
gb|ACR34989.1|  unknown                                                 311   8e-98    
gb|KHG16518.1|  Auxin-induced 5NG4                                      310   1e-97    
ref|XP_006339251.1|  PREDICTED: WAT1-related protein At5g07050-like     310   1e-97    
ref|XP_006644860.1|  PREDICTED: WAT1-related protein At5g07050-like     310   1e-97    
gb|EMT31802.1|  Auxin-induced protein 5NG4                              310   1e-97    
ref|XP_010999363.1|  PREDICTED: WAT1-related protein At4g08290 is...    308   2e-97    
ref|XP_009419851.1|  PREDICTED: WAT1-related protein At5g07050-like     310   2e-97    
gb|EYU23896.1|  hypothetical protein MIMGU_mgv1a008243mg                310   2e-97    
ref|XP_002299181.1|  hypothetical protein POPTR_0001s06980g             311   2e-97    
ref|XP_008443233.1|  PREDICTED: WAT1-related protein At5g07050-like     310   2e-97    
ref|XP_011079091.1|  PREDICTED: WAT1-related protein At5g07050-like     310   2e-97    
gb|EYU26922.1|  hypothetical protein MIMGU_mgv1a007458mg                310   2e-97    
ref|XP_007141061.1|  hypothetical protein PHAVU_008G164000g             309   3e-97    
ref|XP_008445949.1|  PREDICTED: WAT1-related protein At5g07050          309   3e-97    
dbj|BAK04850.1|  predicted protein                                      309   3e-97    
ref|NP_001055529.2|  Os05g0409500                                       310   4e-97    
dbj|BAB92246.1|  putative nodulin MtN21                                 309   5e-97    
gb|EMS48876.1|  Auxin-induced protein 5NG4                              309   5e-97    
gb|EAY98030.1|  hypothetical protein OsI_19945                          310   5e-97    
gb|EYU22954.1|  hypothetical protein MIMGU_mgv1a0088041mg               308   5e-97    
ref|XP_008219762.1|  PREDICTED: WAT1-related protein At4g08290          308   6e-97    
gb|EEC79453.1|  hypothetical protein OsI_20446                          309   7e-97    
ref|NP_001055921.1|  Os05g0493800                                       309   7e-97    
emb|CDY00403.1|  BnaC07g14230D                                          308   9e-97    
ref|XP_003564421.1|  PREDICTED: WAT1-related protein At5g07050          308   9e-97    
gb|KHG18008.1|  Auxin-induced 5NG4                                      308   1e-96    
ref|XP_004964911.1|  PREDICTED: WAT1-related protein At1g44800-like     308   1e-96    
ref|XP_003526345.1|  PREDICTED: WAT1-related protein At5g07050-like     308   2e-96    
ref|XP_008443232.1|  PREDICTED: WAT1-related protein At5g07050-like     307   2e-96    
dbj|BAK02715.1|  predicted protein                                      307   2e-96    
gb|ADN33888.1|  nodulin-like protein                                    307   2e-96    
ref|XP_007223097.1|  hypothetical protein PRUPE_ppa007061mg             307   2e-96    
ref|XP_003560938.1|  PREDICTED: WAT1-related protein At1g44800-like     307   3e-96    
gb|EEC71658.1|  hypothetical protein OsI_04113                          307   3e-96    
ref|XP_010096006.1|  Auxin-induced protein 5NG4                         307   4e-96    
ref|XP_008375333.1|  PREDICTED: WAT1-related protein At5g07050-like     306   4e-96    
ref|XP_006471332.1|  PREDICTED: WAT1-related protein At5g07050-like     307   4e-96    
ref|XP_008782344.1|  PREDICTED: WAT1-related protein At1g21890-like     307   4e-96    
ref|XP_002267371.1|  PREDICTED: WAT1-related protein At5g07050          306   7e-96    
ref|XP_011034692.1|  PREDICTED: WAT1-related protein At5g07050-like     306   7e-96    
ref|XP_006410932.1|  hypothetical protein EUTSA_v10016799mg             303   1e-95    
ref|XP_003601062.1|  Auxin-induced protein 5NG4                         306   1e-95    
ref|XP_006432378.1|  hypothetical protein CICLE_v10001335mg             306   1e-95    
gb|EMS45454.1|  Auxin-induced protein 5NG4                              305   1e-95    
ref|XP_003523924.1|  PREDICTED: WAT1-related protein At5g07050-like     305   1e-95    
ref|XP_010423261.1|  PREDICTED: WAT1-related protein At5g07050          305   2e-95    
ref|XP_003544681.1|  PREDICTED: WAT1-related protein At1g44800-like     305   2e-95    
ref|XP_007218075.1|  hypothetical protein PRUPE_ppa006848mg             304   3e-95    
ref|NP_196322.3|  nodulin MtN21 /EamA-like transporter family pro...    305   3e-95    
gb|AFK35983.1|  unknown                                                 303   3e-95    
ref|XP_002283348.1|  PREDICTED: WAT1-related protein At5g07050          304   3e-95    
ref|XP_003568462.2|  PREDICTED: WAT1-related protein At5g07050-like     304   5e-95    
ref|XP_009361913.1|  PREDICTED: WAT1-related protein At5g07050-like     304   6e-95    
ref|XP_006289728.1|  hypothetical protein CARUB_v10003296mg             303   6e-95    
ref|XP_011020462.1|  PREDICTED: WAT1-related protein At5g07050          304   7e-95    
ref|XP_007223104.1|  hypothetical protein PRUPE_ppa007123mg             303   7e-95    
ref|XP_003628011.1|  Auxin-induced protein 5NG4                         303   8e-95    
ref|XP_010456426.1|  PREDICTED: WAT1-related protein At5g07050-like     303   9e-95    
ref|XP_002284458.1|  PREDICTED: WAT1-related protein At4g08290 is...    303   1e-94    
ref|XP_006654584.1|  PREDICTED: WAT1-related protein At5g07050-like     303   1e-94    
ref|XP_010067382.1|  PREDICTED: WAT1-related protein At2g39510-like     300   1e-94    
ref|XP_009370627.1|  PREDICTED: WAT1-related protein At5g07050-like     303   2e-94    
ref|NP_001150619.1|  nodulin-like protein                               303   2e-94    
ref|XP_006416254.1|  hypothetical protein EUTSA_v10007890mg             302   2e-94    
gb|KHG23400.1|  Auxin-induced 5NG4                                      302   2e-94    
gb|ACL54205.1|  unknown                                                 303   2e-94    
ref|XP_002458648.1|  hypothetical protein SORBIDRAFT_03g037390          303   2e-94    
ref|XP_010538980.1|  PREDICTED: WAT1-related protein At4g08300          301   3e-94    
ref|XP_010459911.1|  PREDICTED: WAT1-related protein At1g21890          302   3e-94    
ref|XP_009363179.1|  PREDICTED: WAT1-related protein At1g21890-like     301   3e-94    
gb|AFW82369.1|  hypothetical protein ZEAMMB73_445023                    301   3e-94    
ref|XP_004307206.1|  PREDICTED: auxin-induced protein 5NG4-like         302   4e-94    
ref|XP_011091919.1|  PREDICTED: WAT1-related protein At5g07050-like     301   4e-94    
ref|XP_008346651.1|  PREDICTED: WAT1-related protein At5g07050-like     301   4e-94    
ref|XP_009346345.1|  PREDICTED: WAT1-related protein At1g21890-like     301   5e-94    
ref|XP_010477438.1|  PREDICTED: WAT1-related protein At1g21890-like     301   5e-94    
gb|KFK44291.1|  hypothetical protein AALP_AA1G239100                    301   6e-94    
ref|XP_010067678.1|  PREDICTED: WAT1-related protein At5g07050          301   6e-94    
gb|KGN59420.1|  hypothetical protein Csa_3G819280                       301   7e-94    
ref|XP_004499808.1|  PREDICTED: WAT1-related protein At5g07050-like     301   7e-94    
ref|XP_004136770.1|  PREDICTED: auxin-induced protein 5NG4-like         299   7e-94    
ref|XP_008388240.1|  PREDICTED: WAT1-related protein At1g21890          300   8e-94    
dbj|BAJ92223.1|  predicted protein                                      301   8e-94    
ref|XP_004164556.1|  PREDICTED: auxin-induced protein 5NG4-like         298   1e-93    
ref|XP_007148806.1|  hypothetical protein PHAVU_005G015900g             300   1e-93    
ref|XP_011074856.1|  PREDICTED: WAT1-related protein At1g44800-like     300   2e-93    
emb|CAA75575.1|  MtN21                                                  300   2e-93    
ref|XP_004498328.1|  PREDICTED: WAT1-related protein At1g44800-li...    300   2e-93    
ref|XP_010091380.1|  Auxin-induced protein 5NG4                         300   2e-93    
ref|XP_006307681.1|  hypothetical protein CARUB_v10009309mg             300   2e-93    
ref|XP_004493329.1|  PREDICTED: WAT1-related protein At5g07050-li...    297   2e-93    
ref|XP_002303952.2|  hypothetical protein POPTR_0003s19170g             300   2e-93    
ref|XP_007133643.1|  hypothetical protein PHAVU_011G196800g             299   3e-93    
ref|XP_009103277.1|  PREDICTED: WAT1-related protein At1g21890          299   3e-93    
ref|XP_008391904.1|  PREDICTED: WAT1-related protein At1g21890-like     299   4e-93    
ref|NP_001239827.1|  uncharacterized protein LOC100804390               300   4e-93    
ref|XP_006593592.1|  PREDICTED: WAT1-related protein At1g44800-like     298   5e-93    
gb|EYU18591.1|  hypothetical protein MIMGU_mgv1a007543mg                298   7e-93    
ref|XP_003545806.1|  PREDICTED: WAT1-related protein At5g07050-like     299   8e-93    
ref|XP_003590514.1|  Auxin-induced protein 5NG4                         293   9e-93    
emb|CDY04680.1|  BnaC05g17180D                                          298   9e-93    
emb|CDY01310.1|  BnaA07g10830D                                          298   1e-92    
gb|EMT18779.1|  Auxin-induced protein 5NG4                              298   1e-92    
gb|KHG10292.1|  Auxin-induced 5NG4                                      298   1e-92    
ref|XP_009395155.1|  PREDICTED: WAT1-related protein At5g07050-like     297   2e-92    
emb|CBI19038.3|  unnamed protein product                                299   2e-92    
ref|XP_010498646.1|  PREDICTED: WAT1-related protein At1g21890-like     297   2e-92    
ref|XP_010664225.1|  PREDICTED: WAT1-related protein At4g08290 is...    295   2e-92    
ref|XP_004170561.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    297   2e-92    
ref|XP_002513792.1|  Auxin-induced protein 5NG4, putative               296   2e-92    
ref|XP_010495095.1|  PREDICTED: WAT1-related protein At5g07050-like     297   3e-92    
ref|XP_002893187.1|  T26F17.11                                          296   3e-92    
ref|XP_004511088.1|  PREDICTED: WAT1-related protein At5g07050-like     297   3e-92    
gb|KHN09193.1|  Auxin-induced protein 5NG4                              296   4e-92    
ref|XP_006351896.1|  PREDICTED: WAT1-related protein At4g08300-like     295   4e-92    
ref|XP_007137398.1|  hypothetical protein PHAVU_009G123700g             295   4e-92    
ref|NP_173607.1|  WAT1-related protein                                  296   5e-92    
gb|ACU23200.1|  unknown                                                 296   7e-92    
ref|XP_004500563.1|  PREDICTED: WAT1-related protein At4g08290-like     295   7e-92    
ref|XP_002525547.1|  Auxin-induced protein 5NG4, putative               296   8e-92    
ref|XP_007010782.1|  Nodulin MtN21 /EamA-like transporter family ...    296   1e-91    
ref|XP_003544679.1|  PREDICTED: WAT1-related protein At4g08290-like     295   2e-91    
gb|EMT14666.1|  Auxin-induced protein 5NG4                              295   2e-91    
ref|XP_010063982.1|  PREDICTED: WAT1-related protein At4g08290-like     293   3e-91    
ref|XP_003527931.1|  PREDICTED: WAT1-related protein At4g08290-like     294   3e-91    
ref|XP_009767374.1|  PREDICTED: WAT1-related protein At4g08300-like     293   4e-91    
gb|AAL38712.1|  putative nodulin protein                                293   5e-91    
ref|XP_007019026.1|  Nodulin MtN21 /EamA-like transporter family ...    291   6e-91    
ref|XP_009623146.1|  PREDICTED: WAT1-related protein At4g08300 is...    293   7e-91    
ref|XP_009623147.1|  PREDICTED: WAT1-related protein At4g08300 is...    293   7e-91    
gb|KHG29314.1|  Auxin-induced 5NG4                                      290   9e-91    
gb|AFK43964.1|  unknown                                                 289   1e-90    
ref|XP_004494996.1|  PREDICTED: WAT1-related protein At2g37460-li...    288   1e-90    
ref|XP_004250321.2|  PREDICTED: WAT1-related protein At4g08300-like     293   1e-90    
ref|XP_010525695.1|  PREDICTED: WAT1-related protein At2g37460-like     292   2e-90    
ref|XP_010906432.1|  PREDICTED: WAT1-related protein At5g07050-like     292   2e-90    
ref|NP_001170095.1|  hypothetical protein                               293   2e-90    
ref|NP_001151393.1|  nodulin-like protein                               291   3e-90    
ref|XP_008455745.1|  PREDICTED: WAT1-related protein At5g07050-like     293   4e-90    
ref|XP_007141063.1|  hypothetical protein PHAVU_008G164200g             290   5e-90    
gb|KHN33864.1|  Auxin-induced protein 5NG4                              291   5e-90    
ref|XP_004290851.1|  PREDICTED: auxin-induced protein 5NG4-like         290   5e-90    
gb|AAF16542.1|AC013482_16  T26F17.11                                    291   6e-90    
gb|AAM01041.1|AC091735_14  Putative nodulin-like protein                288   6e-90    
ref|XP_004144320.1|  PREDICTED: auxin-induced protein 5NG4-like         292   9e-90    



>ref|XP_006343754.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=366

 Score =   466 bits (1199),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 231/366 (63%), Positives = 292/366 (80%), Gaps = 10/366 (3%)
 Frame = -2

Query  1260  FVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLF  1081
              ++++K  KPY  V  LQ  YA S++I+KSALN GM+H+ F VYRN+ A + FAPFA+LF
Sbjct  4     LLKFVKEGKPYLAVTLLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATIVFAPFALLF  63

Query  1080  ERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWI  901
             ERKIRP+MTI+IFLKIMLL L+EPVIDQNLYY G++YTTAT A AMCN+LPA+TFLLAWI
Sbjct  64    ERKIRPKMTISIFLKIMLLGLVEPVIDQNLYYTGLRYTTATSAAAMCNLLPALTFLLAWI  123

Query  900   LRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHD  721
             LRLE+VNI+ L SQ KI+GTT+T GGAMIMTL+ G  IGLPWT  H+    +I P++  D
Sbjct  124   LRLERVNIKRLSSQAKIIGTTVTFGGAMIMTLIGGPTIGLPWTRHHL----NIIPSSPTD  179

Query  720   --HVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
                +KGA+ IAAGC CW+CFY LQAITLK+YPA LSLTCLIC AGALQ T+LTLVVERGN
Sbjct  180   LQPIKGALFIAAGCICWACFYNLQAITLKTYPATLSLTCLICSAGALQGTLLTLVVERGN  239

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFM  367
               IWA+ WDT+FL+YVY+G++ SGV YY+SG+IM EKGP FVTAFNPL+M++VAI+GSF+
Sbjct  240   TSIWAIQWDTSFLSYVYSGMVTSGVGYYVSGLIMKEKGPVFVTAFNPLNMVIVAILGSFI  299

Query  366   LAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssk--sseddDNNALSNNKESILTKQSA  193
             L+E+L+ G++ G  +I++GLYLVIWGKSKD  SS   SSE+   +   + KE  ++K S 
Sbjct  300   LSEELNLGRVLGGAIIVIGLYLVIWGKSKDQQSSTSFSSEEAVQSEFVDQKE--ISKSSN  357

Query  192   EQKIDD  175
             + K+ D
Sbjct  358   QAKVGD  363



>ref|XP_009798285.1| PREDICTED: WAT1-related protein At2g39510-like [Nicotiana sylvestris]
Length=372

 Score =   461 bits (1186),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 233/367 (63%), Positives = 285/367 (78%), Gaps = 3/367 (1%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
              E  ++++K A+PY  V+ LQ  YA S++I+KSALN GM+H+ F VYRN+ A   FAPFA
Sbjct  4     RERILKFVKEAQPYLAVILLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATFVFAPFA  63

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             M+ ERKIRP MT++IFLKIMLL LLEPVIDQNLYY G++YTTATFATAMCNVLPA+TFLL
Sbjct  64    MVLERKIRPNMTVSIFLKIMLLGLLEPVIDQNLYYTGLRYTTATFATAMCNVLPALTFLL  123

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH--VPQTQSIGP  736
             AWILRLEKVNIR L SQ KIVGTT+T GGAMIM L+ G  IGLPWT +H     T +   
Sbjct  124   AWILRLEKVNIRRLSSQAKIVGTTVTFGGAMIMALIGGPTIGLPWT-RHLLSTTTATSAS  182

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
              TE   +KGA+ IAAGC CW+CFY LQAITLK+YPA LSLTCLIC AGA++ T LTLV E
Sbjct  183   LTELQPIKGALFIAAGCICWACFYNLQAITLKTYPAALSLTCLICSAGAVEGTALTLVAE  242

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             RGN  IWA+H DT  L+YVY+G++ SG+ YY+SG+IM +KGP FVTAFNPL+M++VAI+G
Sbjct  243   RGNTSIWAIHLDTKLLSYVYSGMVTSGLGYYVSGLIMKDKGPVFVTAFNPLNMVLVAILG  302

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQS  196
             SF+L+EQL+ G++ G  +I++GLYLVIWGKSKD   SKSS  DD  A    KE+ +TK  
Sbjct  303   SFILSEQLNLGRVLGGAIIVIGLYLVIWGKSKDQILSKSSSTDDAEAEPVGKETSITKSL  362

Query  195   AEQKIDD  175
              + K  D
Sbjct  363   NQVKAGD  369



>ref|XP_004240770.1| PREDICTED: WAT1-related protein At2g39510 [Solanum lycopersicum]
Length=364

 Score =   458 bits (1179),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 225/363 (62%), Positives = 283/363 (78%), Gaps = 10/363 (3%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             +++K  K Y  V  LQ  YA S++I+KSALN GM+H+ F VYRN+ A + FAPFA++FER
Sbjct  6     KFVKEGKAYLAVTLLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATIVFAPFALVFER  65

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             KIRP+M+I+IFLKIMLL L+EPVIDQNLYY G++YTTAT A AMCN+LPA+TFLLAWILR
Sbjct  66    KIRPKMSISIFLKIMLLGLVEPVIDQNLYYTGLRYTTATSAAAMCNLLPALTFLLAWILR  125

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS-KHVPQTQSIGPATEHD-  721
             LEKVNI  L SQ KI+GTT+T GGAMIMTLV G  IGLPWT   H+    +I P++  D 
Sbjct  126   LEKVNIMRLSSQAKIIGTTVTFGGAMIMTLVGGPTIGLPWTRHDHI----NIIPSSTTDL  181

Query  720   -HVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNY  544
               +KGA+ IAAGC CW+CFY LQAITLK+YPA LSLTCLIC AGALQ T+LTLVVERGN 
Sbjct  182   QPIKGALFIAAGCICWACFYNLQAITLKTYPASLSLTCLICSAGALQGTLLTLVVERGNT  241

Query  543   GIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFML  364
              IWA+ WDTTFL+YVY+G++ SGV YY+SG+IM EKGP FVTAFNPL+M++VAI+GSF+L
Sbjct  242   SIWAIQWDTTFLSYVYSGMVTSGVGYYVSGLIMKEKGPVFVTAFNPLNMVIVAILGSFIL  301

Query  363   AEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQK  184
             +E+L+ G++ G  +I++GLYLVIWG       S S E+   +   + KE  ++K S + K
Sbjct  302   SEELNLGRVLGGAIIVIGLYLVIWG-KSKDQQSLSIEETAQSEFVDQKE--ISKSSNQAK  358

Query  183   IDD  175
             + D
Sbjct  359   VGD  361



>ref|XP_009625314.1| PREDICTED: WAT1-related protein At2g39510-like [Nicotiana tomentosiformis]
Length=375

 Score =   458 bits (1178),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 241/377 (64%), Positives = 293/377 (78%), Gaps = 8/377 (2%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
              E  +++LK AKPY  V+FLQ  YA S++I+KSALN GM+HY F VYRN  AAV FAPFA
Sbjct  6     KECLIKFLKEAKPYLAVIFLQFGYAGSAIIAKSALNHGMSHYAFAVYRNSFAAVVFAPFA  65

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
              + ERKIRP+MT++IF KIMLL LLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL
Sbjct  66    AILERKIRPKMTLSIFWKIMLLGLLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  125

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPAT  730
             AWILRLE VNI  +HSQ KIVGT +T+GGAM+MTLV G  IGLPWT KH   T S+   T
Sbjct  126   AWILRLENVNIWKIHSQAKIVGTIITLGGAMVMTLVGGPTIGLPWT-KHSTTTTSVASPT  184

Query  729   EHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
             E + VKGA+ I  GCFCW+CFY LQ ITLK+YPAGLSLT LICMAGALQ T LTLVVERG
Sbjct  185   ELNPVKGALFILVGCFCWACFYNLQMITLKAYPAGLSLTSLICMAGALQGTALTLVVERG  244

Query  549   NYGIWALHWDTTFL-AYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
             N  +W++ W ++ L AYVY GI+ SG+ YY+SG+IMN KGP FVTAFNPL+M++VAI+GS
Sbjct  245   NSAVWSIQWGSSKLFAYVYCGIVNSGIGYYVSGLIMNVKGPVFVTAFNPLNMVIVAILGS  304

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSA  193
             F+L+EQL+ G++ GA VI++GLYLVIWG +K+  SSK       +  +  +E+ + K+ A
Sbjct  305   FILSEQLNLGRVVGAAVIVIGLYLVIWGTTKEQKSSKIL-----STTTEEEEAAVDKELA  359

Query  192   EQKIDDTIKIRTVDDTV  142
             E K  +   I T D++V
Sbjct  360   EIKSSNQAVI-TGDESV  375



>ref|XP_009601954.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Nicotiana 
tomentosiformis]
Length=372

 Score =   457 bits (1175),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 230/367 (63%), Positives = 283/367 (77%), Gaps = 3/367 (1%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
              E  ++++K A+PY  V+ LQ  YA S++I+KSALN GM+H+ F VYRN  A + FAPFA
Sbjct  4     RERLLKFVKEAQPYLAVILLQFGYAGSAIIAKSALNHGMSHFTFAVYRNAFATLVFAPFA  63

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             ++ ERKIRP MT++IFLKIMLL LLEPVIDQNLYY G++YTTATFATAMCNVLPA+TF+L
Sbjct  64    IVLERKIRPNMTVSIFLKIMLLGLLEPVIDQNLYYTGLRYTTATFATAMCNVLPALTFML  123

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH--VPQTQSIGP  736
             AWILRLEKVN+R L SQ KIVGTT+T GGAMIMTL+ G  IGLPWT +H     T +   
Sbjct  124   AWILRLEKVNVRRLSSQAKIVGTTVTFGGAMIMTLIGGPTIGLPWT-RHLLSTTTATSAS  182

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
              TE   +KGA+ IAAGC CW+CFY LQAITLK+YPA LSLTCLIC AGA+Q T LTLV E
Sbjct  183   LTELQPIKGALFIAAGCICWACFYNLQAITLKTYPAALSLTCLICSAGAVQGTALTLVAE  242

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             RGN  IW++H DT  L+YVY+G++ SGV YY+SG+IM +KGP FVTAFNPL+M++VAI+G
Sbjct  243   RGNTSIWSIHLDTKLLSYVYSGMVTSGVGYYVSGLIMKDKGPVFVTAFNPLNMVIVAILG  302

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQS  196
             SF+L+EQL+ G++ G  +I++GLYLVIWGKSKD   SK S  DD       KE+  TK  
Sbjct  303   SFILSEQLNLGRVLGGAIIVIGLYLVIWGKSKDQKLSKYSSTDDVEVEPVGKETSTTKSL  362

Query  195   AEQKIDD  175
              + K  D
Sbjct  363   NQTKAGD  369



>ref|XP_009798400.1| PREDICTED: WAT1-related protein At2g39510 [Nicotiana sylvestris]
Length=373

 Score =   452 bits (1164),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 225/328 (69%), Positives = 266/328 (81%), Gaps = 1/328 (0%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
              E  +++LK AKPY  V+FLQ  YA S++I+KSALN GM+HY F VYRN  AAV FAPFA
Sbjct  6     KECLIKFLKEAKPYLAVIFLQFGYAGSAIIAKSALNHGMSHYTFAVYRNAFAAVVFAPFA  65

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
              LFERKIRP+MT +IF KIMLL LLEPVIDQNLYYAGMK+TTATFATAMCNVLPAITFLL
Sbjct  66    ALFERKIRPKMTFSIFWKIMLLGLLEPVIDQNLYYAGMKFTTATFATAMCNVLPAITFLL  125

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPAT  730
             AWILRLE VNI  +HSQ KIVGT +T+GGAM+MTLV G  IGLPWT      T S+   T
Sbjct  126   AWILRLENVNIWKIHSQAKIVGTIITLGGAMVMTLVGGPTIGLPWTKHSSTATTSVASPT  185

Query  729   EHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
             E + VKGA+ I  GCFCW+CFY LQ ITLK+YPAGLSLT LICMAGALQ T LTLVVERG
Sbjct  186   ELNPVKGALFILVGCFCWACFYNLQMITLKAYPAGLSLTSLICMAGALQGTALTLVVERG  245

Query  549   NYGIWALHWDTT-FLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
             N  +W++ W ++  +A VY GI+ SG+ YY+SG+IMN KGP FVTAFNPL+M++VAI+GS
Sbjct  246   NSAVWSIQWGSSKLIASVYCGIVNSGIGYYVSGLIMNVKGPVFVTAFNPLNMVIVAILGS  305

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F+L+EQL+ G++ GA VI++GLYLVIWG
Sbjct  306   FILSEQLNLGRVVGAAVIVIGLYLVIWG  333



>ref|XP_011072605.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Sesamum 
indicum]
Length=379

 Score =   452 bits (1163),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 215/326 (66%), Positives = 256/326 (79%), Gaps = 4/326 (1%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             ++L+ AKPY  V+ LQ     S++I+KSALN GM+HY F VYRNI+A V  APFA++ ER
Sbjct  4     KFLRKAKPYLAVIMLQFGSTGSAIIAKSALNHGMSHYTFSVYRNIVATVVMAPFALVLER  63

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             KIRPRMT +IF KI+LLALLEPVIDQNLYYAGMKYTTATFA+AMCNVLPAITFLLAW L 
Sbjct  64    KIRPRMTFSIFYKIVLLALLEPVIDQNLYYAGMKYTTATFASAMCNVLPAITFLLAWALG  123

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS-KHVPQTQSIGPATEHDH  718
             LE+VNI+   SQ K+ GT +T+ GAMIMTLVRG IIGLPWT   H+    +   A  + H
Sbjct  124   LERVNIKRWSSQAKVAGTLVTVSGAMIMTLVRGSIIGLPWTRHSHINSQLTAADADANSH  183

Query  717   ---VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
                V+GA+MI AGCFCWS FYILQAITLKSYPAGLSLT LICM GALQ T LTLV E+ N
Sbjct  184   QNPVRGALMITAGCFCWSIFYILQAITLKSYPAGLSLTALICMGGALQGTALTLVAEKSN  243

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFM  367
               IW +  DT  LAYVY+G++ SG+ YY++GV+  EKGP F T+FNPLSM+ VA++ SF+
Sbjct  244   TAIWTIRGDTKLLAYVYSGLVGSGITYYVAGVVSKEKGPVFATSFNPLSMVFVAVMSSFI  303

Query  366   LAEQLDFGKIFGAVVIIVGLYLVIWG  289
             LAEQLD GK+ GA+VI+VGLYL IWG
Sbjct  304   LAEQLDVGKVSGAIVIVVGLYLFIWG  329



>ref|XP_011072598.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Sesamum 
indicum]
Length=386

 Score =   446 bits (1146),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 215/333 (65%), Positives = 256/333 (77%), Gaps = 11/333 (3%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             ++L+ AKPY  V+ LQ     S++I+KSALN GM+HY F VYRNI+A V  APFA++ ER
Sbjct  4     KFLRKAKPYLAVIMLQFGSTGSAIIAKSALNHGMSHYTFSVYRNIVATVVMAPFALVLER  63

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             KIRPRMT +IF KI+LLALLEPVIDQNLYYAGMKYTTATFA+AMCNVLPAITFLLAW L 
Sbjct  64    KIRPRMTFSIFYKIVLLALLEPVIDQNLYYAGMKYTTATFASAMCNVLPAITFLLAWALG  123

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS-KHVPQTQSIGPATEHDH  718
             LE+VNI+   SQ K+ GT +T+ GAMIMTLVRG IIGLPWT   H+    +   A  + H
Sbjct  124   LERVNIKRWSSQAKVAGTLVTVSGAMIMTLVRGSIIGLPWTRHSHINSQLTAADADANSH  183

Query  717   ---VKGAVMIAAGCFCWSCFYI-------LQAITLKSYPAGLSLTCLICMAGALQSTVLT  568
                V+GA+MI AGCFCWS FYI       LQAITLKSYPAGLSLT LICM GALQ T LT
Sbjct  184   QNPVRGALMITAGCFCWSIFYILQKKLTYLQAITLKSYPAGLSLTALICMGGALQGTALT  243

Query  567   LVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMV  388
             LV E+ N  IW +  DT  LAYVY+G++ SG+ YY++GV+  EKGP F T+FNPLSM+ V
Sbjct  244   LVAEKSNTAIWTIRGDTKLLAYVYSGLVGSGITYYVAGVVSKEKGPVFATSFNPLSMVFV  303

Query  387   AIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             A++ SF+LAEQLD GK+ GA+VI+VGLYL IWG
Sbjct  304   AVMSSFILAEQLDVGKVSGAIVIVVGLYLFIWG  336



>ref|XP_006365719.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=377

 Score =   437 bits (1124),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 233/371 (63%), Positives = 292/371 (79%), Gaps = 5/371 (1%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             E  ++ LK +KPY  V+FLQ  +  S++I+K+ALN GM+HY F VYRN+ AAV FAPFA 
Sbjct  7     ECLMKNLKRSKPYLAVIFLQFGFGGSAIIAKTALNNGMSHYTFSVYRNLFAAVVFAPFAA  66

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             L ERKIRP+MT++IF KIMLL LLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA
Sbjct  67    LLERKIRPKMTLSIFWKIMLLGLLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  126

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH--VPQTQSIGPA  733
             WILRLE VN+  + SQ KI+GT +T+GGA IMTLV G  IGLPWT  H  VP T ++   
Sbjct  127   WILRLENVNVWKVGSQAKIIGTIITLGGATIMTLVGGPTIGLPWTKHHNNVPTTTNVVSP  186

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
              E + +KGA+ IAAGCFCW+CFY LQAITLK Y AG+SLT LICM+GALQ T LTL+V+R
Sbjct  187   NELNPLKGAIFIAAGCFCWACFYNLQAITLKKYQAGMSLTSLICMSGALQGTALTLLVQR  246

Query  552   GNYGIWALHWDTT-FLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             GN+GIW++HW ++ F A +Y GI+ SG+ YY+SG+IMNEKGP FVTAFNPL+M++VAI+G
Sbjct  247   GNFGIWSIHWGSSLFYASLYCGIVNSGIGYYVSGLIMNEKGPVFVTAFNPLNMVIVAILG  306

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQS  196
             SF+L+EQL+ G++ GA VI+VGLYLVIWG SKD  S+K    +  N  SNN + +   +S
Sbjct  307   SFILSEQLNMGRVVGAAVIVVGLYLVIWGSSKDKISTKIVSTNIENVESNNDKELAEIKS  366

Query  195   AEQKI--DDTI  169
             + Q +  D+++
Sbjct  367   SNQLVIGDESV  377



>gb|EYU38348.1| hypothetical protein MIMGU_mgv1a009263mg [Erythranthe guttata]
Length=348

 Score =   436 bits (1121),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 208/324 (64%), Positives = 256/324 (79%), Gaps = 3/324 (1%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             + +K  KPY  ++F+Q  YA  ++I+K+AL+QGM++Y   +YRN IA +  APFA+L ER
Sbjct  4     KLVKKVKPYLAIVFMQFGYAGFAIIAKTALDQGMSNYTLSIYRNAIATLVVAPFALLLER  63

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             KIRP+MT+++  KI LLA LEPVIDQNLYY GMK+TTATF+TAMCN+LPAITFLLAW LR
Sbjct  64    KIRPKMTVSVLWKIALLAFLEPVIDQNLYYMGMKHTTATFSTAMCNILPAITFLLAWALR  123

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPA--TEHD  721
             LEKVN+R  H   KI+GT  T+GGAMIMTLV+G IIGLPWT K  P ++S      T  D
Sbjct  124   LEKVNVRRAHGYAKILGTFATLGGAMIMTLVQGSIIGLPWT-KIEPNSESADGVVITTQD  182

Query  720   HVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYG  541
              VKGA+MI  GCFC S FYILQAIT+KSY A LSLTCLICMAG LQ  VLTL VERGN+ 
Sbjct  183   PVKGALMITVGCFCCSIFYILQAITMKSYAAPLSLTCLICMAGMLQGIVLTLAVERGNFS  242

Query  540   IWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLA  361
             IW++ WDT  LAY Y+G+I SGV YY+SG++MNEKGP FVT+FNPL+M++VA++ SF+ A
Sbjct  243   IWSIGWDTKLLAYTYSGVICSGVSYYVSGIVMNEKGPVFVTSFNPLNMVIVAVLSSFIFA  302

Query  360   EQLDFGKIFGAVVIIVGLYLVIWG  289
             EQL+ GK+ GA VI+ GLYLVIWG
Sbjct  303   EQLNIGKVIGATVIVFGLYLVIWG  326



>ref|XP_004236759.1| PREDICTED: WAT1-related protein At2g39510 [Solanum lycopersicum]
Length=376

 Score =   437 bits (1124),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 234/367 (64%), Positives = 290/367 (79%), Gaps = 3/367 (1%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             E  ++ LK +KPY  V+FLQ  +  S++I+K+ALN GM+HY F VYRN+ AAV FAPFA 
Sbjct  7     ECLMKLLKRSKPYLAVIFLQFGFGGSAIIAKTALNNGMSHYTFSVYRNLFAAVVFAPFAA  66

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             L ERKIRP+MT++IF KIMLL LLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA
Sbjct  67    LLERKIRPKMTLSIFWKIMLLGLLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  126

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH--VPQTQSIGPA  733
             WILRLE VN+  + SQ KI+GT +T+GGA IM+LV G IIGLPWT  H  VP T+++   
Sbjct  127   WILRLENVNVWKVSSQAKIIGTIITLGGATIMSLVGGPIIGLPWTKHHSNVPTTKNVVSP  186

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
              E + VKGA+ IAAGCFCW+CFY LQAITLK Y AG+SLT LICM+GALQ T LTL+V+R
Sbjct  187   NELNPVKGAIFIAAGCFCWACFYNLQAITLKKYQAGMSLTSLICMSGALQGTALTLLVQR  246

Query  552   GNYGIWALHWDTT-FLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             GN+GIW++ W ++ F A +Y GI+ SG+ YY+SG+IMNEKGP FVTAFNPL+M++VAI+G
Sbjct  247   GNFGIWSIKWGSSLFYASLYCGIVNSGIGYYVSGLIMNEKGPVFVTAFNPLNMVIVAILG  306

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQS  196
             SF+L+EQL+ G++ GA VI+VGLYLVIWG SKD +S+K     +N   +N+KE    K S
Sbjct  307   SFILSEQLNMGRVVGAAVIVVGLYLVIWGTSKDKNSTKIVSTKENVESNNDKELADIKSS  366

Query  195   AEQKIDD  175
              +  I D
Sbjct  367   NQLVIGD  373



>ref|XP_009601955.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Nicotiana 
tomentosiformis]
Length=330

 Score =   427 bits (1097),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 251/312 (80%), Gaps = 3/312 (1%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
              E  ++++K A+PY  V+ LQ  YA S++I+KSALN GM+H+ F VYRN  A + FAPFA
Sbjct  4     RERLLKFVKEAQPYLAVILLQFGYAGSAIIAKSALNHGMSHFTFAVYRNAFATLVFAPFA  63

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             ++ ERKIRP MT++IFLKIMLL LLEPVIDQNLYY G++YTTATFATAMCNVLPA+TF+L
Sbjct  64    IVLERKIRPNMTVSIFLKIMLLGLLEPVIDQNLYYTGLRYTTATFATAMCNVLPALTFML  123

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH--VPQTQSIGP  736
             AWILRLEKVN+R L SQ KIVGTT+T GGAMIMTL+ G  IGLPWT +H     T +   
Sbjct  124   AWILRLEKVNVRRLSSQAKIVGTTVTFGGAMIMTLIGGPTIGLPWT-RHLLSTTTATSAS  182

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
              TE   +KGA+ IAAGC CW+CFY LQAITLK+YPA LSLTCLIC AGA+Q T LTLV E
Sbjct  183   LTELQPIKGALFIAAGCICWACFYNLQAITLKTYPAALSLTCLICSAGAVQGTALTLVAE  242

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             RGN  IW++H DT  L+YVY+G++ SGV YY+SG+IM +KGP FVTAFNPL+M++VAI+G
Sbjct  243   RGNTSIWSIHLDTKLLSYVYSGMVTSGVGYYVSGLIMKDKGPVFVTAFNPLNMVIVAILG  302

Query  375   SFMLAEQLDFGK  340
             SF+L+EQL+ G 
Sbjct  303   SFILSEQLNLGS  314



>emb|CDP05672.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   428 bits (1100),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 219/361 (61%), Positives = 278/361 (77%), Gaps = 4/361 (1%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             K AKPY  V+F+Q  YA S++ISKSALN+GM+HY F +YRN+ AA  FAPFA++ ERK+R
Sbjct  5     KQAKPYLAVIFMQFGYAGSAIISKSALNKGMSHYAFAIYRNLFAAAVFAPFAVVLERKVR  64

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             PRMTI++  KI+LL LLEPVIDQNLYYA MKYTTATFA +M N+LPA+TFLLAWILRLE+
Sbjct  65    PRMTISVLWKIILLGLLEPVIDQNLYYAAMKYTTATFAVSMTNMLPALTFLLAWILRLEE  124

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGA  706
             VN R LHSQ KI GT +T+GGAMIMTLVRG  I LPWT       QS   A   D +KGA
Sbjct  125   VNTRRLHSQIKIAGTIITVGGAMIMTLVRGPAINLPWTRADA-NVQSPAAANPQDPIKGA  183

Query  705   VMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALH  526
             +MI+AGCFCW+ F+ILQA+T+KSYPA LSLT +IC AGALQ T++TLV ERGN  +W++H
Sbjct  184   LMISAGCFCWASFHILQAMTVKSYPACLSLTSMICTAGALQGTIVTLVAERGNPSVWSIH  243

Query  525   WDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDF  346
             +DT  ++YVY+G++ SGV Y ISG+IM  KGP FVTAF+PLSM++VA + +F+LAE+L F
Sbjct  244   FDTILMSYVYSGVVTSGVGYCISGIIMRAKGPVFVTAFSPLSMVIVAFMSTFILAERLTF  303

Query  345   GKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNK---ESILTKQSAEQKIDD  175
             G++FGA+ I+ GLYLVIWGK KD  S   S + D     + +   +++ TK S ++K D 
Sbjct  304   GRVFGAISIVTGLYLVIWGKCKDQISPSKSTNVDETDPIDEQLPDKNLTTKSSNDEKNDA  363

Query  174   T  172
             T
Sbjct  364   T  364



>ref|XP_010253282.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=382

 Score =   426 bits (1096),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 197/324 (61%), Positives = 248/324 (77%), Gaps = 0/324 (0%)
 Frame = -2

Query  1260  FVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLF  1081
             F R    AKP+  V+FLQL  A  ++I+K AL+QG++HY FVVYRN +A    APFA+  
Sbjct  11    FCRLFNKAKPFLAVIFLQLGLAGMAIIAKIALDQGLSHYTFVVYRNAVATCVIAPFAITL  70

Query  1080  ERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWI  901
             ERK+RP+MT ++F KI LL LLEPVIDQNLYYAGM YTTATF  AMCN+LPA+TFLLA++
Sbjct  71    ERKVRPKMTYSVFAKIALLGLLEPVIDQNLYYAGMSYTTATFTAAMCNILPALTFLLAFV  130

Query  900   LRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHD  721
             LRLEKVNI+++ SQ K+VGT +T+GGAM+MTL++G  + LPWT   V  T   G   + D
Sbjct  131   LRLEKVNIKNVRSQAKVVGTLVTVGGAMLMTLIKGPTMDLPWTKGTVNNTSQTGHPVQQD  190

Query  720   HVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYG  541
              +KGA+MIA GCFCWSCF ILQAITLK+YPAGLSLT L+C  G ++   + L ++ GN  
Sbjct  191   PIKGALMIATGCFCWSCFIILQAITLKAYPAGLSLTALLCFMGTIEGAAVALAMQWGNTS  250

Query  540   IWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLA  361
              WA+HWD  FLA VY GI+ SGV YY+ GVIM E+GP FVTAF+PL MI+VAI+GSF+LA
Sbjct  251   SWAIHWDAKFLAAVYGGIMCSGVAYYVQGVIMKERGPVFVTAFSPLCMIIVAILGSFILA  310

Query  360   EQLDFGKIFGAVVIIVGLYLVIWG  289
             E++  G + GA VI+VGLYLV+WG
Sbjct  311   EEMYLGSVIGATVIVVGLYLVVWG  334



>ref|XP_008447554.1| PREDICTED: WAT1-related protein At2g37460-like [Cucumis melo]
Length=373

 Score =   419 bits (1076),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 201/370 (54%), Positives = 268/370 (72%), Gaps = 11/370 (3%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
             N    +W   AKP+F V+FLQ   A   ++SK+ALNQGM++Y+ VVYR+ +A +  APFA
Sbjct  2     NSQVSQWCVSAKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHAVATIVIAPFA  61

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             ++F++K+RP+MTI +F K+M+L+LLEPVIDQNLY+ GMKYTTATFA AMCN+LPAITF++
Sbjct  62    LIFDKKVRPKMTIPVFAKLMVLSLLEPVIDQNLYFLGMKYTTATFAAAMCNILPAITFVM  121

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPAT  730
             AWILRLEKV I+S+ SQ KIVGT  T+GGAMIMTL++G I+ L W  +     Q  G  +
Sbjct  122   AWILRLEKVRIKSIRSQAKIVGTVATVGGAMIMTLMKGPILELFWVKERGTNPQQSGEIS  181

Query  729   EHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
                 +KG++MI  GCF W+CF ILQAITLK+YPA LSLT  IC+ G  + TV+ LV+ERG
Sbjct  182   LQHTIKGSIMITIGCFSWACFMILQAITLKAYPAELSLTAWICLLGTAEGTVVALVMERG  241

Query  549   NYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSF  370
             N  +W++ W T  LA VY+GI  SG+ YYI G++M +KGP FVTAF+PLSM++VAI+ SF
Sbjct  242   NPAVWSITWGTKLLAAVYSGIFCSGLAYYIQGLVMKDKGPVFVTAFSPLSMVIVAIMSSF  301

Query  369   MLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAE  190
             +L E+L FG++ GAVVIIVGLYLV+WG           ++ D N  SN    + TKQ+ E
Sbjct  302   ILGERLYFGRVLGAVVIIVGLYLVVWG-----------KNKDENCSSNEDLKLPTKQTIE  350

Query  189   QKIDDTIKIR  160
                 +++ I 
Sbjct  351   DNKMESLTIE  360



>ref|XP_004142085.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN54225.1| hypothetical protein Csa_4G293840 [Cucumis sativus]
Length=375

 Score =   415 bits (1066),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 192/327 (59%), Positives = 252/327 (77%), Gaps = 0/327 (0%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
             N    +W   AKP+F V+FLQ   A   ++SK+ALNQGM++Y+ VVYR+ +A +  APFA
Sbjct  2     NPQVSQWCVSAKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHAVATIVIAPFA  61

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             ++F++K+RP+MTI +F K+M+L+LLEPVIDQNLY+ GMKYTTATFA AMCN+LPAITF++
Sbjct  62    LIFDKKVRPKMTIPVFAKLMVLSLLEPVIDQNLYFMGMKYTTATFAAAMCNILPAITFVM  121

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPAT  730
             AWILRLEKV I+S+ SQ KIVGT  T+GGAMIMTL++G I+ L W  +     Q  G  +
Sbjct  122   AWILRLEKVRIKSIRSQAKIVGTVATVGGAMIMTLMKGPIVELFWVKERANNPQQRGEIS  181

Query  729   EHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
                 +KG++MI  GCF W+CF ILQAITLK+YPA LSLT  IC+ G  + TV+ LV+ERG
Sbjct  182   LQHTIKGSIMITIGCFSWACFMILQAITLKAYPAELSLTAWICLLGTAEGTVVALVMERG  241

Query  549   NYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSF  370
             N  +W++ W T  LA VY+GI  SG+ YYI G++M +KGP FVTAF+PLSM++VAI+ SF
Sbjct  242   NPAVWSITWGTKLLAAVYSGIFCSGLAYYIQGLVMKDKGPVFVTAFSPLSMVIVAIMSSF  301

Query  369   MLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +L E+L FG++ GAVVIIVGLYLV+WG
Sbjct  302   ILGERLYFGRVLGAVVIIVGLYLVVWG  328



>ref|XP_008369847.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
 ref|XP_008369848.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
Length=363

 Score =   414 bits (1064),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 197/367 (54%), Positives = 270/367 (74%), Gaps = 10/367 (3%)
 Frame = -2

Query  1263  SFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAML  1084
             S V  +K AKP+F V+FLQ   A   ++SK+ALNQGM++Y+ VVYR+++A    APFA++
Sbjct  2     SIVETMKAAKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFAVI  61

Query  1083  FERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAW  904
              ++K+RP+MT++IF+KIMLLALLEPV+DQNLY+ GMKYTTATFA AMCN+LPA+TF++AW
Sbjct  62    LDKKVRPKMTLSIFIKIMLLALLEPVLDQNLYFMGMKYTTATFAAAMCNILPALTFVMAW  121

Query  903   ILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEH  724
             +LRLEKVN++S+ SQ K+VGT  T+ GAMIMTLV+G ++ L WT     Q  S   + + 
Sbjct  122   VLRLEKVNLKSIRSQSKLVGTVATVAGAMIMTLVKGPLLHLFWTRASHEQHTSAATSLQ-  180

Query  723   DHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNY  544
             D +KG++MI  GCFCW+CF ILQAITLK+YPA LSL+  IC  G L+ T + LV+ERGN 
Sbjct  181   DSIKGSLMITVGCFCWACFMILQAITLKTYPAELSLSAWICALGTLEGTAVALVMERGNA  240

Query  543   GIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFML  364
              +W++ WDT  LA  Y+GI  SG+ YYI GV+M  +GP FVTAF+PLSM++VA++ SF+L
Sbjct  241   AVWSIKWDTKLLAASYSGIFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFIL  300

Query  363   AEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQK  184
              EQ+  G++ GAVVII GLYLV+WG          ++D ++   +   E   TKQ+ ++K
Sbjct  301   REQMFLGRLLGAVVIIAGLYLVVWG---------KAKDYESPEKTIEDELTATKQAQDEK  351

Query  183   IDDTIKI  163
               + I I
Sbjct  352   ALEAITI  358



>ref|XP_002315243.2| hypothetical protein POPTR_0010s21630g [Populus trichocarpa]
 gb|EEF01414.2| hypothetical protein POPTR_0010s21630g [Populus trichocarpa]
Length=381

 Score =   411 bits (1056),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 194/329 (59%), Positives = 245/329 (74%), Gaps = 1/329 (0%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M  ES       AKP+  V+ +Q  YA  S+ISK ALN+GM+ ++ VVYR+ +A +  AP
Sbjct  1     MATESSDSPYDKAKPFLAVVLMQFGYAGMSIISKHALNEGMSQHVLVVYRHAVATIVIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA +F+RK+RP+MT++IF KIML+ LLEP IDQNLYY GMKYTTATFA+AMCN+LPA  F
Sbjct  61    FAFIFDRKVRPKMTLSIFFKIMLMGLLEPTIDQNLYYTGMKYTTATFASAMCNILPAFAF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             L+AW LRLEKVNIR +HSQ KI+GT +T+GGAM+MTLV+G  + LPWT K   Q  S G 
Sbjct  121   LMAWALRLEKVNIRKMHSQAKIIGTIVTVGGAMLMTLVKGTQLDLPWT-KGYDQHASTGG  179

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
              T+ D +KGA+MI  GC CW+ F ILQAITLKSYP  LSLT  IC  G ++ TVL +V+E
Sbjct  180   LTKQDPIKGALMITTGCACWASFIILQAITLKSYPVELSLTAWICFMGTIEGTVLAVVME  239

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             RGN   W++  D   LA VY+G+  SG+ YY+ G+IM  +GP FVTAFNPLSM++VAI+G
Sbjct  240   RGNPSAWSIALDYKLLAAVYSGVFCSGLAYYVQGLIMKRRGPVFVTAFNPLSMVIVAILG  299

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             SF L E L  G++FGAVVI+ GLYLV+WG
Sbjct  300   SFFLKEILYLGRVFGAVVIVTGLYLVLWG  328



>ref|XP_002528467.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF33950.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=381

 Score =   411 bits (1056),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 194/364 (53%), Positives = 258/364 (71%), Gaps = 10/364 (3%)
 Frame = -2

Query  1242  HAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRP  1063
              AKP+  V+ LQ  YA  S+ISK ALNQGM+ ++ VVYR+ +A +   PFA+LF+RK+RP
Sbjct  12    KAKPFLAVILLQFGYAGLSIISKFALNQGMSQHVLVVYRHAVATIVITPFAILFDRKVRP  71

Query  1062  RMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKV  883
             +MTI+IFLKI+++ LLEP IDQNLYY GMKYTTATFA  MCN+LPA  F++AWILRLEKV
Sbjct  72    KMTISIFLKILMMGLLEPTIDQNLYYTGMKYTTATFAATMCNILPAFAFIMAWILRLEKV  131

Query  882   NIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAV  703
             N++ +HSQ K++GT +T+GGAMIMTLV+G  + LPWT  +     S    T  D +KGA 
Sbjct  132   NLKRVHSQAKLLGTIVTVGGAMIMTLVKGAKLNLPWTEGYNDIQGSSSAPTMQDTIKGAS  191

Query  702   MIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHW  523
             +I  GC CWS F ILQAITLK+YPA LSLT  IC+ G ++ T+  +++ERGN   W++H+
Sbjct  192   LIGVGCICWSAFIILQAITLKTYPAELSLTAFICLMGTIEGTIFAVIMERGNPSAWSIHF  251

Query  522   DTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFG  343
             DT  LA VY+G+I SGV YY+ GVIM  KGP FVTAFNPL MI+V I+GSF+L+E + FG
Sbjct  252   DTKLLACVYSGVICSGVAYYVQGVIMKSKGPVFVTAFNPLCMIIVTILGSFVLSEIVYFG  311

Query  342   KIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKIDDTIKI  163
             ++ GA+VI++GLYLV+WG             D + + SNN + +    S    +++ I  
Sbjct  312   RVLGALVIVIGLYLVLWG----------KSKDQSPSTSNNDDKVEVTTSEMDTMNERIGA  361

Query  162   RTVD  151
                D
Sbjct  362   SDQD  365



>ref|XP_010260186.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=390

 Score =   409 bits (1051),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 192/329 (58%), Positives = 248/329 (75%), Gaps = 0/329 (0%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M  +S  R    AKP+  V+FLQL  A  ++I+K AL++G+NHY FVVYRN IA    +P
Sbjct  5     MPIQSPSRLFSKAKPFLAVIFLQLGLAGMAIIAKLALDEGLNHYTFVVYRNFIATCVISP  64

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA+  ERK+RP+MT TIF KI LL LLEPVIDQNLYY+GM+ T+ATF TAMCN+LPA+TF
Sbjct  65    FAITLERKVRPKMTFTIFAKIALLGLLEPVIDQNLYYSGMRITSATFTTAMCNILPALTF  124

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             L+A+I RLEKV I+ + SQ K+VGT +T+GGAM+MTL++G +I LPWT   V    +   
Sbjct  125   LMAFICRLEKVKIKKVRSQAKVVGTLVTVGGAMLMTLIKGPVINLPWTKGRVNNHGNQTT  184

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
                 D +KG++MIAAGCFCWSCF ILQAITL+ YPA L+LT LIC+ GA +  V+ L ++
Sbjct  185   PIHQDPIKGSLMIAAGCFCWSCFIILQAITLREYPAELTLTALICLMGAAEGAVVALALQ  244

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
              G   IW++HWD  FLA +Y GI+ SGV YYI  VI+ ++GP FVTAF+PL MI+VAI+G
Sbjct  245   WGKSSIWSIHWDAKFLAALYGGIVCSGVSYYIQAVIIKKRGPVFVTAFSPLCMIIVAILG  304

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             SF+LAEQ+  G + GA+VI+VGLYLV+WG
Sbjct  305   SFILAEQMFVGSVIGAIVIVVGLYLVVWG  333



>ref|XP_009377106.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
 ref|XP_009377107.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
Length=363

 Score =   407 bits (1046),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 195/367 (53%), Positives = 267/367 (73%), Gaps = 10/367 (3%)
 Frame = -2

Query  1263  SFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAML  1084
             S V  +K AKP+F V+FLQ   A   ++SK+ALNQGM++Y+ VVYR+++A    APFA++
Sbjct  2     SIVETMKAAKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFAVI  61

Query  1083  FERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAW  904
              ++K+RP+MT++IF+KIMLL LLEPV+DQNLY+ GMKYTTATFA AMCN+LPA+TF++AW
Sbjct  62    LDKKVRPKMTLSIFIKIMLLGLLEPVLDQNLYFMGMKYTTATFAAAMCNILPALTFVMAW  121

Query  903   ILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEH  724
             +LRLEKV ++S+ SQ K+VGT  T+ GAMIMTLV+G ++ L WT     Q  S   + + 
Sbjct  122   VLRLEKVKLKSIRSQSKLVGTVATVAGAMIMTLVKGPLLHLFWTRPGHEQHTSAATSLQ-  180

Query  723   DHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNY  544
             D +KG++MI  GCFCW+CF ILQAITLK+YPA LSL+  IC  G L+ T   LV+ERGN 
Sbjct  181   DSIKGSLMITVGCFCWACFMILQAITLKTYPAELSLSAWICALGTLEGTAAALVMERGNA  240

Query  543   GIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFML  364
              +W++ WDT  LA  Y+GI  SG+ YYI GV+M  +GP FVTAF+PLSM++VA++ SF+L
Sbjct  241   AVWSIKWDTKLLAASYSGIFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFIL  300

Query  363   AEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQK  184
              EQ+  G++ GAVVII GLYLV+WG          ++D ++   +   E   TKQ+ ++K
Sbjct  301   REQMFLGRLLGAVVIIAGLYLVVWG---------KAKDHESPEKTIGDELTATKQAQDEK  351

Query  183   IDDTIKI  163
               + I I
Sbjct  352   ALEVITI  358



>ref|XP_011027136.1| PREDICTED: WAT1-related protein At2g39510-like [Populus euphratica]
Length=380

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/329 (59%), Positives = 244/329 (74%), Gaps = 1/329 (0%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M  ES       AKP+  V+ +Q  YA  SLISK ALN+GM+ ++ VVYR+ +A +  AP
Sbjct  1     MATESSDSPYDRAKPFLAVVLMQFGYAGMSLISKHALNEGMSQHVLVVYRHAVATIVIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA +F+RK+RP+MT++IF KIML+ LLEP +DQNLYY GMKYTTATFA+AMCNVLPA  F
Sbjct  61    FAFIFDRKVRPKMTLSIFFKIMLMGLLEPTLDQNLYYTGMKYTTATFASAMCNVLPAFAF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             L+AW LRLEKVNIR +HSQ KI+GT +T+GGAM+MTLV+G  + LPWT K   Q  S G 
Sbjct  121   LMAWALRLEKVNIRKMHSQAKIIGTIVTVGGAMLMTLVKGTQLDLPWT-KGYDQHPSTGG  179

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
               + D +KGA+MI  GC CW+ F ILQAITLK+YP  LSLT  IC  G ++ TVL +V+E
Sbjct  180   LIKQDPIKGALMITIGCVCWASFIILQAITLKTYPVELSLTAWICFMGTIEGTVLAVVME  239

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             RGN   W++  D   LA VY+G+  SG+ YY+ G+IM  +GP FVTAFNPLSM++VAI+G
Sbjct  240   RGNPSAWSIALDYKLLAAVYSGVFCSGLAYYVQGLIMKRRGPVFVTAFNPLSMVIVAILG  299

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             SF L E L  G++FGAVVI+ GLYLV+WG
Sbjct  300   SFFLKEILYLGRVFGAVVIVTGLYLVLWG  328



>ref|XP_002274909.2| PREDICTED: WAT1-related protein At2g37460-like [Vitis vinifera]
Length=396

 Score =   407 bits (1045),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 189/329 (57%), Positives = 249/329 (76%), Gaps = 0/329 (0%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             + ++S  R L   KP+  V FLQ  +A   + SK ALNQG+++Y+ VVYR+ IA  F AP
Sbjct  5     ISSKSTYRLLYRVKPFLAVTFLQFGFAGMDVFSKVALNQGVSNYVLVVYRHAIATAFIAP  64

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++ ++K+RP+MT +IF K+MLL+LLEPVIDQNLYY G+KYTTATFA AM N+LPAITF
Sbjct  65    FAVILDKKVRPKMTFSIFTKLMLLSLLEPVIDQNLYYFGLKYTTATFAAAMYNILPAITF  124

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             L+A I  LEKV ++S+HSQ K+VGT  T+ GAM+MTLV+G +I L WT     Q    G 
Sbjct  125   LMACIFGLEKVTLKSIHSQAKVVGTVATVAGAMLMTLVKGPVIELIWTKGRNNQGVKGGG  184

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
                HD +KG++MI AGCF W+CF ILQAITLK+YPA LSLT  IC+ G  Q T++ LV+E
Sbjct  185   TNIHDSIKGSLMITAGCFSWACFIILQAITLKTYPAELSLTAWICLLGTAQGTIVALVME  244

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             RG   +W++HWDT FLA +Y+GI+ SG+ YYI GV+M ++GP FVTAFNPLSMI+VA++ 
Sbjct  245   RGKTSVWSIHWDTKFLAALYSGIVCSGLAYYIQGVVMKDRGPVFVTAFNPLSMIIVAVMS  304

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             SF+LAEQ+  G++ GA+VI+ GLY V+WG
Sbjct  305   SFILAEQMYLGRVIGAIVIVAGLYFVVWG  333



>ref|XP_004161682.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=368

 Score =   405 bits (1041),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 187/317 (59%), Positives = 248/317 (78%), Gaps = 0/317 (0%)
 Frame = -2

Query  1239  AKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPR  1060
             ++ +F V+FLQ   A   ++SK+ALNQGM++Y+ VVYR+ +A +  APFA++F++K+RP+
Sbjct  5     SQAFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHAVATIVIAPFALIFDKKVRPK  64

Query  1059  MTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVN  880
             MTI +F K+M+L+LLEPVIDQNLY+ GMKYTTATFA AMCN+LPAITF++AWILRLEKV 
Sbjct  65    MTIPVFAKLMVLSLLEPVIDQNLYFMGMKYTTATFAAAMCNILPAITFVMAWILRLEKVR  124

Query  879   IRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVM  700
             I+S+ SQ KIVGT  T+GGAMIMTL++G I+ L W  +     Q  G  +    +KG++M
Sbjct  125   IKSIRSQAKIVGTVATVGGAMIMTLMKGPIVELFWVKERANNPQQRGEISLQHTIKGSIM  184

Query  699   IAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWD  520
             I  GCF W+CF ILQAITLK+YPA LSLT  IC+ G  + TV+ LV+ERGN  +W++ W 
Sbjct  185   ITIGCFSWACFMILQAITLKAYPAELSLTAWICLLGTAEGTVVALVMERGNPAVWSITWG  244

Query  519   TTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGK  340
             T  LA VY+GI  SG+ YYI G++M +KGP FVTAF+PLSM++VAI+ SF+L E+L FG+
Sbjct  245   TKLLAAVYSGIFCSGLAYYIQGLVMKDKGPVFVTAFSPLSMVIVAIMSSFILGERLYFGR  304

Query  339   IFGAVVIIVGLYLVIWG  289
             + GAVVIIVGLYLV+WG
Sbjct  305   VLGAVVIIVGLYLVVWG  321



>ref|XP_004307548.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=350

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 197/369 (53%), Positives = 256/369 (69%), Gaps = 19/369 (5%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M  ES  + L  AKP+  V+FLQ  +A  S+I+K ALNQGM+ ++ VVYRN +A VF AP
Sbjct  1     MPKESVSQMLTQAKPFVAVIFLQFGFAGMSIITKFALNQGMSQHVLVVYRNAVAFVFIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++F+RK+RP+MT+++F+KI+LL LLEPVID NL+Y GMK TTATF TAMCNVLPA  F
Sbjct  61    FALVFDRKLRPKMTLSVFVKILLLGLLEPVIDGNLFYTGMKLTTATFTTAMCNVLPAFAF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++AWI RLE VNIR LHSQ KI+GT +T+GGAM+MTLV G ++ LPWT +     Q  G 
Sbjct  121   IMAWIFRLEMVNIRKLHSQAKILGTIVTVGGAMLMTLVNGPMLTLPWT-RSTSHHQYTGS  179

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
                 D +KGA+MI AGCFCW+ F ILQA+TLK YPA LSLT  IC+ G L+ TV  + +E
Sbjct  180   TASQDPIKGALMITAGCFCWASFMILQAVTLKVYPAELSLTAWICLMGTLEGTVAAVAIE  239

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
               N   WA+H D   L  VY G+I SGV YYI G++M E+GP FVTAFNPLSM++VAI+ 
Sbjct  240   WHNTAAWAIHLDYKLLPAVYGGVICSGVAYYIQGIVMKERGPVFVTAFNPLSMVIVAILS  299

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQS  196
             S  L+E L  G++ GA+VII+GLY+V+WGK                  S +  S    ++
Sbjct  300   SIALSEILYLGRVMGAMVIIIGLYMVLWGK------------------SKDHHSQTDSEA  341

Query  195   AEQKIDDTI  169
             A+ K+  T+
Sbjct  342   ADDKVATTV  350



>ref|XP_008461645.1| PREDICTED: WAT1-related protein At2g39510-like [Cucumis melo]
Length=374

 Score =   404 bits (1038),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/364 (57%), Positives = 261/364 (72%), Gaps = 1/364 (0%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             E FVR+L  AKPYFGVLF+QL  A  ++I+K ALN+GM+ Y+FV YR IIA +  APFA+
Sbjct  2     EGFVRFLVLAKPYFGVLFMQLGSAGMAIIAKFALNKGMSQYVFVFYRMIIATLIMAPFAI  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             +FERK+R +MTI++  KI++L LLEPVID NLY+ GMKYTTATFA AMCNVLPA  FL+A
Sbjct  62    IFERKVRTKMTISLVFKIVMLGLLEPVIDLNLYFTGMKYTTATFAVAMCNVLPAFAFLMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE  727
             W  RLEKVNIR   SQ KIVGT +T+GGAMIMT +RG ++ LPWT  + P + S   +  
Sbjct  122   WACRLEKVNIRKRGSQAKIVGTIVTVGGAMIMTFIRGPMLNLPWTKPNHPSSSSSSSSKN  181

Query  726   H-DHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
             H D +KG++MIA GC C S F ILQAITLK YPA LSLT LIC+   +   ++ LV+ERG
Sbjct  182   HQDQIKGSLMIAIGCICQSAFIILQAITLKLYPAELSLTALICLVATVGGCLVALVMERG  241

Query  549   NYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSF  370
             N   WALH+D+  L+ VY G+I SGV YYI G++M  KGP FVTAFNPLSMI VAI+ SF
Sbjct  242   NPSAWALHFDSQLLSVVYAGVICSGVTYYIQGMVMQIKGPVFVTAFNPLSMIFVAIMSSF  301

Query  369   MLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAE  190
             +L+E +  G+I GAV II GLYLV+WGK KD    KS  D        ++ S  T Q ++
Sbjct  302   ILSEIMLLGRIVGAVTIITGLYLVLWGKRKDRLLVKSDSDSKQQMTETDETSKKTVQPSQ  361

Query  189   QKID  178
             + I 
Sbjct  362   EFIS  365



>ref|XP_011080962.1| PREDICTED: WAT1-related protein At2g39510-like [Sesamum indicum]
Length=379

 Score =   403 bits (1035),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 191/319 (60%), Positives = 244/319 (76%), Gaps = 0/319 (0%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             K  + Y  ++ +Q      ++++K+ALNQG +HY F VYRN IAA+ FAPFAM+ ERKIR
Sbjct  9     KKLQVYLSLVVVQFGNVGFAIVAKAALNQGTSHYTFSVYRNAIAALLFAPFAMVLERKIR  68

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             P+MT ++F+KIMLL LL+PV  QN++Y+G+ YT+ATFA+AMCN+LPAITF++AWILR+EK
Sbjct  69    PKMTFSVFVKIMLLGLLDPVFGQNMFYSGLNYTSATFASAMCNLLPAITFVMAWILRIEK  128

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGA  706
             VN+R + S  KIVGT +T+GGAMIMTL+ G +I LPWT K      S       + VKGA
Sbjct  129   VNLREVRSHAKIVGTMVTVGGAMIMTLLSGPVIPLPWTHKSHQSHSSSNSNDHENPVKGA  188

Query  705   VMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALH  526
             +MI AGCF +S FYILQA+TLK+YPAGLSLT LIC  GAL+ TVLT +VERGN  IWAL 
Sbjct  189   LMIGAGCFGYSLFYILQAVTLKTYPAGLSLTALICTFGALEGTVLTFIVERGNTAIWALG  248

Query  525   WDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDF  346
             W+   LAYVY GI+ SGV YY+SGVIM  KGP F+TAFNP +M++VAI+ SF+  EQ+  
Sbjct  249   WNAKLLAYVYGGIVASGVTYYLSGVIMKHKGPVFLTAFNPCTMVIVAILSSFIFHEQMTV  308

Query  345   GKIFGAVVIIVGLYLVIWG  289
             GK+ GA+VI+ GLY VIWG
Sbjct  309   GKVTGALVIVTGLYFVIWG  327



>emb|CDP00045.1| unnamed protein product [Coffea canephora]
Length=379

 Score =   403 bits (1035),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 212/329 (64%), Positives = 266/329 (81%), Gaps = 1/329 (0%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M N   + +LKHA PY  V+F+Q+ +A S++I+KSALNQGM+HY   +YRN+IAAV FAP
Sbjct  1     MINHRGMGFLKHANPYLAVIFVQVGFAGSAIIAKSALNQGMSHYALSIYRNLIAAVAFAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++ ERK+RPRMT ++  KI+LL LLEPVIDQNLYYA MKYTTATF  AM N++PA+TF
Sbjct  61    FAVVLERKVRPRMTFSVLWKILLLGLLEPVIDQNLYYAAMKYTTATFTAAMTNMVPALTF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             LLAWILRLE+VN+R +H   KI GT +T+GGAMIMTLV+G  IGLPWT K      S   
Sbjct  121   LLAWILRLEQVNLRRIHGLVKIAGTAVTVGGAMIMTLVKGPTIGLPWT-KADTGVHSSTV  179

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
             A   D +KGA+M+AAGCFCW+ FY LQAITLKSYPAGLSLT +ICMAGALQ+ V+TLV E
Sbjct  180   ANPQDPIKGALMLAAGCFCWANFYNLQAITLKSYPAGLSLTSMICMAGALQAIVVTLVAE  239

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             RGN  IW++H+DT  L YVY G+I SGV YY++G+I+  KGP FV AFNPLSM++VAI+ 
Sbjct  240   RGNSSIWSIHFDTILLCYVYCGLINSGVTYYVTGLILRSKGPVFVAAFNPLSMVIVAIMS  299

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             SF+L+E+L+FG++FGAV+I++GLYLVIWG
Sbjct  300   SFILSERLNFGRVFGAVIIMLGLYLVIWG  328



>ref|XP_008371417.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=350

 Score =   400 bits (1027),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 187/329 (57%), Positives = 249/329 (76%), Gaps = 1/329 (0%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M   S    L  A P+  V F+Q  YA  S+ISK ALN GM+ ++ VVYR+ +A VF AP
Sbjct  1     MSKGSMAEMLNRAMPFMAVTFMQFGYAGMSIISKFALNHGMSPHVLVVYRHAVATVFIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++F+RK+RP+MT++IF+KI+LL LLEPVIDQNL+Y GMK TTATFA+AMCNVLPA  F
Sbjct  61    FAVVFDRKVRPKMTLSIFIKIVLLGLLEPVIDQNLFYTGMKLTTATFASAMCNVLPAFAF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++AWI RLEK+N+RSLHS  KI+GT +T+GGAM+MTL+ G ++  PWT +++ Q  ++  
Sbjct  121   IMAWIFRLEKINLRSLHSLAKILGTIVTVGGAMLMTLINGPMLNFPWTRRNIHQESTVS-  179

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
                 D +KGA+MIAAGCFCW+ F ILQAITL SYPA L+L   IC+AG +Q T + L  E
Sbjct  180   TVHQDPIKGAIMIAAGCFCWAGFMILQAITLNSYPAELTLATWICLAGTVQGTAVALAFE  239

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
               N  +W++H+D   LA VY+GII SG+ YYI GV+M E+GP FVTAF+PLSMI+VAI+ 
Sbjct  240   WNNPIVWSIHFDFKLLAAVYSGIICSGIAYYIQGVVMKERGPVFVTAFSPLSMIIVAIMS  299

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             S +LAE +  G++ GA+VI++GLY+V+WG
Sbjct  300   SLILAEIMYLGRVIGAMVIVIGLYMVLWG  328



>ref|XP_007205382.1| hypothetical protein PRUPE_ppa007333mg [Prunus persica]
 gb|EMJ06581.1| hypothetical protein PRUPE_ppa007333mg [Prunus persica]
Length=372

 Score =   400 bits (1029),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 241/321 (75%), Gaps = 1/321 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             +K AKP+F V+FLQ   A   ++SK+ALNQGM++Y+ VVYR+++A    APFA++ ++KI
Sbjct  12    VKAAKPFFAVIFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFALILDKKI  71

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF+KIMLL LLEPVIDQNLY+ GM+YTTATFA AMCN+LPA+TF +AWILRLE
Sbjct  72    RPKMTLPIFIKIMLLGLLEPVIDQNLYFMGMRYTTATFAAAMCNILPALTFAMAWILRLE  131

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE-HDHVK  712
             KV ++ + SQ K+ GT  T+ GAMIMTLV+G ++ L WT       Q  G A      +K
Sbjct  132   KVKLKCIRSQSKVFGTAATVAGAMIMTLVKGPLLDLFWTRGTTSHEQQTGGAISLQSSIK  191

Query  711   GAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWA  532
             GAVMI  GCFCW+CF ILQ+ITLK+YPA LSL+  IC+ G L+ T L LV+ERGN  +WA
Sbjct  192   GAVMITIGCFCWACFMILQSITLKTYPAELSLSAWICLMGTLEGTALALVMERGNSAVWA  251

Query  531   LHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQL  352
             + WD   LA  Y+ +  SG+ YYI GV+M  +GP FVTAF+PLSM++VA++ SF+L EQL
Sbjct  252   IKWDAKLLAACYSAVFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFILREQL  311

Query  351   DFGKIFGAVVIIVGLYLVIWG  289
               G++ GA VI+ GLY+V+WG
Sbjct  312   YLGRLLGAAVIVAGLYMVVWG  332



>emb|CBI32681.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   400 bits (1029),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 247/335 (74%), Gaps = 6/335 (2%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             + ++S  R L   KP+  V FLQ  +A   + SK ALNQG+++Y+ VVYR+ IA  F AP
Sbjct  5     ISSKSTYRLLYRVKPFLAVTFLQFGFAGMDVFSKVALNQGVSNYVLVVYRHAIATAFIAP  64

Query  1095  FAM------LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNV  934
             FA        F RK+RP+MT +IF K+MLL+LLEPVIDQNLYY G+KYTTATFA AM N+
Sbjct  65    FAKTEYKIHFFNRKVRPKMTFSIFTKLMLLSLLEPVIDQNLYYFGLKYTTATFAAAMYNI  124

Query  933   LPAITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQ  754
             LPAITFL+A I  LEKV ++S+HSQ K+VGT  T+ GAM+MTLV+G +I L WT     Q
Sbjct  125   LPAITFLMACIFGLEKVTLKSIHSQAKVVGTVATVAGAMLMTLVKGPVIELIWTKGRNNQ  184

Query  753   TQSIGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTV  574
                 G    HD +KG++MI AGCF W+CF ILQAITLK+YPA LSLT  IC+ G  Q T+
Sbjct  185   GVKGGGTNIHDSIKGSLMITAGCFSWACFIILQAITLKTYPAELSLTAWICLLGTAQGTI  244

Query  573   LTLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMI  394
             + LV+ERG   +W++HWDT FLA +Y+GI+ SG+ YYI GV+M ++GP FVTAFNPLSMI
Sbjct  245   VALVMERGKTSVWSIHWDTKFLAALYSGIVCSGLAYYIQGVVMKDRGPVFVTAFNPLSMI  304

Query  393   MVAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +VA++ SF+LAEQ+  G++ GA+VI+ GLY V+WG
Sbjct  305   IVAVMSSFILAEQMYLGRVIGAIVIVAGLYFVVWG  339



>ref|XP_008241503.1| PREDICTED: WAT1-related protein At2g37460-like [Prunus mume]
Length=372

 Score =   400 bits (1028),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 241/321 (75%), Gaps = 1/321 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             +K AKP+F V+FLQ   A   ++SK+ALNQGM++Y+ VVYR+++A    APFA++ ++KI
Sbjct  12    VKAAKPFFAVIFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFALILDKKI  71

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF+KIMLL LLEPVIDQNLY+ GM+YTTATFA AMCN+LPA+TF +AWILRLE
Sbjct  72    RPKMTLPIFIKIMLLGLLEPVIDQNLYFMGMRYTTATFAAAMCNILPALTFAMAWILRLE  131

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE-HDHVK  712
             KV ++ + SQ K+ GT  T+ GAMIMTLV+G ++ L WT       Q  G A      +K
Sbjct  132   KVKLKCIRSQSKVFGTAATVAGAMIMTLVKGPLLDLFWTRGTTSHEQQTGGAVSLQSSIK  191

Query  711   GAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWA  532
             GA+MI  GCFCW+CF ILQ+ITLK+YPA LSL+  IC+ G L+ T L LV+ERGN  +WA
Sbjct  192   GAIMITIGCFCWACFMILQSITLKTYPAELSLSAWICLMGTLEGTALALVMERGNSAVWA  251

Query  531   LHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQL  352
             + WD   LA  Y+ +  SG+ YYI G++M  +GP FVTAF+PLSM++VA++ SF+L EQL
Sbjct  252   IKWDAKLLAACYSAVFCSGLAYYIQGIVMKYRGPVFVTAFSPLSMVIVAVMSSFILREQL  311

Query  351   DFGKIFGAVVIIVGLYLVIWG  289
               G++ GA VII GLY+V+WG
Sbjct  312   YLGRLLGAAVIITGLYMVVWG  332



>ref|XP_004302750.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   400 bits (1027),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 188/377 (50%), Positives = 258/377 (68%), Gaps = 14/377 (4%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M     V   K AKP+  V+FLQ   A   ++ K+ALN+G+++Y+ VVYR+ +A +   P
Sbjct  1     MSGHELVERFKAAKPFLAVVFLQFGLAGMDILCKAALNEGVSNYVLVVYRHAVATLVVGP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++ ++K+RP+MT+ IF KIM+L LLEPV+DQNLYY GMKYTTATFA AM N+LPA+TF
Sbjct  61    FAVVLDKKVRPKMTLAIFTKIMVLGLLEPVLDQNLYYLGMKYTTATFAAAMSNILPALTF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++AWILRLEKV +  + SQ K++GT  T+ GAMIMTLV+G ++ L WT       Q    
Sbjct  121   VMAWILRLEKVKLTCIRSQCKLLGTAATVAGAMIMTLVKGPLLKLFWTRATTSNQQQTNG  180

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
                H  +KGA+MI AGCFCW+CF ILQ++TL++YPA LSL+  IC+ G L+ T + LV+E
Sbjct  181   VDIHSSIKGALMITAGCFCWACFMILQSMTLRTYPAELSLSAWICLMGTLEGTAVALVME  240

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             RGN  +WA+HWD   LA VY+GI  SG+ YYI GV+M  +GP FVTAF+PLSM++VA++ 
Sbjct  241   RGNAAVWAIHWDGKLLAAVYSGIFCSGLAYYIQGVVMKHRGPVFVTAFSPLSMVIVAVMS  300

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQS  196
             SF+L EQL  G++ GA VII+GLYLV+WG               +   S  +E   TKQ 
Sbjct  301   SFILREQLFLGRLLGAFVIIIGLYLVVWG--------------KSKEKSPEEELATTKQV  346

Query  195   AEQKIDDTIKIRTVDDT  145
              E+K    +++ T+  +
Sbjct  347   GEEKDRANLQVITIASS  363



>ref|XP_009347454.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=345

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 184/323 (57%), Positives = 246/323 (76%), Gaps = 1/323 (0%)
 Frame = -2

Query  1257  VRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFE  1078
             V+ L  A P+  V F+Q  +A  SLISK ALN GM+ ++ VVYR+ +A VF APFA++F+
Sbjct  2     VQMLNQAMPFMAVTFMQFGFAGMSLISKFALNHGMSPHVLVVYRHAVATVFIAPFAIIFD  61

Query  1077  RKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWIL  898
             R +RP+MT++IF KI+LL LLEPVIDQNL+Y GMK TTATF +AMCNVLPA  F++AWI 
Sbjct  62    RNVRPKMTLSIFTKIVLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIF  121

Query  897   RLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH  718
             RLEK+N+RSLHS  KI+GT +T+GGAM+MTL+ G ++  PWT +++ Q  ++      D 
Sbjct  122   RLEKINLRSLHSLAKILGTIVTVGGAMLMTLINGPMLNFPWTRRNIHQESTVS-TVHQDP  180

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             +KGA+MIAAGCFCWSCF ILQAITLKSYPA LSLT  IC+ G +Q T   L  E  N   
Sbjct  181   IKGAIMIAAGCFCWSCFMILQAITLKSYPAELSLTTWICLVGTVQGTAAALAFEWNNPIA  240

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             W++H+D   LA VY+GI+ SG+ YYI G++M E+GP FVTAF+PL+MI+ A++ SF+LAE
Sbjct  241   WSIHFDYKLLAAVYSGIMCSGIAYYIQGMVMKERGPVFVTAFSPLNMIITAVMSSFILAE  300

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
              +  G++ GA+VI++GLY+V+WG
Sbjct  301   IMYLGRVIGAMVIVIGLYMVLWG  323



>ref|XP_008233581.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Prunus 
mume]
Length=347

 Score =   397 bits (1019),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 186/330 (56%), Positives = 249/330 (75%), Gaps = 3/330 (1%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M   S  + +  AKP+  V  +Q  YA  S+ISK ALN+GM+ ++ VVYR+ +A VF AP
Sbjct  1     MSKSSMAQMINLAKPFVAVTLMQFGYAGMSIISKFALNRGMSQHVLVVYRHAVATVFIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++F+RK+RP+MT ++F KI+LL LLEPVIDQNL+Y GMK TTATF +AMCNVLPA  F
Sbjct  61    FAIVFDRKVRPKMTFSVFTKILLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++AWI RLE +N RSL S  KI+GT +T+GGAM+MTL+ G ++ LPWT +++ Q  +   
Sbjct  121   IMAWIFRLENINFRSLRSLAKILGTIVTVGGAMLMTLINGPMLNLPWTRRNIHQEST--S  178

Query  735   ATEH-DHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
             AT+H D +KG ++I AGCFCW+ F  LQAITLKSYPA LSL   IC+ G +Q TV+ L  
Sbjct  179   ATDHQDPIKGTLLIGAGCFCWAGFVNLQAITLKSYPAELSLAAWICLMGTVQGTVVALGF  238

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             E  N   W++HWD+  LA VY+GII SGVVYY+ G++M E+GP FVTAF+PLSMI+VA++
Sbjct  239   EWDNPAAWSIHWDSKLLAAVYSGIICSGVVYYVQGLVMKERGPVFVTAFSPLSMIIVAVM  298

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
              SFMLAE +  G++ GA+VI++GLY+V+WG
Sbjct  299   SSFMLAEIMYLGRVIGAMVIVIGLYMVLWG  328



>ref|XP_009778852.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Nicotiana 
sylvestris]
Length=379

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/369 (52%), Positives = 270/369 (73%), Gaps = 22/369 (6%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
             +E F+R    +KP+  V+FLQ   A   +++K ALN+GM++Y+FVVYR+ +A +  APFA
Sbjct  5     SELFIR----SKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFA  60

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             ++ ++KIRP+MT++IF K++LL++LEPVIDQNLY  G+KYTTATFA AMCN+LPAITF++
Sbjct  61    IILDKKIRPKMTLSIFTKLVLLSILEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIM  120

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT---SKHVPQTQSIG  739
             AWI RLE+V + S+ SQ KI+GT  T+ GAMIMTLVRG +I L WT   S H  ++QS G
Sbjct  121   AWIFRLERVKLTSIRSQAKIIGTVATVAGAMIMTLVRGPVIELFWTKGNSSH--ESQSGG  178

Query  738   PATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
                 H  +KG++MI  GCF W+ F ILQAITL++YPA LSLT  IC+ G  +  ++ +V+
Sbjct  179   LNLSH-AIKGSLMITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVM  237

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             ERG   +WA+ WDT FLA VY+GI  SG+ YYI GVIM ++GP FVTAFNPLSM++VAI+
Sbjct  238   ERGKAAVWAIKWDTKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAIL  297

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQ  199
              SF+L EQ++ G++ GAVVI++GLY+V+WG           +  D  + S ++++I T++
Sbjct  298   SSFILREQMNLGRVLGAVVIVLGLYIVLWG-----------KSKDQKSPSADEQAIPTQE  346

Query  198   SA-EQKIDD  175
             +  E KID 
Sbjct  347   TTHENKIDK  355



>ref|XP_009614496.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Nicotiana 
tomentosiformis]
Length=379

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/369 (52%), Positives = 269/369 (73%), Gaps = 22/369 (6%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
              E F+R    +KP+  V+FLQ   A   +++K ALN+GM++Y+FVVYR+ +A +  APFA
Sbjct  5     RELFIR----SKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFA  60

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             M+ ++KIRP+MT++IF K++LL++LEPVIDQNLY  G+KYTTATFA AMCN+LPAITF++
Sbjct  61    MILDKKIRPKMTLSIFTKLVLLSILEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIM  120

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT---SKHVPQTQSIG  739
             AWI RLE+V + S+ SQ KI+GT  T+ GAMIMTLVRG +I L WT   S H  ++QS G
Sbjct  121   AWIFRLERVKLTSIRSQAKIIGTIATVAGAMIMTLVRGPVIELFWTKGNSSH--ESQSGG  178

Query  738   PATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
                 H  +KG+++I  GCF W+ F ILQAITL++YPA LSLT  IC+ G  +  ++ +V+
Sbjct  179   LNLSH-AIKGSLLITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVM  237

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             ERG   +WA+ WDT FLA VY+GI  SG+ YYI GVIM ++GP FVTAFNPLSM++VAI+
Sbjct  238   ERGKAAVWAIKWDTKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAIL  297

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQ  199
              SF+L EQ++ G++ GAVVI++GLY+V+WG           +  D  + S ++++I T++
Sbjct  298   SSFILREQMNLGRVLGAVVIVLGLYIVLWG-----------KSKDQKSPSTDEQAIPTQE  346

Query  198   SA-EQKIDD  175
             +  E KID 
Sbjct  347   TTHENKIDK  355



>ref|XP_002312071.1| nodulin MtN21 family protein [Populus trichocarpa]
 gb|EEE89438.1| nodulin MtN21 family protein [Populus trichocarpa]
Length=380

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/381 (50%), Positives = 265/381 (70%), Gaps = 22/381 (6%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
               AKP+  V+ LQ  YA    ++K AL++GM+ ++ VVYR+ +A +  APFA++F+RK+R
Sbjct  9     DRAKPFLAVILLQFGYAGMFTMTKHALDEGMSQHVLVVYRHAVATIVIAPFALVFDRKVR  68

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             P+MT++IF KIMLL LLEP IDQNLYY GMKYTTATF +AMCNVLPA  FL+AW LR+E+
Sbjct  69    PKMTLSIFFKIMLLGLLEPTIDQNLYYTGMKYTTATFTSAMCNVLPAFAFLMAWALRIEQ  128

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGA  706
             VNIR +HSQ KI GT +T+GGAM+MTLV+G  + LPWT  +  Q  S    T+ D +KGA
Sbjct  129   VNIRKMHSQAKIFGTIVTVGGAMLMTLVKGTQLDLPWTRGY-DQQASTSALTKQDPIKGA  187

Query  705   VMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALH  526
             +MIA GC CW+ F ILQ+ITLKSYP  LSLT  IC  G ++ +++ +V+ERGN   W++ 
Sbjct  188   LMIATGCVCWASFIILQSITLKSYPVELSLTAWICFMGTIEGSMVAVVMERGNPSAWSVG  247

Query  525   WDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDF  346
              +   LA VY+G+I SG+ YY+ G+IM  KGP FVTAF+PLSM++VAI+GSF L E L  
Sbjct  248   LNYKLLAAVYSGVICSGIGYYVQGLIMKRKGPVFVTAFSPLSMVIVAILGSFFLKEILCV  307

Query  345   GKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAE--QKID--  178
             G++ GAVVI+ GLYLV+WG        KS +   +++  +  E+I+T+ + E  ++ D  
Sbjct  308   GRVIGAVVIVTGLYLVLWG--------KSKDQPPSDSSDDKAEAIVTQTATEMQERTDPE  359

Query  177   ---------DTIKIRTVDDTV  142
                      D  K+R  D+++
Sbjct  360   TVDQEFVAIDITKVRRTDESI  380



>ref|XP_007009428.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY18238.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=376

 Score =   393 bits (1010),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 248/321 (77%), Gaps = 5/321 (2%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
               AKP+  V+FLQ  YA  S+I+K ALNQGM+ ++FV+YR+ IA +  APFA++ +RK+R
Sbjct  6     NQAKPFLAVIFLQFGYAGMSIIAKFALNQGMSQHVFVMYRHAIAFLVIAPFAIVLDRKVR  65

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             P+MT++IF+K++LL LLEP IDQNLY+ GMKYT+ATF  AMCNVLPA  F+LAWI +LEK
Sbjct  66    PKMTLSIFVKLLLLGLLEPTIDQNLYFTGMKYTSATFTAAMCNVLPAFAFVLAWIFKLEK  125

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSI--GPATEHDHVK  712
             V+I+ LHSQ KI+GT +T+GGAM+MTL+ G ++ LPW +   P  Q +    A + DH+K
Sbjct  126   VHIKKLHSQAKILGTMVTVGGAMLMTLINGPMLNLPWAN---PNNQHVFSSAAAKQDHIK  182

Query  711   GAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWA  532
             GAVMIA GCFCW+ F ILQAITLKSYPA LSLT LIC+ G ++ +++ L  E GN   W+
Sbjct  183   GAVMIAVGCFCWAGFIILQAITLKSYPAELSLTALICLVGTIEGSIVALAREAGNAAAWS  242

Query  531   LHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQL  352
             +H D  FLA VY G++ SGV YY+  VIM  +GP FVTAFNPL+M++VAI+GSF+L+E L
Sbjct  243   VHLDVKFLAAVYGGVVCSGVGYYLQAVIMKARGPVFVTAFNPLTMVIVAILGSFVLSEVL  302

Query  351   DFGKIFGAVVIIVGLYLVIWG  289
               G++ GA+VI++GLYLV+WG
Sbjct  303   YSGRVIGAIVIVIGLYLVLWG  323



>ref|XP_009347451.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=350

 Score =   392 bits (1007),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 182/329 (55%), Positives = 247/329 (75%), Gaps = 1/329 (0%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M   S    L  A P+  V F+Q  +A  S+ISK ALN GM+ ++ VVYR+ +A+VF AP
Sbjct  1     MSKGSMAEMLNWATPFMAVTFMQFGFAGMSIISKFALNHGMSPHVLVVYRHAVASVFIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++F+RK+RP+MT++IF KI+LL LLEPV+DQNL+Y GMK TTATF +AMCNVLP   F
Sbjct  61    FAIVFDRKVRPKMTLSIFTKIVLLGLLEPVLDQNLFYTGMKLTTATFTSAMCNVLPTFAF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++AWI R+EK+N+RSLHS  KI+GT +T+GGAM+MTL+ G ++  PWT +++ Q  ++  
Sbjct  121   IMAWIFRIEKINLRSLHSLAKILGTIVTVGGAMLMTLINGPLLNFPWTRRNIHQESTVS-  179

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
                 D +KGA+MIAAGCFCW+ F ILQAITL SYPA LSL   IC+AG +Q T + L  E
Sbjct  180   TVHQDPIKGAIMIAAGCFCWAGFMILQAITLNSYPAELSLATWICLAGTVQGTAVALAFE  239

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
               N   W++H+D   LA VY+GII SG+ YY+ GV+M E+GP FVTAF+PLSMI+VA++ 
Sbjct  240   WNNPIAWSIHFDFKLLAAVYSGIICSGIAYYVQGVVMKERGPVFVTAFSPLSMIIVAVMS  299

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             SF+LAE +  G++ GA+VI++GLY+V+WG
Sbjct  300   SFILAEIMYLGRVIGAMVIVIGLYMVLWG  328



>ref|XP_009357771.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=337

 Score =   390 bits (1003),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/315 (57%), Positives = 241/315 (77%), Gaps = 1/315 (0%)
 Frame = -2

Query  1233  PYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRMT  1054
             P+  V F+Q  +A  SLISK ALN GM+ ++ VVYR+ +A VF APFA++F+R +RP+MT
Sbjct  2     PFMAVTFMQFGFAGMSLISKFALNHGMSPHVLVVYRHAVATVFIAPFAIIFDRNVRPKMT  61

Query  1053  ITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNIR  874
             ++IF KI+LL LLEPVIDQNL+Y GMK TTATF +AMCNVLPA  F++AWI RLEK+N+R
Sbjct  62    LSIFTKIVLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIFRLEKINLR  121

Query  873   SLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMIA  694
             SLHS  KI+GT +T+GGAM+MTL+ G ++  PWT +++ Q  ++      D +KGA+MIA
Sbjct  122   SLHSLAKILGTIVTVGGAMLMTLINGPMLNFPWTRRNIHQESTVS-TVHQDPIKGAIMIA  180

Query  693   AGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDTT  514
             AGCFCWSCF ILQAITLKSYPA LSLT  IC+ G +Q T   L  E  N   W++H+D  
Sbjct  181   AGCFCWSCFMILQAITLKSYPAELSLTTWICLVGTVQGTAAALAFEWNNPIAWSIHFDYK  240

Query  513   FLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKIF  334
              LA  Y+GI+ SG+ YYI G++M E+GP FVTAF+PL+MI+ A++ SF+LAE +  G++ 
Sbjct  241   LLAAFYSGIMCSGIAYYIQGMVMKERGPVFVTAFSPLNMIITAVMSSFILAEIMYLGRVI  300

Query  333   GAVVIIVGLYLVIWG  289
             GA+VI++GLY+V+WG
Sbjct  301   GAMVIVIGLYMVLWG  315



>ref|XP_010669871.1| PREDICTED: WAT1-related protein At2g39510 [Beta vulgaris subsp. 
vulgaris]
Length=366

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/368 (52%), Positives = 258/368 (70%), Gaps = 19/368 (5%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KPY  V+F+Q   A  ++I+K ALN+GM+HY FVVYR  +AA+  +PFA++ ERK+RP M
Sbjct  8     KPYLAVIFMQFGIAGLAIIAKFALNKGMSHYSFVVYRQAVAAIVISPFALVLERKVRPNM  67

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             +++IF+KI LL LLEPVIDQNLYYAGM+YTTATF +A+ N +PA+TF++AWI RLEKVN+
Sbjct  68    SVSIFIKIALLGLLEPVIDQNLYYAGMQYTTATFVSALSNTVPALTFIMAWIFRLEKVNL  127

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSK---HVPQTQSIGPATEHDHVKGA  706
             R + S  K+ GT +TIGGA IMTLV+G  + LPW  +   HV  T     +   D +KGA
Sbjct  128   REVRSLAKVGGTMVTIGGATIMTLVKGPGVKLPWIKRDYNHVTNT-----SYHQDPIKGA  182

Query  705   VMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALH  526
             +MI +GC  W+ F ILQAITL+SYPA +SLT L+C AGA++  ++ L++ER N  IW+LH
Sbjct  183   IMITSGCMGWAAFVILQAITLRSYPAEMSLTALMCFAGAVEGGIIALIMER-NTSIWSLH  241

Query  525   WDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDF  346
             WD   LAY+Y+G++ S + +++ G IM EKGP FVTAFNPLSM++VAI+GSF+LAEQL  
Sbjct  242   WDPKLLAYIYSGVVCSAIGFFLQGKIMQEKGPVFVTAFNPLSMVIVAILGSFILAEQLTL  301

Query  345   GKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKIDDTIK  166
             G+I GAVVI+ GLY+VIWG             D +    N  E IL   S +     T  
Sbjct  302   GRITGAVVIVSGLYIVIWG----------KSKDKDQTSHNTTEQILPIDSPKTNQGSTKD  351

Query  165   IRTVDDTV  142
               +VD+ V
Sbjct  352   DASVDNDV  359



>ref|XP_008371332.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
 ref|XP_008348046.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=345

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 242/320 (76%), Gaps = 1/320 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L  A P+  V F+Q+ +A  SLISK ALN GM+ ++ VVYR+ +A VF APFA++F+R +
Sbjct  5     LNRAVPFMAVTFMQIGFAGMSLISKFALNHGMSPHVLVVYRHAVATVFIAPFAIIFDRNV  64

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT++IF KI+LL LLEPVIDQNL+Y GMK TTATF +AMCNVLPA  F++AWI R E
Sbjct  65    RPKMTLSIFTKIVLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIFRFE  124

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             K+N+RSLHS   I+GT +T+GGAM+MTL+ G ++  PWT +++ Q  ++      D +KG
Sbjct  125   KINLRSLHSLAMILGTIVTVGGAMLMTLINGPMLNFPWTRRNIHQESTVS-TVHQDPIKG  183

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
              +M+AAGCFCWSCF ILQAITLKSYPA LSLT  IC+ G +Q T   L  E  N   W++
Sbjct  184   GIMLAAGCFCWSCFMILQAITLKSYPAELSLTTWICLVGTVQGTAAALAFEWNNPIAWSI  243

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
             H+D   LA VY+GI+ SG+ YYI G++M E+GP FVTAF+PLSMI+ A++ SF+LAE + 
Sbjct  244   HFDYKLLAAVYSGIMCSGIAYYIQGMVMKERGPVFVTAFSPLSMIITAVMSSFILAEIMY  303

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GA+VI++GLY+V+WG
Sbjct  304   LGRVIGAMVIVIGLYMVLWG  323



>ref|NP_181483.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|O80638.1|WTR14_ARATH RecName: Full=WAT1-related protein At2g39510 [Arabidopsis thaliana]
 gb|AAC27842.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAP12854.1| At2g39510 [Arabidopsis thaliana]
 dbj|BAE99731.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC09688.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=374

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/358 (55%), Positives = 257/358 (72%), Gaps = 0/358 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             LK  KP+  V+ LQ  YA  S+I+K ALNQGM+ ++   YR+I+A +F APFA   +RKI
Sbjct  3     LKTWKPFITVVSLQFGYAGLSIIAKFALNQGMSPHVLASYRHIVATIFIAPFAYFLDRKI  62

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT++IF KI+LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  F++AWI RLE
Sbjct  63    RPKMTLSIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLE  122

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KVN++ +HSQ KI+GT +T+GGAM+MT+V+G +I LPW + H     S     + D  KG
Sbjct  123   KVNVKKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPWANPHDIHQDSSNTGVKQDLTKG  182

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A +IA GC CW+ F  LQAITLKSYP  LSLT  IC  G+++ST++ L +ERGN   WA+
Sbjct  183   ASLIAIGCICWAGFINLQAITLKSYPVELSLTAYICFLGSIESTIVALFIERGNPSAWAI  242

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
             H D+  LA VY G+I SG+ YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +LAE + 
Sbjct  243   HLDSKLLAAVYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMF  302

Query  348   FGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKIDD  175
              G+I GA+VI++GLY V+WGKSKD  SS  S+ D    LS  +  + +K +A+   +D
Sbjct  303   LGRILGAIVIVLGLYSVLWGKSKDEPSSSFSDMDKELPLSTPQIVLPSKANAKMDTND  360



>ref|XP_004147717.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=373

 Score =   390 bits (1003),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 206/371 (56%), Positives = 259/371 (70%), Gaps = 1/371 (0%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             E   R+L  AKPYFGVLF+QL  A  ++I+K ALN+GM+ Y+FV YR IIA V  APFA+
Sbjct  2     EGLRRFLVLAKPYFGVLFMQLGSAGMAIIAKFALNKGMSQYVFVFYRMIIATVIMAPFAI  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             +FERK+R +MTI++  KI++L LLEPVID NLY+ GMKYTTATFA AMCNVLPA  FL+A
Sbjct  62    IFERKVRTKMTISLAFKIVMLGLLEPVIDLNLYFTGMKYTTATFAVAMCNVLPAFAFLMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPA-T  730
             W  RLE+VNI    SQ KIVGT +TIGGAMIMT +RG ++ LPWT  + P + S   +  
Sbjct  122   WACRLERVNIWKRGSQAKIVGTIVTIGGAMIMTFIRGPMLNLPWTKPNHPSSSSSSSSIN  181

Query  729   EHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
              H+ +KG++MI  GC C S F ILQAITLK YPA LSLT LIC+   +   ++ LV+ERG
Sbjct  182   HHNQIKGSLMITIGCICQSAFIILQAITLKLYPAELSLTALICLVATVGGCLVALVMERG  241

Query  549   NYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSF  370
             N   WALH+D+  L+ VY G+I SGV YYI G++M  KGP FVTAFNPLSMI VAI+ SF
Sbjct  242   NPSAWALHFDSQLLSVVYAGVICSGVTYYIQGMVMQIKGPVFVTAFNPLSMIFVAIMSSF  301

Query  369   MLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAE  190
             +L+E +  G+I GAV II GLYLV+WGK KD    KS  D        ++ S  T Q ++
Sbjct  302   ILSEIMLLGRIVGAVTIITGLYLVLWGKRKDKLLVKSDSDGKQQMTETDEASKRTVQPSQ  361

Query  189   QKIDDTIKIRT  157
             + I   +   T
Sbjct  362   EFISLDVTRET  372



>ref|XP_010505629.1| PREDICTED: WAT1-related protein At2g39510-like [Camelina sativa]
Length=375

 Score =   390 bits (1003),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 199/369 (54%), Positives = 260/369 (70%), Gaps = 1/369 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             LK  KP+  V+ LQ  YA  S+I+K ALNQGM+ ++   YR+I A +F APFA   +RKI
Sbjct  3     LKTWKPFLTVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIFATIFIAPFAYFLDRKI  62

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI+LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  F++AWI RLE
Sbjct  63    RPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLE  122

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KVN+R +HSQ KI+GT +T+GGAM+MT+V+G +I LPW + +     +  P  + D  KG
Sbjct  123   KVNVRKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPWANPNDIHQDASNPGVKQDLTKG  182

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A++IA GC CW+ F  LQAITLKSYP  LSLT  IC  G+L+ST++ L +ERGN   WA+
Sbjct  183   ALLIAVGCICWAGFINLQAITLKSYPVELSLTACICFMGSLESTIVALYIERGNPSAWAI  242

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
               D+  LA VY GII SG+ YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +LAE + 
Sbjct  243   QLDSKLLAAVYGGIICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMF  302

Query  348   FGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNK-ESILTKQSAEQKIDDT  172
              G+I GA+VI++GLY V+WGKSKD  SS   + D    LS  +  +  +K++AE   +D 
Sbjct  303   LGRILGAIVIVLGLYSVLWGKSKDEPSSPFPDMDKELPLSTPQIVTFSSKENAEMDTNDA  362

Query  171   IKIRTVDDT  145
               + T  +T
Sbjct  363   SVVFTRPNT  371



>ref|XP_004167778.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN50536.1| hypothetical protein Csa_5G181430 [Cucumis sativus]
Length=374

 Score =   390 bits (1002),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 206/372 (55%), Positives = 259/372 (70%), Gaps = 2/372 (1%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             E   R+L  AKPYFGVLF+QL  A  ++I+K ALN+GM+ Y+FV YR IIA V  APFA+
Sbjct  2     EGLRRFLVLAKPYFGVLFMQLGSAGMAIIAKFALNKGMSQYVFVFYRMIIATVIMAPFAI  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             +FERK+R +MTI++  KI++L LLEPVID NLY+ GMKYTTATFA AMCNVLPA  FL+A
Sbjct  62    IFERKVRTKMTISLAFKIVMLGLLEPVIDLNLYFTGMKYTTATFAVAMCNVLPAFAFLMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPA--  733
             W  RLE+VNI    SQ KIVGT +TIGGAMIMT +RG ++ LPWT  + P + S   +  
Sbjct  122   WACRLERVNIWKRGSQAKIVGTIVTIGGAMIMTFIRGPMLNLPWTKPNHPSSSSSSSSSI  181

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
               H+ +KG++MI  GC C S F ILQAITLK YPA LSLT LIC+   +   ++ LV+ER
Sbjct  182   NHHNQIKGSLMITIGCICQSAFIILQAITLKLYPAELSLTALICLVATVGGCLVALVMER  241

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
             GN   WALH+D+  L+ VY G+I SGV YYI G++M  KGP FVTAFNPLSMI VAI+ S
Sbjct  242   GNPSAWALHFDSQLLSVVYAGVICSGVTYYIQGMVMQIKGPVFVTAFNPLSMIFVAIMSS  301

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSA  193
             F+L+E +  G+I GAV II GLYLV+WGK KD    KS  D        ++ S  T Q +
Sbjct  302   FILSEIMLLGRIVGAVTIITGLYLVLWGKRKDKLLVKSDSDGKQQMTETDEASKRTVQPS  361

Query  192   EQKIDDTIKIRT  157
             ++ I   +   T
Sbjct  362   QEFISLDVTRET  373



>ref|XP_007218251.1| hypothetical protein PRUPE_ppa008064mg [Prunus persica]
 gb|EMJ19450.1| hypothetical protein PRUPE_ppa008064mg [Prunus persica]
Length=347

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/330 (56%), Positives = 248/330 (75%), Gaps = 3/330 (1%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M   S  + +  AKP   V  +Q  +A  S+ISK ALN+GM+ ++ VVYR+ +A VF AP
Sbjct  1     MSKSSMAQMINRAKPSVAVTLMQFGFAGMSIISKFALNRGMSQHVLVVYRHAVATVFIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++F+RK+RP+MT ++  KI+LL LLEPVIDQNL+Y GMK TTATF +AMCNVLPA  F
Sbjct  61    FAVVFDRKVRPKMTFSVLTKILLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++AWI RLE +N RSLHS  KI+GT +T+GGAM+MTL+ G ++ LPWT +++ Q  +   
Sbjct  121   IMAWIFRLENINFRSLHSLAKILGTIVTVGGAMLMTLINGPMLNLPWTRRNIHQEST--S  178

Query  735   ATEH-DHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
             AT+H D +KGA+MI AGCFCW+ F  LQAITLKSYPA LSL   IC+ G +Q TV+ L  
Sbjct  179   ATDHQDPIKGALMIGAGCFCWAGFVNLQAITLKSYPAELSLAAWICLMGTVQGTVVALGF  238

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             E  N   W++HWD+  LA VY+GII SGV YY+ G++M E+GP FVTAF+PLSMI+VA++
Sbjct  239   EWDNPAAWSIHWDSKLLAAVYSGIICSGVAYYVQGLVMKERGPVFVTAFSPLSMIIVAVM  298

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
              SFMLAE +  G++ GA+VI++GLY+V+WG
Sbjct  299   SSFMLAEIMYLGRVIGAMVIVIGLYMVLWG  328



>ref|XP_002284091.1| PREDICTED: WAT1-related protein At2g39510 [Vitis vinifera]
 emb|CBI31716.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/332 (58%), Positives = 244/332 (73%), Gaps = 6/332 (2%)
 Frame = -2

Query  1275  MGNESFVRWLK--HAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFF  1102
             MG E +   ++   A P   V+ LQ  YA  S+I+K ALN GMNHY FVVYR++IAA   
Sbjct  1     MGEEDYSLRVQIMQAMPILAVVLLQFGYAGLSIIAKYALNAGMNHYTFVVYRHVIAAAVI  60

Query  1101  APFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAI  922
             APFA++ ERK  PRMT++IF KIML+ LLEPVIDQNLYY GMK TTATF TAM N++PA 
Sbjct  61    APFAIVLERKRWPRMTVSIFAKIMLMGLLEPVIDQNLYYVGMKNTTATFTTAMSNIIPAF  120

Query  921   TFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS-KHVPQTQS  745
             TFL+A +LRLEKVN+R LHSQ K+VGT +T+GGAM+MTLV+G    LPWT  +H  Q+ +
Sbjct  121   TFLVALVLRLEKVNLRRLHSQAKVVGTLVTVGGAMLMTLVKGPAPDLPWTKGRHYHQSST  180

Query  744   IGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTL  565
                + +   +KGA+MI AGC CW+CF  LQA T+KSYPA LSLT LIC+ GAL+  ++TL
Sbjct  181   ---SQQQHPIKGALMITAGCVCWACFLNLQARTVKSYPAQLSLTTLICLMGALEGAMVTL  237

Query  564   VVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVA  385
             ++E GN  IW +    T  A +Y GI+ S + YYI GVIM EKGP FV++FNPLSMI+VA
Sbjct  238   IIEHGNASIWVIPKGPTLCAVLYGGIVCSAIAYYIQGVIMGEKGPVFVSSFNPLSMIIVA  297

Query  384   IVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             I+ SF+ AE L  G + GAVVII+GLYL++WG
Sbjct  298   ILSSFIFAEALYLGMVLGAVVIIIGLYLILWG  329



>gb|KDP29854.1| hypothetical protein JCGZ_18429 [Jatropha curcas]
Length=348

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/330 (57%), Positives = 248/330 (75%), Gaps = 10/330 (3%)
 Frame = -2

Query  1188  SLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRMTITIFLKIMLLALLEP  1009
             S+ISK ALNQGM+ ++ VVYR+ +A +  APFA+LF+RK+RP+MT ++F+KI+LL LLEP
Sbjct  2     SIISKFALNQGMSQHVLVVYRHAVATIVMAPFAILFDRKVRPKMTFSVFVKILLLGLLEP  61

Query  1008  VIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNIRSLHSQGKIVGTTLTI  829
              IDQNLYY GMKYTTATFA+AMCN+LPA  FL+AW LRLE+V  + +HS  K++GT +T+
Sbjct  62    TIDQNLYYTGMKYTTATFASAMCNILPAFAFLMAWALRLEEVKWKKVHSWAKVLGTIVTV  121

Query  828   GGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMIAAGCFCWSCFYILQAI  649
             GGAM+MTL++G I+ LPW SK      S    T HD +KGA MI  GC CWSCF ILQAI
Sbjct  122   GGAMLMTLIKGAILELPW-SKGYDNQASTAAVTPHDTIKGAFMIGIGCLCWSCFIILQAI  180

Query  648   TLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVV  469
             TLK+YPA LSLT LIC  G ++ ++  +++E+GN   W++H+D+  LA VY+G++ SG+ 
Sbjct  181   TLKTYPAELSLTALICFMGTIEGSIFAVIMEKGNPSAWSIHFDSKLLAAVYSGVMCSGIA  240

Query  468   YYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             YY+ GVIM  KGP FVTAFNPLSM++V I+GSF+L+E +  G+I GA+VI+ GLYLV+WG
Sbjct  241   YYVQGVIMKAKGPVFVTAFNPLSMVIVTILGSFVLSEIMYLGRIIGALVIVTGLYLVLWG  300

Query  288   kskdisssksseddDNNALSNNKESILTKQ  199
             KSKD S           A SN+KE + T +
Sbjct  301   KSKDKSPL---------ASSNDKEVVTTSE  321



>ref|XP_010517305.1| PREDICTED: WAT1-related protein At2g39510 [Camelina sativa]
Length=375

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 237/320 (74%), Gaps = 0/320 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             LK  KP+  V+ LQ  YA  S+I+K ALNQGM+ ++   YR+I+A +F APFA   +RKI
Sbjct  3     LKTWKPFLTVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIVATIFIAPFAYFLDRKI  62

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI+LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  F++AWI RLE
Sbjct  63    RPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLE  122

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KVN+R +HSQ KI+GT +T+GGAM+MT+V+G +I LPW + +     +  P  + D  KG
Sbjct  123   KVNVRKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPWANPNDIHQDASNPGVKQDLTKG  182

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A++IA GC CW+ F  LQAITLKSYP  LSLT  IC  G+L+ST++ L +ERGN   WA+
Sbjct  183   ALLIAVGCICWAGFINLQAITLKSYPVELSLTAYICFMGSLESTIVALYIERGNPSAWAI  242

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
               D+  LA VY GII SG+ YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +LAE + 
Sbjct  243   QLDSKLLAAVYGGIICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMF  302

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G+I GA+VI++GLY V+WG
Sbjct  303   LGRILGAIVIVLGLYSVLWG  322



>ref|XP_004246473.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum lycopersicum]
Length=375

 Score =   389 bits (998),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/326 (55%), Positives = 244/326 (75%), Gaps = 0/326 (0%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             E+       AKP+  V+FLQ   A   +++K ALN+GM++Y+FVVYR+ +A +  APFA+
Sbjct  2     EAVRELYNRAKPFLAVIFLQFGLAGMDILTKVALNEGMSNYVFVVYRHAVATLVIAPFAI  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             + ++K+RP+MT +IF K++LL+LLEPVIDQNLY  G+KYTTATFA AMCN+LPAITF++A
Sbjct  62    ILDKKVRPKMTPSIFAKLVLLSLLEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE  727
             WI RLEKV + S+ SQ KIVGT  T+ GAMIMTLVRG I+ L WT+ +       G    
Sbjct  122   WIFRLEKVKLTSIRSQAKIVGTVATVAGAMIMTLVRGPIVELFWTTGNAGHNSQSGGLNL  181

Query  726   HDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
                +KG++MI  GCF W+ F ILQAITL++YPA LSLT  IC+ G  +  ++ +V+ERG 
Sbjct  182   SHAIKGSIMITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTTEGAIVAMVMERGK  241

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFM  367
               +WA++WD+ FLA VY+GI  SG+ YYI GVIM ++GP FVTAFNPLSM++VA++ + +
Sbjct  242   PAVWAINWDSKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAVLSTII  301

Query  366   LAEQLDFGKIFGAVVIIVGLYLVIWG  289
             L EQL+ G++ GAVVI+VGLY+V+WG
Sbjct  302   LREQLNLGRVLGAVVIVVGLYIVLWG  327



>ref|XP_006341065.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum tuberosum]
Length=375

 Score =   388 bits (997),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 179/326 (55%), Positives = 244/326 (75%), Gaps = 0/326 (0%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             E+       AKP+  V+FLQ   A   +++K ALN+GM++Y+FVVYR+ +A +  APFA+
Sbjct  2     EAVREQYNRAKPFLAVIFLQFGLAGMDILTKVALNEGMSNYVFVVYRHAVATLVIAPFAI  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             + ++K+RP+MT +IF K++LL+LLEPVIDQNLY  G+KYTTATFA AMCN+LPAITF++A
Sbjct  62    ILDKKVRPKMTPSIFAKLVLLSLLEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE  727
             WI RLEKV + S+ SQ K+VGT  T+ GAMIMTLVRG I+ L WT+ +       G    
Sbjct  122   WIFRLEKVKLTSIRSQAKLVGTVATVAGAMIMTLVRGPIVELFWTAGNAGHDSQSGGLNL  181

Query  726   HDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
                +KG++MI  GCF W+ F ILQAITL++YPA LSLT  IC+ G  +  ++ +V+ERG 
Sbjct  182   SHAIKGSIMITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTTEGAIVAMVMERGK  241

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFM  367
               +WA++WD+ FLA VY+GI  SG+ YYI GVIM ++GP FVTAFNPLSM++VAI+ + +
Sbjct  242   PAVWAINWDSKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSTII  301

Query  366   LAEQLDFGKIFGAVVIIVGLYLVIWG  289
             L EQL+ G++ GAVVI+VGLY+V+WG
Sbjct  302   LREQLNLGRVLGAVVIVVGLYIVLWG  327



>ref|XP_009141815.1| PREDICTED: WAT1-related protein At2g39510 [Brassica rapa]
Length=375

 Score =   388 bits (997),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 193/369 (52%), Positives = 257/369 (70%), Gaps = 11/369 (3%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             LK  KP+  V+ LQ  YA  S+I+K AL++GM+ ++   YR+I+A +F APFA   +RK+
Sbjct  3     LKTWKPFLTVISLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDRKV  62

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  FL+AWI RLE
Sbjct  63    RPKMTLPIFFKIALLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLE  122

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KVNIR +HSQ KI+GT +T+GGAM+MT+V+G ++ LPW + +     S  P    D  KG
Sbjct  123   KVNIRKIHSQAKILGTVVTVGGAMLMTVVKGPLVPLPWANPNDSHQDSSNPGVTPDLTKG  182

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A++IA GC CW+ F  LQAITLKSYP  LSLT  IC+ G+++ST++ L +ERGN   WA+
Sbjct  183   ALLIAIGCICWAGFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPSAWAI  242

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
               D+  LA VY G+I SGV YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +LAE + 
Sbjct  243   QLDSKLLAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMY  302

Query  348   FGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKIDDTI  169
              G+I GA+VI++GLY V+WG          S+D+ +N+ S+    I   +S  Q +  ++
Sbjct  303   LGRILGAIVIVLGLYSVLWG---------KSKDEPSNSFSD--MDIELPRSTPQVVTFSL  351

Query  168   KIRTVDDTV  142
             K  T  DT+
Sbjct  352   KANTETDTM  360



>ref|XP_006411179.1| hypothetical protein EUTSA_v10016823mg [Eutrema salsugineum]
 gb|ESQ52632.1| hypothetical protein EUTSA_v10016823mg [Eutrema salsugineum]
Length=371

 Score =   388 bits (997),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 178/320 (56%), Positives = 239/320 (75%), Gaps = 0/320 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             LK  KP+  V+ LQ  YA  S+I+K AL++GM+ ++   YR+I+A +  APFA + +RK+
Sbjct  3     LKTWKPFLTVVSLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATILMAPFAFILDRKV  62

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI++L LLEP +DQNLYY GMKYT+ATF  AM NVLPA  FL+AWI RLE
Sbjct  63    RPKMTLPIFFKILVLGLLEPTLDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLE  122

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KVNIR +HSQ KI+GT +T+GGAM+MT+V+G +I LPWT+ +     S  P  + D  KG
Sbjct  123   KVNIRKIHSQAKIIGTIVTVGGAMLMTVVKGPLIPLPWTNPNENHQDSSNPGVKPDLTKG  182

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A++IA GC CW+ F  LQAITLKSYP  LSLT  IC+ G+++ST++ L +ERGN   WA+
Sbjct  183   ALLIATGCICWAAFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPAAWAI  242

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
               D+  LA +Y G+I SG+ YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +L+E + 
Sbjct  243   QLDSKLLAAIYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILSEVMY  302

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G+I GA+VI++GLY V+WG
Sbjct  303   LGRILGAIVIVIGLYSVLWG  322



>ref|XP_010509005.1| PREDICTED: WAT1-related protein At2g39510-like [Camelina sativa]
Length=375

 Score =   388 bits (996),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 237/320 (74%), Gaps = 0/320 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L+  KP+  V+ LQ  YA  S+I+K ALNQGM+ ++   YR+I+A +F APFA   +RKI
Sbjct  3     LETWKPFLTVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIVATIFIAPFAFFLDRKI  62

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI+LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  F++AWI RLE
Sbjct  63    RPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLE  122

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KVN+R +HSQ KI+GT +T+GGAM+MT+V+G +I LPW + +     +  P  + D  KG
Sbjct  123   KVNVRKIHSQAKILGTIVTVGGAMLMTVVKGPMIPLPWANPNDIHQDASNPGVKQDLTKG  182

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A++IA GC CW+ F  LQAITLKSYP  LS+T  IC  G+L+ST++ L +ERGN   WA+
Sbjct  183   ALLIAVGCICWAGFINLQAITLKSYPVELSMTAYICFMGSLESTIVALYIERGNPSAWAI  242

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
               D+  LA VY GII SG+ YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +LAE + 
Sbjct  243   QLDSKLLAAVYGGIICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMF  302

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G+I GA+VI++GLY V+WG
Sbjct  303   LGRILGAIVIVLGLYSVLWG  322



>ref|XP_003521346.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=377

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/361 (52%), Positives = 257/361 (71%), Gaps = 17/361 (5%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             +     KP+ GV+FLQ  YA   ++SK+ALN+GM++Y+FVVYR++ A V  APFA++ E+
Sbjct  7     KLFNRLKPFIGVVFLQFGYAGMDILSKAALNKGMSNYVFVVYRHVFAFVVMAPFALILEK  66

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K+RP+MT +IF+KIM+L+LLEPVIDQNLY+ GMKYTTATFA +M NVLPAITF++AWILR
Sbjct  67    KVRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWILR  126

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHV  715
             LEKV ++S+ SQ K+VGT  T+ GAM+MTL++G I+ L  T       Q  G       +
Sbjct  127   LEKVKLKSIRSQAKVVGTLATVVGAMVMTLIKGPILDLFGTHASSTHNQQNGGVNLQHAI  186

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             KG+VMI  GCF  +CF ILQAIT+++YPA LSLT  IC+ G ++  V+ LV+ER N   W
Sbjct  187   KGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLSAW  246

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
             +L WDT  LA VY+GI+ SG+ YYI G +M ++GP FVT FNPL M++VAI+GSF LAE 
Sbjct  247   SLQWDTKLLAAVYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFLAEI  306

Query  354   LDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNN----KESILTKQSAEQ  187
             +  G++ GA+VII+GLYLV+WG               N+  S+N    K ++ +KQ+ E+
Sbjct  307   MYLGRVVGAIVIILGLYLVVWG-------------KSNDYESSNSITKKHTLPSKQTVEE  353

Query  186   K  184
             +
Sbjct  354   E  354



>ref|XP_009143306.1| PREDICTED: WAT1-related protein At2g39510-like [Brassica rapa]
Length=375

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/316 (58%), Positives = 234/316 (74%), Gaps = 0/316 (0%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KP+  V+ LQ  YA  S+I+K AL++GM+ ++   YR+I+A VF APFA   +RKIRP+M
Sbjct  7     KPFLTVVSLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATVFIAPFAFFLDRKIRPKM  66

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+ IF KI+LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  FL+AWI RLEKVNI
Sbjct  67    TLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLEKVNI  126

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMI  697
             R +HSQ KI+GT +T+GGAM+MT+V+G +I LPW         S     + D  KGA++I
Sbjct  127   RKIHSQAKILGTVVTVGGAMLMTVVKGPLIPLPWAHPSDNHQDSSNLGVKQDLTKGALLI  186

Query  696   AAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDT  517
             A GC CW+ F  LQAITLKSYP  LSLT LIC+ G+++ST++ L +ERGN   WA+  D+
Sbjct  187   ATGCICWAGFVNLQAITLKSYPVELSLTALICLMGSIESTIVALFIERGNPSAWAIQLDS  246

Query  516   TFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKI  337
               LA VY G+I SGV YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +L+E +  G+I
Sbjct  247   KLLAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAIMGSIILSEVMYLGRI  306

Query  336   FGAVVIIVGLYLVIWG  289
              GA+VI++GLY V+WG
Sbjct  307   LGAIVIVLGLYSVLWG  322



>emb|CDY20446.1| BnaC04g05980D [Brassica napus]
Length=375

 Score =   385 bits (990),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 198/369 (54%), Positives = 261/369 (71%), Gaps = 4/369 (1%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KP+  V+ LQ  YA  S+I+K AL++GM+ ++   YR+I+A +F APFA   +RKIRP+M
Sbjct  7     KPFLTVVSLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDRKIRPKM  66

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+ IF +I+LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  FL+AWI RLEKVNI
Sbjct  67    TLPIFFEILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLEKVNI  126

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMI  697
             R +HSQ KI+GT +T+GGAM+MT+V+G +I LPW         S     + D  KGA++I
Sbjct  127   RKIHSQAKILGTVVTVGGAMLMTVVKGPLIPLPWAHPSDNHQDSSNLGVKQDLTKGALLI  186

Query  696   AAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDT  517
             A GC CW+ F  LQAITLKSYP  LSLT LIC+ G+++ST++ L +ERGN   WA+  D+
Sbjct  187   ATGCICWAGFVNLQAITLKSYPVELSLTALICLMGSIESTIVALFIERGNPSAWAIQLDS  246

Query  516   TFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKI  337
               LA VY GII SGV YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +L+E +  G+I
Sbjct  247   KLLAAVYGGIICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILSEVMYLGRI  306

Query  336   FGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNK-ESILTKQSAEQKIDDT---I  169
              GA+VI++GLY V+WGKSKD  ++  S+ D    LSN +  S  +K +A++   D    I
Sbjct  307   LGAIVIVLGLYSVLWGKSKDEPANSFSDTDKELPLSNIQVVSFSSKANADKDTMDANVVI  366

Query  168   KIRTVDDTV  142
                T +D+V
Sbjct  367   LRSTTNDSV  375



>ref|XP_007162672.1| hypothetical protein PHAVU_001G170400g [Phaseolus vulgaris]
 gb|ESW34666.1| hypothetical protein PHAVU_001G170400g [Phaseolus vulgaris]
Length=382

 Score =   385 bits (989),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 180/322 (56%), Positives = 243/322 (75%), Gaps = 0/322 (0%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             +     KP+ GV+FLQ  YA   ++SK+ALN+GM++Y+FVVYR++ A V  APFA+  E+
Sbjct  7     KLFNRLKPFIGVVFLQFGYAGMDVLSKAALNKGMSNYVFVVYRHVFAFVVMAPFAVFLEK  66

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K+RP+MT +IF+K+++L+LLEPVIDQNLY+ GMKYTTATFA +M NVLPAITFL+AWILR
Sbjct  67    KVRPKMTFSIFMKLVILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFLMAWILR  126

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHV  715
             LEK+ ++S+ SQ K+VGT  T+ GAMIMTL++G I+ L  T  +       G       +
Sbjct  127   LEKIKLKSIRSQAKVVGTLATVAGAMIMTLLKGPILDLFGTHGNNTNNLQNGGVNLQHAI  186

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             KG+VMI  GCF  +CF ILQAIT+++YPA LSLT  IC+ G ++  ++ LV+ER N+  W
Sbjct  187   KGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGIVALVMERNNFSAW  246

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
             +L WDT  LA VY+GI+ SG+ YYI GV+M ++GP FVT FNPL M++VAI+GSF LAEQ
Sbjct  247   SLQWDTKLLAAVYSGIVCSGMAYYIQGVVMKDRGPVFVTTFNPLCMVIVAIMGSFFLAEQ  306

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G+  GA+VII+GLYLV+WG
Sbjct  307   MYLGRAVGAIVIILGLYLVVWG  328



>ref|XP_007009430.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18240.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=394

 Score =   385 bits (990),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 188/360 (52%), Positives = 254/360 (71%), Gaps = 11/360 (3%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ES       A PY  ++F++   A   +++K ALN+GM+ ++ VVYR  IA +  APFA+
Sbjct  2     ESSGSMYNKAMPYLAMVFMRFGSAGMPIVAKFALNRGMSQHVLVVYRFAIATLVLAPFAI  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             +F+RK+RP+MT +IF++I+LL LLEP IDQNLYY G+KYTTAT ATA+CNVLPA  FLLA
Sbjct  62    VFDRKVRPKMTFSIFVQILLLGLLEPTIDQNLYYTGIKYTTATVATALCNVLPAFVFLLA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE  727
                RLEKV++R LH Q KI+GT  T+GGAMIMTLV G I+ LPWT K   + QS   AT+
Sbjct  122   LACRLEKVDMRKLHCQAKILGTLGTVGGAMIMTLVNGPILPLPWT-KVTNEHQSTVSATK  180

Query  726   HDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
              D +KGA+MI AGC CW+CF ILQAITLKSYPA LSLT L+C  GA++ T++ LV+E GN
Sbjct  181   DDPLKGALMILAGCVCWACFVILQAITLKSYPAELSLTTLVCFMGAIEGTIVALVMEGGN  240

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFM  367
                W++HWD+   A VY+G+I SGV YY+  +++  KGP F  AFNPL+M++VAI+ SF+
Sbjct  241   AAAWSIHWDSKLFAAVYSGVICSGVAYYVGAMVIQAKGPVFYAAFNPLTMVIVAIMSSFI  300

Query  366   LAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQ  187
              +E +  G++ GA+VI+VGLYLV+WG             D +++ S++ E     +S EQ
Sbjct  301   FSEIMYLGRVIGAIVIVVGLYLVLWG----------KNKDQHSSDSDSNEEAAAPRSGEQ  350



>ref|XP_002881660.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57919.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=375

 Score =   384 bits (987),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 234/320 (73%), Gaps = 0/320 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             LK  KP+  V+ LQ  YA  S+I+K ALNQGM+ ++   YR+I+A +F APFA   +RKI
Sbjct  3     LKTWKPFITVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIVATIFIAPFAYFLDRKI  62

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI+LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  F++AWI RLE
Sbjct  63    RPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLE  122

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KVN++ +HSQ KI+GT +T+GGAM+MT+V+G +I LPW + H           + D  KG
Sbjct  123   KVNVKKIHSQAKILGTVVTVGGAMLMTVVKGPLIPLPWANPHDIHQDPSNTGVQQDLTKG  182

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A +IA GC CW+ F  LQAITLKSYP  LSLT  IC  G+++ST++ L +ERGN   WA+
Sbjct  183   ASLIAIGCICWAGFINLQAITLKSYPVELSLTAYICFMGSIESTIVALFIERGNPSAWAI  242

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
               D+  LA VY G+I SG+ YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +LAE + 
Sbjct  243   QLDSKLLAAVYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMF  302

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G+I GA+VI++GLY V+WG
Sbjct  303   LGRILGAIVIVLGLYSVLWG  322



>ref|XP_010037869.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   385 bits (988),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/328 (54%), Positives = 244/328 (74%), Gaps = 6/328 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R     KP+  V+FLQ  +A   ++ K+ALN+GM++Y+ VVYR+ +A +   PFA++ +R
Sbjct  5     RLFHKLKPFLAVVFLQFGFAGMDILCKAALNKGMSNYVLVVYRHAVATIVIVPFAVIMDR  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K RPRMT+ IF+++M+L+LLEPVIDQNLYY GMK TTATFA AMCN+LPAITF++AWI+R
Sbjct  65    KTRPRMTLPIFIRLMVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAITFVIAWIMR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPW------TSKHVPQTQSIGPA  733
             LEKV ++S+ SQ K+ GT  T+ GAMIMTL++G ++ L W      T+ ++    + G  
Sbjct  125   LEKVKLKSIRSQAKVFGTLATVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGGI  184

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
             +  + +KG++MI AGCF W+CF ILQAITL++YPA LSLT  IC  G ++   + L +ER
Sbjct  185   SLQNSIKGSLMITAGCFSWACFMILQAITLQTYPAELSLTAWICFLGTVEGAAVALFMER  244

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
             GN  +W + WDT  LA VY+GI+ SGV YYI GV+M ++GP FVTAFNPLSM++VAI+ +
Sbjct  245   GNATVWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVTAFNPLSMVIVAILST  304

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F+ AEQL  G++ GAVVI+ GLYLV+WG
Sbjct  305   FIFAEQLFLGRLVGAVVIVAGLYLVVWG  332



>gb|KHN09434.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=377

 Score =   384 bits (987),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/361 (52%), Positives = 256/361 (71%), Gaps = 17/361 (5%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             +     KP+ GV+FLQ  YA   ++SK+ALN+GM++Y+FVVYR++ A V  APFA++ E+
Sbjct  7     KLFNRLKPFIGVVFLQFGYAGMDILSKAALNKGMSNYVFVVYRHVFAFVVMAPFALILEK  66

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K+RP+MT +IF+KIM+L+LLEPVIDQNLY+ GMKYTTATFA +M NVLPAITF++AWILR
Sbjct  67    KVRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWILR  126

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHV  715
             LEKV ++S+ SQ K+VGT  T+ GAM+MTL++G I+ L  T       Q  G       +
Sbjct  127   LEKVKLKSIRSQAKVVGTLATVVGAMVMTLIKGPILDLFGTHASSTHNQQNGGVNLQHAI  186

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             KG+VMI  GCF  +CF ILQAIT+++YPA LSLT  IC+ G ++  V+ LV+ER N   W
Sbjct  187   KGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLSAW  246

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
             +L WDT  LA VY+GI+ SG+ YYI G +M ++GP FVT FNPL M++VAI+GSF  AE 
Sbjct  247   SLQWDTKLLAAVYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFPAEI  306

Query  354   LDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNN----KESILTKQSAEQ  187
             +  G++ GA+VII+GLYLV+WG               N+  S+N    K ++ +KQ+ E+
Sbjct  307   MYLGRVVGAIVIILGLYLVVWG-------------KSNDYESSNSITKKHTLPSKQTVEE  353

Query  186   K  184
             +
Sbjct  354   E  354



>emb|CDY53594.1| BnaA05g34670D [Brassica napus]
Length=375

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 234/316 (74%), Gaps = 0/316 (0%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KP+  V+ LQ  YA  S+I+K AL++GM+ ++   YR+I+A +F APFA   +RKIRP+M
Sbjct  7     KPFLTVVSLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDRKIRPKM  66

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+ IF KI+LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  FL+AWI RLEKVNI
Sbjct  67    TLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLEKVNI  126

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMI  697
             R +HSQ KI+GT +T+GGAM+MT+V+G +I LPW         S     + D  KGA++I
Sbjct  127   RKIHSQAKILGTVVTVGGAMLMTVVKGPLIPLPWAHPSDNHQDSSNLGVKQDLTKGALLI  186

Query  696   AAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDT  517
             A GC CW+ F  LQAITLKSYP  LSLT LIC+ G+++ST++ L +ERGN   WA+  D+
Sbjct  187   ATGCICWAGFVNLQAITLKSYPVELSLTALICLMGSIESTIVALFIERGNPSAWAIQLDS  246

Query  516   TFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKI  337
               +A VY G+I SGV YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +L+E +  G+I
Sbjct  247   KLVAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAIMGSIILSEVMYLGRI  306

Query  336   FGAVVIIVGLYLVIWG  289
              GA+VI++GLY V+WG
Sbjct  307   LGAIVIVLGLYSVLWG  322



>gb|KCW49646.1| hypothetical protein EUGRSUZ_K03164 [Eucalyptus grandis]
Length=446

 Score =   386 bits (992),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/328 (54%), Positives = 244/328 (74%), Gaps = 6/328 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R     KP+  V+FLQ  +A   ++ K+ALN+GM++Y+ VVYR+ +A +   PFA++ +R
Sbjct  65    RLFHKLKPFLAVVFLQFGFAGMDILCKAALNKGMSNYVLVVYRHAVATIVIVPFAVIMDR  124

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K RPRMT+ IF+++M+L+LLEPVIDQNLYY GMK TTATFA AMCN+LPAITF++AWI+R
Sbjct  125   KTRPRMTLPIFIRLMVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAITFVIAWIMR  184

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPW------TSKHVPQTQSIGPA  733
             LEKV ++S+ SQ K+ GT  T+ GAMIMTL++G ++ L W      T+ ++    + G  
Sbjct  185   LEKVKLKSIRSQAKVFGTLATVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGGI  244

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
             +  + +KG++MI AGCF W+CF ILQAITL++YPA LSLT  IC  G ++   + L +ER
Sbjct  245   SLQNSIKGSLMITAGCFSWACFMILQAITLQTYPAELSLTAWICFLGTVEGAAVALFMER  304

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
             GN  +W + WDT  LA VY+GI+ SGV YYI GV+M ++GP FVTAFNPLSM++VAI+ +
Sbjct  305   GNATVWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVTAFNPLSMVIVAILST  364

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F+ AEQL  G++ GAVVI+ GLYLV+WG
Sbjct  365   FIFAEQLFLGRLVGAVVIVAGLYLVVWG  392



>ref|XP_006296517.1| hypothetical protein CARUB_v10025706mg [Capsella rubella]
 gb|EOA29415.1| hypothetical protein CARUB_v10025706mg [Capsella rubella]
Length=375

 Score =   383 bits (984),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 195/360 (54%), Positives = 255/360 (71%), Gaps = 2/360 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L+  KP+  V+ LQ  YA  S+I+K ALNQGM+ ++   YR+I+A +F APFA   +RKI
Sbjct  3     LETWKPFLTVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIVATIFIAPFAYFLDRKI  62

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI+LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  F++AWI RLE
Sbjct  63    RPKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLE  122

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIG-PATEHDHVK  712
             KVN++ +HSQ KI+GT +T+GGAM+MT+V+G +I LPW +      Q    P  + D  K
Sbjct  123   KVNVKKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPWANPSDMHHQDASNPGVKQDLTK  182

Query  711   GAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWA  532
             GA++IA GC CW+ F  LQAITLKSYP  LS+T  IC  G+L+ST++ L +ERGN   WA
Sbjct  183   GALLIAIGCICWAGFINLQAITLKSYPVELSMTAYICFMGSLESTIVALYIERGNPSAWA  242

Query  531   LHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQL  352
             +  D+  LA VY G+I SG+ YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +LAE +
Sbjct  243   IQLDSKLLAAVYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVM  302

Query  351   DFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKE-SILTKQSAEQKIDD  175
               G+I GAVVI++GLY V+WGKSKD  SS   + D    LS  +  +  +K +AE   +D
Sbjct  303   YLGRILGAVVIVLGLYSVLWGKSKDQPSSSFPDMDKELPLSTPQTVTFSSKANAEMDTND  362



>emb|CDY07016.1| BnaA04g22990D [Brassica napus]
Length=376

 Score =   383 bits (983),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 236/321 (74%), Gaps = 1/321 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFE-RK  1072
             LK  KP+  V+ LQ  YA  S+I+K AL++GM+ ++   YR+I+A +F APFA   + RK
Sbjct  3     LKTWKPFLTVISLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDSRK  62

Query  1071  IRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRL  892
             +RP+MT+ IF KI LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  FL+AWI RL
Sbjct  63    VRPKMTLPIFFKIALLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRL  122

Query  891   EKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVK  712
             EKVNIR +HSQ KI+GT +T+GGAM+MT+V+G ++ LPW + +     S  P    D  K
Sbjct  123   EKVNIRKIHSQAKILGTVVTVGGAMLMTVVKGPLVPLPWVNPNDSHQDSSNPGVTPDLTK  182

Query  711   GAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWA  532
             GA++IA GC CW+ F  LQAITLKSYP  LSLT  IC+ G+++ST++ L +ERGN   WA
Sbjct  183   GALLIAIGCICWAGFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPSAWA  242

Query  531   LHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQL  352
             +  D+  LA VY G+I SGV YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +LAE +
Sbjct  243   IQLDSKLLAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVM  302

Query  351   DFGKIFGAVVIIVGLYLVIWG  289
               G+I GA+VI++GLY V+WG
Sbjct  303   YLGRILGAIVIVLGLYSVLWG  323



>ref|XP_011023754.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At2g39510-like 
[Populus euphratica]
Length=351

 Score =   381 bits (979),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 179/319 (56%), Positives = 236/319 (74%), Gaps = 1/319 (0%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
               AKP+  V+ LQ  YA    I+K AL++GM+ ++ VV R+ +A +   PFA++F+RK+R
Sbjct  9     DRAKPFLAVILLQFGYAGMFTITKHALDEGMSQHVLVVXRHAVATIVITPFALVFDRKVR  68

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             P+MT++IF KIMLL LLEP IDQNLYY GMKYTTATF +AMCNVLPA  FL+AW+LR+E+
Sbjct  69    PKMTLSIFFKIMLLGLLEPTIDQNLYYTGMKYTTATFTSAMCNVLPAFAFLMAWVLRIEQ  128

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGA  706
             VNIR  HSQ KI GT +T+GGAM+MTLV+G  + LPWT  +  Q  S    T+ D +KGA
Sbjct  129   VNIRKKHSQAKIFGTIVTVGGAMLMTLVKGTQLDLPWTRGY-DQQASTSALTKQDPIKGA  187

Query  705   VMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALH  526
             +MIA GC CW+ F ILQ+ITLKSYP  LSLT  IC  G ++ +++ +V+ERGN   W++ 
Sbjct  188   LMIATGCVCWASFIILQSITLKSYPVELSLTAWICFMGTIEGSMVAVVMERGNPSAWSVG  247

Query  525   WDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDF  346
              +   LA VY+G+I SG+ YY+ G+IM  KGP FVTAF+PLSM++V I+GSF L E L  
Sbjct  248   LNYKLLAAVYSGVICSGIGYYVQGLIMKRKGPVFVTAFSPLSMVIVTILGSFFLKEILYV  307

Query  345   GKIFGAVVIIVGLYLVIWG  289
             G++ GAVVI+ GLYLV+WG
Sbjct  308   GRVIGAVVIVTGLYLVLWG  326



>gb|KHN02414.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=383

 Score =   382 bits (982),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/328 (55%), Positives = 243/328 (74%), Gaps = 2/328 (1%)
 Frame = -2

Query  1272  GNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPF  1093
             GN+   +     KP+ GV+FLQ  YA   ++SK+ALN+GM++Y+FVVYR++ A V  APF
Sbjct  3     GNKQ--KLFNRLKPFIGVVFLQFGYAGMDILSKAALNKGMSNYVFVVYRHVFAFVVTAPF  60

Query  1092  AMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFL  913
             A++ E+K+RP+MT +IF+KIM+L+LLEPVIDQNLY+ GMKYTTATFA +M NVLPAITF+
Sbjct  61    ALILEKKVRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFV  120

Query  912   LAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPA  733
             +AWI RLEKV ++S+ SQ K+VGT  T+ GAM+MTL++G ++ L  T       Q  G  
Sbjct  121   MAWIFRLEKVKLKSIRSQAKVVGTLATVAGAMVMTLIKGPVLDLFGTHTSNTHNQQNGGV  180

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
                  +KG+VMI  GCF  +CF ILQAIT+++YPA LSLT  IC+ G ++  V+ LV+ER
Sbjct  181   NLQHAIKGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMER  240

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
              N   W+L WDT  LA VY+GI+ SG+ YYI G +M ++GP FVT FNPL M++VAI+GS
Sbjct  241   KNLSAWSLQWDTKLLAAVYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGS  300

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F LAE +  G+  GA+VII+GLYLV+WG
Sbjct  301   FFLAEIMYLGRAVGAIVIILGLYLVVWG  328



>gb|KHG26265.1| Auxin-induced 5NG4 [Gossypium arboreum]
 gb|KHG27688.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KPYF  +FLQ+  A   ++SK+ALNQGM++Y+ VVYR+ IA +  APFA++ E+K+RP+M
Sbjct  8     KPYFAAIFLQVGLAGMDILSKAALNQGMSNYVLVVYRHAIATLVMAPFAVILEKKVRPKM  67

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             TI+IF+KIMLL+LLEPVIDQNLYY GMKYTTATFA AM N+LPAITFL+AWILRLEKVN 
Sbjct  68    TISIFIKIMLLSLLEPVIDQNLYYVGMKYTTATFAAAMYNILPAITFLMAWILRLEKVNF  127

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE--HDHVKGAV  703
             RS+ S  K+ GT  T+ GAM+MTL++G ++ L WT+  +   ++        HD +KG +
Sbjct  128   RSIRSHAKVFGTLATVAGAMVMTLMKGPVLELFWTTGRINNHEAAAKNRTDFHDTIKGGL  187

Query  702   MIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHW  523
             +IA GCF ++CF ILQA+TLK+YPA LSLT  IC+ G L++TV  LV+E G   IWA+ W
Sbjct  188   LIAVGCFSYACFVILQAVTLKTYPAELSLTVWICLMGTLEATVAALVMETGKASIWAIKW  247

Query  522   DTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFG  343
             DT  L   Y+GI+ SG+ YYI GVIM ++GP FVTAF+PL M++VAI+ SF+LAEQ+  G
Sbjct  248   DTKLLTAAYSGIVCSGLAYYIQGVIMKDRGPVFVTAFSPLCMVIVAIMASFILAEQMFLG  307

Query  342   KIFGAVVIIVGLYLVIWG  289
             ++ GA++IIVGLYLV+WG
Sbjct  308   RVIGAIIIIVGLYLVLWG  325



>ref|XP_003553527.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=383

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/328 (55%), Positives = 243/328 (74%), Gaps = 2/328 (1%)
 Frame = -2

Query  1272  GNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPF  1093
             GN+   +     KP+ GV+FLQ  YA   ++SK+ALN+GM++Y+FVVYR++ A V  APF
Sbjct  3     GNKQ--KLFNRLKPFIGVVFLQFGYAGMDVLSKAALNKGMSNYVFVVYRHVFAFVVTAPF  60

Query  1092  AMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFL  913
             A++ E+K+RP+MT +IF+KIM+L+LLEPVIDQNLY+ GMKYTTATFA +M NVLPAITF+
Sbjct  61    ALILEKKVRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFV  120

Query  912   LAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPA  733
             +AWI RLEKV ++S+ SQ K+VGT  T+ GAM+MTL++G ++ L  T       Q  G  
Sbjct  121   MAWIFRLEKVKLKSIRSQAKVVGTLATVAGAMVMTLIKGPVLDLFGTHTSNTHNQQNGGV  180

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
                  +KG+VMI  GCF  +CF ILQAIT+++YPA LSLT  IC+ G ++  V+ LV+ER
Sbjct  181   NLQHAIKGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMER  240

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
              N   W+L WDT  LA VY+GI+ SG+ YYI G +M ++GP FVT FNPL M++VAI+GS
Sbjct  241   KNLSAWSLQWDTKLLAAVYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGS  300

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F LAE +  G+  GA+VII+GLYLV+WG
Sbjct  301   FFLAEIMYLGRAVGAIVIILGLYLVVWG  328



>gb|KFK36842.1| hypothetical protein AALP_AA4G179000 [Arabis alpina]
Length=368

 Score =   380 bits (977),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 189/371 (51%), Positives = 258/371 (70%), Gaps = 12/371 (3%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L   KP+  V+ LQ  YA  S+I+K AL++GM+ ++   YR+I+A +F APFA   +RK+
Sbjct  3     LNKWKPFLTVISLQFGYAGLSIIAKFALDRGMSPHVLASYRHIVATLFIAPFAYFLDRKV  62

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI+LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  FL+AWI RLE
Sbjct  63    RPKMTLPIFFKILLLGLLEPTIDQNLYYMGMKYTSATFTAAMTNVLPAFAFLMAWIFRLE  122

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
              VN++ +HSQ KI+GT +T+GGAM+MTLV+G +I LPW + +     S     + D  KG
Sbjct  123   NVNVKKIHSQAKILGTVVTVGGAMLMTLVKGPLIPLPWANPNDHHQDSSNTGVKQDLTKG  182

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A++IA GC CW+ F  LQAITLKSYP  LSLT  IC+ G+++ST++ L +ERGN   W++
Sbjct  183   AMLIATGCICWAGFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPSAWSI  242

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
               D+  LA VY G+I SG+ YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +LAE + 
Sbjct  243   QLDSKLLAAVYAGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMY  302

Query  348   FGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKE---SILTKQSAEQKID  178
              G+I GA+VI++GLY V+WG          S+D+ ++ L  +KE   SI +K +AE   +
Sbjct  303   LGRILGAIVIVLGLYSVLWG---------KSKDEPSSFLDMDKELPLSIRSKANAEIDTN  353

Query  177   DTIKIRTVDDT  145
             D   + +  +T
Sbjct  354   DASVVTSRPNT  364



>ref|XP_011094815.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
 ref|XP_011094816.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
Length=383

 Score =   380 bits (977),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 197/360 (55%), Positives = 252/360 (70%), Gaps = 11/360 (3%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M  ES       +KP+ GV+FLQ   A   +ISK+ALN+GM++Y+FVVYR+ +A +  AP
Sbjct  3     MSRESMHDLFHKSKPFLGVVFLQAGLAGMDIISKAALNEGMSNYVFVVYRHAVATLVIAP  62

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA+  ++KIRP+MT  IF KIMLL+LLEPVIDQNLY+ GMKYTTATFA AM NVLPAITF
Sbjct  63    FAIALDKKIRPKMTTAIFAKIMLLSLLEPVIDQNLYFLGMKYTTATFAAAMANVLPAITF  122

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++A I RLEKV + S+ SQ KI+GT  T+ GAMIMTLVRG  + LPWT       +    
Sbjct  123   VMACIFRLEKVRLMSIRSQAKIIGTLATVAGAMIMTLVRGPNLDLPWTKVMTDPARQQSE  182

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
                   +KGA+MI  GCF W+CF ILQA+TL++YPA LSLT  IC+ G  Q   + LV+E
Sbjct  183   VNLQHSIKGALMITVGCFSWACFMILQAVTLRTYPAELSLTAWICLLGTAQGAAVALVME  242

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             +GN   WA+ WDT FLA  Y+GI  SG+ YY+ GVIM E+GP FVTAF+PLSM++VAI+ 
Sbjct  243   KGNSAAWAIKWDTKFLAAAYSGIFCSGIAYYVQGVIMKERGPVFVTAFSPLSMVIVAIMS  302

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQS  196
             SF+LAEQ+  G++ GA+VI++GLYLV+WGK KD             + S  +E I  KQS
Sbjct  303   SFILAEQMFLGRVVGAIVIVMGLYLVVWGKKKDY-----------GSPSEGEEEIPVKQS  351



>emb|CDX93255.1| BnaC04g46410D [Brassica napus]
Length=376

 Score =   380 bits (976),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 236/321 (74%), Gaps = 1/321 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFE-RK  1072
             LK  KP+  V+ LQ  YA  S+I+K AL++GM+ ++   YR+I+A +F APFA   + RK
Sbjct  3     LKTWKPFLIVISLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDSRK  62

Query  1071  IRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRL  892
             +RP+MT+ IF KI LL LLEP IDQNLYY GMKYT+ATF  AM NVLPA  FL+AWI RL
Sbjct  63    VRPKMTLPIFFKIALLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRL  122

Query  891   EKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVK  712
             EKVNIR +HSQ KI+GT +T+GGAM+MT+V+G ++ LPW + +     S  P    D  K
Sbjct  123   EKVNIRKVHSQAKILGTVVTVGGAMLMTVVKGPLVPLPWANPNDNHQDSSNPGVTPDLTK  182

Query  711   GAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWA  532
             GA++IA GC CW+ F  LQAIT+KSYP  LSLT  IC+ G+++ST++ L +ERGN   WA
Sbjct  183   GALLIAIGCICWAGFVNLQAITIKSYPVELSLTAYICLMGSIESTIVALFIERGNPSAWA  242

Query  531   LHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQL  352
             +  D+  LA VY G+I SGV YY+ GVIM  +GP FVTAFNPLSM++VAI+GS +LAE +
Sbjct  243   IQLDSKLLAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVM  302

Query  351   DFGKIFGAVVIIVGLYLVIWG  289
               G+I GA+VI++GLY V+WG
Sbjct  303   YLGRILGAIVIVLGLYSVLWG  323



>ref|XP_008370940.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=350

 Score =   379 bits (973),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 177/329 (54%), Positives = 242/329 (74%), Gaps = 1/329 (0%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M   S  + L    P+  V  LQ  +A   +ISK ALN+GM+  +FV YR+ +A VF AP
Sbjct  1     MSKCSTAQMLIRLMPFMAVTLLQFGFAGLFIISKFALNRGMSPQVFVAYRHAVATVFIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++F+R++RP+MT++IF KI+LL LLEPV+DQNL Y GMK TTAT  +A+ NVLPA  F
Sbjct  61    FAIIFDRRVRPKMTLSIFFKIVLLGLLEPVMDQNLAYTGMKLTTATVTSALYNVLPAFAF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++AW+ RLEKVN+RSLHSQ KI+GT + +GGAM+MTL+ G ++  PWT ++ P  +S   
Sbjct  121   IMAWVFRLEKVNLRSLHSQAKILGTIVMVGGAMLMTLINGPMLNFPWTRRN-PHHESTVS  179

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
                 DH+KGA+M+AAGCFCW+ F  LQAITLKSYPA LSLT  IC+AG +Q   + L  E
Sbjct  180   TDHQDHIKGAIMVAAGCFCWAGFVTLQAITLKSYPAELSLTVWICLAGTVQGFAVALAFE  239

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
               N   W++H+D+  LA VY GI+ SG+ +YI G++M E+GP FVTAFNPLS+I+VA++ 
Sbjct  240   WNNLTAWSIHFDSKLLAVVYCGIMCSGIAFYIQGIVMKERGPVFVTAFNPLSLIIVAVMS  299

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             SF+LAE +  G++ GA+VI++GLY+V+WG
Sbjct  300   SFILAEIMYLGRVIGAIVIVIGLYMVLWG  328



>ref|XP_004141853.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN50537.1| hypothetical protein Csa_5G181440 [Cucumis sativus]
Length=377

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 188/382 (49%), Positives = 256/382 (67%), Gaps = 27/382 (7%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ESF+R+L+ AKPYFGV+F+Q  YA  ++++KSAL++GM+ ++FV YR + A +  APFA+
Sbjct  2     ESFIRFLRSAKPYFGVIFVQFGYAGMAILTKSALDKGMSQHVFVAYRQVAATLVIAPFAI  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             +FERK R +MT ++  KI+LL  LEPVIDQNLYY GMKYTTATFA AMCNVLPA  FL+A
Sbjct  62    IFERKARTKMTFSLLFKILLLGFLEPVIDQNLYYTGMKYTTATFAAAMCNVLPAFVFLMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT---SKHVPQTQSIGP  736
             W  RLEKV I    SQ KI+GT +T+GGAMIMT +RG ++ LPWT   ++    +     
Sbjct  122   WACRLEKVKIMKRGSQAKILGTIVTVGGAMIMTFIRGPMLNLPWTKLPNQVSASSSLSAA  181

Query  735   ATEH-DHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
             + +H + + G +MI  GC CW+ F  LQAITLK YPA LSLT LIC+ G +    + LV+
Sbjct  182   SPDHQNQIVGFLMITTGCVCWAAFITLQAITLKEYPADLSLTTLICLVGTIGGFGVALVI  241

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             ERGN   WALH+D+  LA VY+G+I SGV YYI GV+M  KGP F  +FNPL+MI+VAI+
Sbjct  242   ERGNVSAWALHFDSQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFASFNPLAMILVAIM  301

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQ  199
               F+L+E +  G++ G V+II GLY+V+WGK                  S ++  +L  +
Sbjct  302   SFFILSEIMFLGRMIGVVIIICGLYMVLWGK------------------SQDEPPVLNSE  343

Query  198   -----SAEQKIDDTIKIRTVDD  148
                    EQ++  T  +++  D
Sbjct  344   CDNMTPCEQQMKTTTTVQSSQD  365



>ref|XP_006436050.1| hypothetical protein CICLE_v10031857mg [Citrus clementina]
 ref|XP_006486498.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
 gb|ESR49290.1| hypothetical protein CICLE_v10031857mg [Citrus clementina]
Length=375

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/326 (56%), Positives = 249/326 (76%), Gaps = 1/326 (0%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ES  R+   AKP+  V+ LQ  YA  S+ SK ALN+GM+ ++F VYR+ +A +  APFA+
Sbjct  2     ESLARFYIRAKPFLAVILLQFGYAGMSIFSKFALNKGMSPHVFAVYRHAVATIVVAPFAL  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             + +RK+RP+MT++IF+KI+LL LLEP IDQNL+Y GMKYTTATF TAM NVLPA  FL+A
Sbjct  62    ILDRKVRPKMTLSIFVKILLLGLLEPTIDQNLFYTGMKYTTATFTTAMANVLPAFAFLMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE  727
             WI+RLEKVN R  HS  K+ GT +T+GGAM MTL++G ++ LPWT+ +  Q +S   ++ 
Sbjct  122   WIIRLEKVNFRKFHSWAKVFGTIVTVGGAMFMTLIKGPVLDLPWTNHNYHQ-ESTSNSSV  180

Query  726   HDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
                +KGA+MI  GCF W+ F +LQAITLKSYP  LSLT LIC+ G ++ T++ L +ERGN
Sbjct  181   QSPIKGALMITIGCFSWAGFMVLQAITLKSYPTELSLTALICLMGTIEGTIVALFLERGN  240

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFM  367
               +W++H D+  LA VY+G+I SG+ YY+SGV+M ++GP FVTAFNPL MI+VAI+GSF+
Sbjct  241   AAVWSIHLDSKLLAAVYSGVICSGIGYYVSGVVMKDRGPVFVTAFNPLCMIIVAIMGSFL  300

Query  366   LAEQLDFGKIFGAVVIIVGLYLVIWG  289
             L+E +  G++ GA++I+VGLYLV+WG
Sbjct  301   LSEIMYLGRVVGAIIIVVGLYLVLWG  326



>ref|XP_010554433.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=355

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/310 (56%), Positives = 234/310 (75%), Gaps = 0/310 (0%)
 Frame = -2

Query  1218  LFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRMTITIFL  1039
             +FLQ   A  ++I+KSALN+GM+ ++   YR+I+A +  APFA  F+RK+RP+MT+ I  
Sbjct  1     MFLQFGIAGLAIIAKSALNKGMSPHVLAAYRHIVATLVIAPFAFFFDRKVRPKMTLPILF  60

Query  1038  KIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNIRSLHSQ  859
             KI+LL LLEP IDQNLYY GM  T+ATF  AM NVLPA +FL+AW+ RLEKVN+R + SQ
Sbjct  61    KIVLLGLLEPTIDQNLYYTGMGCTSATFTAAMSNVLPAFSFLMAWLFRLEKVNVRKIPSQ  120

Query  858   GKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMIAAGCFC  679
              KI+GT +T+GGAM+MTLV+G ++ LPWT+ H     +  P T+ D VKGA++I  GC C
Sbjct  121   AKILGTIVTVGGAMLMTLVKGPLVPLPWTNNHSNSQGASNPETKQDLVKGAILIGVGCIC  180

Query  678   WSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDTTFLAYV  499
             W+ F  LQAITLKSYPA LSLT  +C++GA+  T++ LV+ER N   W++ +D+  LA V
Sbjct  181   WAGFINLQAITLKSYPAELSLTAYMCLSGAIGGTIVALVIERANPAAWSIQFDSKLLAVV  240

Query  498   YNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKIFGAVVI  319
             Y+G+I SG+ YYI G +M  +GP FVTAFNPLSM++VAI+GSF+LAE +  G+I GAVVI
Sbjct  241   YSGVICSGISYYIQGAVMKTRGPVFVTAFNPLSMVIVAILGSFLLAEVMFLGRILGAVVI  300

Query  318   IVGLYLVIWG  289
             ++GLY V+WG
Sbjct  301   VLGLYSVLWG  310



>gb|EYU28266.1| hypothetical protein MIMGU_mgv1a008729mg [Erythranthe guttata]
Length=364

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 240/321 (75%), Gaps = 4/321 (1%)
 Frame = -2

Query  1242  HAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRP  1063
              AKP+  V+FLQL  A   +I K+ALN+GM+ Y+FVVYR++IA VF APFA++ E+KIRP
Sbjct  17    KAKPFLAVIFLQLGVAGLDIICKAALNEGMSSYVFVVYRHVIATVFIAPFALVLEKKIRP  76

Query  1062  RMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKV  883
             +MT ++F KI+LL+LLEP+IDQNLY+ GMKYTTATFA AM NVLPAITF++A + RLEKV
Sbjct  77    KMTTSVFAKIVLLSLLEPIIDQNLYFLGMKYTTATFAAAMGNVLPAITFIMACLFRLEKV  136

Query  882   NIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVP---QTQSIGPATEHDHVK  712
                S HS  K+VGT  T+ GAMIMTLV+G  I LPW  + +     +   G  + H  V 
Sbjct  137   KFTSKHSLAKMVGTLTTVTGAMIMTLVKGPHIHLPWNKEGLSNNNHSTQKGEISFHHSVT  196

Query  711   GAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWA  532
             GA+MIA GC CW+CF ILQ ITL++YPA LSLT  IC+ GA++  V+ L++E      W+
Sbjct  197   GAIMIAIGCLCWACFMILQVITLRAYPAELSLTAWICVLGAVEGGVVALIMENDKLA-WS  255

Query  531   LHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQL  352
             L WD   LA  Y+GII SG+ YY+ GV++ E+GP FVTAF+PLSM++VA++ SF+L+EQ+
Sbjct  256   LKWDIKLLAVAYSGIICSGIAYYVQGVVLKERGPVFVTAFSPLSMVLVAVLSSFILSEQM  315

Query  351   DFGKIFGAVVIIVGLYLVIWG  289
               G++ GA++II+GLYLVIWG
Sbjct  316   YLGRVIGAIIIIMGLYLVIWG  336



>ref|XP_008461650.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Cucumis 
melo]
Length=378

 Score =   379 bits (972),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 182/331 (55%), Positives = 241/331 (73%), Gaps = 5/331 (2%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ESFVR+++ AKPYFGV+F+Q  YA  ++++KSAL++GM+ ++FV YR + A +  APFA+
Sbjct  2     ESFVRFMRSAKPYFGVIFVQFGYAGMTILTKSALDKGMSQHVFVAYRQVAATLVIAPFAI  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             +FERK R +MT ++  KI+LL  LEPVIDQNL+Y GMKYTTATFA AMCNVLPA  FL+A
Sbjct  62    IFERKARTKMTFSLLFKILLLGFLEPVIDQNLFYTGMKYTTATFAAAMCNVLPAFVFLMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS--KHVPQTQSIGPA  733
             W  RLEKVNI    SQ KI+GT +T+GGAMIMT ++G ++ LPW+    H   + S   A
Sbjct  122   WACRLEKVNIMKRGSQAKILGTIVTVGGAMIMTFIKGPMLHLPWSKLPNHPSASSSSSSA  181

Query  732   TEHDH---VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLV  562
                DH   + G +M+  GC CW+ F  LQAITLK YPA LSLT LIC+ G +  + + LV
Sbjct  182   ASTDHQNQIIGFLMLTTGCICWAAFITLQAITLKEYPAELSLTALICLVGTIGGSGVALV  241

Query  561   VERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAI  382
             +ERGN   WALH+D   LA VY+G+I SGV YYI GV+M  KGP F +AFNPL+M++VAI
Sbjct  242   IERGNPSAWALHFDRQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFSAFNPLAMVLVAI  301

Query  381   VGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +  F+L+E +  G++ G V+II GLY+V+WG
Sbjct  302   MSFFILSEIMFLGRMIGVVIIICGLYMVLWG  332



>ref|XP_009337582.1| PREDICTED: WAT1-related protein At2g39510 [Pyrus x bretschneideri]
Length=350

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/329 (53%), Positives = 243/329 (74%), Gaps = 1/329 (0%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M   S  + L    P+  V FLQ  YA   +ISK ALN+GM+  +FV YR+ +A VF AP
Sbjct  1     MSKCSKAQMLTRLMPFMAVTFLQFGYAGLFIISKFALNRGMSPQVFVAYRHAVATVFIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++F+R++RP+MT++IF KI+LL LLEPV+DQNL Y GMK TTATF +A+ NVLPA  F
Sbjct  61    FAIIFDRRVRPKMTLSIFCKIVLLGLLEPVLDQNLTYTGMKLTTATFTSALYNVLPAFAF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++AW+ RLEK+N+RSLHSQ KI+GT +T+GGAM++TL+ G ++  PWT ++ P  +S   
Sbjct  121   IMAWVFRLEKINLRSLHSQAKILGTLVTVGGAMLLTLINGPMLNFPWTRRN-PHHESTVS  179

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
                 DH+KGA+M+AAGCFCW+ F  L AITLKSYPA LSLT  IC+ G +Q + + +  E
Sbjct  180   TDHQDHIKGAIMVAAGCFCWAGFVNLLAITLKSYPAELSLTAWICLVGTVQGSAVAVAFE  239

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
               N   W++H+D+  LA VY+GI+ SG+ YYI G++M E+GP FVT+F+PL MI+VA++ 
Sbjct  240   WNNPTSWSIHFDSKLLAAVYSGIMCSGIAYYIQGMVMKERGPVFVTSFSPLIMIIVAVMS  299

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             SF+LAE +  G+  GA+VI++GLY+V+WG
Sbjct  300   SFILAEIMYLGRAIGAIVIVIGLYMVLWG  328



>ref|XP_010067380.1| PREDICTED: WAT1-related protein At2g39510-like [Eucalyptus grandis]
Length=382

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/327 (57%), Positives = 239/327 (73%), Gaps = 2/327 (1%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
              E  +R L   KPY  V+ LQ  +A  ++++K +LN+GMN ++FVVYR+  A    APFA
Sbjct  5     GERVIRVLSRLKPYLAVVLLQFGFAGMAIVAKFSLNRGMNQHVFVVYRHAFAIAVVAPFA  64

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             +LFERK RP+MT ++FLKI+LL LLEPVIDQNL+Y GMKYTTA+F  AM N+LPA TFL+
Sbjct  65    ILFERKTRPKMTRSVFLKILLLGLLEPVIDQNLFYTGMKYTTASFTAAMSNMLPAFTFLM  124

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPAT  730
             AW  RLE+++IRS HSQ KI+GT +TIGGAMIMTL +G ++ LPWT          G A 
Sbjct  125   AWFFRLERLSIRSKHSQAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSTSAHVDLDGVA-  183

Query  729   EHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
                 ++GA+MI AGCFCW+ F ILQAITLKSYPA L+LT LICM G  Q  V    +ER 
Sbjct  184   -QKPIEGALMITAGCFCWASFIILQAITLKSYPAELTLTTLICMTGTFQGAVFAFAMERS  242

Query  549   NYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSF  370
             N+  W++ +D   LA VY+GII SGV YYI GV+M  KGP F+TAFNPL M++VAI+GSF
Sbjct  243   NFAAWSIQFDVRLLAVVYSGIICSGVGYYIQGVVMQIKGPVFLTAFNPLHMVLVAILGSF  302

Query  369   MLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +L E L  G++ GA+VI++GLYLV+WG
Sbjct  303   ILHEILCLGRVIGALVIVLGLYLVLWG  329



>ref|XP_010039216.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   376 bits (965),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 239/322 (74%), Gaps = 6/322 (2%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KP+  V+FLQ   A   ++ K+ALN+GM++Y+ VVYRN +A +  APFA++ ERK RPRM
Sbjct  11    KPFLAVVFLQFGLAGMDILCKAALNKGMSNYVLVVYRNAVATIVIAPFAVIMERKTRPRM  70

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+ IF+++++L+LLEPVIDQNLYY GMK TTATFA AMCN+LPAI  ++AWI+ LE V +
Sbjct  71    TLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAIALVMAWIMGLETVKM  130

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPW------TSKHVPQTQSIGPATEHDHV  715
             +S+ SQ K+ GT   + GAMIMTLV+G ++ L W      T+ ++    + G  +  + +
Sbjct  131   KSIRSQAKVFGTLAMVAGAMIMTLVKGPVLELFWTRGGGTTANNIQNGSAAGGISLQNSI  190

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             +G++MI AGCF W+CF ILQAITL++YPA LSLT  IC  G ++  V+ L++ERGN   W
Sbjct  191   EGSLMITAGCFSWACFMILQAITLRTYPAELSLTAWICFLGTVEGAVVALIMERGNATAW  250

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              + WDT  LA VY+GI+ SGV YYI GV+M ++GP FV AFNPLSM++VAI+ +F+LAEQ
Sbjct  251   FIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAILSTFILAEQ  310

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             L  G++ GAVVI+ GLYLV+WG
Sbjct  311   LFLGRLVGAVVIVAGLYLVVWG  332



>ref|XP_004166081.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=377

 Score =   375 bits (963),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 186/382 (49%), Positives = 254/382 (66%), Gaps = 27/382 (7%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ESF+R+L+ AKPYFGV+F+Q  YA  ++++KSAL++GM+ ++   YR + A +  APFA+
Sbjct  2     ESFIRFLRSAKPYFGVIFVQFGYAGMAILTKSALDKGMSQHVLXAYRQVAATLVIAPFAI  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             +FERK R +MT ++  KI+LL  LEPVIDQNLYY GMKYTTATFA AMCNVLPA  FL+A
Sbjct  62    IFERKARTKMTFSLLFKILLLGFLEPVIDQNLYYTGMKYTTATFAAAMCNVLPAFVFLMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT---SKHVPQTQSIGP  736
             W  RLEKV I    SQ KI+GT +T+GGAMIMT +RG ++ LPWT   ++    +     
Sbjct  122   WACRLEKVKIMKRGSQAKILGTIVTVGGAMIMTFIRGPMLNLPWTKLPNQVSASSSLSAA  181

Query  735   ATEH-DHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
             + +H + + G +MI  GC CW+ F  LQAITLK YPA LSLT LIC+ G +    + LV+
Sbjct  182   SPDHQNQIVGFLMITTGCVCWAAFITLQAITLKEYPADLSLTTLICLVGTIGGFGVALVI  241

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             ERGN   WALH+D+  LA VY+G+I SGV YYI GV+M  KGP F  +FNPL+MI+VAI+
Sbjct  242   ERGNVSAWALHFDSQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFASFNPLAMILVAIM  301

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQ  199
               F+L+E +  G++ G V+II GLY+V+WGK                  S ++  +L  +
Sbjct  302   SFFILSEIMFLGRMIGVVIIICGLYMVLWGK------------------SQDEPPVLNSE  343

Query  198   -----SAEQKIDDTIKIRTVDD  148
                    EQ++  T  +++  D
Sbjct  344   CDNMTPCEQQMKTTTTVQSSQD  365



>ref|XP_003625520.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES81738.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=379

 Score =   375 bits (963),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 178/327 (54%), Positives = 243/327 (74%), Gaps = 4/327 (1%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
              +SF  W    KP+  V+ LQ  YA   ++SKSALN+GM+ Y+ VVYR+ +A V   PFA
Sbjct  6     QKSFQNW----KPFIAVVLLQFGYAGMDILSKSALNKGMSCYVLVVYRHAVAFVVIVPFA  61

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             ++ E+K+RP+MT++IFLK++ L++LEPVIDQNLY+ GMKYTTATFA AM NVLPAITF++
Sbjct  62    VILEKKVRPKMTLSIFLKLVALSVLEPVIDQNLYFLGMKYTTATFAVAMFNVLPAITFVV  121

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPAT  730
             AWIL++EK+ +RS+HSQ KIVGT  T+ GAM+MTL++G I+ L    +   Q Q  G   
Sbjct  122   AWILKMEKIKMRSVHSQAKIVGTIATVAGAMVMTLIKGPILNLFGIHESSAQIQHNGGVN  181

Query  729   EHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
                 VKG++MI  GCF  +CF ILQA+TL++YPA LSLT  IC+ G ++  ++ L++ERG
Sbjct  182   LQHAVKGSIMITIGCFSCACFTILQAVTLETYPAELSLTAWICLLGTVEGGIVALIMERG  241

Query  549   NYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSF  370
                +W+L WDT  LA VY+GI+ SG+ YYI GV+M  +GP FVT FNPL M++VAI+  F
Sbjct  242   EPSVWSLSWDTKLLAAVYSGIVCSGMAYYIQGVVMRYRGPVFVTTFNPLCMVIVAIMSPF  301

Query  369   MLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +LAE++  G++ GAVVII+GLYLV+WG
Sbjct  302   ILAEKIYLGRVIGAVVIILGLYLVVWG  328



>gb|AFK37217.1| unknown [Medicago truncatula]
Length=379

 Score =   375 bits (962),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 178/327 (54%), Positives = 243/327 (74%), Gaps = 4/327 (1%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
              +SF  W    KP+  V+ LQ  YA   ++SKSALN+GM+ Y+ VVYR+ +A V   PFA
Sbjct  6     QKSFQNW----KPFIAVVLLQFGYAGMDILSKSALNKGMSCYVLVVYRHAVAFVVIVPFA  61

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             ++ E+K+RP+MT++IFLK++ L++LEPVIDQNLY+ GMKYTTATFA AM NVLPAITF++
Sbjct  62    VILEKKVRPKMTLSIFLKLVALSVLEPVIDQNLYFLGMKYTTATFAVAMFNVLPAITFVV  121

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPAT  730
             AWIL++EK+ +RS+HSQ KIVGT  T+ GAM+MTL++G I+ L    +   Q Q  G   
Sbjct  122   AWILKMEKIKMRSVHSQAKIVGTIATVAGAMVMTLIKGPILNLFGIHESSAQIQHNGGVN  181

Query  729   EHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
                 VKG++MI  GCF  +CF ILQA+TL++YPA LSLT  IC+ G ++  ++ L++ERG
Sbjct  182   LQHAVKGSIMITIGCFSCACFTILQAVTLEAYPAELSLTAWICLLGTVEGGIVALIMERG  241

Query  549   NYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSF  370
                +W+L WDT  LA VY+GI+ SG+ YYI GV+M  +GP FVT FNPL M++VAI+  F
Sbjct  242   EPSVWSLSWDTKLLAAVYSGIVCSGMAYYIQGVVMRYRGPVFVTTFNPLCMVIVAIMSPF  301

Query  369   MLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +LAE++  G++ GAVVII+GLYLV+WG
Sbjct  302   ILAEKIYLGRVIGAVVIILGLYLVVWG  328



>gb|KCW49650.1| hypothetical protein EUGRSUZ_K03168 [Eucalyptus grandis]
Length=446

 Score =   377 bits (967),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 239/322 (74%), Gaps = 6/322 (2%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KP+  V+FLQ   A   ++ K+ALN+GM++Y+ VVYRN +A +  APFA++ ERK RPRM
Sbjct  71    KPFLAVVFLQFGLAGMDILCKAALNKGMSNYVLVVYRNAVATIVIAPFAVIMERKTRPRM  130

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+ IF+++++L+LLEPVIDQNLYY GMK TTATFA AMCN+LPAI  ++AWI+ LE V +
Sbjct  131   TLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAIALVMAWIMGLETVKM  190

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPW------TSKHVPQTQSIGPATEHDHV  715
             +S+ SQ K+ GT   + GAMIMTLV+G ++ L W      T+ ++    + G  +  + +
Sbjct  191   KSIRSQAKVFGTLAMVAGAMIMTLVKGPVLELFWTRGGGTTANNIQNGSAAGGISLQNSI  250

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             +G++MI AGCF W+CF ILQAITL++YPA LSLT  IC  G ++  V+ L++ERGN   W
Sbjct  251   EGSLMITAGCFSWACFMILQAITLRTYPAELSLTAWICFLGTVEGAVVALIMERGNATAW  310

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              + WDT  LA VY+GI+ SGV YYI GV+M ++GP FV AFNPLSM++VAI+ +F+LAEQ
Sbjct  311   FIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAILSTFILAEQ  370

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             L  G++ GAVVI+ GLYLV+WG
Sbjct  371   LFLGRLVGAVVIVAGLYLVVWG  392



>ref|XP_010684183.1| PREDICTED: WAT1-related protein At2g37460-like [Beta vulgaris 
subsp. vulgaris]
Length=377

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/328 (54%), Positives = 244/328 (74%), Gaps = 3/328 (1%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ES  R    +KP+  V+FLQ+  A   ++SK ALN GM++Y+ VVYR+ +A +   PFA+
Sbjct  2     ESSRRLYNQSKPFLAVIFLQVGLAGMDILSKVALNHGMSNYVLVVYRHAVATIVITPFAL  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
              F++K+RP+MT++IF+K++LL+LLEPVIDQNLYY GMKYT+ATFA  M NVLPAITF++A
Sbjct  62    FFDKKVRPKMTLSIFIKLLLLSLLEPVIDQNLYYMGMKYTSATFAATMVNVLPAITFVMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP--A  733
             WILRLE+V  RS+ SQ KIVGT  T+GGAM+MTL++G  +   W+         + P   
Sbjct  122   WILRLERVKCRSIRSQAKIVGTVATVGGAMMMTLIKGPAL-TSWSKNTATDHNGVKPLDI  180

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
             + HD +KG++MI  GCF W+ F ILQAITLK+YP  LSLT  IC+ G L+ T L LV+E+
Sbjct  181   SVHDAIKGSIMIIIGCFSWAAFVILQAITLKTYPVELSLTAWICLLGTLEGTALALVMEK  240

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
             G   +WA++WD   LA VY+GI  SG++Y+I GV+M E+GP FVTAF+PL M++VAI+ +
Sbjct  241   GRSSVWAINWDANLLAAVYSGIFCSGLLYFIQGVVMKERGPVFVTAFSPLCMVIVAILST  300

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F +AE++  G++ GAVVI+VGLY+VIWG
Sbjct  301   FFMAEKMYLGRVLGAVVIVVGLYMVIWG  328



>ref|XP_010534481.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=375

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/328 (55%), Positives = 242/328 (74%), Gaps = 1/328 (0%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
             ++  V  LK  KP+  V+FLQ   A  S+I+K ALN+GM+ ++   YR+++A +  APFA
Sbjct  2     DKGCVGRLKTWKPFLTVIFLQFGNAGMSIIAKFALNKGMSPHVLAAYRHVVATLIIAPFA  61

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
                +RK+RP+MT+ I  KI+LL LLEP IDQNLYY GM+YT+ATF  AM NVLPA  FL+
Sbjct  62    FFLDRKVRPKMTLPILFKILLLGLLEPTIDQNLYYTGMRYTSATFTAAMSNVLPAFAFLM  121

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSK-HVPQTQSIGPA  733
             AW+ RLEKVNI+ + SQ KI+GT +T+GGAM+MTLV+G ++ LPWT   +    +S  P+
Sbjct  122   AWLFRLEKVNIKKMPSQAKILGTIVTVGGAMLMTLVKGPLVPLPWTDNPNNAHQESSNPS  181

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
              + D VKGA++IA GC CW+ F  LQAITLK+YP  LSLT  IC+ GA++ TV+ LV+ER
Sbjct  182   IKQDPVKGALLIAVGCICWAGFINLQAITLKTYPVELSLTAYICLMGAIEGTVVALVIER  241

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
             GN   W++  D+  LA VY+G+I SG+ YY+ GV+M  +GP FVTAFNPLSM++VAI+GS
Sbjct  242   GNPSAWSIQLDSKLLAIVYSGVICSGIAYYVQGVVMKTRGPVFVTAFNPLSMVIVAILGS  301

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F+LAE +  G I GA+VI++GLY V+WG
Sbjct  302   FVLAEVMFLGTILGAIVIVLGLYSVLWG  329



>gb|KDO67718.1| hypothetical protein CISIN_1g043160mg, partial [Citrus sinensis]
Length=333

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/320 (55%), Positives = 234/320 (73%), Gaps = 3/320 (1%)
 Frame = -2

Query  1242  HAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRP  1063
             HAKPY GV+F+Q   +  S+I+K AL QGM+ ++ V YR ++A    APFA++ ERK RP
Sbjct  7     HAKPYLGVIFMQFCSSIMSIITKIALTQGMSQHVLVAYRMVVATSLIAPFAIVLERKTRP  66

Query  1062  RMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKV  883
             +MT  IF KI LL L EPVI QNLY+ G+K +TATF  AMCN+LPA+TFL+AWI RLEKV
Sbjct  67    KMTFRIFAKIALLGLFEPVIGQNLYFTGLKCSTATFTVAMCNILPALTFLMAWIFRLEKV  126

Query  882   NIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQS-IGPATEHDHV-KG  709
              I+S+ SQ KI+GT +T GGAM MTL++G I+  PW    +   QS  G   + +H+ KG
Sbjct  127   KIKSMRSQAKILGTIVTAGGAMCMTLLKGPILEFPWKQVRILHNQSETGTHNKEEHITKG  186

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A+MIAAGCF WSCF IL+A  LKSYPA LSLT L+C   +++ T+L L +ERGN GIW L
Sbjct  187   ALMIAAGCFSWSCFIILEAFLLKSYPAELSLTALMCFVSSVEGTILALAIERGNTGIWLL  246

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
             H+D   L+ +Y G + S   Y+I G +M  KGP FV++FNPLSM+++AI+GSF +AE+L 
Sbjct  247   HFDAKLLSVLYGGFV-SCTAYFIMGWLMKRKGPVFVSSFNPLSMVIIAILGSFFIAEELF  305

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G+I GA+VI++GLY+V+WG
Sbjct  306   LGRIVGAIVIVIGLYMVLWG  325



>ref|XP_011019904.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Populus 
euphratica]
Length=348

 Score =   372 bits (955),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 172/319 (54%), Positives = 234/319 (73%), Gaps = 0/319 (0%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
               AKP+  V+FLQ   A   ++SK+ALNQGM++Y+ VVYR+ +A V  APFA + ++K+R
Sbjct  5     DRAKPFVAVMFLQAGLAGMDILSKAALNQGMSNYVLVVYRHAVATVVIAPFAAILDKKLR  64

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             P+MT++IF+K++ L+LLEPVIDQNLY+ GMKYTTATFA A+ NVLPAITF++AWI+RLEK
Sbjct  65    PKMTLSIFIKLVALSLLEPVIDQNLYFLGMKYTTATFAAAIVNVLPAITFIIAWIVRLEK  124

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGA  706
             V I SLHSQ K+ GT  T+ GAM+MTL++G +I                    H  +KGA
Sbjct  125   VKIGSLHSQAKVAGTIATVAGAMLMTLMKGPLIEFFRIKGRAYHENGTSGIDLHSSIKGA  184

Query  705   VMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALH  526
             +MI  GCF W+CF ILQAITLKSYP  LSLT  IC+ G ++ TV+ LV E+G   +WA++
Sbjct  185   LMITVGCFSWACFMILQAITLKSYPVELSLTAWICLLGTIEGTVVALVAEKGKPSVWAIN  244

Query  525   WDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDF  346
             WD   LA VY+G+  SG+ YYI G++M ++GP FVTAF+PL M++VA++ S + AEQ+  
Sbjct  245   WDMKLLAAVYSGVFCSGLAYYIQGIVMKDRGPVFVTAFSPLCMVIVAVMSSIIWAEQMYL  304

Query  345   GKIFGAVVIIVGLYLVIWG  289
             G+I GA++I+ GLYLV+WG
Sbjct  305   GRILGALIIVAGLYLVVWG  323



>ref|XP_010529854.1| PREDICTED: WAT1-related protein At2g37460-like [Tarenaya hassleriana]
Length=383

 Score =   373 bits (958),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 234/320 (73%), Gaps = 0/320 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++ A+P+  V+FLQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A    APFA  F++K+
Sbjct  12    MERARPFMAVVFLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATFIIAPFAFYFDKKV  71

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             R +MT+ IF++I LL LLEPVIDQNLYY GMKYTTATFA AM NVLPAITF+LA+I RLE
Sbjct  72    RTKMTMRIFIQITLLGLLEPVIDQNLYYLGMKYTTATFAAAMYNVLPAITFVLAYIFRLE  131

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +VN+R + S  KI+GT  T+ GAM+MTLV+G ++ L WT    PQ         H  +KG
Sbjct  132   RVNLRCIRSAAKIIGTAATVAGAMMMTLVKGPVLDLFWTKGPSPQHDGTEGTDIHSAIKG  191

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV+I  GCF ++CF +LQAITL++YPA LSLT  IC+ G ++ T L LV+E+G+ G WA+
Sbjct  192   AVLITIGCFSYACFMVLQAITLRTYPAELSLTAWICLMGTIEGTALALVMEKGHPGAWAI  251

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  L   Y+GI+ SG+ YYI GV+M ++GP FVTAFNPL M++VA + S + AEQ+ 
Sbjct  252   GWDTKLLTATYSGIVCSGLAYYIGGVVMKDRGPVFVTAFNPLCMVIVAFISSIIFAEQMY  311

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GAVVI  GLY VIWG
Sbjct  312   LGRVLGAVVICAGLYFVIWG  331



>ref|XP_010039215.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   373 bits (958),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/328 (53%), Positives = 240/328 (73%), Gaps = 6/328 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R     KP+  V+FLQ   A   ++ K+ALN+GM++Y+ VVYRN +A +  APFA++ +R
Sbjct  5     RLFHKLKPFLAVVFLQFGLAGMDILCKAALNKGMSNYVLVVYRNAVATIVIAPFAVIMDR  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K RPRMT+ IF+++++L+LLEPVIDQNLYY GMK TTATFA AMCN+LPAI  ++AWI+ 
Sbjct  65    KKRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAIALVMAWIMG  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPW------TSKHVPQTQSIGPA  733
             LE V ++S+ SQ K+ GT   + GAMIMTL++G ++ L W      T+ ++    + G  
Sbjct  125   LETVKMKSIRSQAKVFGTLAMVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGGI  184

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
             +  + ++G++MI AGCF W+CF ILQAITL++YPA LSLT  IC  G ++  V+ L++ER
Sbjct  185   SLQNSIEGSLMITAGCFSWACFMILQAITLQTYPAELSLTDWICFLGTVEGAVVALIMER  244

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
             GN   W + WDT  LA VY+GI+ SGV YYI GV+M ++GP FV AFNPLSM++VAI+ +
Sbjct  245   GNATAWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAILST  304

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F+LAEQL  G++ GAVVI+ GLYLV+WG
Sbjct  305   FILAEQLFLGRLVGAVVIVAGLYLVVWG  332



>ref|XP_007027104.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY07606.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=391

 Score =   372 bits (956),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/317 (57%), Positives = 242/317 (76%), Gaps = 1/317 (0%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KPYF  +FLQ+  +   ++SK+ALNQGM++Y  VVYR+ IA V   PFA + ++K+RPRM
Sbjct  14    KPYFAAIFLQVGLSGMDVLSKAALNQGMSNYALVVYRHAIATVVMVPFAAVLDKKVRPRM  73

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+ IF+KIM+L LLEPVIDQNLYY GMKYTTATFA+AM N+LPAITF++AW+LRLEKVN+
Sbjct  74    TLPIFIKIMVLGLLEPVIDQNLYYVGMKYTTATFASAMYNILPAITFVMAWVLRLEKVNL  133

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE-HDHVKGAVM  700
             RS+   GK+VGT  T+ GAM+MTL++G ++ L WT        +    T+ H  +KG +M
Sbjct  134   RSIRGHGKVVGTLATVAGAMVMTLMKGPVLELFWTKGSTNHQAAAQNGTDIHHTIKGGLM  193

Query  699   IAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWD  520
             I  GCF ++CF ILQA+TL++YPA LSLT  IC+ G L+ T+  L++ERGN  IWA+ WD
Sbjct  194   ITVGCFSYACFVILQAVTLETYPAELSLTVWICLMGTLEGTIAALIMERGNAAIWAIKWD  253

Query  519   TTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGK  340
             T  L   Y+GI+ SG+ YYI GVIM ++GP FVTAF+PL M++VAI+ +F+LAEQ+  G+
Sbjct  254   TKLLTAAYSGIVCSGLAYYIQGVIMKDRGPVFVTAFSPLCMVIVAIMSTFILAEQMYLGR  313

Query  339   IFGAVVIIVGLYLVIWG  289
             + GA++IIVGLYLV+WG
Sbjct  314   VIGAIIIIVGLYLVLWG  330



>ref|XP_003590513.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES60764.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=364

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 240/322 (75%), Gaps = 2/322 (1%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
              W++ AKP+  VLFLQ  YA   ++SK+ALN+GM++Y+FVVYR+ +A +   PFA+ F+R
Sbjct  9     NWIEKAKPFIAVLFLQFGYAIMDVLSKAALNRGMSNYVFVVYRHAVAFIVITPFALYFDR  68

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             KIRP+MTI+IF+KI+LL+LLEPVIDQNLY+ GMKYTTATFA AM N+LPAITF+LA I+R
Sbjct  69    KIRPKMTISIFIKIVLLSLLEPVIDQNLYFLGMKYTTATFAAAMSNMLPAITFILASIVR  128

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHV  715
             LEK+ I+S+ SQ K++GT  T+ GAM+MTL++G I+       H     S G +  H  +
Sbjct  129   LEKIKIKSMRSQAKVLGTIATVSGAMVMTLMKGPIL-FETFGDHSQSYHSSGTSAHHT-I  186

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
              G+V+I  GCF W+CF ILQAITL++YPA LSL+  IC+ GA++   L LV+ER N  +W
Sbjct  187   LGSVLITIGCFSWACFVILQAITLETYPAALSLSSWICLFGAIEGAALALVMERNNPSVW  246

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
             ++ WD   L+ +Y GI  SG+ YY+ GV+M  +GP FVT FNP  M++VAI+G F+LAEQ
Sbjct  247   SIKWDMRLLSAIYTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPFCMVIVAIMGYFLLAEQ  306

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G++ GA +I +GLYLV+WG
Sbjct  307   MFLGRVIGAFIICLGLYLVVWG  328



>gb|KGN51272.1| hypothetical protein Csa_5G505820 [Cucumis sativus]
Length=376

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/372 (51%), Positives = 253/372 (68%), Gaps = 6/372 (2%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L  AKPY  V+  Q   A   +ISK ALNQG+N ++ VVYR  IA +  APFA +FERK+
Sbjct  8     LSQAKPYIAVILQQFITAGMVIISKFALNQGLNQHVLVVYRYTIATIVVAPFAFVFERKV  67

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT +IF K++LL LLEP +DQNLYY GMKYTTATFA+AM N+ P + FL+AW+ RLE
Sbjct  68    RPKMTWSIFGKVVLLGLLEPALDQNLYYTGMKYTTATFASAMTNMAPGLVFLMAWVARLE  127

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KV++R L SQ KI+GT + +GGAMIMT VRG I+ LPWT+ H     S   A + D +KG
Sbjct  128   KVDVRQLSSQAKILGTVVAVGGAMIMTAVRGPILNLPWTN-HNLHDHSTTAANQQDLLKG  186

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             ++MI  GC  WS F +LQAIT+K YPA LSLT  IC  GA+Q++V+   +E      W+L
Sbjct  187   SLMILIGCIFWSVFNVLQAITIKVYPAQLSLTAWICFTGAVQASVIAFAMEGHKPAAWSL  246

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
             H D+T LA +Y+GI+ SGV Y I   +M  KGP F + F+PLSM++VAI+ SF L+E L 
Sbjct  247   HLDSTLLAPLYSGIMSSGVSYTIQAAVMKTKGPVFSSTFSPLSMVIVAIISSFALSEILY  306

Query  348   FGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKID---  178
             FG++ GA VII GLYLV+WGK KD +  K   +    A S+ K + +T++      +   
Sbjct  307   FGRVIGAAVIITGLYLVLWGKIKDQALYKLDSEKM--APSDQKLTAITEKPKTSDKELGV  364

Query  177   DTIKIRTVDDTV  142
             D  +I+TVDD+V
Sbjct  365   DLARIKTVDDSV  376



>gb|KHG11891.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=392

 Score =   371 bits (953),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/330 (52%), Positives = 239/330 (72%), Gaps = 1/330 (0%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M  +S   +   A PY  ++ ++   A   +++K ALN+GM+ ++ VVYR IIA +  AP
Sbjct  1     MSLKSSASFYNQALPYVAMVLMRFGSAGMPIVAKYALNRGMSQHVLVVYRFIIATLVLAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++F+RK+RP+MT+++F++I LL LLEP IDQNLYY G+KYTTAT ATA+ NVLPA  F
Sbjct  61    FAIVFDRKVRPKMTLSVFVQIALLGLLEPAIDQNLYYTGIKYTTATVATALSNVLPAFVF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS-KHVPQTQSIG  739
             LLAW+ RLEKV++R +  Q KI+GT  T+ GAMIMT+V G ++ LPWT   +  Q+ +  
Sbjct  121   LLAWVCRLEKVDVRKVKCQAKILGTIGTVAGAMIMTIVYGPMLPLPWTKVNNHHQSTNTD  180

Query  738   PATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
                  D +KGAVMI  GC CW+CF ILQAITLKSYPA LSLT L+C  GA++  ++ LV+
Sbjct  181   AKNNEDALKGAVMILVGCVCWACFVILQAITLKSYPAELSLTTLVCFMGAIEGGIVALVM  240

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             ERGN   WA+HWD+   A VY+GII SGV YYI  +++  KGP F  +FNPL+M++VAI+
Sbjct  241   ERGNAAAWAIHWDSKLFAVVYSGIICSGVAYYIGAMVIQAKGPVFFASFNPLTMVIVAIM  300

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
              SF+ +E +  G++ GA+VI+VGLY+V+WG
Sbjct  301   SSFIFSEIMYLGRVIGAMVIVVGLYMVLWG  330



>ref|XP_002308146.2| hypothetical protein POPTR_0006s08270g [Populus trichocarpa]
 gb|EEE91669.2| hypothetical protein POPTR_0006s08270g [Populus trichocarpa]
Length=414

 Score =   372 bits (955),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/319 (54%), Positives = 236/319 (74%), Gaps = 0/319 (0%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
               AKP+  V+FLQ+ +A   ++SK+ALNQGM++Y+ VVYR+ +A V  APFA + ++K+R
Sbjct  71    DRAKPFVAVIFLQVGFAGMDILSKAALNQGMSNYVLVVYRHAVATVVIAPFAAILDKKLR  130

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             P+MT++IF+K++ L+LLEPVIDQNLY+ GMKYTTATFA A+ NVLPAITF++AWI+RLEK
Sbjct  131   PKMTLSIFIKLVALSLLEPVIDQNLYFLGMKYTTATFAAAIVNVLPAITFIIAWIVRLEK  190

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGA  706
             V I SLHSQ K+ GT  T+ GAM+MTL++G +I       +       G    H  +KGA
Sbjct  191   VKIGSLHSQAKLAGTIATVAGAMLMTLMKGPLIEFFRIKGNAYHENGTGGIDLHSSIKGA  250

Query  705   VMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALH  526
             +MI  GCF W+CF ILQAITLKSYPA LSLT  IC+ G ++  V+ LV E G   +WA++
Sbjct  251   LMITVGCFSWACFMILQAITLKSYPAELSLTAWICLLGTIEGAVVALVAENGKPSVWAIN  310

Query  525   WDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDF  346
             WD   LA VY+GI  SG+ YYI G++M ++GP FVTAF+PL M++VA++   + AEQ+  
Sbjct  311   WDMKLLAAVYSGIFCSGLAYYIQGIVMKDRGPVFVTAFSPLCMVIVAVMSCIIWAEQMYL  370

Query  345   GKIFGAVVIIVGLYLVIWG  289
             G+I GA++I+ GLYLV+WG
Sbjct  371   GRILGAIIIVAGLYLVVWG  389



>ref|XP_004142736.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN51278.1| hypothetical protein Csa_5G512850 [Cucumis sativus]
Length=374

 Score =   370 bits (951),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 181/328 (55%), Positives = 238/328 (73%), Gaps = 3/328 (1%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             E   +  + AKPY G + L+ + A  S+ISK+ALNQGMN  + +VYR  I A+  APFA 
Sbjct  2     EKIGKTFEKAKPYLGAIALRFASAGMSIISKAALNQGMNQLVTIVYRYSIGAIVVAPFAF  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             + +RKIRP+MT+ IF KI+LL LLEPVI Q+L Y+G KYTTATFATAMCN+LPA  FL+A
Sbjct  62    VLDRKIRPKMTLPIFAKILLLGLLEPVIAQSLIYSGTKYTTATFATAMCNILPAFAFLMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH--VPQTQSIGPA  733
             WI R+EKVNIRSL SQ KI+GT +T+GGAM+MTL++G ++ LPWT+++   P + S  P 
Sbjct  122   WICRMEKVNIRSLRSQAKILGTLVTVGGAMMMTLLKGPLLSLPWTNQNNLNPHSYSTLP-  180

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
              +   VK A++I     C S F IL A T+++YPA L+LT  IC+AGA++ST+L L  E 
Sbjct  181   NKQQPVKAAIVITISSICSSAFTILLAHTIRTYPAELTLTTFICLAGAVESTILALAFEW  240

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
              N   W LH D+  LA +Y GII SG+ YY+ GV++  KGP FVTAFNPLSM++VAI+ S
Sbjct  241   DNPSAWVLHADSILLAALYGGIISSGIAYYLQGVVVKLKGPVFVTAFNPLSMVIVAIISS  300

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F+ AE L  G++ GA VII+GLYLV+WG
Sbjct  301   FIFAETLRLGRVVGAAVIIIGLYLVLWG  328



>ref|XP_004149823.1| PREDICTED: auxin-induced protein 5NG4-like, partial [Cucumis 
sativus]
 ref|XP_004166635.1| PREDICTED: auxin-induced protein 5NG4-like, partial [Cucumis 
sativus]
Length=384

 Score =   371 bits (952),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/372 (51%), Positives = 253/372 (68%), Gaps = 6/372 (2%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L  AKPY  V+  Q   A   +ISK ALNQG+N ++ VVYR  IA +  APFA +FERK+
Sbjct  16    LSQAKPYIAVILQQFITAGMVIISKFALNQGLNQHVLVVYRYTIATIVVAPFAFVFERKV  75

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT +IF K++LL LLEP +DQNLYY GMKYTTATFA+AM N+ P + FL+AW+ RLE
Sbjct  76    RPKMTWSIFGKVVLLGLLEPALDQNLYYTGMKYTTATFASAMTNMAPGLVFLMAWVARLE  135

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KV++R L SQ KI+GT + +GGAMIMT VRG I+ LPWT+ H     S   A + D +KG
Sbjct  136   KVDVRQLSSQAKILGTVVAVGGAMIMTAVRGPILNLPWTN-HNLHDHSTTAANQQDLLKG  194

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             ++MI  GC  WS F +LQAIT+K YPA LSLT  IC  GA+Q++V+   +E      W+L
Sbjct  195   SLMILIGCIFWSVFNVLQAITIKVYPAQLSLTAWICFTGAVQASVIAFAMEGHKPAAWSL  254

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
             H D+T LA +Y+GI+ SGV Y I   +M  KGP F + F+PLSM++VAI+ SF L+E L 
Sbjct  255   HLDSTLLAPLYSGIMSSGVSYTIQAAVMKTKGPVFSSTFSPLSMVIVAIISSFALSEILY  314

Query  348   FGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKID---  178
             FG++ GA VII GLYLV+WGK KD +  K   +    A S+ K + +T++      +   
Sbjct  315   FGRVIGAAVIITGLYLVLWGKIKDQALYKLDSEKM--APSDQKLTAITEKPKTSDKELGV  372

Query  177   DTIKIRTVDDTV  142
             D  +I+TVDD+V
Sbjct  373   DLARIKTVDDSV  384



>ref|XP_006410933.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
 gb|ESQ52386.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
Length=380

 Score =   370 bits (950),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 176/320 (55%), Positives = 235/320 (73%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++ A+P+  V+ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A V  APFA  F++K+
Sbjct  10    MEKARPFISVVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAFYFDKKV  69

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE
Sbjct  70    RPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLE  129

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +V +R + S GK+VGT  T+GGAMIMTLV+G ++ L WT       Q+      H  +KG
Sbjct  130   RVKLRCIRSAGKVVGTLATVGGAMIMTLVKGPVLDLFWTKGS--SAQNTNGTDIHSAIKG  187

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV++  GCF ++CF ILQA+TL++YPA LSLT  IC+ G ++ T + LV+E+GN G WA+
Sbjct  188   AVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAI  247

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  L   Y+GI+ S + YYI GV+M  +GP FVTAF+PL MI+VAI+ + + AEQ+ 
Sbjct  248   GWDTKLLTATYSGIVCSALAYYIGGVVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMY  307

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GAVVI  GLYLVIWG
Sbjct  308   LGRVLGAVVICAGLYLVIWG  327



>gb|KCW65509.1| hypothetical protein EUGRSUZ_G02914 [Eucalyptus grandis]
Length=373

 Score =   370 bits (949),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 183/316 (58%), Positives = 233/316 (74%), Gaps = 2/316 (1%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KPY  V+ LQ  +A  ++I+K +LN+GMN ++FVVYR+  A    APFA+LFERK RP+M
Sbjct  7     KPYLAVVLLQFGFAGMAIITKFSLNRGMNQHVFVVYRHAFATAVVAPFAILFERKTRPKM  66

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T ++FLKI+LL LLEPVIDQNLYY GMKYTTA+F  AM N+LPA  FL+AW  RLE+++I
Sbjct  67    TRSVFLKILLLGLLEPVIDQNLYYTGMKYTTASFTAAMSNMLPAFAFLMAWFFRLERLSI  126

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMI  697
             RS HSQ KI+GT +TIGGAMIMTL +G ++ LPWT          G A     ++GA+MI
Sbjct  127   RSKHSQAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSASAHVDLDGVA--QKPIEGALMI  184

Query  696   AAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDT  517
              AGCFCW+ F ILQAITLKSYPA L+LT LICM G  Q  V    +ER N   W++ +D 
Sbjct  185   TAGCFCWASFIILQAITLKSYPAELTLTALICMTGTFQGAVFAFAMERSNSAAWSIQFDV  244

Query  516   TFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKI  337
               LA VY+G+I SGV YY+ GV+M  KGP F+TAFNPL M++VAI+GSF+L E L  G++
Sbjct  245   RLLAIVYSGLICSGVGYYVQGVVMQIKGPVFLTAFNPLHMVLVAILGSFILHEILCLGRV  304

Query  336   FGAVVIIVGLYLVIWG  289
              GA+VI++GLYLV+WG
Sbjct  305   IGALVIVLGLYLVLWG  320



>ref|XP_008461649.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Cucumis 
melo]
Length=388

 Score =   370 bits (951),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 182/341 (53%), Positives = 241/341 (71%), Gaps = 15/341 (4%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ESFVR+++ AKPYFGV+F+Q  YA  ++++KSAL++GM+ ++FV YR + A +  APFA+
Sbjct  2     ESFVRFMRSAKPYFGVIFVQFGYAGMTILTKSALDKGMSQHVFVAYRQVAATLVIAPFAI  61

Query  1086  LFER----------KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCN  937
             +FER          K R +MT ++  KI+LL  LEPVIDQNL+Y GMKYTTATFA AMCN
Sbjct  62    IFERLSVFGVFACRKARTKMTFSLLFKILLLGFLEPVIDQNLFYTGMKYTTATFAAAMCN  121

Query  936   VLPAITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS--KH  763
             VLPA  FL+AW  RLEKVNI    SQ KI+GT +T+GGAMIMT ++G ++ LPW+    H
Sbjct  122   VLPAFVFLMAWACRLEKVNIMKRGSQAKILGTIVTVGGAMIMTFIKGPMLHLPWSKLPNH  181

Query  762   VPQTQSIGPATEHDH---VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAG  592
                + S   A   DH   + G +M+  GC CW+ F  LQAITLK YPA LSLT LIC+ G
Sbjct  182   PSASSSSSSAASTDHQNQIIGFLMLTTGCICWAAFITLQAITLKEYPAELSLTALICLVG  241

Query  591   ALQSTVLTLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAF  412
              +  + + LV+ERGN   WALH+D   LA VY+G+I SGV YYI GV+M  KGP F +AF
Sbjct  242   TIGGSGVALVIERGNPSAWALHFDRQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFSAF  301

Query  411   NPLSMIMVAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             NPL+M++VAI+  F+L+E +  G++ G V+II GLY+V+WG
Sbjct  302   NPLAMVLVAIMSFFILSEIMFLGRMIGVVIIICGLYMVLWG  342



>gb|KCW49647.1| hypothetical protein EUGRSUZ_K03165 [Eucalyptus grandis]
Length=472

 Score =   373 bits (957),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 173/328 (53%), Positives = 240/328 (73%), Gaps = 6/328 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R     KP+  V+FLQ   A   ++ K+ALN+GM++Y+ VVYRN +A +  APFA++ +R
Sbjct  91    RLFHKLKPFLAVVFLQFGLAGMDILCKAALNKGMSNYVLVVYRNAVATIVIAPFAVIMDR  150

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K RPRMT+ IF+++++L+LLEPVIDQNLYY GMK TTATFA AMCN+LPAI  ++AWI+ 
Sbjct  151   KKRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAIALVMAWIMG  210

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPW------TSKHVPQTQSIGPA  733
             LE V ++S+ SQ K+ GT   + GAMIMTL++G ++ L W      T+ ++    + G  
Sbjct  211   LETVKMKSIRSQAKVFGTLAMVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGGI  270

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
             +  + ++G++MI AGCF W+CF ILQAITL++YPA LSLT  IC  G ++  V+ L++ER
Sbjct  271   SLQNSIEGSLMITAGCFSWACFMILQAITLQTYPAELSLTDWICFLGTVEGAVVALIMER  330

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
             GN   W + WDT  LA VY+GI+ SGV YYI GV+M ++GP FV AFNPLSM++VAI+ +
Sbjct  331   GNATAWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAILST  390

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F+LAEQL  G++ GAVVI+ GLYLV+WG
Sbjct  391   FILAEQLFLGRLVGAVVIVAGLYLVVWG  418



>ref|XP_010939363.1| PREDICTED: WAT1-related protein At1g21890 isoform X1 [Elaeis 
guineensis]
Length=371

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 235/325 (72%), Gaps = 0/325 (0%)
 Frame = -2

Query  1263  SFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAML  1084
             +F   +  AKPY  ++FLQ+ YA   +IS ++L +GMNHY+ VVYRN +A    APFA+ 
Sbjct  2     AFGEVVSKAKPYLAMVFLQVGYAGMYVISVASLKRGMNHYVLVVYRNAVAVAAIAPFALW  61

Query  1083  FERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAW  904
             FERK+RP+MT++IFLK M LALLEPV+DQN YY G   T+A FA+A+ N+LPAITFL+A 
Sbjct  62    FERKVRPKMTLSIFLKTMALALLEPVLDQNFYYVGANLTSAGFASALFNILPAITFLMAI  121

Query  903   ILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEH  724
             +LR+EKVN+R   SQ K+VGT +T+ GA++M L +G ++   W+     Q  ++G     
Sbjct  122   VLRMEKVNLRQRRSQAKLVGTIVTVAGAVLMILYKGPVLDFVWSKGRSHQNTAVGHQNSS  181

Query  723   DHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNY  544
             + +KG +M+ +GCFCWSCF+ILQ+ T+ SYPA L+LT LIC+ GAL  +++ LV ERG+ 
Sbjct  182   NWLKGTLMLLSGCFCWSCFFILQSNTIDSYPAELTLTTLICLMGALMGSLVALVAERGSA  241

Query  543   GIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFML  364
               W + WDT  LA VY+G+I SGV YY+ G +M E+GP FVTAFNPL MI+ A++GS +L
Sbjct  242   KPWIIGWDTRLLAAVYSGVICSGVAYYMQGKVMKERGPVFVTAFNPLCMIITAVLGSIVL  301

Query  363   AEQLDFGKIFGAVVIIVGLYLVIWG  289
             AE +  G + GAV I++GLY +IWG
Sbjct  302   AEDITLGSVIGAVFIVIGLYSLIWG  326



>ref|XP_006436052.1| hypothetical protein CICLE_v10031808mg [Citrus clementina]
 ref|XP_006486061.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
 gb|ESR49292.1| hypothetical protein CICLE_v10031808mg [Citrus clementina]
Length=383

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 184/325 (57%), Positives = 239/325 (74%), Gaps = 4/325 (1%)
 Frame = -2

Query  1254  RWLKH-AKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFE  1078
             ++L H AKPY GV+F+Q  Y+  S+I+K ALNQGM+ Y+ V YR ++A +  APFA + E
Sbjct  8     QFLSHNAKPYLGVIFMQFCYSIMSVIAKLALNQGMSPYVLVAYRMVVATILIAPFAFVLE  67

Query  1077  RKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWIL  898
             RK RP+MT+ IF KI L++L EPVI QNLYY GMKYTTATF  AMCN+LPA+TFL+AWI 
Sbjct  68    RKTRPKMTLPIFAKIALVSLFEPVISQNLYYTGMKYTTATFTVAMCNILPALTFLMAWIF  127

Query  897   RLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHV--PQTQSIGPATEH  724
             RLEKV I+S HSQ KI+GT +T GGAM MTL +G I+  PW    +   Q ++     E 
Sbjct  128   RLEKVKIKSTHSQAKILGTIVTAGGAMCMTLFKGPILKFPWKQVRLLHNQLETSIQNNEE  187

Query  723   DHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNY  544
             D  KGA++IAAGCF WSCF ILQA  LKSYPA LSLT LIC   +++ T+LTL +ERGN 
Sbjct  188   DLTKGALLIAAGCFAWSCFIILQAFLLKSYPAELSLTALICFMSSVEGTILTLAIERGNT  247

Query  543   GIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFML  364
             GIW LH+D   LA +Y G + S   Y+I G +M  +GP FV++FNPL M+++A++GSF L
Sbjct  248   GIWLLHFDAKLLAVIYGGFV-SCTAYFIMGWLMKRRGPVFVSSFNPLGMVIIAVLGSFFL  306

Query  363   AEQLDFGKIFGAVVIIVGLYLVIWG  289
             AE+L  G+I GAV+I++GLY+V+WG
Sbjct  307   AEKLYLGRIIGAVIIVIGLYMVLWG  331



>ref|XP_011077436.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
Length=383

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 185/327 (57%), Positives = 235/327 (72%), Gaps = 0/327 (0%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
              E F      AKP+  V+FLQ   A   +ISK+A+NQGM+ Y+ VVYR+ IA +F +PFA
Sbjct  7     RERFWHLFGKAKPFLCVVFLQAGVAGMDIISKAAMNQGMSTYVLVVYRHAIATIFISPFA  66

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
               F++KIRPRM  +IF KI+LL+LLEP+IDQN Y+ GMK+TTATF  AM NVLPAITFL+
Sbjct  67    FAFDKKIRPRMNFSIFWKILLLSLLEPIIDQNFYFLGMKHTTATFTAAMANVLPAITFLM  126

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPAT  730
             A   RLEKV ++S HSQ KIVGT  T+ GAMIMTLVRG  I LPWT +        G   
Sbjct  127   ACFFRLEKVKLKSTHSQAKIVGTLATVAGAMIMTLVRGPDIPLPWTKEGSKHGNHQGEID  186

Query  729   EHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
                 +KGAVMI  GCF W+CF ILQ ITL++YPA LSLT  IC+ G ++  ++ L++E+G
Sbjct  187   LQHSIKGAVMIIIGCFSWACFMILQVITLQTYPAELSLTAWICLMGTVEGAIVALIMEKG  246

Query  549   NYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSF  370
             N   W+L WD  F A  Y+GI  SG+ YY+ GV+M E+GP FVTAF+PLSMI+VAI+ SF
Sbjct  247   NATAWSLKWDIRFFAAAYSGIFCSGIAYYVQGVVMKERGPVFVTAFSPLSMILVAILSSF  306

Query  369   MLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +LAE+L  G++ GA+VIIVGLY V+WG
Sbjct  307   ILAEKLYLGRVIGAMVIIVGLYFVVWG  333



>gb|KDO67719.1| hypothetical protein CISIN_1g042257mg [Citrus sinensis]
Length=383

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 184/325 (57%), Positives = 240/325 (74%), Gaps = 4/325 (1%)
 Frame = -2

Query  1254  RWLKH-AKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFE  1078
             ++L H AKPY GV+F+Q  Y+  S+I+K ALNQGM+ Y+ V YR ++A +  APFA + E
Sbjct  8     QFLSHNAKPYLGVIFMQFCYSIMSVIAKLALNQGMSPYVLVAYRMVVATILIAPFAFVLE  67

Query  1077  RKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWIL  898
             RK RP+MT+ IF KI L++L EPVI QNLYY GMKYTTATF  AMCN+LPA+TFL+AWI 
Sbjct  68    RKTRPKMTLPIFAKIALVSLFEPVISQNLYYTGMKYTTATFTVAMCNILPALTFLMAWIF  127

Query  897   RLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHV--PQTQSIGPATEH  724
             RLEKV I+S HSQ KI+GT +T GGAM MTL++G I+  PW    +   Q ++     E 
Sbjct  128   RLEKVKIKSTHSQAKILGTIVTAGGAMCMTLLKGPILKFPWKQVRLLHNQLETGIQNNEE  187

Query  723   DHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNY  544
             D  KGA++IAAGCF WSCF ILQA  LKSYPA LSLT LIC   +++ T+LTL +ERGN 
Sbjct  188   DLTKGALLIAAGCFAWSCFIILQAFLLKSYPAELSLTALICFMSSVEGTILTLAIERGNT  247

Query  543   GIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFML  364
             GIW LH+D   LA +Y G + S   Y+I G +M  +GP FV++FNPL M+++A++GSF L
Sbjct  248   GIWLLHFDAKLLAVIYGGFV-SCTAYFIMGWLMKRRGPVFVSSFNPLGMVIIAVLGSFFL  306

Query  363   AEQLDFGKIFGAVVIIVGLYLVIWG  289
             AE+L  G+I GAV+I++GLY+V+WG
Sbjct  307   AEKLYLGRIIGAVIIVIGLYMVLWG  331



>ref|XP_008463583.1| PREDICTED: WAT1-related protein At2g39510-like [Cucumis melo]
Length=432

 Score =   370 bits (950),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 238/324 (73%), Gaps = 3/324 (1%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             +  + AKPY G + L+ + A  S+ISK+ALNQGMN  + +VYR  I A+  APFA + +R
Sbjct  67    KIFEKAKPYLGAIALRFASAGMSIISKAALNQGMNQLVTIVYRYSIGAIVVAPFAFVLDR  126

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             KIRP+MT+ IF KI+LL LLEPVI Q+L Y+G KYTTATFATAMCN+LPA  FL+AWI R
Sbjct  127   KIRPKMTLPIFAKILLLGLLEPVIAQSLIYSGTKYTTATFATAMCNILPAFAFLMAWICR  186

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH--VPQTQSIGPATEHD  721
             +EKVNIRSL SQ KI+GT +T+GGAM+MTL++G ++ LPWT+++   P + S  P  +  
Sbjct  187   MEKVNIRSLRSQAKILGTLVTVGGAMMMTLLKGPLLSLPWTNQNNFNPHSYSTLP-NKQQ  245

Query  720   HVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYG  541
              VK A++I     C S F IL A T+++YPA L+LT  IC+AGA++ST+L L  E  N  
Sbjct  246   PVKAAIVITISSICSSAFTILLAHTIRTYPAELTLTTFICLAGAVESTILALAFEWDNPS  305

Query  540   IWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLA  361
              WALH D+  LA +Y GII SG+ YY+ GV++  KGP FVTAFNPLSM++VA++ SF+ A
Sbjct  306   AWALHADSILLAALYGGIISSGIAYYLQGVVVKLKGPVFVTAFNPLSMVIVAVISSFIFA  365

Query  360   EQLDFGKIFGAVVIIVGLYLVIWG  289
             E L  G++ GA VII+GLYLV+WG
Sbjct  366   ETLRLGRVVGAAVIIIGLYLVLWG  389



>gb|KHG24903.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=373

 Score =   368 bits (944),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/317 (56%), Positives = 241/317 (76%), Gaps = 1/317 (0%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KP+F  +FLQ+ YA   ++SK+ALN GM++Y+ VVYR+ IA +  APFA   ++K+RP+M
Sbjct  14    KPFFAAVFLQVGYAGMDILSKTALNLGMSNYVLVVYRHAIATLVMAPFAAFLDKKVRPKM  73

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+ IF++IM+L LLEPVIDQNLY+ GMKYTTATFATAM N+LPAITF++AWI RLEKV +
Sbjct  74    TMRIFIQIMVLGLLEPVIDQNLYFLGMKYTTATFATAMYNILPAITFVMAWIFRLEKVKL  133

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE-HDHVKGAVM  700
             RS+ S GKI+GT  T+ GAM+MTL++G ++ L WT        +    T+ HD +KG V+
Sbjct  134   RSIRSHGKIIGTLATVAGAMVMTLMKGPVLELFWTKGRNNHEAASKNGTDLHDCIKGGVL  193

Query  699   IAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWD  520
             I  GCF ++CF ILQAITL++YPA LSLT  IC+ G L+ T+  L++E+GN  IWA+ WD
Sbjct  194   ITIGCFSYACFVILQAITLETYPADLSLTVWICLLGTLEGTIAALIMEKGNAAIWAIKWD  253

Query  519   TTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGK  340
             T  L   Y GI+ SG+ YYI G+IM  +GP FVTAF+PL M++VAI+ SF+LAEQ+  G+
Sbjct  254   TKLLTAAYTGIVCSGLAYYIQGMIMRHRGPVFVTAFSPLCMVIVAIMSSFILAEQMFLGR  313

Query  339   IFGAVVIIVGLYLVIWG  289
             + GA++IIVGLYLV+WG
Sbjct  314   VIGAIIIIVGLYLVLWG  330



>ref|XP_004493898.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Cicer 
arietinum]
Length=382

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/316 (55%), Positives = 238/316 (75%), Gaps = 0/316 (0%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KP+  V+FLQ  YA   ++SK+ALN+GM++Y+ VVYR+ +A +  APFA++ E+K+RP+M
Sbjct  13    KPFIAVVFLQFGYAGMDVLSKAALNKGMSNYVLVVYRHAVAFIVIAPFALILEKKVRPKM  72

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T +IF+K++ LA+LEPVIDQNLY+ GMKYTTATFA AM NVLPAITF++A IL+LEK+ +
Sbjct  73    TFSIFMKLVTLAVLEPVIDQNLYFLGMKYTTATFAVAMINVLPAITFVMACILKLEKIKM  132

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMI  697
             +S HSQ K+VGT  T+ GAM+MTL++G I+ +        Q Q    A     +KG++MI
Sbjct  133   KSTHSQAKVVGTLATVLGAMVMTLLKGPILNVFGIHGSSTQIQHNAGANLQHPIKGSIMI  192

Query  696   AAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDT  517
               GCF  +CF ILQAITL++YPA LSLT  IC+ G ++  ++ L++ERG   +W+L+WDT
Sbjct  193   TIGCFSCACFMILQAITLETYPAELSLTAWICLLGTVEGGIVALIMERGEPSVWSLNWDT  252

Query  516   TFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKI  337
               LA VY+GI+ SG+ YYI G +M  +GP FVT FNPL M++VAI+GSF LAE++  G++
Sbjct  253   KLLAAVYSGIVCSGMAYYIQGALMRYRGPVFVTTFNPLCMVIVAIMGSFFLAEKIYLGRV  312

Query  336   FGAVVIIVGLYLVIWG  289
              GAVVII GLYLV+WG
Sbjct  313   IGAVVIIFGLYLVVWG  328



>gb|KFK36632.1| hypothetical protein AALP_AA4G149800 [Arabis alpina]
Length=370

 Score =   366 bits (940),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 176/320 (55%), Positives = 238/320 (74%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++ A+P+  ++ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A V  APFA+ F++K+
Sbjct  1     MEKARPFICMVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAIYFDKKV  60

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE
Sbjct  61    RPKMTMMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLE  120

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +VN+R + S GKI+GT  T+GGAMIMTLV+G ++ L WT K V    + G    H  +KG
Sbjct  121   RVNLRCIRSAGKIIGTLATVGGAMIMTLVKGPVLELFWT-KGVSAPNTAGTDI-HSAIKG  178

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV++  GCF ++CF ILQA+TL++YPA LSLT  IC+ G ++ T + LV+E+GN G WA+
Sbjct  179   AVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAI  238

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  L   Y+GI+ S + YY+ GV+M  +GP FVTAF+PL MI+VAI+ + + AEQ+ 
Sbjct  239   GWDTKLLTATYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMY  298

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GA VI  GLYLVIWG
Sbjct  299   LGRVLGAGVICAGLYLVIWG  318



>ref|XP_006294412.1| hypothetical protein CARUB_v10023430mg [Capsella rubella]
 gb|EOA27310.1| hypothetical protein CARUB_v10023430mg [Capsella rubella]
Length=380

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 237/320 (74%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++ A+P+  ++ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A V  APFA  F++K+
Sbjct  10    MEKARPFISMVVLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAFYFDKKV  69

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE
Sbjct  70    RPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLE  129

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +V +R + S GK++GT  T+GGAMIMTLV+G ++ L WT K +    + G    H  +KG
Sbjct  130   RVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWT-KGISSKNTAGTDI-HSAIKG  187

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV++  GCF ++CF ILQA+TL++YPA LSLT  IC+ G L+ TV+ LV+E+GN   WA+
Sbjct  188   AVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTLEGTVVALVMEKGNPSAWAI  247

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  L   Y+GI+ S + YY+ GV+M  +GP FVTAF+PL MI+VAI+ + + AEQ+ 
Sbjct  248   GWDTKLLTSTYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMY  307

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GAVVI  GLYLVIWG
Sbjct  308   LGRVLGAVVICGGLYLVIWG  327



>emb|CDY18444.1| BnaA04g21430D [Brassica napus]
Length=373

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 171/316 (54%), Positives = 233/316 (74%), Gaps = 2/316 (1%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             +P+  ++ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A V  APFA+ F++K+RP+M
Sbjct  10    RPFISMVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFALYFDKKVRPKM  69

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+ IF KI LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE+V +
Sbjct  70    TLMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLERVKL  129

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMI  697
             R + S GK++GT  T+GGAMIMTLV+G ++ L WT   V   Q+      H  +KGAV++
Sbjct  130   RCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWT--KVASAQNTDGTDIHSAIKGAVLV  187

Query  696   AAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDT  517
               GCF ++CF ILQA+TL++YPA LSLT  IC+ G ++ T + LV+E+GN G WA+ WDT
Sbjct  188   TIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAIGWDT  247

Query  516   TFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKI  337
               L   Y+GI+ S + YY+ G++M  +GP FVTAF+PL MI+VAI+ + + AEQ+  G++
Sbjct  248   KLLTSTYSGIVCSAIAYYVGGLVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMYLGRV  307

Query  336   FGAVVIIVGLYLVIWG  289
              GA VI  GLYLVIWG
Sbjct  308   LGAAVICAGLYLVIWG  323



>emb|CDX93378.1| BnaC04g45180D [Brassica napus]
Length=373

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 238/320 (74%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             +  A+P+  ++ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A V  APFA+ F++K+
Sbjct  10    MAKARPFISMVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFALYFDKKV  69

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE
Sbjct  70    RPKMTLMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLE  129

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +V +R + S GK++GT  T+GGAMIMTLV+G ++ L WT K V  TQ+      +  +KG
Sbjct  130   RVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWT-KGV-STQNTDGTDINSAIKG  187

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV++  GCF ++CF ILQA+TL++YPA LSLT  IC+ G ++ T + LV+E+GN G WA+
Sbjct  188   AVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAI  247

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  L   Y+GI+ S + YY+ G++M  +GP FVTAF+PL MI+VAI+ + + AEQ+ 
Sbjct  248   GWDTKLLTSTYSGIVCSAIAYYVGGMVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMY  307

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GAVVI  GLYLVIWG
Sbjct  308   LGRVLGAVVICAGLYLVIWG  327



>ref|XP_008463490.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Cucumis 
melo]
Length=376

 Score =   365 bits (936),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 186/372 (50%), Positives = 249/372 (67%), Gaps = 6/372 (2%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L  A+PY  V+  Q   A   +ISK ALNQG+N ++ VVYR  IA +  APFA +FERK+
Sbjct  8     LSQARPYIAVILQQFITAGMVIISKFALNQGLNQHVLVVYRYTIATIVVAPFAFVFERKV  67

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RPRMT +IF K++LL LLEP +DQNLYY GMKYTTATFA+AM N+ P + FL+AW +RLE
Sbjct  68    RPRMTWSIFGKVVLLGLLEPALDQNLYYTGMKYTTATFASAMTNMTPGLVFLMAWAVRLE  127

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
              V++R L SQ KI+GT + +GGAMIMT VRG I+ LPWT+ ++    S     + D +KG
Sbjct  128   IVDVRQLSSQAKILGTVVAVGGAMIMTTVRGPILNLPWTNHNI-HDHSTTAVNQQDLLKG  186

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             ++MI  GC  WS F +LQAIT+K YPA LSLT LIC  GA+Q++V+   +E      W+L
Sbjct  187   SLMILVGCILWSVFNVLQAITIKVYPAQLSLTTLICFTGAVQASVIAFAMEGHKPAAWSL  246

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
             H D+T LA +Y+GI+ SGV Y I   +M  KGP F + F PLS+++VAI+ SF L+E L 
Sbjct  247   HLDSTLLAPLYSGIMSSGVSYTIQSAVMKTKGPVFSSTFGPLSLVIVAIISSFALSEILY  306

Query  348   FGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKID---  178
              G++ GA VII GLYLV+WGK K  +  K   +      S+ K + +T +S     +   
Sbjct  307   IGRVIGAAVIITGLYLVLWGKIKGQALYKLDSEKMTP--SDQKLTAITDKSKTSDKELGV  364

Query  177   DTIKIRTVDDTV  142
             D  +I+TVDD+V
Sbjct  365   DLARIKTVDDSV  376



>emb|CDP06652.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   363 bits (932),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 164/289 (57%), Positives = 223/289 (77%), Gaps = 0/289 (0%)
 Frame = -2

Query  1155  MNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGM  976
             MN+Y+FVVYR+ IA    APFA++ ++KIRP+M ++IF KI++L+LLEPVIDQNLY+ GM
Sbjct  1     MNNYVFVVYRHAIATALIAPFAIILDKKIRPKMRLSIFAKILVLSLLEPVIDQNLYFLGM  60

Query  975   KYTTATFATAMCNVLPAITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRG  796
             KYTTATFA AM N+LPAITFL+AWI RLEKV ++S++SQ KIVGT  T+GGAM+MTL+RG
Sbjct  61    KYTTATFAAAMSNILPAITFLMAWIFRLEKVKLKSINSQAKIVGTVATVGGAMLMTLLRG  120

Query  795   HIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSL  616
              +I LPWT          G     + +KGA+ I  G F WSCF +LQAITL++YPA LSL
Sbjct  121   PVIKLPWTKGTTSPEHQSGGINLQNSIKGALFITIGYFGWSCFMVLQAITLRAYPAELSL  180

Query  615   TCLICMAGALQSTVLTLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEK  436
             T  IC+ G  +  +L L++ERG   +W+++WDT FLA +Y+G+  SG+ YYI GV+M ++
Sbjct  181   TAWICLLGTAEGAILALIMERGKAAVWSINWDTKFLAALYSGVFCSGLAYYIQGVVMKQR  240

Query  435   GPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             GP FVTAF+PL+M++VA++ SF+L E +D G++ GA+ I+VGLYLV+WG
Sbjct  241   GPVFVTAFSPLNMVIVAVLSSFILHELMDLGRVLGAITIVVGLYLVVWG  289



>ref|XP_010517017.1| PREDICTED: WAT1-related protein At2g37460 [Camelina sativa]
Length=380

 Score =   365 bits (936),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 173/320 (54%), Positives = 237/320 (74%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++ A+P+  ++ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A +  APFA  F++K+
Sbjct  10    MEKARPFISMVVLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATIVMAPFAFYFDKKV  69

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE
Sbjct  70    RPKMTLVIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLE  129

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +V +R + S GK++GT  T+GGAMIMTLV+G ++ L WT K +    + G    H  +KG
Sbjct  130   RVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWT-KGISSKNTDGTDI-HSAIKG  187

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV++  GCF ++CF ILQA+TL++YPA LSLT  IC+ G ++ TV+ LV+E+GN   WA+
Sbjct  188   AVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTVVALVMEKGNPSAWAI  247

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  L   Y+GI+ S + YY+ GV+M  +GP FVTAF+PL MI+VAI+ + + AEQ+ 
Sbjct  248   GWDTKLLTSTYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMY  307

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GAVVI  GLYLVIWG
Sbjct  308   LGRVLGAVVICGGLYLVIWG  327



>ref|NP_181282.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|Q9ZUS1.1|WTR13_ARATH RecName: Full=WAT1-related protein At2g37460 [Arabidopsis thaliana]
 gb|AAC98072.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAK59607.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAK73261.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAL34209.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AEC09403.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=380

 Score =   365 bits (936),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 236/320 (74%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++ A+P+  ++ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A +  APFA  F++K+
Sbjct  10    MEKARPFISMVVLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATIVMAPFAFYFDKKV  69

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE
Sbjct  70    RPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLE  129

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +V +R + S GK+VGT  T+GGAMIMTLV+G ++ L WT K V    + G    H  +KG
Sbjct  130   RVKLRCIRSTGKVVGTLATVGGAMIMTLVKGPVLDLFWT-KGVSAHNTAGTDI-HSAIKG  187

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV++  GCF ++CF ILQAITL++YPA LSLT  IC+ G ++ T + LV+E+GN   WA+
Sbjct  188   AVLVTIGCFSYACFMILQAITLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPSAWAI  247

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  L   Y+GI+ S + YY+ GV+M  +GP FVTAF+PL MI+VAI+ + + AEQ+ 
Sbjct  248   GWDTKLLTATYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMY  307

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GAVVI  GLYLVIWG
Sbjct  308   LGRVLGAVVICAGLYLVIWG  327



>ref|XP_010509331.1| PREDICTED: WAT1-related protein At2g37460-like [Camelina sativa]
Length=380

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/320 (54%), Positives = 237/320 (74%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++ A+P+  ++ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A +  APFA  F++K+
Sbjct  10    MEKARPFISMVVLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATIVMAPFAFYFDKKV  69

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE
Sbjct  70    RPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLE  129

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +V +R + S GK++GT  T+GGAMIMTLV+G ++ L WT K +    + G    H  +KG
Sbjct  130   RVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWT-KGISSKNTDGTDI-HSAIKG  187

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV++  GCF ++CF ILQA+TL++YPA LSLT  IC+ G ++ TV+ LV+E+GN   WA+
Sbjct  188   AVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTVVALVMEKGNPSAWAI  247

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  L   Y+GI+ S + YY+ GV+M  +GP FVTAF+PL MI+VAI+ + + AEQ+ 
Sbjct  248   GWDTKLLTSTYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMY  307

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GAVVI  GLYLVIWG
Sbjct  308   LGRVLGAVVICGGLYLVIWG  327



>ref|XP_007009429.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18239.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=436

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/360 (51%), Positives = 255/360 (71%), Gaps = 11/360 (3%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             E+       A PY  ++F++   A   +++K ALN+GM+ ++ VVYR  IA + FAPFA+
Sbjct  2     EASASMYNKAMPYLAMVFMRFGSAGMPIVAKFALNRGMSQHVLVVYRFAIATLVFAPFAI  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             +F+RK+RP+MT ++F++I+LL LLEP IDQNLYY G+KYTTAT ATA+CNVLPA  FLLA
Sbjct  62    VFDRKVRPKMTFSVFVQILLLGLLEPTIDQNLYYTGIKYTTATVATALCNVLPAFVFLLA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE  727
             W  RLEKV++R LH Q KI+GT  T+GGAMIMTLV G I+ LPWT K   + QS   AT+
Sbjct  122   WACRLEKVDMRKLHCQAKILGTLGTVGGAMIMTLVNGPILPLPWT-KVKNEHQSTVSATK  180

Query  726   HDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
              D +KGA+MI AGC CW+CF ILQAITLKSYPA LSLT L+C  GA++ T++ LV+E GN
Sbjct  181   DDPLKGALMILAGCVCWACFVILQAITLKSYPAELSLTTLVCFMGAIEGTIVALVMEGGN  240

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFM  367
                W++HWD+   A  Y+G+I SGV YY+  +++  KGP F  AFNPL+M++VAI+ SF+
Sbjct  241   AAAWSIHWDSKLFAAAYSGVICSGVAYYVGAMVIQAKGPVFFAAFNPLTMVIVAIMSSFI  300

Query  366   LAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQ  187
              +E +  G++ G +VI+VGLYLV+WG             D +++ S++ ++    +S EQ
Sbjct  301   FSEIMYLGRVIGVIVIVVGLYLVLWG----------KSKDQHSSDSDSNKAAAAPRSGEQ  350


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  495  NGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKIFGAVVII  316
            +G++ SGV YY+  VIM  +GP FVTAFNPL+M++VAI+GSF+L+E L  G++ GA++I+
Sbjct  371  DGVVCSGVAYYLQAVIMKARGPVFVTAFNPLTMVIVAILGSFVLSEVLYLGRVIGAILIV  430

Query  315  VGLYLV  298
             GLYLV
Sbjct  431  TGLYLV  436



>ref|XP_010505334.1| PREDICTED: WAT1-related protein At2g37460-like [Camelina sativa]
Length=380

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/320 (54%), Positives = 237/320 (74%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++ A+P+  ++ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A +  APFA  F++K+
Sbjct  10    MEKARPFISMVVLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATIVMAPFAFYFDKKV  69

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE
Sbjct  70    RPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLE  129

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +V +R + S GK++GT  T+GGAMIMTLV+G ++ L WT K +    + G    H  +KG
Sbjct  130   RVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWT-KGISSKNTDGTDI-HSAIKG  187

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV++  GCF ++CF ILQA+TL++YPA LSLT  IC+ G ++ TV+ LV+E+GN   WA+
Sbjct  188   AVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTVVALVMEKGNPRAWAI  247

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  L   Y+GI+ S + YY+ GV+M  +GP FVTAF+PL MI+VAI+ + + AEQ+ 
Sbjct  248   GWDTKLLTSTYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMY  307

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GAVVI  GLYLVIWG
Sbjct  308   LGRVLGAVVICGGLYLVIWG  327



>emb|CDY07788.1| BnaA03g17230D [Brassica napus]
Length=362

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/320 (54%), Positives = 236/320 (74%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++  +P+  V+ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A +  APFA+ F++K+
Sbjct  10    MEKVRPFILVVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATLVMAPFALYFDKKV  69

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT  IF +I LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE
Sbjct  70    RPKMTFMIFFRITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLE  129

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +V +R + S GK++GT  T+GGAMIMTLV+G ++ L WT K      ++G    H  +KG
Sbjct  130   RVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWT-KGASAPNTVGTDI-HSAIKG  187

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV++  GCF ++CF ILQA TL++YPA LSLT  IC+ G ++  V+ LV+E+GN G WA+
Sbjct  188   AVLVTIGCFSYACFMILQAFTLRTYPAELSLTAWICLMGTIEGAVVALVIEKGNPGAWAI  247

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  +   Y+GI+ SG+ YY+ G++M  KGP FVTAF+PL MI+VAI+ + + AEQ+ 
Sbjct  248   GWDTKLITATYSGIVCSGIGYYVGGIVMKTKGPVFVTAFSPLGMIIVAIMSTIIFAEQMY  307

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GAVVI  GLYLVIWG
Sbjct  308   LGRVLGAVVICAGLYLVIWG  327



>gb|AFK37263.1| unknown [Lotus japonicus]
Length=386

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/327 (54%), Positives = 245/327 (75%), Gaps = 8/327 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             +W   AKP+ GV+F+Q  YA   ++ K+ALN GM++Y+ VVYR+ +A V   PFA++ ++
Sbjct  7     KWFHKAKPFIGVVFIQSGYAGMDVLCKAALNNGMSNYVLVVYRHAVAFVVMVPFALILDK  66

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             KIRP+MT +IF+KI+LL+LLEPVIDQNLYY GMKYTTATFA +M N+LPAITFL+A+IL+
Sbjct  67    KIRPKMTFSIFVKIVLLSLLEPVIDQNLYYLGMKYTTATFAVSMYNILPAITFLMAYILK  126

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT----SKHVPQTQSIGPATE  727
             LEK+ I+S+ SQ K+ GT  T+ GAM+MTL++G  + L  T    S H+   Q  G    
Sbjct  127   LEKIKIKSIRSQAKVFGTLATVAGAMVMTLIKGPELELFGTHGGSSTHI---QHNGGVNL  183

Query  726   HDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
                +KG+VMI  GCF ++ F ILQAITL++YPA LSLT  IC+ G ++  ++ LV+ERGN
Sbjct  184   QHAIKGSVMITIGCFSFAGFMILQAITLEAYPADLSLTAWICLLGTVEGGIVALVMERGN  243

Query  546   YG-IWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSF  370
                +W+L+W+T+ LA VY GI+ SG+ YYI G +M  KGP FVT F+PL MI+VAI+GSF
Sbjct  244   PAPVWSLNWNTSLLAAVYGGIVCSGMTYYIQGAVMKYKGPVFVTTFSPLCMIIVAILGSF  303

Query  369   MLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +LAEQ+  G++ GA+VI++GLYLV+WG
Sbjct  304   ILAEQMYLGRVIGAIVILLGLYLVVWG  330



>ref|XP_009133180.1| PREDICTED: WAT1-related protein At2g37460-like [Brassica rapa]
Length=362

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/320 (54%), Positives = 236/320 (74%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++  +P+  V+ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A +  APFA+ F++K+
Sbjct  10    MEKVRPFILVVLLQVGLAGMDVLSKAVLNKGMSNYVLVVYRHAVATLVMAPFALYFDKKV  69

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT  IF +I LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE
Sbjct  70    RPKMTFMIFFRITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLE  129

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +V +R + S GK++GT  T+GGAMIMTLV+G ++ L WT K      ++G    H  +KG
Sbjct  130   RVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWT-KGASAPNTVGTDI-HSAIKG  187

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV++  GCF ++CF ILQA TL++YPA LSLT  IC+ G ++  V+ LV+E+GN G WA+
Sbjct  188   AVLVTIGCFSYACFMILQAFTLRTYPAELSLTAWICLMGTIEGAVVALVIEKGNPGAWAI  247

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  +   Y+GI+ SG+ YY+ G++M  KGP FVTAF+PL MI+VAI+ + + AEQ+ 
Sbjct  248   GWDTKLITATYSGIVCSGIGYYVGGIVMKTKGPVFVTAFSPLGMIIVAIMSTIIFAEQMY  307

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GAVVI  GLYLVIWG
Sbjct  308   LGRVLGAVVICAGLYLVIWG  327



>ref|XP_010554592.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=378

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/328 (52%), Positives = 232/328 (71%), Gaps = 1/328 (0%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
                FV  LK  KP+  V+FLQ   A  S+I+KSALN GM+ ++ V YR I+A +  +PFA
Sbjct  2     ERGFVGTLKTWKPFLLVIFLQFGSAGLSIIAKSALNNGMSPHVLVSYRYIVATLVISPFA  61

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
                +RK+RP+MT+ +  KI++L LLEP IDQNLYY GM+YT+ATF  AM NVLPA  FL+
Sbjct  62    FFLDRKVRPKMTLPVLFKILMLGLLEPTIDQNLYYTGMRYTSATFTAAMSNVLPAFAFLM  121

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPW-TSKHVPQTQSIGPA  733
             AW+ RLE VNIR    Q KI GT +T+GGAM+MTLVRG ++ LPW T+  +   ++  P 
Sbjct  122   AWLFRLENVNIRKTQGQAKIFGTIVTVGGAMLMTLVRGPLVPLPWNTNPDIIDREAPNPE  181

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
              E+  +KGA++I  G  CW+ F  LQAITLKSYP  LSLT  IC+ GA++ T+   ++ER
Sbjct  182   IENQPLKGAILIVVGSICWAGFINLQAITLKSYPFELSLTAYICLMGAIEGTLAAFLIER  241

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
             GN   W++ +D+  LA VY+G+I SG+ YY+ G+IM  +GP FVTAF+PL M++VAI+GS
Sbjct  242   GNPAAWSVQFDSKLLAAVYSGVICSGIAYYVQGLIMKTRGPVFVTAFSPLKMVIVAILGS  301

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F+LAE    G + GA+VI++GLY V+WG
Sbjct  302   FVLAEVFFLGTVLGAIVIVLGLYSVLWG  329



>emb|CDX79734.1| BnaC03g20700D [Brassica napus]
Length=362

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 233/321 (73%), Gaps = 4/321 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++ A+P   V+ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A +  APFA+ F++K+
Sbjct  10    MEKARPVILVVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATLVMAPFALYFDKKV  69

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT  IF +I LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE
Sbjct  70    RPKMTFMIFFRITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFILAYIFGLE  129

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS-KHVPQTQSIGPATEHDHVK  712
             +V +R + S GK++GT  T+GGAMIMTLV+G ++ L WT     P T        H  +K
Sbjct  130   RVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKGASAPNTAG---TDIHSAIK  186

Query  711   GAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWA  532
             GAV++  GCF ++CF ILQA TL++YPA LSLT  IC+ G ++  V+ LV+E+GN G WA
Sbjct  187   GAVLVTIGCFSYACFMILQAFTLRTYPAELSLTAWICLMGTIEGAVVALVIEKGNPGAWA  246

Query  531   LHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQL  352
             + WDT  +   Y GI+ SG+ YY+ G++M  KGP FVTAF+PL MI+VAI+ + + AEQ+
Sbjct  247   IGWDTKLITATYTGIVCSGIGYYVGGIVMKTKGPVFVTAFSPLGMIIVAIMSTIIFAEQM  306

Query  351   DFGKIFGAVVIIVGLYLVIWG  289
               G++ GAVVI  GLYLVIWG
Sbjct  307   YLGRVLGAVVICAGLYLVIWG  327



>ref|XP_010553301.1| PREDICTED: WAT1-related protein At2g37460-like [Tarenaya hassleriana]
Length=388

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/329 (52%), Positives = 233/329 (71%), Gaps = 0/329 (0%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             MG E     ++ A+PY  V+ LQ+  A   ++SK+ LN GM++Y+ VVYR+++A +   P
Sbjct  1     MGEEKRRECMEKARPYISVVLLQVGLAGMDILSKAVLNIGMSNYVLVVYRHVVATLAILP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA  F++K+R +MT+ +F+ +MLL LLEPVIDQNLYY GMKYTTATFA+AM NVLPAITF
Sbjct  61    FAFYFDKKVRTKMTMRVFINVMLLGLLEPVIDQNLYYLGMKYTTATFASAMYNVLPAITF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             +LA+I RLE+V +R + S  KI+GT  T+ GAM+MTLV+G ++ L WT            
Sbjct  121   VLAYIFRLERVKLRCVRSAAKILGTAATVSGAMMMTLVKGPVLHLFWTKGASTNDGGTAG  180

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
                H  +KGAV+I  GCF ++CF ILQAITLK+YPA LSLT  IC+ G ++ T + LV+E
Sbjct  181   TDIHSAIKGAVLITIGCFSYACFMILQAITLKTYPAELSLTAWICLMGTIEGTAVALVME  240

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             +GN G+W + WDT  L   Y+GI+ S + YYI GV+M  +GP FVTAFNPL M++VA + 
Sbjct  241   KGNPGVWVIGWDTKLLTATYSGIVCSALAYYIGGVVMKSRGPVFVTAFNPLCMVIVAFMS  300

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             S + AEQ+  G++ GA+VI VGLY V+WG
Sbjct  301   SVIFAEQMYLGRVLGALVICVGLYFVLWG  329



>ref|XP_009141663.1| PREDICTED: WAT1-related protein At2g37460 [Brassica rapa]
Length=370

 Score =   362 bits (930),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 171/320 (53%), Positives = 233/320 (73%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++ A+P+  ++ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A V  APFA+ F++K+
Sbjct  10    MEKARPFISMVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFALYFDKKV  69

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP MT+ IF KI LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE
Sbjct  70    RPEMTLMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLE  129

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +V +R + S GK++GT  T+GGAMIMTLV+G ++ L WT   V   Q+      H  +KG
Sbjct  130   RVKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWT--KVASAQNTDGTDIHSAIKG  187

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV++  GCF ++CF ILQA+TL++YPA LSLT  IC+ G ++ T + LV+E+GN G WA+
Sbjct  188   AVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAI  247

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  L   Y+GI+ S + YY+ G +M  + P FVTAF+PL MI+VAI+ + + AEQ+ 
Sbjct  248   GWDTKLLTSTYSGIVCSAIAYYVGGPVMKTRCPVFVTAFSPLCMIIVAIMSTVIFAEQMY  307

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GA VI  GLYLVIWG
Sbjct  308   LGRVLGAAVICAGLYLVIWG  327



>ref|XP_009143490.1| PREDICTED: WAT1-related protein At2g37460-like [Brassica rapa]
 emb|CDX91365.1| BnaC04g07850D [Brassica napus]
 emb|CDX74958.1| BnaA05g07040D [Brassica napus]
Length=380

 Score =   362 bits (930),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 236/320 (74%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++ A+P+  V+ LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A V  APFA  F++K+
Sbjct  10    MEKARPFISVVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAFYFDKKV  69

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT  IF KI LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA++  LE
Sbjct  70    RPKMTWMIFGKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYLFGLE  129

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             +VN+R + S GKI+GT  T+GGAMIMTLV+G ++ L WT K V    + G    H  +KG
Sbjct  130   RVNLRCIRSAGKIIGTLATVGGAMIMTLVKGPVLDLFWT-KGVSAPNTTGTDI-HSAIKG  187

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             AV++  GCF ++CF ILQA+TL++Y A LSLT  IC+ G ++ T + LV+E+GN G WA+
Sbjct  188   AVLVTIGCFSYACFMILQAVTLRTYQAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAI  247

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WDT  L   Y+GI+ S + YY+ G++M  +GP FVTAF+PL MI+VAI+ + + AEQ+ 
Sbjct  248   GWDTELLTAAYSGIVCSAIAYYVGGMVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMY  307

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GAVVI  GLYLVIWG
Sbjct  308   LGRVLGAVVICAGLYLVIWG  327



>ref|XP_007144467.1| hypothetical protein PHAVU_007G158600g [Phaseolus vulgaris]
 gb|ESW16461.1| hypothetical protein PHAVU_007G158600g [Phaseolus vulgaris]
Length=377

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 177/330 (54%), Positives = 243/330 (74%), Gaps = 5/330 (2%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M N+    W + AKP   V+ +Q  YA   +ISK+A+N+GM++Y+FVVYR+ +A    AP
Sbjct  1     MENQQKQSWFEKAKPLAAVVSIQFGYALMDIISKAAMNKGMSNYVFVVYRHAVAFFVMAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
              A  FERK++ +MT++IF+KI++L+LLEPVIDQNLY+ GMKYTTATFA  M N+LPAITF
Sbjct  61    LAWFFERKVKQKMTLSIFMKILVLSLLEPVIDQNLYFLGMKYTTATFAVTMTNMLPAITF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHII-GLPWTSKHVPQTQSIG  739
             + A ILRLEK+NIRS+ SQ K+VGT  T+ GAMIMTL++G ++ G   ++ H   +Q+ G
Sbjct  121   VFACILRLEKINIRSIRSQAKVVGTVATVSGAMIMTLIKGPVLFGSHVSNAH---SQNNG  177

Query  738   PATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
              +T+H  + G VMI  GCFCW+ F ILQAITLK+YPA LSL+  IC+ G ++   + LV+
Sbjct  178   TSTQHS-MTGFVMITIGCFCWASFMILQAITLKTYPAALSLSAWICLMGTIEGAAVALVM  236

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             ERG+  +W+L +D   L  VY GI  SGV YY+ GV+M  +GP FVTAF+PL MI+VAI+
Sbjct  237   ERGHPSVWSLKFDMRLLCAVYAGITCSGVGYYLQGVVMKSRGPVFVTAFSPLCMIIVAIM  296

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             G F+LAEQ+  G++ GA++I +GLY V+WG
Sbjct  297   GFFILAEQVFLGRMIGAIIICLGLYSVVWG  326



>gb|KDP35589.1| hypothetical protein JCGZ_09027 [Jatropha curcas]
Length=375

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/322 (52%), Positives = 240/322 (75%), Gaps = 8/322 (2%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KP+  V+F+Q+  A   ++SK+ALN GM++Y+ VVYR+ +A +  APFA   ++K+RP+M
Sbjct  13    KPFIAVIFMQIGLAGMDVMSKAALNGGMSNYVLVVYRHAVATIVIAPFAFFLDKKVRPKM  72

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T +IF+KI++L+LLEPVIDQNLY+ GMKYTTATFA A+ N+LPAITF++A I+RLEKV +
Sbjct  73    TRSIFIKILVLSLLEPVIDQNLYFLGMKYTTATFAAAIINILPAITFVMACIVRLEKVKM  132

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSK------HVPQTQSIGPATEHDHV  715
              SLHSQ K+VGT  T+ GAM+MT+V+G  + L  ++K      H  QT        H+ +
Sbjct  133   TSLHSQAKVVGTIATVAGAMVMTVVKGPPVDLFNSTKGMRIYHHNQQTSD--DVNLHNSI  190

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             KGA+MI  GCF W+CF ILQAITLK+YPA LSLT  IC+ G ++ +++ LV+ERGN  +W
Sbjct  191   KGALMITIGCFGWACFVILQAITLKTYPAELSLTAWICLFGTIEGSIVALVMERGNPSVW  250

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
             +L+ D      VY+G++ SG  YYI GV+M ++GP FVTAF+PL M++VA++ S +LAEQ
Sbjct  251   SLNLDIKLATAVYSGVVCSGFAYYIQGVVMKDRGPVFVTAFSPLCMVIVAVMSSIILAEQ  310

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G++ GA++I+ GLYLV+WG
Sbjct  311   MFLGRVIGAIIIVGGLYLVVWG  332



>gb|AAM62850.1| nodulin-like protein [Arabidopsis thaliana]
Length=362

 Score =   357 bits (915),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 228/308 (74%), Gaps = 2/308 (1%)
 Frame = -2

Query  1212  LQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRMTITIFLKI  1033
             LQ+  A   ++SK+ LN+GM++Y+ VVYR+ +A +  APFA  F++K+RP+MT+ IF KI
Sbjct  4     LQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATIVMAPFAFYFDKKVRPKMTLMIFFKI  63

Query  1032  MLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNIRSLHSQGK  853
              LL LLEPVIDQNLYY GMKYTTATFATAM NVLPAITF+LA+I  LE+V +R + S GK
Sbjct  64    SLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLERVKLRCIRSTGK  123

Query  852   IVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMIAAGCFCWS  673
             +VGT  T+GGAMIMTLV+G ++ L WT K V    + G    H  +KGAV++  GCF ++
Sbjct  124   VVGTLATVGGAMIMTLVKGPVLDLFWT-KGVSAHNTAGTDI-HSAIKGAVLVTIGCFSYA  181

Query  672   CFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDTTFLAYVYN  493
             CF ILQAITL++YPA LSLT  IC+ G ++ T + LV+E+GN   WA+ WDT  L   Y+
Sbjct  182   CFMILQAITLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPSAWAIGWDTKLLTATYS  241

Query  492   GIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKIFGAVVIIV  313
             GI+ S + YY+ GV+M  +GP FVTAF+PL MI+VAI+ + + AEQ+  G++ GAVVI  
Sbjct  242   GIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMYLGRVLGAVVICA  301

Query  312   GLYLVIWG  289
             GLYLVIWG
Sbjct  302   GLYLVIWG  309



>ref|XP_004167845.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=347

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/302 (57%), Positives = 225/302 (75%), Gaps = 3/302 (1%)
 Frame = -2

Query  1188  SLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRMTITIFLKIMLLALLEP  1009
             S+ISK+ALNQGMN  + +VYR  I A+  APFA + +RKIRP+MT+ IF KI+LL LLEP
Sbjct  2     SIISKAALNQGMNQLVTIVYRYSIGAIVVAPFAFVLDRKIRPKMTLPIFAKILLLGLLEP  61

Query  1008  VIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNIRSLHSQGKIVGTTLTI  829
             VI Q+L Y+G KYTTATFATAMCN+LPA  FL+AWI R+EKVNIRSL SQ KI+GT +T+
Sbjct  62    VIAQSLIYSGTKYTTATFATAMCNILPAFAFLMAWICRMEKVNIRSLRSQAKILGTLVTV  121

Query  828   GGAMIMTLVRGHIIGLPWTSKH--VPQTQSIGPATEHDHVKGAVMIAAGCFCWSCFYILQ  655
             GGAM+MTL++G ++ LPWT+++   P + S  P  +   VK A++I     C S F IL 
Sbjct  122   GGAMMMTLLKGPLLSLPWTNQNNLNPHSYSTLP-NKQQPVKAAIVITISSICSSAFTILL  180

Query  654   AITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDTTFLAYVYNGIIRSG  475
             A T+++YPA L+LT  IC+AGA++ST+L L  E  N   W LH D+  LA +Y GII SG
Sbjct  181   AHTIRTYPAELTLTTFICLAGAVESTILALAFEWDNPSAWVLHADSILLAALYGGIISSG  240

Query  474   VVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVI  295
             + YY+ GV++  KGP FVTAFNPLSM++VAI+ SF+ AE L  G++ GA VII+GLYLV+
Sbjct  241   IAYYLQGVVVKLKGPVFVTAFNPLSMVIVAIISSFIFAETLRLGRVIGAAVIIIGLYLVL  300

Query  294   WG  289
             WG
Sbjct  301   WG  302



>emb|CDX75163.1| BnaC09g25190D [Brassica napus]
Length=384

 Score =   355 bits (911),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/363 (48%), Positives = 256/363 (71%), Gaps = 6/363 (2%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             +K+ +P+  ++FLQ   A + ++  + LNQG N Y+ +VYRN +AA+   PFA+  ERK+
Sbjct  8     IKNFRPFLLMIFLQFGAAGTYIVIMATLNQGQNRYVLIVYRNAVAALVLGPFAIFCERKV  67

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+++FLKI+LL  LEP++DQ   Y GM  T+AT+ +A+ NVLP++TF++AWILR+E
Sbjct  68    RPKMTLSVFLKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWILRME  127

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQS-IGPATEHDH-V  715
             KVNI  + SQ KI+GT + +GGA++MTL +G +I LPW++ +  Q       + +H+H V
Sbjct  128   KVNIAEVRSQAKIIGTLVALGGALVMTLYKGPLIPLPWSNPNTNQHNGHSNSSQDHNHWV  187

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
              G ++I  GC  WSCFY+LQ+IT+K+YPA LSL+ LIC++GA+QSTV+ LVVER + G W
Sbjct  188   GGTLLILLGCVAWSCFYVLQSITIKTYPADLSLSALICLSGAVQSTVVALVVERHSRG-W  246

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
             A+ WD   LA +Y GI+ SG+ YY+ G++M  +GP FVTAFNPL MI+VA++ SF+L EQ
Sbjct  247   AVGWDARLLAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFILHEQ  306

Query  354   LDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKIDD  175
             + +G + G  VI +GLYLV+WGK KD   S  +  + N   S  +    T+ + + K+D 
Sbjct  307   IHYGCVIGGTVIAMGLYLVVWGKGKDYDVSVLAMLEKN---SLQELPFRTQVNNDDKLDS  363

Query  174   TIK  166
             +I 
Sbjct  364   SID  366



>ref|XP_010421738.1| PREDICTED: WAT1-related protein At4g08290 [Camelina sativa]
Length=386

 Score =   355 bits (910),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 172/366 (47%), Positives = 252/366 (69%), Gaps = 12/366 (3%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++  +PYF ++FLQ   A + ++  + LNQG N Y+F+VYRN++AA+  APFA++FERK+
Sbjct  8     MQKCRPYFLMIFLQFGAAGAYIVIMATLNQGQNRYVFIVYRNLVAALVLAPFALIFERKV  67

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT ++F KIM L  LEPV+DQ   Y GM  T+AT+A+A+ N+LP++TF++AWILR+E
Sbjct  68    RPKMTFSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYASAIMNILPSVTFIIAWILRME  127

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQS-IGPATEHDH-V  715
             KVNI  + S+ KI+GT + +GGA++MTL +G +I LPW++  + Q       + +H H V
Sbjct  128   KVNIAEVRSKAKIIGTLIGVGGALVMTLYKGPLIPLPWSNPSMDQQNGHTNSSQDHSHWV  187

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
              G +++  GC  WS FY+LQ+IT+K+YPA LSL+ LIC+AGA+QS  + LVVER   G W
Sbjct  188   VGTLLLLIGCVAWSGFYVLQSITIKTYPANLSLSSLICLAGAVQSFAVALVVERHPSG-W  246

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
             A+ WD      +Y GI+ SG+ YY+ G++MN +GP FVTAFNPL M++VA++ SF+L EQ
Sbjct  247   AVGWDARLYGPLYTGIVSSGITYYVQGMVMNTRGPVFVTAFNPLCMVLVALLASFILHEQ  306

Query  354   LDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKIDD  175
             + FG + G VVI  GLY+V+WGK KD            + L N ++S L +     K DD
Sbjct  307   IHFGCVIGGVVIAAGLYMVVWGKGKDYEV---------SGLDNLEKSSLHELPITTKGDD  357

Query  174   TIKIRT  157
               ++ +
Sbjct  358   DTRLAS  363



>ref|XP_007009431.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18241.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=361

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/329 (52%), Positives = 239/329 (73%), Gaps = 4/329 (1%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
               S  +   +AKP+  V+ +Q  YA  S+I+K ALNQGM+ ++ V YR  +A+   APFA
Sbjct  2     ESSLPQLFNNAKPFLAVILVQFGYAVMSIIAKFALNQGMSPHVLVAYRMAVASALIAPFA  61

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             ++ ERK RP+MT+TIF KIML++L EPV+D NLYY G+KYTTATF TAMCN+LP  TF +
Sbjct  62    IVLERKSRPKMTLTIFAKIMLISLFEPVLDHNLYYTGLKYTTATFTTAMCNMLPTFTFAM  121

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS--KHVPQTQSIGP  736
             A I +LE+V IR +HSQ K+VGT +T+GGAM+MTL++G ++ LPWT    H+ Q+ + G 
Sbjct  122   ACIFKLERVEIRRVHSQAKVVGTMVTVGGAMVMTLIKGPVLELPWTKGRNHLDQSGASG-  180

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
               EHD +KG +M+ AGC CWSCF I QA+ LKSYPA LSL  LIC  G ++ T+L   VE
Sbjct  181   GHEHDLMKGTLMLMAGCCCWSCFIISQAVILKSYPAKLSLAALICTMGTVEGTILAFAVE  240

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
               N  +W  H D+ F+A +Y G+I +  V  + G +M ++GP FV+AFNPLS+++VAI+G
Sbjct  241   WRNTSVWLFHLDSKFIAAIYGGMISAFAVTTL-GSVMKKRGPVFVSAFNPLSLVIVAILG  299

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             SF+LAE++  G++ G+++I++GLYLV+WG
Sbjct  300   SFLLAEEICLGRVIGSIIIVIGLYLVLWG  328



>ref|XP_008233582.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Prunus 
mume]
Length=321

 Score =   352 bits (902),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 227/318 (71%), Gaps = 24/318 (8%)
 Frame = -2

Query  1239  AKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPR  1060
             AKP+  V  +Q  YA  S+ISK ALN+GM+ ++ VVYR+ +A VF APFA++F+R     
Sbjct  8     AKPFVAVTLMQFGYAGMSIISKFALNRGMSQHVLVVYRHAVATVFIAPFAIVFDR-----  62

Query  1059  MTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVN  880
                             PVIDQNL+Y GMK TTATF +AMCNVLPA  F++AWI RLE +N
Sbjct  63    ----------------PVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIFRLENIN  106

Query  879   IRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEH-DHVKGAV  703
              RSL S  KI+GT +T+GGAM+MTL+ G ++ LPWT +++ Q  +   AT+H D +KG +
Sbjct  107   FRSLRSLAKILGTIVTVGGAMLMTLINGPMLNLPWTRRNIHQEST--SATDHQDPIKGTL  164

Query  702   MIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHW  523
             +I AGCFCW+ F  LQAITLKSYPA LSL   IC+ G +Q TV+ L  E  N   W++HW
Sbjct  165   LIGAGCFCWAGFVNLQAITLKSYPAELSLAAWICLMGTVQGTVVALGFEWDNPAAWSIHW  224

Query  522   DTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFG  343
             D+  LA VY+GII SGVVYY+ G++M E+GP FVTAF+PLSMI+VA++ SFMLAE +  G
Sbjct  225   DSKLLAAVYSGIICSGVVYYVQGLVMKERGPVFVTAFSPLSMIIVAVMSSFMLAEIMYLG  284

Query  342   KIFGAVVIIVGLYLVIWG  289
             ++ GA+VI++GLY+V+WG
Sbjct  285   RVIGAMVIVIGLYMVLWG  302



>ref|XP_009151422.1| PREDICTED: WAT1-related protein At4g08290 [Brassica rapa]
Length=383

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/363 (47%), Positives = 256/363 (71%), Gaps = 7/363 (2%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             +K+ +P+  ++FLQ   A + ++  + LNQG N Y+ +VYRN +AA+  APFA+ FERK+
Sbjct  8     IKNFRPFLLMIFLQFGGAGTYIVIMATLNQGQNRYVLIVYRNAVAALVLAPFAIFFERKV  67

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+++F KI+LL  LEP++DQ   Y GM  T+AT+ +A+ NVLP++TF++AWILR+E
Sbjct  68    RPKMTLSVFWKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWILRME  127

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQ-TQSIGPATEHDH-V  715
             KVNI  + SQ KI+GT + +GGA++MTL +G +I L W++ +  Q  +    + +H+H V
Sbjct  128   KVNIAEVRSQAKIIGTLVALGGALVMTLYKGPLIPLQWSNPNTNQHNEHSNSSQDHNHWV  187

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
              G ++I  GC  WSCFY+LQ+IT+++YPA LSL+ LIC++GA+QSTV+ LVVER + G W
Sbjct  188   GGTLLILLGCVAWSCFYVLQSITIRTYPADLSLSALICLSGAVQSTVVALVVERHSRG-W  246

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
             A+ WD   LA +Y GI+ SG+ YY+ G++M  +GP FVTAFNPL MI+VA++ SF+L EQ
Sbjct  247   AVGWDARLLAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFILHEQ  306

Query  354   LDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKIDD  175
             + +G + G  VI +GLYLV+WGK KD   S  +  + N+     +E  +  Q    K+D 
Sbjct  307   IHYGCVIGGTVIAMGLYLVVWGKGKDYDVSVLAMPEKNSL----QELPIRTQVNNDKLDS  362

Query  174   TIK  166
             +I 
Sbjct  363   SID  365



>emb|CDY29141.1| BnaA09g53940D [Brassica napus]
Length=383

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/363 (48%), Positives = 256/363 (71%), Gaps = 7/363 (2%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             +K+ +P+  ++FLQ   A + ++  + LNQG N Y+ +VYRN +AA+  APFA+ FERK+
Sbjct  8     IKNFRPFLLMIFLQFGGAGTYIVIMATLNQGQNRYVLIVYRNAVAALVLAPFAIFFERKV  67

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+++F KI+LL  LEP++DQ   Y GM  T+AT+ +A+ NVLP++TF++AWILR+E
Sbjct  68    RPKMTLSVFWKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWILRME  127

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQ-TQSIGPATEHDH-V  715
             KVNI  + SQ KI+GT + +GGA++MTL +G +I L W++ +  Q  +    + +H+H V
Sbjct  128   KVNIAEVRSQAKIIGTLVALGGALVMTLYKGPLIPLQWSNPNTNQHNEHSNSSQDHNHWV  187

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
              G ++I  GC  WSCFY+LQ+IT+K+YPA LSL+ LIC++GA+QSTV+ LVVER + G W
Sbjct  188   GGTLLILLGCVAWSCFYVLQSITIKTYPADLSLSALICLSGAVQSTVVALVVERHSRG-W  246

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
             A+ WD   LA +Y GI+ SG+ YY+ G++M  +GP FVTAFNPL MI+VA++ SF+L EQ
Sbjct  247   AVGWDARLLAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFILHEQ  306

Query  354   LDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKIDD  175
             + +G + G  VI +GLYLV+WGK KD   S  +  + N+     +E  +  Q    K+D 
Sbjct  307   IHYGCVIGGTVIAMGLYLVVWGKGKDYDVSVLAMPEKNSL----QELPIRIQVNNDKLDS  362

Query  174   TIK  166
             +I 
Sbjct  363   SID  365



>ref|XP_009614497.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Nicotiana 
tomentosiformis]
Length=358

 Score =   353 bits (905),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/369 (49%), Positives = 249/369 (67%), Gaps = 43/369 (12%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
              E F+R    +KP+  V+FLQ   A   +++K ALN+GM++Y+FVVYR+ +A +  APFA
Sbjct  5     RELFIR----SKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFA  60

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             M+ ++                     PVIDQNLY  G+KYTTATFA AMCN+LPAITF++
Sbjct  61    MILDK---------------------PVIDQNLYSIGLKYTTATFAAAMCNILPAITFIM  99

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT---SKHVPQTQSIG  739
             AWI RLE+V + S+ SQ KI+GT  T+ GAMIMTLVRG +I L WT   S H  ++QS G
Sbjct  100   AWIFRLERVKLTSIRSQAKIIGTIATVAGAMIMTLVRGPVIELFWTKGNSSH--ESQSGG  157

Query  738   PATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
                 H  +KG+++I  GCF W+ F ILQAITL++YPA LSLT  IC+ G  +  ++ +V+
Sbjct  158   LNLSH-AIKGSLLITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVM  216

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             ERG   +WA+ WDT FLA VY+GI  SG+ YYI GVIM ++GP FVTAFNPLSM++VAI+
Sbjct  217   ERGKAAVWAIKWDTKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAIL  276

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQ  199
              SF+L EQ++ G++ GAVVI++GLY+V+WG           +  D  + S ++++I T++
Sbjct  277   SSFILREQMNLGRVLGAVVIVLGLYIVLWG-----------KSKDQKSPSTDEQAIPTQE  325

Query  198   SA-EQKIDD  175
             +  E KID 
Sbjct  326   TTHENKIDK  334



>ref|XP_009778858.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Nicotiana 
sylvestris]
Length=358

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/369 (49%), Positives = 250/369 (68%), Gaps = 43/369 (12%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
             +E F+R    +KP+  V+FLQ   A   +++K ALN+GM++Y+FVVYR+ +A +  APFA
Sbjct  5     SELFIR----SKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFA  60

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             ++ ++                     PVIDQNLY  G+KYTTATFA AMCN+LPAITF++
Sbjct  61    IILDK---------------------PVIDQNLYSIGLKYTTATFAAAMCNILPAITFIM  99

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT---SKHVPQTQSIG  739
             AWI RLE+V + S+ SQ KI+GT  T+ GAMIMTLVRG +I L WT   S H  ++QS G
Sbjct  100   AWIFRLERVKLTSIRSQAKIIGTVATVAGAMIMTLVRGPVIELFWTKGNSSH--ESQSGG  157

Query  738   PATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
                 H  +KG++MI  GCF W+ F ILQAITL++YPA LSLT  IC+ G  +  ++ +V+
Sbjct  158   LNLSH-AIKGSLMITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVM  216

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             ERG   +WA+ WDT FLA VY+GI  SG+ YYI GVIM ++GP FVTAFNPLSM++VAI+
Sbjct  217   ERGKAAVWAIKWDTKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAIL  276

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQ  199
              SF+L EQ++ G++ GAVVI++GLY+V+WG           +  D  + S ++++I T++
Sbjct  277   SSFILREQMNLGRVLGAVVIVLGLYIVLWG-----------KSKDQKSPSADEQAIPTQE  325

Query  198   SA-EQKIDD  175
             +  E KID 
Sbjct  326   TTHENKIDK  334



>ref|XP_006436051.1| hypothetical protein CICLE_v10033577mg, partial [Citrus clementina]
 gb|ESR49291.1| hypothetical protein CICLE_v10033577mg, partial [Citrus clementina]
Length=339

 Score =   350 bits (898),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 236/332 (71%), Gaps = 4/332 (1%)
 Frame = -2

Query  1275  MGNESFVRWLKH-AKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFA  1099
             M N S  ++L H AKPY GV+F+Q   +  S+I+K AL QGM+ ++ V YR ++A    A
Sbjct  1     MSNCSSTQFLSHHAKPYLGVIFMQFCSSIMSIITKIALTQGMSQHVLVAYRMVVATSLIA  60

Query  1098  PFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAIT  919
             PFA++ ERK RP+MT  IF KI LL L EPVI QNLY+ G+K +TATF  AMCN+LPA+T
Sbjct  61    PFAIVLERKTRPKMTFRIFAKIALLGLFEPVIGQNLYFTGLKCSTATFTVAMCNILPALT  120

Query  918   FLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQ-SI  742
             FL+AWI RLEKV  +S+ SQ KI+GT +T GGAM MTL++G I+  PW    +   Q   
Sbjct  121   FLMAWIFRLEKVKTKSMRSQAKILGTIVTAGGAMCMTLLKGPILEFPWKQVRILHNQLET  180

Query  741   GPATEHDHV-KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTL  565
             G   + +H+ KGA+MIAA CF WSCF ILQA  LKSYPA LSLT L+C   +++ T+L L
Sbjct  181   GTHNKEEHMTKGALMIAAACFSWSCFIILQAFLLKSYPAELSLTALMCFVSSVEGTILAL  240

Query  564   VVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVA  385
              +E+GN GIW LH+D   L+ +Y G + S   Y+I G +M  KGP FV++FNPLSM+++A
Sbjct  241   AIEQGNTGIWLLHFDAKLLSVLYGGFV-SCTAYFIMGWLMKRKGPVFVSSFNPLSMVIIA  299

Query  384   IVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             I+GSF +AE+L  G+I G +VI++GLY+V+WG
Sbjct  300   ILGSFFIAEELFLGRIVGGIVIVIGLYMVLWG  331



>ref|XP_006486497.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
Length=341

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/320 (54%), Positives = 230/320 (72%), Gaps = 3/320 (1%)
 Frame = -2

Query  1242  HAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRP  1063
             HAKPY GV+F+Q   +  S+I+K AL QGM+ ++ V YR ++A    APFA++ ERK RP
Sbjct  14    HAKPYLGVIFMQFCSSIMSIITKIALTQGMSQHVLVAYRMVVATSLIAPFAIVLERKTRP  73

Query  1062  RMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKV  883
             +MT  IF KI LL L EPVI QNLY+ G+K +TATF  AMCN+LPA+TFL+AWI RLEKV
Sbjct  74    KMTFRIFAKIALLGLFEPVIGQNLYFTGLKCSTATFTVAMCNILPALTFLMAWIFRLEKV  133

Query  882   NIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQ-SIGPATEHDHV-KG  709
               +S+ SQ KI+GT +T GGAM MTL++G I+  PW    +   Q   G   + +H+ KG
Sbjct  134   KTKSMRSQAKILGTIVTAGGAMCMTLLKGPILEFPWKQVRILHNQLETGTHNKEEHMTKG  193

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A+MIAA CF WSCF ILQA  LKSYPA LSLT L+C   +++ T+L L +E+GN GIW L
Sbjct  194   ALMIAAACFSWSCFIILQAFLLKSYPAELSLTALMCFVSSVEGTILALAIEQGNTGIWLL  253

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
             H+D   L+ +Y G + S   Y+I G +M  KGP FV++FNPLSM+++AI+GSF +AE+L 
Sbjct  254   HFDAKLLSVLYGGFV-SCTAYFIMGWLMKRKGPVFVSSFNPLSMVIIAILGSFFIAEELF  312

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G+I G +VI++GLY+V+WG
Sbjct  313   LGRIVGGIVIVIGLYMVLWG  332



>ref|XP_004494995.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Cicer 
arietinum]
Length=314

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/315 (52%), Positives = 231/315 (73%), Gaps = 2/315 (1%)
 Frame = -2

Query  1284  TTIMGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVF  1105
             T +M  +     ++   P+  VLFLQ  YA   ++SK+ALN+GM++Y+FVVYR+ +A + 
Sbjct  2     TIMMERQHRRNCIEKIMPFIAVLFLQFGYAVMDVLSKAALNKGMSNYVFVVYRHAVAFIV  61

Query  1104  FAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPA  925
               PFA+ F++K+RP+MTI+IF+KI+ L+LLEPVIDQNLY+ GMK+TTATFA +M N+LPA
Sbjct  62    VTPFALYFDKKVRPKMTISIFIKIVALSLLEPVIDQNLYFLGMKFTTATFAASMSNILPA  121

Query  924   ITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQS  745
             ITF+LA ILR+EK+ IRS+ +Q K+VGT  T+ GAM+MTL++G ++   + S       S
Sbjct  122   ITFILASILRIEKIKIRSIRTQAKVVGTIATVSGAMVMTLIKGPVLFGTFGSDSQNHHNS  181

Query  744   IGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTL  565
              G +T+H  + GAVMI  GCF W+CF ILQAITL++YPA LSL+  IC+ G L+   + L
Sbjct  182   -GISTQHT-IIGAVMITLGCFSWACFIILQAITLETYPAALSLSSWICLLGTLEGAAVAL  239

Query  564   VVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVA  385
             VVERGNY +W++ WD   L+ +Y GI  SG+ YY+ GV+M  +GP FVT FNPL M++VA
Sbjct  240   VVERGNYSVWSIKWDVRLLSAIYTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPLCMVIVA  299

Query  384   IVGSFMLAEQLDFGK  340
             I+G F+LAEQ+  G+
Sbjct  300   IMGYFILAEQMFLGR  314



>gb|KHG03072.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=391

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 231/328 (70%), Gaps = 3/328 (1%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ES+ +   H KP+  ++ +Q SYA  S+I+K ALNQGM+ ++ V YR  +AAV   PFA+
Sbjct  2     ESWTQLFNHGKPFLAMILMQSSYAVMSIIAKYALNQGMSPHVLVAYRLAVAAVIITPFAI  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             + ERK RP+MT  IF+KIML++LLEPV+D N +Y GMKYTTATF TAMCN+LPA+TF LA
Sbjct  62    VLERKTRPKMTFNIFIKIMLISLLEPVLDHNFFYTGMKYTTATFTTAMCNILPALTFALA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS--KHVPQTQSIGPA  733
              I++LE+V    + SQ K+ GT + +GGAMIMTL++G ++ LPWT    H         A
Sbjct  122   CIVKLERVETGKVRSQAKVAGTAVAVGGAMIMTLIKGPVLELPWTKGRNHYLGQHGASGA  181

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
              + D V GA+++ AGC CW+CF I QA  LKSYPA LSLT LIC+ G  + T+L   VE 
Sbjct  182   HKQDMVMGALLLLAGCCCWACFVISQARILKSYPAKLSLTALICIMGTFEGTILAFAVEW  241

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
              N  +W + +D+  +A +Y G++ +  +Y + G +M  +GP FV+AFNPLSM++VAI+GS
Sbjct  242   RNPSVWLIGFDSKLIASLYGGLVTAFALYAM-GSVMKRRGPVFVSAFNPLSMVIVAILGS  300

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F LAE +  G++ G++VI++GLYLV+WG
Sbjct  301   FFLAEDMYLGRVLGSIVIVIGLYLVLWG  328



>gb|EMS60728.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=389

 Score =   350 bits (898),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 224/322 (70%), Gaps = 0/322 (0%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R L   KPY  ++ LQ+ +A  ++++ S+L  GM+H++ VVYRNI+A  F APFA+ FER
Sbjct  6     RVLNDVKPYLAMVLLQVGFAGMNIVAVSSLKAGMSHFVLVVYRNIVATAFMAPFALYFER  65

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             + RP+MT TIF+KIM LA LEPV+DQNLY+ G K T+A FATA+ N LPA+TF+LA ILR
Sbjct  66    ERRPKMTTTIFIKIMWLAFLEPVLDQNLYFMGAKLTSAGFATALLNTLPAVTFVLALILR  125

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHV  715
             +EKV +RSLHSQ KI GT L + GA++M L  G ++  PWTS H   T     A   D +
Sbjct  126   MEKVRLRSLHSQAKIAGTVLAVAGAVLMVLYHGPVVRFPWTSGHHDATIGGQVAAARDWL  185

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
              G VM+ A C  W  F+ILQA TL SYPA LSLT LIC  G+L S  + LV ER +  +W
Sbjct  186   IGTVMLIASCMIWPGFFILQANTLGSYPAELSLTALICGMGSLMSGAIALVAERADTQVW  245

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              + +D+  L  VY GI+ SGV YY+ GV+  ++GP FVTAF+PLSMI+ A++GS +L E+
Sbjct  246   VVGFDSRLLTVVYAGIVCSGVAYYLQGVVSRQRGPVFVTAFSPLSMIITAVMGSIILKEE  305

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G + GAV+I+ GLY +IWG
Sbjct  306   ITLGSVIGAVIIVTGLYFIIWG  327



>ref|XP_010534299.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=386

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 175/373 (47%), Positives = 244/373 (65%), Gaps = 14/373 (4%)
 Frame = -2

Query  1251  WLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERK  1072
             W +   P   V+ LQ  YA  S+ +  AL QGM+ ++ +VYR+ IA +F  PFA+ F+RK
Sbjct  2     WREWKAP-MAVILLQFGYAGLSITANFALRQGMSPHVLIVYRHAIATLFITPFALFFDRK  60

Query  1071  IRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRL  892
             +RP+MT  IF+KI+ L LLEP I QNL+Y GMKYT+ TF +AM NVLPA  FL+AWI RL
Sbjct  61    VRPKMTWPIFIKIVFLGLLEPTIGQNLFYTGMKYTSPTFTSAMSNVLPAFAFLMAWIFRL  120

Query  891   EKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH-----------VPQTQS  745
             EKV+IR +HSQ  I+GT +T+GGAM M LV+G  + +PW   H             Q+  
Sbjct  121   EKVDIRRVHSQAMIMGTIVTVGGAMAMALVKGPSMDIPWVHNHHKIHDMYLNLLQQQSHQ  180

Query  744   IGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTL  565
                 T HD  KGA+ +A+GC CW+ F  LQA+TLK+YPA LSL   IC  GA + ++  L
Sbjct  181   TKSTTSHDPTKGALFVASGCLCWAAFTTLQALTLKAYPAVLSLAAWICFIGATEGSIAAL  240

Query  564   VVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVA  385
             V+ER N   W+LH D    A VY+G+I SGV YY+ G+IM +KGP FVTAFNPLSM++V 
Sbjct  241   VMERHNISAWSLHIDIKLFAAVYSGVICSGVGYYVQGMIMRKKGPVFVTAFNPLSMVIVT  300

Query  384   IVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILT  205
             I+ S +  E +  G++ G+++I+VGLYLV+WGKSKD + +  + D +  A + ++  I  
Sbjct  301   IISSLVFHEGIHLGRVTGSILIVVGLYLVLWGKSKDQTEALPNSDIEKTAATKHRNKIYN  360

Query  204   KQSAEQKIDDTIK  166
             +   E++ D+  +
Sbjct  361   EN--EERSDEETR  371



>ref|XP_002312070.1| hypothetical protein POPTR_0008s05130g [Populus trichocarpa]
 gb|EEE89437.1| hypothetical protein POPTR_0008s05130g [Populus trichocarpa]
Length=368

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/326 (51%), Positives = 232/326 (71%), Gaps = 1/326 (0%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ESF+     A+ Y  V+F+Q  Y+  S+++K ALN GM  ++ V YR  +A++ F PFA+
Sbjct  2     ESFISLYNQARAYLLVIFVQFGYSVMSILAKLALNLGMKPHVLVAYRMAVASILFTPFAL  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             + ER  RP+MT  +F KI LL+  EPV+DQNL+YAGMK TT TF  AMCN+LPA+TF++A
Sbjct  62    VLERNSRPKMTWWMFAKIALLSFFEPVLDQNLFYAGMKITTPTFVLAMCNILPAMTFVMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE  727
              I +LEKV++R LH Q K+VGT +TIGGAM++ L  G +I LPWT ++  + QS      
Sbjct  122   CIFKLEKVDMRRLHFQAKVVGTLVTIGGAMLLPLAHGPLINLPWTKRNFCRGQSAHSVHI  181

Query  726   HDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
              D +KGAVM+  GC  WS F ILQA+ L+SYPA LSL  L+C+ G ++ST+L   VER N
Sbjct  182   QDLIKGAVMVIFGCLSWSSFIILQAMILESYPAKLSLAALMCIMGTVESTILAFAVERAN  241

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFM  367
               +W++++D   LA VY GI+ SG+ YYI G+++ E+GP F++A NPLS++MVAI+GSF+
Sbjct  242   TAVWSVYFDIRLLAAVYGGIL-SGLAYYIFGLLVKERGPVFMSASNPLSLVMVAILGSFI  300

Query  366   LAEQLDFGKIFGAVVIIVGLYLVIWG  289
               E+   G+  GA+VI++GLYLV+WG
Sbjct  301   FKEKFYLGRAIGAIVIVLGLYLVLWG  326



>emb|CDX91104.1| BnaC02g04930D [Brassica napus]
Length=379

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 231/322 (72%), Gaps = 4/322 (1%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             + A+P+  ++F+Q  YA  S+++K ALN+GM+ ++ V YR  +A+    PFA++ ER  R
Sbjct  4     QKARPFIAIVFIQFLYALMSIVAKLALNEGMSPHVLVAYRMAVASALITPFALVLERNSR  63

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             PR+T  I  +I +L+L EPV++QNLYY+GMK TTATF +A+CN LPAITF++A I +LEK
Sbjct  64    PRLTFKILFQISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAITFIMACIFKLEK  123

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVP---QTQSIGPATEHDHV  715
             VNI+  HSQ K+VGT + IGGAM+MT V+G++I LPWTSK      Q+  +    + D  
Sbjct  124   VNIKRRHSQAKLVGTMVAIGGAMLMTFVKGNVIELPWTSKSRSYNGQSHVMNTPKQEDTG  183

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             KG++M+ A CF WSC+ ILQA  L SY A LSLT L+C  G L++TV+ L++ER N   W
Sbjct  184   KGSIMLVASCFTWSCYIILQANILNSYQAELSLTALMCCMGMLEATVMALILERNNMSAW  243

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              +H D   LA +Y G++ SG+ YYI+G    E+GP FV+AFNPLSM++VAI+ SF+  E+
Sbjct  244   KIHPDMRLLASIYGGLV-SGLSYYITGWASKERGPVFVSAFNPLSMVIVAILSSFIFLEK  302

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G++ G+VVI++G+YLV+WG
Sbjct  303   MYIGRVDGSVVIVIGIYLVLWG  324



>ref|XP_011019905.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Populus 
euphratica]
Length=313

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/298 (54%), Positives = 218/298 (73%), Gaps = 0/298 (0%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
               AKP+  V+FLQ   A   ++SK+ALNQGM++Y+ VVYR+ +A V  APFA + ++K+R
Sbjct  5     DRAKPFVAVMFLQAGLAGMDILSKAALNQGMSNYVLVVYRHAVATVVIAPFAAILDKKLR  64

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             P+MT++IF+K++ L+LLEPVIDQNLY+ GMKYTTATFA A+ NVLPAITF++AWI+RLEK
Sbjct  65    PKMTLSIFIKLVALSLLEPVIDQNLYFLGMKYTTATFAAAIVNVLPAITFIIAWIVRLEK  124

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGA  706
             V I SLHSQ K+ GT  T+ GAM+MTL++G +I                    H  +KGA
Sbjct  125   VKIGSLHSQAKVAGTIATVAGAMLMTLMKGPLIEFFRIKGRAYHENGTSGIDLHSSIKGA  184

Query  705   VMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALH  526
             +MI  GCF W+CF ILQAITLKSYP  LSLT  IC+ G ++ TV+ LV E+G   +WA++
Sbjct  185   LMITVGCFSWACFMILQAITLKSYPVELSLTAWICLLGTIEGTVVALVAEKGKPSVWAIN  244

Query  525   WDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQL  352
             WD   LA VY+G+  SG+ YYI G++M ++GP FVTAF+PL M++VA++ S +LA+Q+
Sbjct  245   WDMKLLAAVYSGVFCSGLAYYIQGIVMKDRGPVFVTAFSPLCMVIVAVMSSIILAQQM  302



>gb|EMT04611.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=385

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/322 (51%), Positives = 224/322 (70%), Gaps = 0/322 (0%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             + +  AKPY  ++ LQ+ +A   +I+ ++L +GM+H++ VVYRN++A    APFA+ FER
Sbjct  6     KAVNDAKPYLAMVLLQVGFAGMYIIAVASLKRGMSHFVLVVYRNLVATAVMAPFALYFER  65

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
              +RP+MTITIF+KIM LALLEPV+DQNLYY G   T+A FATA+ N+LPA+TF+LA ILR
Sbjct  66    GVRPKMTITIFIKIMGLALLEPVLDQNLYYMGANLTSAGFATALVNILPAVTFVLALILR  125

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHV  715
             +EKV +RSLHSQ KI GT LT+ GA++M L  G ++  PWT        +   A     +
Sbjct  126   MEKVRLRSLHSQAKIAGTVLTVAGAVLMVLYHGPVVQFPWTKGQHHAGGAATAADGAAWL  185

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             KG +M  A C  WSCF+ILQ+ TL+ YPA LSLT LIC  G++ ST + +V ER N   W
Sbjct  186   KGTIMTVAACVAWSCFFILQSSTLRDYPAELSLTVLICGVGSVMSTAVAVVAERANTHAW  245

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              + +DT     VY GI+ SGV YY+ GV+  ++GP FVTAFNPL MI+ A++GS +L E 
Sbjct  246   VIGFDTRLFTVVYGGIVCSGVAYYVQGVVSRQRGPVFVTAFNPLCMIVTAVMGSIILKEA  305

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G + GAV+I+VGLY +IWG
Sbjct  306   ITLGSVIGAVIIVVGLYFLIWG  327



>ref|XP_008785769.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=651

 Score =   356 bits (913),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 169/333 (51%), Positives = 234/333 (70%), Gaps = 1/333 (0%)
 Frame = -2

Query  1287  DTTIMGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAV  1108
             +T I+ + +F       KPY  ++FLQ  YA   +IS  +L + MNHY+ VVYRN IA  
Sbjct  269   ETDIVVSMAFSEVASKVKPYLAMVFLQFGYAGMFVISVESLKRRMNHYVLVVYRNAIAVA  328

Query  1107  FFAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLP  928
               +PFA+ FERK+RP+MT++IFLKIM LA LEPV+DQN YY G   T+A+FA+AM N+LP
Sbjct  329   AVSPFALWFERKVRPKMTLSIFLKIMALAFLEPVLDQNFYYVGSNLTSASFASAMFNILP  388

Query  927   AITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQ  748
             AITFLLA +LR+E +N+R   SQ K+VGT +T+ GA++M L +G ++   W+        
Sbjct  389   AITFLLAIVLRIETMNLRRRRSQAKLVGTIVTVAGALLMILYKGPVLDFVWSKGRSHHNT  448

Query  747   SIGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLT  568
             ++G     + +KG +M+  GCFC S FYILQ+ TL+SYPA L+LT LIC+ GAL S+++ 
Sbjct  449   AVG-QNGSNSLKGTLMLLGGCFCCSSFYILQSNTLESYPAELTLTSLICLMGALMSSLVA  507

Query  567   LVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMV  388
             LV ERG+   W + WDT  LA VY+G++ SGV YY+ G +M E+GP FVTAFNPL MI+ 
Sbjct  508   LVAERGSAKPWIIGWDTRLLAVVYSGVLCSGVAYYVQGKVMKERGPVFVTAFNPLCMIVT  567

Query  387   AIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             A++GS +LAE++  G + GA VI++GLY +IWG
Sbjct  568   AVLGSIVLAEEITLGSVIGAAVIVIGLYSLIWG  600


 Score =   265 bits (676),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 176/257 (68%), Gaps = 1/257 (0%)
 Frame = -2

Query  1263  SFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAML  1084
             +F   +   KPY  ++FLQ  YA   +IS ++L  GMNHY+ VVYRN +A    APFA+ 
Sbjct  2     AFGEVVSKVKPYLAMVFLQFGYAGMFVISVASLKHGMNHYVLVVYRNAVAVAVVAPFALW  61

Query  1083  FERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAW  904
             FERK+RP+MT++IFLK M LALLEPV+DQN YY G   T+A+FA+A+ N+LPAITFLLA 
Sbjct  62    FERKVRPKMTLSIFLKTMALALLEPVLDQNFYYVGANLTSASFASALFNILPAITFLLAI  121

Query  903   ILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEH  724
             +LR+E +N+R   SQ K+VGT +T+ GA++M L +G  +   W+        ++      
Sbjct  122   VLRIENMNLRRRRSQAKLVGTIVTVAGALLMILYKGPSLDFVWSKGRSHHNTAVS-QNGS  180

Query  723   DHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNY  544
             + +KG +M+  GCFCWS F+ILQ+ TL+SYPA L+LT LIC+ G L S+++ LV ERG+ 
Sbjct  181   NSLKGTLMLLGGCFCWSSFFILQSNTLESYPAALTLTTLICLMGTLMSSLVALVAERGSA  240

Query  543   GIWALHWDTTFLAYVYN  493
               W + WDT  LA VY+
Sbjct  241   KPWIIGWDTRLLAVVYS  257



>gb|KHN05928.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=379

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 236/323 (73%), Gaps = 5/323 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
              W +  KP+  V+ +Q  YAA  ++SK+A+N+GM++Y+FVVYR+ +A    AP A  F++
Sbjct  5     NWFERLKPFAAVVSIQFGYAAMDVLSKAAMNKGMSNYVFVVYRHAVAFFVMAPLAWFFDK  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K+RP+MT++IF+KI +L+ +EPVIDQNLY+ GMKYTTATFA  + N+LPAITF+ A ILR
Sbjct  65    KVRPKMTLSIFMKIAVLSWIEPVIDQNLYFLGMKYTTATFAVTITNMLPAITFIFACILR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHII-GLPWTSKHVPQTQSIGPATEHDH  718
             LEK+ IRS+ SQ K+VGT  T+ GAM+MTL++G ++ G   ++ H   +Q  G +  H  
Sbjct  125   LEKIKIRSIRSQAKVVGTLTTVSGAMVMTLLKGPVLFGSHGSNDH---SQHNGTSMRHT-  180

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             + G ++I  GCFCW+CF ILQA TLK+YPA LSL+  IC+ G ++   + +++ERGN  +
Sbjct  181   ITGFILITIGCFCWACFVILQATTLKTYPAELSLSAWICLMGTIEGAAVAMIMERGNPSV  240

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             W+L  D   L  VY+GI+ SG+ YY+ GV+M  +GP FVTAF+PL M++VA++  F+LAE
Sbjct  241   WSLKLDMKLLCAVYSGIVCSGMSYYLQGVVMKTRGPVFVTAFSPLCMVIVAVMSYFILAE  300

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             Q+  G++ GAV+I +GLY V+WG
Sbjct  301   QVFLGRVIGAVIICLGLYAVVWG  323



>ref|XP_008461651.1| PREDICTED: WAT1-related protein At2g39510-like isoform X3 [Cucumis 
melo]
Length=357

 Score =   346 bits (888),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 172/331 (52%), Positives = 227/331 (69%), Gaps = 26/331 (8%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ESFVR+++ AKPYFGV+F+Q  YA  ++++KSAL++GM+ ++FV YR + A +  APFA+
Sbjct  2     ESFVRFMRSAKPYFGVIFVQFGYAGMTILTKSALDKGMSQHVFVAYRQVAATLVIAPFAI  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             +FER                     PVIDQNL+Y GMKYTTATFA AMCNVLPA  FL+A
Sbjct  62    IFER---------------------PVIDQNLFYTGMKYTTATFAAAMCNVLPAFVFLMA  100

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS--KHVPQTQSIGPA  733
             W  RLEKVNI    SQ KI+GT +T+GGAMIMT ++G ++ LPW+    H   + S   A
Sbjct  101   WACRLEKVNIMKRGSQAKILGTIVTVGGAMIMTFIKGPMLHLPWSKLPNHPSASSSSSSA  160

Query  732   TEHDH---VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLV  562
                DH   + G +M+  GC CW+ F  LQAITLK YPA LSLT LIC+ G +  + + LV
Sbjct  161   ASTDHQNQIIGFLMLTTGCICWAAFITLQAITLKEYPAELSLTALICLVGTIGGSGVALV  220

Query  561   VERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAI  382
             +ERGN   WALH+D   LA VY+G+I SGV YYI GV+M  KGP F +AFNPL+M++VAI
Sbjct  221   IERGNPSAWALHFDRQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFSAFNPLAMVLVAI  280

Query  381   VGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +  F+L+E +  G++ G V+II GLY+V+WG
Sbjct  281   MSFFILSEIMFLGRMIGVVIIICGLYMVLWG  311



>ref|XP_003537193.1| PREDICTED: WAT1-related protein At2g37460-like isoform 1 [Glycine 
max]
Length=379

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 235/323 (73%), Gaps = 5/323 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
              W +  KP+  V+ +Q  YAA  ++SK+A+N+GM++Y+FVVYR+ +A    AP A  F++
Sbjct  5     NWFERLKPFAAVVSIQFGYAAMDVLSKAAMNKGMSNYVFVVYRHAVAFFVMAPLAWFFDK  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K+RP+MT +IF+KI +L+ +EPVIDQNLY+ GMKYTTATFA  + N+LPAITF+ A ILR
Sbjct  65    KVRPKMTFSIFMKIAVLSWIEPVIDQNLYFLGMKYTTATFAVTITNMLPAITFIFACILR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHII-GLPWTSKHVPQTQSIGPATEHDH  718
             LEK+ IRS+ SQ K+VGT  T+ GAM+MTL++G ++ G   ++ H   +Q  G +  H  
Sbjct  125   LEKIKIRSIRSQAKVVGTLTTVSGAMVMTLLKGPVLFGSHGSNDH---SQHNGTSMRHT-  180

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             + G ++I  GCFCW+CF ILQA TLK+YPA LSL+  IC+ G L+   + +++ERGN  +
Sbjct  181   ITGFILITIGCFCWACFVILQATTLKTYPAELSLSAWICLMGTLEGAAVAMIMERGNPSV  240

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             W+L  D   L  VY+GI+ SG+ YY+ GV+M  +GP FVTAF+PL M++VA++  F+LAE
Sbjct  241   WSLKLDMKLLCAVYSGIVCSGMSYYLQGVVMKTRGPVFVTAFSPLCMVIVAVMSYFILAE  300

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             Q+  G++ GAV+I +GLY V+WG
Sbjct  301   QVFLGRVIGAVIICLGLYAVVWG  323



>emb|CDY65991.1| BnaA10g29860D [Brassica napus]
Length=378

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 163/322 (51%), Positives = 231/322 (72%), Gaps = 4/322 (1%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             + A+P+  ++F+Q  YA  S+++K ALNQGM+ ++ V YR  +AA    PFA++ ER  R
Sbjct  4     EKARPFMAIVFIQFLYALMSIVAKIALNQGMSPHVLVAYRMAVAAALITPFALVLERNSR  63

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             PR+T  IFL+I +L+L EPV++QNLYY+GMK TTATF +A+CN LPA+TF++A I +LEK
Sbjct  64    PRLTFKIFLQISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACIFKLEK  123

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH---VPQTQSIGPATEHDHV  715
             VNIR  HSQ K+VGT + IGGAM+MT  +G++I LPWTSK    + Q  S+    + D  
Sbjct  124   VNIRRRHSQAKLVGTMVAIGGAMLMTFFKGNVIELPWTSKPMGIIGQAHSMNTPKQEDIG  183

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             KG+VM+ A CF WSC+ ILQA  L +Y A LSLT L+C+ G L+++V+ L+ ER N  +W
Sbjct  184   KGSVMLVASCFSWSCYIILQANILNTYNAELSLTALMCIMGMLEASVIALIWERKNMSVW  243

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              +H D   LA +Y G++ SG+ YY  G    ++GP FV+AFNPLSM++VAI+ SF+  E+
Sbjct  244   KIHPDMKLLASIYGGLV-SGLAYYAIGWASKKRGPVFVSAFNPLSMVIVAILSSFVFLEK  302

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             L  G++ G+VVI+ G+YLV+WG
Sbjct  303   LYLGRVVGSVVIVFGVYLVLWG  324



>ref|XP_006397315.1| hypothetical protein EUTSA_v10028726mg [Eutrema salsugineum]
 gb|ESQ38768.1| hypothetical protein EUTSA_v10028726mg [Eutrema salsugineum]
Length=382

 Score =   347 bits (889),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 235/322 (73%), Gaps = 3/322 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             +++ +PY  ++FLQ   A + ++  + LNQG N Y+ +VYRN +AA+  APFA+ FERK+
Sbjct  8     IQNFRPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVLIVYRNAVAALVLAPFALFFERKV  67

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+++F KI+LL  LEP++DQ   Y GM  T+AT+ +A+ NVLP++TF++AWILR+E
Sbjct  68    RPKMTLSVFWKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWILRME  127

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQ-TQSIGPATEHDH-V  715
             KV I    SQ KI+GT + +GGA++MTL +G +I LPW++ ++ Q  +    + +++H V
Sbjct  128   KVKIVEARSQAKIIGTLVALGGALVMTLYKGPLIPLPWSNPNMDQHNEHSNSSQDNNHWV  187

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
              G ++I   C  WSCFY+LQ+IT+K+YPA LSL  LIC++GA+QST + LVVER + G W
Sbjct  188   AGTLLILLACVAWSCFYVLQSITIKTYPADLSLAALICLSGAIQSTAVALVVERHSSG-W  246

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
             A+ WD    A +Y GI+ SG+ YY+ G++M  +GP FVTAFNPL MI+VA++ SF+L EQ
Sbjct  247   AVGWDARLFAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFILHEQ  306

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             + +G + G  VI +GLYLV+WG
Sbjct  307   IHYGCVIGGTVIAMGLYLVVWG  328



>gb|EYU41683.1| hypothetical protein MIMGU_mgv1a009185mg [Erythranthe guttata]
Length=350

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 227/320 (71%), Gaps = 10/320 (3%)
 Frame = -2

Query  1155  MNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGM  976
             M++Y+FVVYR+ +A +  APFA   + KIRP+MT +IF+KIML++LLEPVIDQNLY+ GM
Sbjct  1     MSNYVFVVYRHAVATIVIAPFAFALDTKIRPKMTTSIFVKIMLMSLLEPVIDQNLYFLGM  60

Query  975   KYTTATFATAMCNVLPAITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRG  796
             KYTTATFA AM N+LPA+TF++A   RLEKV + S+ SQ KI+GT  T+ GAMIMTLV+G
Sbjct  61    KYTTATFAAAMANILPALTFVIACFFRLEKVKVMSIRSQAKIIGTLATVAGAMIMTLVQG  120

Query  795   HIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSL  616
               I LPWT   +      G  + H  +KGA+MI  GC  W+CF ILQAITLK+YPA LSL
Sbjct  121   PHINLPWTRSGIDHAHHHGEVSLHHTIKGAIMITIGCLAWACFMILQAITLKTYPAELSL  180

Query  615   TCLICMAGALQSTVLTLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEK  436
             T  IC+ G  +   L LV+E+GN   WA+ WDT FLA  Y+GI  SG+ YY+ GV+M E+
Sbjct  181   TAWICLLGTAEGAALALVMEKGNSSAWAIKWDTKFLAAAYSGIFCSGIAYYVQGVVMKER  240

Query  435   GPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdissskss  256
             GP FVTAF+PLSM+MVAI+ SF+LAEQ+  G+I GA+VI++GLY V+WG           
Sbjct  241   GPVFVTAFSPLSMVMVAIMSSFILAEQMFLGRIVGAIVIVLGLYFVVWG----------K  290

Query  255   eddDNNALSNNKESILTKQS  196
               D  + L  ++E +  KQS
Sbjct  291   AKDYKSPLGEDQEIMPIKQS  310



>ref|XP_010455250.1| PREDICTED: WAT1-related protein At4g08290-like [Camelina sativa]
Length=387

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 249/367 (68%), Gaps = 14/367 (4%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++  +PY  ++FLQ   A + ++  + LNQG N Y+ +VYRN++AA+  APFA++FERK+
Sbjct  8     MQKCRPYILMIFLQFGAAGTYIVIMATLNQGQNRYVLIVYRNLVAALVLAPFALIFERKV  67

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MTI++F KIM L  LEPV+DQ   Y GM  T+AT+A+A+ N+LP++TF++AWILR+E
Sbjct  68    RPKMTISVFWKIMALGFLEPVLDQGFGYLGMNMTSATYASAIMNILPSVTFIIAWILRIE  127

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH---  718
             KVNI  + S+ KI+GT + +GGA++MTL +G +I LPW++    Q Q+    +  DH   
Sbjct  128   KVNIVEVRSKAKIIGTLIGVGGALVMTLYKGPLIPLPWSNPSTDQ-QNGHTNSSQDHSNW  186

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             V G ++I   C  WSCFY+LQ+IT+K+YPA LSL+ LIC+AGA+QS  + LV+ER   G 
Sbjct  187   VVGTLLILICCVAWSCFYVLQSITIKTYPADLSLSSLICLAGAVQSFAVALVMERHPSG-  245

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             WA+ WD      +Y GI+ SG+ YY+ G +M  +GP FVTAFNPL M++VA++ SF+L E
Sbjct  246   WAVGWDARLYGPLYTGIVSSGITYYVQGKVMKTRGPVFVTAFNPLCMVLVALLASFILHE  305

Query  357   QLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKID  178
             Q+ FG + G +VI  GLY+V+WGK KD            + L N ++S L +     K D
Sbjct  306   QIHFGCVIGGIVIAAGLYMVVWGKGKDYEV---------SGLDNLEKSSLHELPITTKGD  356

Query  177   DTIKIRT  157
             D  ++ +
Sbjct  357   DDTRLAS  363



>ref|XP_011023643.1| PREDICTED: WAT1-related protein At5g13670-like [Populus euphratica]
Length=375

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/326 (50%), Positives = 228/326 (70%), Gaps = 1/326 (0%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ESF+     A+ Y  V+F+Q  Y+  S+++K ALN GM  ++ V YR  +A+V   PFA 
Sbjct  4     ESFISLYNQARAYVLVIFVQFGYSVMSILAKLALNLGMKPHVLVAYRMAVASVLLTPFAF  63

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             + ER  RP+MT  +F KI LL+  EPV+DQNL+YAGMK TT  F  AMCN+LPA+TF++A
Sbjct  64    VLERNSRPKMTFWMFAKITLLSFFEPVLDQNLFYAGMKITTPAFVLAMCNILPAMTFVMA  123

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE  727
              I +LEKV++R LH Q K+ GT +TIGGAM++    G ++ LPWT ++  + QS   A  
Sbjct  124   CIFKLEKVDMRRLHFQAKVAGTLVTIGGAMLLPFAHGPLLHLPWTKRNFCRGQSAQSAHI  183

Query  726   HDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
              D +KGAVM+  GC  WS F ILQA+ LKSYPA LSL   +C+ G ++ST+LT  VER N
Sbjct  184   QDLIKGAVMVVFGCLSWSSFIILQAMILKSYPAKLSLAAFMCIMGTVESTILTFAVERAN  243

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFM  367
               +W++++D   LA VY GI+ SG+ YYI G+++ E+GP F++A NPLS++MVAI+GSF+
Sbjct  244   TAVWSVYFDVRLLAAVYGGIL-SGLAYYIFGLLVKERGPVFMSASNPLSLVMVAILGSFI  302

Query  366   LAEQLDFGKIFGAVVIIVGLYLVIWG  289
               E+   G+  GA+VII+GLYLV+WG
Sbjct  303   FKEKFYLGRAIGAIVIILGLYLVLWG  328



>ref|XP_006655900.1| PREDICTED: WAT1-related protein At1g21890-like [Oryza brachyantha]
Length=379

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 228/322 (71%), Gaps = 1/322 (0%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R L  AKPY  ++ LQ+ +A   ++S ++L +GMNH++ VVYRN++A V  APFA+LFER
Sbjct  5     RALSDAKPYAAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFALLFER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
              +RP+MT+ IF+KIM LA+LEPV+DQNLYY G K T+A FA+A+ N+LPA+TFLLA +LR
Sbjct  65    GVRPKMTVRIFIKIMGLAILEPVLDQNLYYMGAKLTSAGFASALVNILPAVTFLLAVLLR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHV  715
             +E+V +RSLHSQ KIVGT  T+ GA++M L  G ++ LPW S+      +    T    +
Sbjct  125   MERVRLRSLHSQAKIVGTVFTVAGAVLMILYHGPVVPLPW-SRGSHHDAAAAAGTASSWL  183

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
              G VM+   C CWS F+ILQ+ TL+SYPA LSLT LIC+ G+  S  + LV ER +  +W
Sbjct  184   NGTVMLVGSCVCWSGFFILQSNTLQSYPAELSLTALICVLGSAMSGAVALVAERRDMSVW  243

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              + +DT     VY+GI+ SGV YY+ G++   +GP FVTAF PL M++ A++GS +L E+
Sbjct  244   VIGFDTRLFTAVYSGIVCSGVAYYVQGLVTRARGPVFVTAFQPLCMMITAVLGSTILKEE  303

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G + GA++I+VGLY +IWG
Sbjct  304   ITLGSVIGALIIVVGLYALIWG  325



>ref|XP_010419331.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At2g37450-like 
[Camelina sativa]
Length=382

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/320 (53%), Positives = 221/320 (69%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             +K A P+  ++FLQ+  A   +++K  LN+GM+ Y+  VYR+ +A V  APFA+ F+R +
Sbjct  11    MKKAIPFLLMVFLQVGLAGMDILTKDVLNKGMSIYVLAVYRHGVATVVMAPFALYFDRTV  70

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI LL LLEPVIDQNL+  GMKYTTATFATA+ N LPAITF+LA I RLE
Sbjct  71    RPKMTLMIFFKITLLGLLEPVIDQNLFILGMKYTTATFATALYNTLPAITFILALIFRLE  130

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KV IR++ S  K+VGT  T+GG M+MTLV+G  + L WT    P  Q+      H  +KG
Sbjct  131   KVKIRNIRSAAKVVGTLTTVGGTMMMTLVKGPALDLFWTKG--PSAQNTTGTDIHSSIKG  188

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A+++  GCF ++CF ILQAITLK+YPA LSL   IC+ G ++  V+ LV+E+GN   WA+
Sbjct  189   AILVTIGCFSYACFMILQAITLKTYPAELSLATWICLMGTVEGAVVALVIEKGNPAAWAI  248

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WD   L   Y+GI+ S + YYI GV+M  +GP FVTAF PL M +VAI  S + AEQ+ 
Sbjct  249   GWDNKLLTVTYSGIMCSALGYYIGGVVMKTRGPVFVTAFKPLCMXVVAIKSSIIFAEQMY  308

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G+  GA +I  GLYLVIWG
Sbjct  309   LGRALGAAIICAGLYLVIWG  328



>ref|XP_002872388.1| hypothetical protein ARALYDRAFT_489740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48647.1| hypothetical protein ARALYDRAFT_489740 [Arabidopsis lyrata subsp. 
lyrata]
Length=383

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/319 (50%), Positives = 232/319 (73%), Gaps = 5/319 (2%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             +PY  ++FLQ   A + ++  + LNQG N Y+ +VYRN++AA+  APFA++FERK+RP+M
Sbjct  12    RPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVVIVYRNLVAALVLAPFALIFERKVRPKM  71

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+++F KIM L  LEPV+DQ   Y GM  T+AT+ +A+ N+LP++TF++AWILR+EKVNI
Sbjct  72    TLSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRMEKVNI  131

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH---VKGA  706
               + S+ KI+GT + +GGA++MTL +G +I LPW++  + Q      ++E DH   V G 
Sbjct  132   AEIRSKAKIIGTLVGLGGALVMTLYKGPLIPLPWSNPTMDQQNGHTNSSE-DHNNWVVGT  190

Query  705   VMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALH  526
             ++I  GC  WS FY+LQ+IT+K+YPA LSL+ LIC+AGA+QS  + LVVER + G WA+ 
Sbjct  191   LLILLGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVERHSSG-WAVG  249

Query  525   WDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDF  346
             WD    A +Y GI+ SG+ YY+ G++M  +GP FVTAFNPL MI+VA++ SF+L EQ+ F
Sbjct  250   WDARLFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALLASFILHEQIHF  309

Query  345   GKIFGAVVIIVGLYLVIWG  289
             G + G  VI  GLY+V+WG
Sbjct  310   GCVIGGAVIAAGLYMVVWG  328



>emb|CDY18443.1| BnaA04g21440D [Brassica napus]
Length=374

 Score =   345 bits (884),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/365 (48%), Positives = 240/365 (66%), Gaps = 8/365 (2%)
 Frame = -2

Query  1257  VRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFE  1078
             +  +K A P+  V+ LQ+  A   +++K+ LN+GM++Y+ VVYR+ +AA+  APFA  F+
Sbjct  7     ISCMKKAMPFILVILLQVGLAGMDILTKAVLNEGMSNYVLVVYRHGVAAIVMAPFAFYFD  66

Query  1077  RKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWIL  898
             +  RP+MT  IF KI LL L EPVIDQNL+  GMKYTTATFATA+ N LPA+TF+LA I+
Sbjct  67    KAARPKMTPMIFFKITLLGLFEPVIDQNLFCLGMKYTTATFATALYNTLPAVTFILALIV  126

Query  897   RLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH  718
             RLEKV +RS+ S  K++GT  ++GG MIMTLV+G  + L WT    P  Q+      H  
Sbjct  127   RLEKVKLRSIRSASKVIGTMTSVGGTMIMTLVKGPALDLFWTKG--PSAQNTTGTDIHSS  184

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             +KGAV++  GCF ++CF+IL AITLK+YP  LSLT  IC+ G L+   + LV+ERGN G 
Sbjct  185   IKGAVLVTIGCFSYACFFILYAITLKTYPTELSLTAWICLMGTLEGAAVALVMERGNPGA  244

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             WA+ WD   L   Y+GI+ S + YYI G++M  +GP FVTAF+PL MI+VA + S + AE
Sbjct  245   WAIGWDNKLLTVTYSGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFAE  304

Query  357   QLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNK------ESILTKQS  196
             Q+  G+  GA VI  GLYLVIWGK  D   + ++       L  N+      E I  ++ 
Sbjct  305   QMYLGRALGAAVICAGLYLVIWGKGNDYKDASTNPTQTKLELIGNEKDNVGHEIINMRKE  364

Query  195   AEQKI  181
              EQ+I
Sbjct  365   GEQRI  369



>ref|XP_010664224.1| PREDICTED: WAT1-related protein At1g21890 [Vitis vinifera]
 emb|CBI19037.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 168/333 (50%), Positives = 230/333 (69%), Gaps = 5/333 (2%)
 Frame = -2

Query  1275  MGNES-FVR---WLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAV  1108
             MG+++ FV+        K Y G++ LQ  YA   +I+  +L  GMNHY+ VVYR+ +A +
Sbjct  1     MGDQTLFVKLSLMFSKVKAYLGIVSLQFGYAGMYIITMVSLKHGMNHYVLVVYRHAVATL  60

Query  1107  FFAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLP  928
               APFA++ ERK+RP+MT++ FLKIM+L  LEPV+DQNLYY GMKYT+ATFA+A  NVLP
Sbjct  61    VIAPFALVLERKVRPKMTLSTFLKIMVLGFLEPVLDQNLYYVGMKYTSATFASATVNVLP  120

Query  927   AITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQ  748
             AITF+LA I RLEK+NI+ + SQ K++GT +T+ GAM+MTL +G II    T        
Sbjct  121   AITFILAIIFRLEKINIKKIPSQAKVIGTLITVTGAMVMTLYKGPIIDFIHTRGISHHES  180

Query  747   SIGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLT  568
             S  P+   +   G +M+   CF WS F+ILQ+ TLK YPA LSLT LIC  G +Q   + 
Sbjct  181   SSDPSAGQNWATGTLMLLGSCFGWSGFFILQSFTLKQYPAELSLTALICFMGTVQGAAVA  240

Query  567   LVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMV  388
             LV+ER +   WA+ +D+  LA  Y+G++ SG+ YY+  +++ E+GP FVTAF+PL MI+ 
Sbjct  241   LVMER-DKAAWAVGFDSRILAAAYSGVVCSGIAYYVQSLVIKERGPVFVTAFSPLCMIIT  299

Query  387   AIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             A +GSF+LAE+L  G I GA VI+VGLY V+WG
Sbjct  300   AALGSFILAEKLHLGSILGAAVIVVGLYSVVWG  332



>ref|XP_009141664.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Brassica 
rapa]
Length=374

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 224/323 (69%), Gaps = 2/323 (1%)
 Frame = -2

Query  1257  VRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFE  1078
             +  +K A P+  V+ LQ+  A   +++K+ LN+GM++Y+ VVYR+ +AA+  APFA  F+
Sbjct  7     ISCMKKAMPFILVILLQVGLAGMDILTKAVLNEGMSNYVLVVYRHGVAAIVMAPFAFYFD  66

Query  1077  RKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWIL  898
             +  RP+MT  IF KI LL L EPVIDQNL+  GMKYTTATFATA+ N LPA+TF+LA I+
Sbjct  67    KAARPKMTPMIFFKITLLGLFEPVIDQNLFCLGMKYTTATFATALYNTLPAVTFVLALIV  126

Query  897   RLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH  718
             RLEKV +RS+ S  K++GT  ++GG MIMTLV+G  + L WT    P  Q+      H  
Sbjct  127   RLEKVKLRSIRSASKVIGTMTSVGGTMIMTLVKGPALDLFWTKG--PSAQNTTGTDIHSS  184

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             +KGA+++  GCF ++CF+IL AITLK+YP  LSLT  IC+ G L+   + LV+ERGN G 
Sbjct  185   IKGAILVTIGCFSYACFFILYAITLKTYPTELSLTAWICLMGTLEGAAVALVMERGNPGA  244

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             WA+ WD   L   Y+GI+ S + YYI G++M  +GP FVTAF+PL MI+VA + S + AE
Sbjct  245   WAIGWDNKLLTVTYSGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFAE  304

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             Q+  G+  GA VI  GLYLVIWG
Sbjct  305   QMYLGRALGAAVICAGLYLVIWG  327



>ref|XP_009121742.1| PREDICTED: WAT1-related protein At5g13670 [Brassica rapa]
Length=407

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 230/322 (71%), Gaps = 4/322 (1%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             + A+P+  ++F+Q  YA  S+++K ALNQGM+ ++ V YR  +AA    PFA++ ER  R
Sbjct  33    EKARPFMAIVFIQFLYALMSIVAKIALNQGMSPHVLVAYRMAVAAALITPFALVLERNSR  92

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             PR+T  IFL+I +L+L EPV++QNLYY+GMK TTATF +A+CN LPA+TF++A I +LEK
Sbjct  93    PRLTFKIFLQISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACIFKLEK  152

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH---VPQTQSIGPATEHDHV  715
             VNIR  HSQ K+VGT + IGGAM+MT  +G++I LPWTSK    + Q  S+    + D  
Sbjct  153   VNIRRRHSQAKLVGTMVAIGGAMLMTFFKGNVIELPWTSKPMGIIGQAHSMNTPKQEDIG  212

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             KG+VM+ A CF WSC+ ILQA  L +Y A LSLT L+C+ G L+++V+ L+ ER N  +W
Sbjct  213   KGSVMLVASCFSWSCYIILQANILNTYNAELSLTALMCIMGMLEASVIALIWERKNMSVW  272

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              +H D   LA +Y G++ SG+ YY  G    ++GP FV+AFNPLSM++VA + SF+  E+
Sbjct  273   KIHPDMKLLASIYGGLV-SGLAYYAIGWASKKRGPVFVSAFNPLSMVIVARLSSFVFLEK  331

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             L  G++ G+VVI+ G+YLV+WG
Sbjct  332   LYLGRVVGSVVIVFGVYLVLWG  353



>ref|XP_010274315.1| PREDICTED: WAT1-related protein At1g21890 [Nelumbo nucifera]
Length=385

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 226/317 (71%), Gaps = 2/317 (1%)
 Frame = -2

Query  1239  AKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPR  1060
             AKP+  ++ LQ  +A   +I+   L +G+NHY+ VVYRN  A +  APFA+ FERKIRP+
Sbjct  17    AKPFVAMVSLQFGFAGMYIITMLCLKRGLNHYVLVVYRNGTATLAIAPFALYFERKIRPK  76

Query  1059  MTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVN  880
             MT+++FLKIM+L  LEPV+DQNLYY GM+YT+ATF++AM NVLPAITF++A I RLEKV 
Sbjct  77    MTLSVFLKIMVLGFLEPVLDQNLYYVGMRYTSATFSSAMFNVLPAITFIMAIIFRLEKVK  136

Query  879   IRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVM  700
             I++LHSQ KI+GT +T+ GAM MTL +G I+ L  +        S   + +H  V G +M
Sbjct  137   IKNLHSQAKIIGTVVTLAGAMAMTLYKGPILNLGLSRGGSHHEDSSSSSGQH-WVVGTLM  195

Query  699   IAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWD  520
             +   C  W+ F+ILQ+ TLK YPA LSLT LIC  G +Q   + LV+ER N   WA+ WD
Sbjct  196   LLGSCTGWASFFILQSFTLKQYPAELSLTSLICFMGTMQGAAVALVMER-NPAAWAVGWD  254

Query  519   TTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGK  340
             +  LA VY G+I SGV YY+ GV++ E+GP FVTAFNPL MI+VA +GS +L EQL  G 
Sbjct  255   SRLLAAVYTGVICSGVAYYVQGVVIKERGPVFVTAFNPLCMIIVAALGSLILGEQLHLGS  314

Query  339   IFGAVVIIVGLYLVIWG  289
             + GA+VI++GLY V+WG
Sbjct  315   VIGALVIVIGLYSVVWG  331



>gb|AAM65570.1| nodulin-like protein [Arabidopsis thaliana]
Length=377

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/360 (48%), Positives = 247/360 (69%), Gaps = 8/360 (2%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             +PY  ++FLQ   A + ++  + LNQG N Y+ +VYRN++AA+  APFA++FERK+RP+M
Sbjct  5     RPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVVIVYRNLVAALVLAPFALIFERKVRPKM  64

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+++  KIM L  LEPV+DQ   Y GM  T+AT+ +A+ N+LP++TF++AWILR+EKVNI
Sbjct  65    TLSVLWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRMEKVNI  124

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH---VKGA  706
               + S+ KI+GT + +GGA++MTL +G +I LPW++ ++ Q Q+    +  DH   V G 
Sbjct  125   AEVRSKAKIIGTLVGLGGALVMTLYKGPLIPLPWSNPNMDQ-QNGHTNSSQDHNNWVVGT  183

Query  705   VMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALH  526
             ++I  GC  WS FY+LQ+IT+K+YPA LSL+ LIC+AGA+QS  + LVVER   G WA+ 
Sbjct  184   LLILLGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVERHPSG-WAVG  242

Query  525   WDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDF  346
             WD    A +Y GI+ SG+ YY+ G++M  +GP FVTAFNPL MI+VA++ SF+L EQ+ F
Sbjct  243   WDARLFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALLASFILHEQIHF  302

Query  345   GKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKIDDTIK  166
             G + G  VI  GLY+V+WGK KD   S     + N   S  +  I TK   + K+  +I 
Sbjct  303   GCVIGGAVIAAGLYMVVWGKGKDYEVSGLDILEKN---SLQELPITTKSEDDNKLVSSIS  359



>emb|CDX93377.1| BnaC04g45190D [Brassica napus]
Length=374

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 223/323 (69%), Gaps = 2/323 (1%)
 Frame = -2

Query  1257  VRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFE  1078
             +  +K A P+  V+ LQ+  A   +++K+ LN+GM++Y+ VVYR+ +AA+  APFA  F+
Sbjct  7     ISCMKKAMPFILVILLQVGLAGMDILTKAVLNEGMSNYVLVVYRHGVAAIIMAPFAFYFD  66

Query  1077  RKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWIL  898
             +  RP+MT  IF KI LL L EPVIDQNL+  GMKYTTATFATA+ N LPA+TF+LA I+
Sbjct  67    KAARPKMTPMIFFKITLLGLFEPVIDQNLFCLGMKYTTATFATALYNTLPAVTFILALIV  126

Query  897   RLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH  718
             RLEKV +RS+ S  K++GT  ++GG MIMTLV+G  + L WT    P  Q+      H  
Sbjct  127   RLEKVKLRSMRSASKVIGTMASVGGTMIMTLVKGPALDLFWTKG--PSAQNTTGTDIHSS  184

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             +KGAV++  GCF ++CF+IL AITLK YP  LSLT  IC+ G L+   + LV+ERGN G 
Sbjct  185   IKGAVLVTIGCFSYACFFILYAITLKIYPTELSLTAWICLMGTLEGAAVALVMERGNPGA  244

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             WA+ WD   L   Y+GI+ S + YYI G++M  +GP FVTAF+PL MI+VA + S + AE
Sbjct  245   WAIGWDNKLLTVTYSGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFAE  304

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             Q+  G+  GA VI  GLYLVIWG
Sbjct  305   QMYLGRALGAAVICAGLYLVIWG  327



>emb|CDY09817.1| BnaC09g43440D [Brassica napus]
Length=345

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 231/322 (72%), Gaps = 4/322 (1%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             + A+P+  ++F+Q  YA  S+++K ALNQGM+ ++ V YR  +AA    PFA++ ER  R
Sbjct  4     EKARPFMAIVFIQFLYALMSIVAKIALNQGMSPHVLVAYRMAVAAALITPFALVLERNSR  63

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             PR+T  I L+I +L+L EPV++QNLYY+GMK TTATF +A+CN LPA+TF++A I +LEK
Sbjct  64    PRLTFKILLQISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACIFKLEK  123

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH---VPQTQSIGPATEHDHV  715
             VNI+  HSQ K+VGT + IGGAM+MT  +G++I LPWTSK    + Q+ ++    + D  
Sbjct  124   VNIKRRHSQAKLVGTMVAIGGAMLMTFFKGNVIELPWTSKPWGIIGQSHAMNTPKQEDVG  183

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             KG+VM+ A CF WSC+ ILQA  L +Y A LSLT L+C+ G L+++V+ L+ ER N  +W
Sbjct  184   KGSVMLVASCFSWSCYIILQANILNTYNAELSLTALMCIMGMLEASVIALIWERKNMSVW  243

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              +H D   LA +Y G++ SG+ YY  G    ++GP FV+AFNPLSM++VAI+ SF+  E+
Sbjct  244   KIHPDMKLLASIYGGLV-SGLAYYAIGWASKKRGPVFVSAFNPLSMVIVAILSSFVFLEK  302

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             L  G++ G+VVI+ G+YLV+WG
Sbjct  303   LYLGRVVGSVVIVFGVYLVLWG  324



>ref|XP_007220060.1| hypothetical protein PRUPE_ppa025780mg [Prunus persica]
 gb|EMJ21259.1| hypothetical protein PRUPE_ppa025780mg [Prunus persica]
Length=378

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/330 (51%), Positives = 227/330 (69%), Gaps = 7/330 (2%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ES    ++ AK    V  LQ +YA  ++I + A+N+GM+HYIF+VYR   A V  APFA+
Sbjct  2     ESLTNLIRRAKLILAVALLQGAYAGQAIIVRMAMNKGMSHYIFLVYRMAFATVLIAPFAL  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             + +RK RP+MT +I +K MLL+L +P++DQNLYY  M Y+TATF +AM N+LPAI F +A
Sbjct  62    ILDRKSRPKMTSSILVKTMLLSLFDPLLDQNLYYMAMSYSTATFTSAMFNILPAIAFFMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT---SKHVPQTQSIGP  736
             WI RLE VNIR LHSQ K++GT +T+GGA+I+TL +G  + LPWT   ++H  Q QS   
Sbjct  122   WIFRLETVNIRKLHSQAKVLGTIITVGGAIILTLAKGPALNLPWTKGKNQHHHQMQS--D  179

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
             +   D  K A++ AA CFCWS F ILQA TL+SYP  LSL  L C  G ++  +L LVVE
Sbjct  180   SNHKDITKSALLSAAACFCWSSFIILQAFTLRSYPCKLSLAALTCFWGLVEGAILALVVE  239

Query  555   -RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
              R +   W++H D   LA  Y GI+ SGV YYI G++  EKGP F +AFNPL  +++AI+
Sbjct  240   WRNSNADWSIHLDIRLLAAFYGGIL-SGVAYYIMGMVNKEKGPVFFSAFNPLGTVIIAIL  298

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             GS +L E +  G + GA+VI+VGLYLV+WG
Sbjct  299   GSLVLDEHMYLGSLIGAIVIVVGLYLVLWG  328



>ref|XP_006294396.1| hypothetical protein CARUB_v10023413mg [Capsella rubella]
 gb|EOA27294.1| hypothetical protein CARUB_v10023413mg [Capsella rubella]
Length=385

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 222/320 (69%), Gaps = 2/320 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             +K A P+  ++FLQ+  A   +++K  LN+GM+ Y+  VYR+ +A V  APFA+ F+R I
Sbjct  4     MKKAMPFMLMVFLQVGLAGMDILTKDVLNKGMSIYVLAVYRHGVATVAMAPFAIYFDRTI  63

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ IF KI LL LLEPVIDQNL+  GMKYTTATFATA+ N LPAITF+LA + RLE
Sbjct  64    RPKMTLMIFFKIALLGLLEPVIDQNLFNLGMKYTTATFATALYNTLPAITFILALMFRLE  123

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KV  R++ S  K+ GT  T+GG M+MTLV+G  + L WT    P  Q+      H  +KG
Sbjct  124   KVKFRNIRSAAKVFGTITTVGGTMMMTLVKGPALDLFWTKG--PSGQNTTGTDIHSSIKG  181

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A+++  GCF ++CF ILQAITLK+YPA LSL  LIC+ G ++  V+ LV+E+GN   WA+
Sbjct  182   AILVTIGCFSYACFMILQAITLKTYPAELSLATLICLMGTIEGAVVALVIEKGNPTAWAI  241

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              WD   L   Y+GI+ S + YYI G++M  +GP FVTAF PL MI+VAI+ S + +EQ+ 
Sbjct  242   GWDNKLLTVTYSGIMCSALGYYIGGMVMKTRGPVFVTAFKPLCMIVVAIMSSIIFSEQMY  301

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G+  GA VI  GLYLVIWG
Sbjct  302   LGRALGAAVICAGLYLVIWG  321



>ref|NP_192569.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
 sp|Q9SUF1.1|WTR31_ARATH RecName: Full=WAT1-related protein At4g08290 [Arabidopsis thaliana]
 emb|CAB45799.1| nodulin-like protein [Arabidopsis thaliana]
 emb|CAB77954.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEE82622.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=384

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/360 (48%), Positives = 246/360 (68%), Gaps = 8/360 (2%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             +PY  ++FLQ   A + ++  + LNQG N Y+ +VYRN++AA+  APFA++FERK+RP+M
Sbjct  12    RPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVVIVYRNLVAALVLAPFALIFERKVRPKM  71

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+++  KIM L  LEPV+DQ   Y GM  T+AT+ +A+ N+LP++TF++AWILR+EKVNI
Sbjct  72    TLSVLWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRMEKVNI  131

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH---VKGA  706
               + S+ KI+GT + +GGA++MTL +G +I LPW++ ++ Q Q+       DH   V G 
Sbjct  132   AEVRSKAKIIGTLVGLGGALVMTLYKGPLIPLPWSNPNMDQ-QNGHTNNSQDHNNWVVGT  190

Query  705   VMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALH  526
             ++I  GC  WS FY+LQ+IT+K+YPA LSL+ LIC+AGA+QS  + LVVER   G WA+ 
Sbjct  191   LLILLGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVERHPSG-WAVG  249

Query  525   WDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDF  346
             WD    A +Y GI+ SG+ YY+ G++M  +GP FVTAFNPL MI+VA++ SF+L EQ+ F
Sbjct  250   WDARLFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALIASFILHEQIHF  309

Query  345   GKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKIDDTIK  166
             G + G  VI  GLY+V+WGK KD   S     + N   S  +  I TK   + K+  +I 
Sbjct  310   GCVIGGAVIAAGLYMVVWGKGKDYEVSGLDILEKN---SLQELPITTKSEDDNKLVSSIS  366



>gb|EEC66707.1| hypothetical protein OsI_33030 [Oryza sativa Indica Group]
Length=364

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/325 (51%), Positives = 232/325 (71%), Gaps = 8/325 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             +W K A PY  ++FLQ  +A   LIS ++L QGM+HY+ VVYRN +AAV  APFA+ FER
Sbjct  6     KWRK-AMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K RP+MT+++F KIM L LLEPV+DQN +Y G K T+A+F++A+ N+LPA+TF+ A ILR
Sbjct  65    KTRPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIILR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHV  715
             +E+++I+   SQ KI GT +T+GGAM+M L +G +I  PWT       Q+I  +++H++ 
Sbjct  125   MERISIKERRSQAKIAGTLITVGGAMLMILFKGPVINFPWTKN---ANQNISDSSDHNNG  181

Query  714   K---GAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNY  544
             +   G  MI   CFCWS F+ILQ+ TL+SYPA LSLT LIC  G  QS  + LV+ER + 
Sbjct  182   RWLMGIFMILLSCFCWSAFFILQSYTLRSYPAELSLTTLICAMGVAQSGAVALVMER-DI  240

Query  543   GIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFML  364
               W + +D      VY+GI+ SGV YY+ G+++ E+GP FVTAF+PL MI+V I+GSF+L
Sbjct  241   KAWLIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFIL  300

Query  363   AEQLDFGKIFGAVVIIVGLYLVIWG  289
              E +  G++ GA++I+VGLY +IWG
Sbjct  301   CEVVTLGRVIGAIIIVVGLYALIWG  325



>ref|XP_002454615.1| hypothetical protein SORBIDRAFT_04g034330 [Sorghum bicolor]
 gb|EES07591.1| hypothetical protein SORBIDRAFT_04g034330 [Sorghum bicolor]
Length=385

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 222/322 (69%), Gaps = 0/322 (0%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             + L   KPY  ++ LQ+ +A   +++ ++L +GM+H++ VVYRN+ A    APFA+ FER
Sbjct  5     KALNDVKPYLAMILLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLFATAVMAPFALWFER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K RPRMTI IFLKIM L LLEPV+DQNLY+ G   T+A FA+A+ N+LPA+TF++A +LR
Sbjct  65    KSRPRMTIKIFLKIMGLTLLEPVLDQNLYFMGANLTSAGFASALINILPAVTFVMALVLR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHV  715
             +EKV +RS+HSQ KIVGT LT+ GA++M L  G ++  PW+  H     + G A+    +
Sbjct  125   MEKVRLRSVHSQAKIVGTVLTVAGAVLMILYHGPVVQFPWSKGHHHDAGAQGAASSGSFL  184

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
              G + I   C CWS F++LQA TLKSYPA LSLT LIC+ G+L S  + LV ER N   W
Sbjct  185   TGIITIIVACVCWSAFFVLQANTLKSYPAELSLTTLICLMGSLMSGSVALVAERNNTQAW  244

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              + +DT      Y GI+ SGV YY+ G++  ++GP FVTAFNPL MI+ AI+GS +L E+
Sbjct  245   VIGFDTRLFTCAYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAIMGSIILKEE  304

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G + GA +I++GLY +IWG
Sbjct  305   ITRGSVIGAAIIVLGLYALIWG  326



>ref|XP_010272782.1| PREDICTED: WAT1-related protein At1g21890-like [Nelumbo nucifera]
Length=386

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/316 (52%), Positives = 224/316 (71%), Gaps = 2/316 (1%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KP+  ++ LQ  YA   +++   L +GM+HY+  VYR+  A +  APFA+ FERKIRP+M
Sbjct  19    KPFMAMVSLQFGYAGMYIVTMLCLRRGMSHYVLAVYRHAAATLAIAPFALFFERKIRPKM  78

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+++FLKIM+LA LEPV+DQNLYY GMK T+ATF++A+ NVLP ITF++A I RLE V I
Sbjct  79    TVSVFLKIMVLAFLEPVLDQNLYYVGMKSTSATFSSAIFNVLPGITFIMAIIFRLEHVKI  138

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMI  697
             + +HSQ KI+GT +T  GAM MTL +G I+ L  +        S   A +H  V G +M+
Sbjct  139   KKIHSQAKIIGTIVTFAGAMAMTLYKGPILNLGLSRGGAHHEASSSAAGQH-WVAGTLML  197

Query  696   AAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDT  517
              A C  WSCF+ILQ+ TLK YPA LSLT LIC  G +Q   + LV+ER   G W+L WD+
Sbjct  198   LASCTGWSCFFILQSFTLKQYPAELSLTSLICFMGMVQGAAVALVMER-KPGAWSLGWDS  256

Query  516   TFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKI  337
               LA VY+G++ SG+ YY+ G+++ E+GP FVTAFNPL M++VA +GS +LAEQ+  G +
Sbjct  257   RLLAAVYSGVVCSGITYYVQGIVIKERGPVFVTAFNPLCMVIVAALGSLILAEQIHLGSV  316

Query  336   FGAVVIIVGLYLVIWG  289
              GA+VI++GLY V+WG
Sbjct  317   IGAIVIVIGLYSVVWG  332



>ref|XP_006289117.1| hypothetical protein CARUB_v10002538mg [Capsella rubella]
 gb|EOA22015.1| hypothetical protein CARUB_v10002538mg [Capsella rubella]
Length=388

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/323 (50%), Positives = 232/323 (72%), Gaps = 5/323 (2%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             +   +PY  ++FLQ   A + ++  + LNQG N Y+ +VYRN++AA+  APFA++FERK+
Sbjct  8     MHKCRPYLLMIFLQFGAAGTYIVVMATLNQGQNRYVVIVYRNLVAALVLAPFALIFERKV  67

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT ++F KIM L  LEPV+DQ   Y GM  T+AT+ +A+ N+LP++TF++AWILR+E
Sbjct  68    RPKMTFSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRME  127

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH---  718
             KVN+  + S+ KI+GT + +GGA++MTL +G +I LPW++  + Q Q+    +  DH   
Sbjct  128   KVNLAEIRSKAKIIGTLIGLGGALVMTLYKGPLIPLPWSNPSMNQ-QNGHTNSSQDHNNW  186

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             V G ++I  GC  WS FY+LQ+IT+K+YPA LSL+ LIC+AGA+QS  + LVVER   G 
Sbjct  187   VVGTLLILVGCVAWSGFYVLQSITIKTYPADLSLSSLICLAGAVQSFGVALVVERHASG-  245

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             WA+ WD    A +Y GI+ SG+ YY+ G++M  +GP FVTAFNPL M++VA++ SF+L E
Sbjct  246   WAVGWDARLYAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMVLVALLASFILHE  305

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             Q+ FG + G VVI  GLY+V+WG
Sbjct  306   QIHFGCVIGGVVIAAGLYMVVWG  328



>ref|XP_006429015.1| hypothetical protein CICLE_v10012001mg [Citrus clementina]
 ref|XP_006480748.1| PREDICTED: WAT1-related protein At2g37460-like [Citrus sinensis]
 gb|ESR42255.1| hypothetical protein CICLE_v10012001mg [Citrus clementina]
Length=370

 Score =   342 bits (877),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 186/352 (53%), Positives = 252/352 (72%), Gaps = 7/352 (2%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
                 +P+ GV+F+Q+ +A   ++ K+ALN+GM+ Y+ VVYR+  A +  APFA++ ++KI
Sbjct  9     FNRTRPFIGVIFMQVGFAGMDVLCKAALNKGMSPYVLVVYRHAAATIAMAPFAVILDKKI  68

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+ I  K++LL LLEPVIDQNLY+ GMKYTTATFA AM N+LPAITFL+AWI+RLE
Sbjct  69    RPKMTLAILTKLLLLGLLEPVIDQNLYFIGMKYTTATFAAAMYNILPAITFLMAWIIRLE  128

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
              VN++S+ S  K++GT  T+ GAM+MTL++G I+ L WT             T H+ +KG
Sbjct  129   NVNLKSIRSLAKVIGTLATVAGAMVMTLIKGPILELFWTKGAENHGHGSSGTTTHNSIKG  188

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A+MI AGCF WS F ILQAITLK+YPA LSLT  IC  G ++ T+  L++ERG   IWA+
Sbjct  189   ALMITAGCFSWSFFIILQAITLKAYPAELSLTAWICFFGTVEGTLAALIMERGKASIWAI  248

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
             HWDT  +A VY+GII SG+ YYI G++M ++GP FV AF+PL M++VAI+ + +LAEQ+ 
Sbjct  249   HWDTKLVASVYSGIICSGLTYYIQGIVMKDRGPVFVAAFSPLCMVIVAIMSTIILAEQMY  308

Query  348   FGKIFGAVVIIVGLYLVIWGkskdissskss-------eddDNNALSNNKES  214
              G+I GA++II GLYLV+WGKSKD  S   S        +  NN  SN KE+
Sbjct  309   LGRIIGAIIIIGGLYLVVWGKSKDHKSPSPSTDEHLPPAEQTNNTGSNGKEN  360



>gb|KDP32785.1| hypothetical protein JCGZ_12077 [Jatropha curcas]
Length=375

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/378 (47%), Positives = 248/378 (66%), Gaps = 16/378 (4%)
 Frame = -2

Query  1275  MGNESFV----RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAV  1108
             MG +S      + L  AKP+  ++ LQ  YA   +++  +   GM+HYI  +YR+I+A +
Sbjct  1     MGEQSICSAVCKGLIKAKPFLAMVSLQFGYAGMYIVTMVSFKHGMSHYILALYRHIVATL  60

Query  1107  FFAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLP  928
               APFA++ ERKIRP+MT+ IFL+I +L  LEPV+DQNLYY GMK T+ATFA+A  NVLP
Sbjct  61    VIAPFALVLERKIRPKMTLPIFLRITVLGFLEPVLDQNLYYVGMKSTSATFASASVNVLP  120

Query  927   AITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT---SKHVP  757
             AITF+LA I RLEKVNI+ +H   KI+GT +T+ GAM+MTL +G I+    +     H  
Sbjct  121   AITFILAIIFRLEKVNIKRVHDIAKIMGTCVTVAGAMVMTLYKGPILNFLTSHGAGSHHG  180

Query  756   QTQSIGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQST  577
              T S  P  +H  V G +M+ A C  W+ F+ILQ+ TLK YPA LSLT LIC+ GA+Q  
Sbjct  181   STTSTEPNDQH-WVTGTLMLLASCCGWASFFILQSFTLKKYPAELSLTALICLMGAVQGA  239

Query  576   VLTLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSM  397
              ++LV+ER +   W + +D+ FLA  Y+GI+ SGV YY+ G+++ E+GP FVT+F+PL M
Sbjct  240   AVSLVMER-DMSAWKIGFDSRFLAAAYSGIVCSGVAYYVQGMVIKERGPVFVTSFSPLCM  298

Query  396   IMVAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKE  217
             I+ A +G+ +LAEQL  G I GA++I++GLY V+WG       +K        AL+N KE
Sbjct  299   IITAALGTIILAEQLRLGSIIGAILIVIGLYTVVWG------KTKDKRISATPALTNEKE  352

Query  216   -SILTKQSAEQKIDDTIK  166
               I TK S+    D+ I 
Sbjct  353   LPITTKSSSTTNFDNGIN  370



>ref|XP_010438422.1| PREDICTED: WAT1-related protein At4g08290-like [Camelina sativa]
Length=386

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/367 (46%), Positives = 249/367 (68%), Gaps = 14/367 (4%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++  +PYF ++FLQ   A + ++  + LNQG N Y+ +VYRN++AA+  APFA++FERK+
Sbjct  8     MQKCRPYFLMIFLQFGSAGNYIVILATLNQGQNRYVLIVYRNLVAALVLAPFALIFERKV  67

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT ++F KIM L  LEPV+DQ   Y GM  T+AT+A+A+ N+LP++TF++AWILR+E
Sbjct  68    RPKMTFSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYASAIMNILPSVTFIIAWILRME  127

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH---  718
             KV+I  + S+ KI+GT + +GGA++MTL +G +I LPW++  + Q Q+    +  DH   
Sbjct  128   KVSIAEVRSKAKIIGTLIGVGGALVMTLYKGPLIPLPWSNPSMDQ-QNGHTNSSQDHSNW  186

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             V G ++I  GC  WS FY+LQ+IT+K+YPA LSL+ LIC+AG +QS  + LVVER   G 
Sbjct  187   VVGTLLILIGCVAWSGFYVLQSITIKTYPADLSLSSLICLAGVVQSFAVALVVERHPSG-  245

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             WA+ WD      +Y GI+ SG+ YY+ G++M  +GP FVTAFNPL M++VA++ SF+L E
Sbjct  246   WAVGWDARLYGPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMVLVALLASFILHE  305

Query  357   QLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKID  178
             ++  G + G V+I  GLYLV+WGK KD            + L N ++S L +     K D
Sbjct  306   KIHVGCVIGGVIIAAGLYLVVWGKGKDYEV---------SGLDNLEKSSLHELPITTKGD  356

Query  177   DTIKIRT  157
             D  ++ +
Sbjct  357   DDTRLAS  363



>gb|KFK32145.1| hypothetical protein AALP_AA6G204100 [Arabis alpina]
Length=383

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/323 (49%), Positives = 227/323 (70%), Gaps = 7/323 (2%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             ++  +PY  ++FLQ   A + ++  + LNQG N Y+ +VYRN IAA+  APFA+ FERK+
Sbjct  8     IQKIRPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVIIVYRNAIAALVLAPFALFFERKV  67

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT+++F KIMLL  LEP++DQ   Y GM  T+AT+ +A+ NVLP++TF++AWILR+E
Sbjct  68    RPKMTLSVFWKIMLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFVIAWILRME  127

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH---  718
             +V I  + SQ KI GT + + GA++MTL +G +I LPW++   P   +    +  DH   
Sbjct  128   RVTIVEVRSQAKIAGTLVALAGALVMTLYKGPLIPLPWSN---PDQLNGNTKSSQDHNHW  184

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             V G ++I   C  WSCFY+LQ+IT+K YPA LSL  LIC++GA+QST + LV+ER + G 
Sbjct  185   VAGTLLILLACVAWSCFYVLQSITIKKYPADLSLAALICLSGAVQSTAVALVMERHSSG-  243

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             WA+ WD    A +Y G++ SG+ YY+ G++M  +GP FVTAFNPL MI+VA++ SF+L E
Sbjct  244   WAVGWDARLFAPLYTGVVSSGLTYYVQGMVMKTRGPVFVTAFNPLCMILVALLASFILHE  303

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             Q+ FG + G  VI  GLY+V+WG
Sbjct  304   QIHFGCVIGGAVIAAGLYMVVWG  326



>ref|XP_006399861.1| hypothetical protein EUTSA_v10013837mg [Eutrema salsugineum]
 gb|ESQ41314.1| hypothetical protein EUTSA_v10013837mg [Eutrema salsugineum]
Length=377

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 229/323 (71%), Gaps = 4/323 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L  A+P+  ++F+Q  YA  S+++K ALN+GM+ ++ V YR  +A+    PFA++ ER  
Sbjct  3     LGKARPFMAIVFIQCLYALMSIVAKLALNEGMSPHVLVAYRMAVASALITPFALVLERNS  62

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT  I  +I +L+L EPV++QNLYY+GMK TTATF +A+CN LPA+TF++A I +LE
Sbjct  63    RPKMTFKILFRISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACIFKLE  122

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH---VPQTQSIGPATEHDH  718
             KVNI+  HSQ K+VGT + +GGAM+MT V+G+ I LPWTSK      Q+ ++    + D 
Sbjct  123   KVNIKRRHSQAKLVGTMVAVGGAMLMTFVKGNAIDLPWTSKSRGFTGQSHAMNTPKQDDI  182

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
              +G+VM+ A C  WSCF ILQA  L  Y A LSLT L+C  G L++TV+ L++ER +  +
Sbjct  183   GRGSVMLVASCLSWSCFIILQANILSLYQAELSLTALMCFMGMLEATVMALILEREDMSV  242

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             W +H D   LA +Y G++ SG+ YY+ G    E+GP FV+AFNPLSM++VAI+ SF+  E
Sbjct  243   WKIHPDMRLLASIYGGLV-SGLAYYVIGWASKERGPVFVSAFNPLSMVLVAILSSFIFLE  301

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             ++  G++ G+VVI++G+Y+V+WG
Sbjct  302   KMYLGRVLGSVVIVIGIYMVLWG  324



>gb|EMS46274.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=385

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/320 (50%), Positives = 221/320 (69%), Gaps = 0/320 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L   KPY  ++ LQ+ +A   +++ ++L +GM+H++ VVYRN++A    APFA+ FER +
Sbjct  6     LSDVKPYLAMVLLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLVATAVMAPFALYFERGL  65

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MTITIF+KIM LA LEPV+DQNLYY G K T+A F  A+ N+LPA+TF+LA I+R+E
Sbjct  66    RPKMTITIFIKIMGLAFLEPVLDQNLYYMGAKLTSAGFGAALINILPAVTFVLALIMRME  125

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KV +RSLHSQ KI GT LT+ GA++M L  G  +  PWT        +   A     +KG
Sbjct  126   KVRLRSLHSQAKIAGTVLTVAGAVLMILYHGPTVQFPWTKGQHHAGGAAAGADAAAWLKG  185

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
              +M+ A C  WSCF++LQ+ TL+ YP+ LSLT LIC  G++ ST + LV ER N   W +
Sbjct  186   TIMVIAACVAWSCFFVLQSSTLRDYPSELSLTVLICGVGSVMSTGVALVAERANTQAWVI  245

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              +D  F   VY GI+ SGV YY+ G++  ++GP FVTAFNPL MI+ A++GS +L E++ 
Sbjct  246   GFDARFFTAVYAGIVCSGVAYYVQGIVSKQRGPVFVTAFNPLCMIITAVMGSIILKEEIT  305

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G + GAV+I+VGLY +IWG
Sbjct  306   LGSVIGAVIIVVGLYFLIWG  325



>ref|XP_010096638.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB65306.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=361

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/331 (50%), Positives = 225/331 (68%), Gaps = 26/331 (8%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M  +S  + LK A+P+  V+ LQ  +A  ++I K ALNQGM+ ++ VVYR+ +A    AP
Sbjct  1     MSRKSLAKRLKLARPFLAVIVLQFGFAGLNIILKFALNQGMSQHVLVVYRHAVATAVIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++ ER                     PVIDQNL+Y GMK TTATFA AM NVLPA  F
Sbjct  61    FALVLER---------------------PVIDQNLFYTGMKSTTATFAAAMSNVLPAFVF  99

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSK--HVPQTQSI  742
             ++AWI+RLEKVNI  +HSQ KI+GT +T+GGAM MTL  G ++ LPW  +  H+  T+  
Sbjct  100   IMAWIVRLEKVNIGRIHSQAKILGTIVTVGGAMFMTLFNGPVLNLPWAKQDNHIDSTKG-  158

Query  741   GPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLV  562
               A     +KGA+MI AGC  WS F ILQAITLK+YPA LSLT LIC+ G +Q + + L 
Sbjct  159   --AHNQVSIKGALMIGAGCVSWSSFIILQAITLKAYPAELSLTALICLMGMVQGSAVALA  216

Query  561   VERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAI  382
             +E GN   W++H+D+  LA +Y+G+I SG+ YYI G++M +KGP FVTAFNPL+M++VAI
Sbjct  217   LEWGNPAAWSIHFDSKLLAALYSGVICSGLTYYIQGIVMQDKGPVFVTAFNPLNMVIVAI  276

Query  381   VGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             + SF+L+E +  G++ GA VI+ GLY+V+WG
Sbjct  277   MSSFILSETMYLGRVIGAAVIVAGLYMVLWG  307



>ref|XP_008233580.1| PREDICTED: WAT1-related protein At2g39510-like [Prunus mume]
Length=378

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/330 (51%), Positives = 226/330 (68%), Gaps = 7/330 (2%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             ES    ++ AK    V  LQ +YA  ++I + A+NQGM+HYIF+VYR   A V  APFA+
Sbjct  2     ESLANLIRPAKLILAVALLQGAYAGQAIIVRMAMNQGMSHYIFLVYRMAFATVLIAPFAL  61

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             + +RK+RP+MT +I +K MLL+L +PV+DQNLYY    Y+TATF +AM N+LPAI F +A
Sbjct  62    ILDRKLRPKMTSSILVKTMLLSLFDPVLDQNLYYMATSYSTATFTSAMFNILPAIAFFMA  121

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT---SKHVPQTQSIGP  736
             WI RLE VNIR LHSQ K++GT +T+GGA+I+TL +G  + LPWT   ++H  Q QS   
Sbjct  122   WIFRLETVNIRKLHSQAKVLGTIITVGGAIILTLAKGAALNLPWTKGKNQHHHQMQS--D  179

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
             +   D  K A++ AA CFCWS F ILQA TL+SYP  LSL  L C  G ++  +L LVVE
Sbjct  180   SNHKDITKSALLSAAACFCWSSFIILQAFTLRSYPCKLSLATLTCFWGLVEGAILALVVE  239

Query  555   -RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
              R +   W++H D   LA  Y GI+ SGV YYI G++  EKGP F +AFNPL  +++AI+
Sbjct  240   WRNSNADWSIHLDIRLLAAFYGGIL-SGVAYYIIGMVNKEKGPVFFSAFNPLGTVIIAIL  298

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             GS +L E    G + G++VI+VG+YLV+WG
Sbjct  299   GSLVLDEHTYLGSLIGSIVIVVGVYLVLWG  328



>ref|XP_011070079.1| PREDICTED: WAT1-related protein At5g07050-like [Sesamum indicum]
Length=404

 Score =   341 bits (874),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/323 (50%), Positives = 233/323 (72%), Gaps = 5/323 (2%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             + AKPY  ++ LQ  YA  ++I+K +LN+GM+HY+ VVYR+  A    APFA++ ERK+R
Sbjct  14    EKAKPYIAMICLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAAIAPFALILERKVR  73

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             P++T TIF+++ +L LL PVIDQNLYYAG+K+T+ TF+ AM N+LPA+TF++A I R+EK
Sbjct  74    PKITFTIFMQLFVLGLLGPVIDQNLYYAGLKFTSPTFSCAMSNMLPAMTFVMAVICRMEK  133

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQ----SIGPATEHDH  718
             VN++ L  Q K+VGT +T+ GAM+MTL +GH+I + W++   PQ      +I   T+ D 
Sbjct  134   VNLKKLRCQAKVVGTIVTVAGAMLMTLYKGHVINMVWSNYIHPQKSYVPTTIDSNTDKDW  193

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             VKG++++      W+ F+ILQAITL+ Y A LSLT L+C  G LQS  +T V+E   +  
Sbjct  194   VKGSILLIIATLAWASFFILQAITLRKYTAQLSLTALVCFMGTLQSIAVTFVMEHKPHA-  252

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             WA+ +D   LA  Y GI+ S + YY+ G++M ++GP FVTAF+PL MI+VAI+GSF+LAE
Sbjct  253   WAIGFDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  312

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             ++  G + GAV+I++GLY V+WG
Sbjct  313   KIYLGGVLGAVLIVIGLYSVLWG  335



>ref|XP_010492135.1| PREDICTED: WAT1-related protein At5g13670 isoform X2 [Camelina 
sativa]
Length=380

 Score =   340 bits (871),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 157/323 (49%), Positives = 228/323 (71%), Gaps = 4/323 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             LK A+P+  ++F+Q  YA  S+++K ALN GM+ ++ V YR  +A+V   PFA++ ER  
Sbjct  3     LKRARPFIAIIFIQCLYALMSIVAKLALNVGMSPHVLVAYRMAVASVLITPFALVLERNT  62

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RPRMT  IFL+I +L+L EPV++QNLYY+GMK TTATF +A+CN LPA+TF++A + +LE
Sbjct  63    RPRMTFKIFLQIAILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACLFKLE  122

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHV---PQTQSIGPATEHDH  718
             KV I+  HSQ K+VGT + +GGAM+MT V+G++I LPWT         + ++    + D 
Sbjct  123   KVTIKKRHSQAKLVGTMVAVGGAMLMTFVKGNVIELPWTKNSKGLNGHSHAMRIPKQDDI  182

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
              KG++M+ A CF WSC+ I QA  L  Y A LSLT L+C+ G L++TVL L+ ER N  +
Sbjct  183   AKGSIMLVASCFSWSCYIIFQAKILAQYQAELSLTALMCIMGMLEATVLGLIWERKNMSV  242

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             W +  D T LA +Y G++ SG+ YY+ G    E+GP FV+AFNPLSM++VAI+ +F+  E
Sbjct  243   WKIKPDVTLLASIYGGLV-SGLAYYVIGWTSKERGPVFVSAFNPLSMVLVAILSTFIFLE  301

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
              +  G++ G+VVI++G+YLV+WG
Sbjct  302   NMYLGRVIGSVVIVIGIYLVLWG  324



>ref|XP_010492134.1| PREDICTED: WAT1-related protein At5g13670 isoform X1 [Camelina 
sativa]
Length=388

 Score =   340 bits (871),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 231/323 (72%), Gaps = 4/323 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             LK A+P+  ++F+Q  YA  S+++K ALN GM+ ++ V YR  +A+V   PFA++ ER  
Sbjct  11    LKRARPFIAIIFIQCLYALMSIVAKLALNVGMSPHVLVAYRMAVASVLITPFALVLERNT  70

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RPRMT  IFL+I +L+L EPV++QNLYY+GMK TTATF +A+CN LPA+TF++A + +LE
Sbjct  71    RPRMTFKIFLQIAILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACLFKLE  130

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT--SKHVP-QTQSIGPATEHDH  718
             KV I+  HSQ K+VGT + +GGAM+MT V+G++I LPWT  SK +   + ++    + D 
Sbjct  131   KVTIKKRHSQAKLVGTMVAVGGAMLMTFVKGNVIELPWTKNSKGLNGHSHAMRIPKQDDI  190

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
              KG++M+ A CF WSC+ I QA  L  Y A LSLT L+C+ G L++TVL L+ ER N  +
Sbjct  191   AKGSIMLVASCFSWSCYIIFQAKILAQYQAELSLTALMCIMGMLEATVLGLIWERKNMSV  250

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             W +  D T LA +Y G++ SG+ YY+ G    E+GP FV+AFNPLSM++VAI+ +F+  E
Sbjct  251   WKIKPDVTLLASIYGGLV-SGLAYYVIGWTSKERGPVFVSAFNPLSMVLVAILSTFIFLE  309

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
              +  G++ G+VVI++G+YLV+WG
Sbjct  310   NMYLGRVIGSVVIVIGIYLVLWG  332



>ref|XP_010558786.1| PREDICTED: WAT1-related protein At5g13670 [Tarenaya hassleriana]
 ref|XP_010558787.1| PREDICTED: WAT1-related protein At5g13670 [Tarenaya hassleriana]
 ref|XP_010558788.1| PREDICTED: WAT1-related protein At5g13670 [Tarenaya hassleriana]
Length=369

 Score =   339 bits (869),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/320 (49%), Positives = 228/320 (71%), Gaps = 10/320 (3%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L+ +KP+  V+F+Q  YA  S+++K ALN GM+ ++ V YR  +A+   +PFA+  ER  
Sbjct  4     LERSKPFLAVIFIQFCYALMSIVAKFALNDGMSPHVLVAYRMALASALISPFAIFLERNK  63

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT  + +++ +L+L EPV++QNL+Y GMK TTATF +AMCNVLPA+TF++A I RLE
Sbjct  64    RPKMTFKLLIQVSMLSLFEPVVEQNLFYTGMKLTTATFTSAMCNVLPALTFIMACIFRLE  123

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KV+I    SQ K+VGT + +GGAM+MT V+G+++ LPWT+K    ++   P       +G
Sbjct  124   KVDISKHRSQAKLVGTIIAVGGAMLMTFVKGNVVELPWTNK----SRGFDPLG-----RG  174

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
             A M+   CF WSC+ ILQA  LKSYPA LSLT L+C  G +++T++ LV ER N  +W +
Sbjct  175   ATMLVVSCFSWSCYIILQAKILKSYPAELSLTALMCFTGMVEATIMALVWERNNTSVWEI  234

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
             H D   LA+VY G++ SG+ YY+ G +  E+GP FV+AFNPL+M++VAI+ SF+ +E + 
Sbjct  235   HPDVRLLAFVYGGVV-SGLAYYVIGWVAKERGPVFVSAFNPLNMVIVAILSSFVFSEVMY  293

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GAVVI+ G+YLV+WG
Sbjct  294   LGRVIGAVVIVFGIYLVLWG  313



>dbj|BAC43205.1| putative nodulin [Arabidopsis thaliana]
 gb|AAO63397.1| At4g08290 [Arabidopsis thaliana]
Length=384

 Score =   339 bits (870),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 170/360 (47%), Positives = 245/360 (68%), Gaps = 8/360 (2%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             +PY  ++FLQ   A + ++  + LNQG N Y+ +VYRN++AA+  A FA++FERK+RP+M
Sbjct  12    RPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVVIVYRNLVAALVLAHFALIFERKVRPKM  71

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T+++  KIM L  LEPV+DQ   Y GM  T+AT+ +A+ N+LP++TF++AWILR+EKVNI
Sbjct  72    TLSVLWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRMEKVNI  131

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH---VKGA  706
               + S+ KI+GT + +GGA++MTL +G +I LPW++ ++ Q Q+       DH   V G 
Sbjct  132   AEVRSKAKIIGTLVGLGGALVMTLYKGPLIPLPWSNPNMDQ-QNGHTNNSQDHNNWVVGT  190

Query  705   VMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALH  526
             ++I  GC  WS FY+LQ+IT+K+YPA LSL+ LIC+AGA+QS  + LVVER   G WA+ 
Sbjct  191   LLILLGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVERHPSG-WAVG  249

Query  525   WDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDF  346
             WD    A +Y GI+ SG+ YY+ G++M  +GP FVTAFNPL MI+VA++ SF+L EQ+ F
Sbjct  250   WDARLFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALIASFILHEQIHF  309

Query  345   GKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKIDDTIK  166
             G + G  VI  GLY+V+WGK KD   S     + N   S  +  I TK   + K+  +I 
Sbjct  310   GCVIGGAVIAAGLYMVVWGKGKDYEVSGLDILEKN---SLQELPITTKSEDDNKLVSSIS  366



>ref|NP_001064323.1| Os10g0210500 [Oryza sativa Japonica Group]
 gb|ABB47053.1| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABB47054.2| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26237.1| Os10g0210500 [Oryza sativa Japonica Group]
 dbj|BAG90481.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50726.1| hypothetical protein OsJ_31032 [Oryza sativa Japonica Group]
Length=364

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 230/325 (71%), Gaps = 8/325 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             +W K A PY  ++FLQ  +A   LIS ++L QGM+HY+ VVYRN +AAV  APFA+ FER
Sbjct  6     KWRK-AMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K RP+MT+++F KIM L LLEPV+DQN +Y G K T+A+F++A+ N+LPA+TF+ A ILR
Sbjct  65    KTRPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIILR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH-  718
             +E+++I+   SQ KI GT +T+GGAM+M L +G +I  PWT        +I  +++H++ 
Sbjct  125   MERISIKERRSQAKIAGTLITVGGAMLMILFKGPVINFPWTKN---ANHNISDSSDHNNG  181

Query  717   --VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNY  544
               + G  MI   CFCWS F+ILQ+ TL+ YPA LSLT LIC  G  QS  + LV+ER + 
Sbjct  182   HWLMGIFMILLSCFCWSAFFILQSYTLRGYPAELSLTTLICAMGVAQSGAVALVMER-DI  240

Query  543   GIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFML  364
               W + +D      VY+GI+ SGV YY+ G+++ E+GP FVTAF+PL MI+V I+GSF+L
Sbjct  241   KAWLIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFIL  300

Query  363   AEQLDFGKIFGAVVIIVGLYLVIWG  289
              E +  G++ GA++I+VGLY +IWG
Sbjct  301   CEVVTLGRVIGAIIIVVGLYALIWG  325



>ref|XP_010063373.1| PREDICTED: WAT1-related protein At4g08300-like [Eucalyptus grandis]
 gb|KCW70588.1| hypothetical protein EUGRSUZ_F03778 [Eucalyptus grandis]
Length=372

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/334 (49%), Positives = 232/334 (69%), Gaps = 7/334 (2%)
 Frame = -2

Query  1275  MGNE-SFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFA  1099
             MG   +F   LK  KPY  ++ LQ  YA   +I+  +LN GMNHY+  VYR+++A +  A
Sbjct  1     MGQSGAFWSGLKKVKPYLAMVSLQFGYAGMYIITLVSLNHGMNHYVLAVYRHVVATLLIA  60

Query  1098  PFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAIT  919
             PFA + ERKIRP++T+ IFL+IM L  LEPV+DQNLYY GMK T+ATFA+A  N+LPAIT
Sbjct  61    PFAFVLERKIRPKLTLPIFLRIMALGFLEPVLDQNLYYVGMKSTSATFASATVNILPAIT  120

Query  918   FLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT--SKHVPQTQS  745
             F++A   RLEKVN++ + S  K++GT +T+GGAM+MTL +G I+    +  + H P    
Sbjct  121   FIMALAFRLEKVNVKKIQSLSKVIGTAVTVGGAMVMTLYKGPIVDFMRSGGTGH-PHAGG  179

Query  744   IGP--ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVL  571
              GP  +T    V G +M+ A C  WS F+ILQ+ TLK YPA LSLT LIC+ G+++   +
Sbjct  180   DGPHQSTNQHWVTGTLMLLASCCGWSGFFILQSFTLKKYPAELSLTALICLMGSVEGAAV  239

Query  570   TLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIM  391
             TLV+ER N  +W + WD+  LA VY+G++ SG+ YY+ GV++ E+GP F+T+F+PL MI+
Sbjct  240   TLVMER-NMNVWRIGWDSRLLAAVYSGVVCSGIAYYVQGVVIKERGPVFITSFSPLCMII  298

Query  390   VAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
              A +G+ +LAE +  G I GA+ I+ GLY+V+WG
Sbjct  299   TAALGAIVLAETIHLGSIIGAIFIVCGLYIVVWG  332



>ref|XP_010097389.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB67895.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=357

 Score =   337 bits (863),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 173/330 (52%), Positives = 232/330 (70%), Gaps = 23/330 (7%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M    FVR  + +KP+ GV+FLQ  +A   ++SK+ALN GM++Y+ VVYR+ +A    AP
Sbjct  1     MKKLQFVRLFERSKPFLGVVFLQFGFAGMDVLSKAALNHGMSNYVLVVYRHAVATAVIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++ ++                     PVIDQNLY+ GMKYTTATFA AM N+LPAITF
Sbjct  61    FAVVLDK---------------------PVIDQNLYFMGMKYTTATFAAAMTNILPAITF  99

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT-SKHVPQTQSIG  739
             ++A IL LEKV I+S+ SQ K+VGTT T+ GAM+MT+++G I+ L WT    V + +S G
Sbjct  100   VMACILGLEKVKIKSIRSQAKVVGTTATVAGAMVMTVMKGPILDLFWTRGTRVDEARSGG  159

Query  738   PATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
              +  H  +KG++MI  GCF W+CF ILQAITLK+YPA LSLT  IC+ G L+ T + LV+
Sbjct  160   ISLSHS-IKGSLMITVGCFSWACFMILQAITLKTYPAELSLTAWICLLGTLEGTAVALVM  218

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             ERGN  +W+L WDT  +A +Y+G++ SG+ YYI GVIM ++GP FVTAF PL M++VAI+
Sbjct  219   ERGNASVWSLKWDTKLMAALYSGVVCSGLAYYIQGVIMRDRGPVFVTAFCPLCMVIVAIM  278

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             GS  LAEQL  G++ GA +IIVGLYLV+WG
Sbjct  279   GSLFLAEQLYLGRVIGATIIIVGLYLVVWG  308



>ref|XP_006661686.1| PREDICTED: WAT1-related protein At4g08290-like [Oryza brachyantha]
Length=364

 Score =   337 bits (863),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 225/322 (70%), Gaps = 2/322 (1%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             +W K A PY  ++FLQ  +A   LIS ++L QGM+HY+ VVYRN +AAV  APFA+ FER
Sbjct  6     KWRK-AMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K RP+MT+++F KIM L LLEPV+DQN +Y G K T+A+F++A+ N+LPA+TF+ A ILR
Sbjct  65    KTRPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIILR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHV  715
             +E+++I+   SQ KIVGT +T+GGAM+M L +G +I  PWT                  +
Sbjct  125   MERISIKERRSQAKIVGTLVTVGGAMLMILFKGPVINFPWTKNANYNVADNSGQNSGHWL  184

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
              G  MI   CFCWS F+ILQ+ TL++YPA LSLT LIC  G  QS  + LV+ER +   W
Sbjct  185   MGIFMILLSCFCWSAFFILQSYTLRNYPAELSLTTLICAMGVAQSGAIALVMER-DMKAW  243

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              + +D      VY+GI+ SGV YY+ G+++ E+GP FVTAF+PL MI+V I+GSF+L+E 
Sbjct  244   LIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFILSEV  303

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G++ GA++I+VGLY +IWG
Sbjct  304   VTLGRVIGAIIIVVGLYALIWG  325



>ref|XP_006289509.1| hypothetical protein CARUB_v10003044mg [Capsella rubella]
 gb|EOA22407.1| hypothetical protein CARUB_v10003044mg [Capsella rubella]
Length=379

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 226/323 (70%), Gaps = 4/323 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L+ A+P+  ++F+Q  YA  S+++K ALN GM+ ++ V YR  +A+    PFA++ ER  
Sbjct  3     LERARPFLAIVFIQCLYALMSIVAKLALNAGMSPHVLVAYRMAVASALITPFALVLERNT  62

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RPRMT  I  +I +L+L EPV++QNLYY+GMK TTATF +A+CN LPA+TF++A I +LE
Sbjct  63    RPRMTFKILFQIAILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACIFKLE  122

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHV---PQTQSIGPATEHDH  718
             KV +R  HSQ K+VGT + IGGAM MT ++GH + LPWT         + S+    + D 
Sbjct  123   KVTMRRRHSQAKVVGTMVAIGGAMFMTFLKGHALELPWTKNSRGLDAHSHSLRIPKQEDI  182

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
              +G++M+ A CF WSC+ ILQA  L  Y A LSLT L+C+ G L++TVL L+ ER N  +
Sbjct  183   ARGSLMLVASCFSWSCYIILQAKILVQYQAELSLTSLMCIMGMLEATVLGLIWERKNMSV  242

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             W +  D T +A +Y G++ SG+ YY+ G    E+GP FV+AFNPLSM++VAI+ +F+  E
Sbjct  243   WKIQPDVTLIASIYGGLV-SGLAYYVIGWASKERGPVFVSAFNPLSMVLVAILSTFIFFE  301

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             +L  G++FG+VVI+VG+Y+V+WG
Sbjct  302   KLYLGRVFGSVVIVVGIYMVLWG  324



>gb|EYU28757.1| hypothetical protein MIMGU_mgv1a023410mg, partial [Erythranthe 
guttata]
Length=302

 Score =   333 bits (854),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/300 (54%), Positives = 219/300 (73%), Gaps = 3/300 (1%)
 Frame = -2

Query  1239  AKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI-RP  1063
             AKP+  V+FLQ + A   +I+K+ALNQGM++Y+F+VYR+ +A +  APFA L E+KI RP
Sbjct  5     AKPFLAVVFLQAALAGMDIIAKAALNQGMSNYVFIVYRHAVATIVIAPFAFLLEKKIQRP  64

Query  1062  RMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKV  883
             +MT+ IF KIML +L  PVI QNLY+ GMKYT+ATF  +M NVLPA+TF++A +LR EKV
Sbjct  65    KMTLVIFFKIMLTSLFGPVISQNLYFLGMKYTSATFIASMTNVLPAVTFVIACLLRHEKV  124

Query  882   NIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAV  703
              + S HSQ KI+GT ++IGGAMIMTLVRG  + LPWT  +  Q    G    ++ +KGA+
Sbjct  125   KMTSTHSQAKIIGTLVSIGGAMIMTLVRGPNLDLPWTRGN-HQDHKNGE-DFNNSIKGAL  182

Query  702   MIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHW  523
             MIA   F W+ F I  AITL++YPA LSLT  ICM G ++   L L++ERGN  +W++ W
Sbjct  183   MIAIASFAWAGFMISHAITLQTYPAALSLTAWICMLGTVEGAALALIMERGNSAVWSIKW  242

Query  522   DTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFG  343
             DT  L  VY+GI  SG+ YY+ G+++ E+GP FVTAF+PLSM++VA++ SF+L EQ+  G
Sbjct  243   DTKLLGAVYSGIFCSGITYYVQGIVLKERGPVFVTAFSPLSMVLVAVMSSFILREQMYLG  302



>ref|XP_006649078.1| PREDICTED: WAT1-related protein At1g21890-like [Oryza brachyantha]
Length=357

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 224/324 (69%), Gaps = 2/324 (1%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R +   KPY  ++ LQ+ +A   +++ ++L +GM+H++ VVYRN+ A    APFA+ FER
Sbjct  5     RVMNDVKPYLAMILLQVGFAGMYVVAVASLKRGMSHFVLVVYRNLFATAVMAPFALWFER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             ++RPRMT+ IFLKIM LALLEPV+DQNLYY G   T+A FA+A+ NVLPA+TF++A +LR
Sbjct  65    RVRPRMTLVIFLKIMGLALLEPVLDQNLYYMGANLTSAGFASALINVLPAVTFVMALVLR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT--SKHVPQTQSIGPATEHD  721
             +E+V +RS+HSQ KI GT  T+ GA++M L  G ++  PWT    H   +   G A    
Sbjct  125   MERVRLRSVHSQAKIAGTLFTVAGAVLMVLYHGPVVQFPWTKGQHHDGASGGAGGAAGGG  184

Query  720   HVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYG  541
              ++G + I   C CWS F++LQ+ TL+SYPA LSLT LIC+ G++ S  + LV ER N  
Sbjct  185   FLQGTIFIVVACVCWSGFFVLQSNTLQSYPAELSLTTLICLMGSVMSGAVALVAERHNTR  244

Query  540   IWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLA  361
              W + +DT     VY GI+ SGV YY+ G++  ++GP FVTAFNPL MI+ AI+GS +L 
Sbjct  245   AWLIGFDTRLFTCVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAIMGSIILK  304

Query  360   EQLDFGKIFGAVVIIVGLYLVIWG  289
             E++  G + GAV+I+VGLY +IWG
Sbjct  305   EEIRLGSVIGAVIIVVGLYALIWG  328



>ref|XP_010453454.1| PREDICTED: WAT1-related protein At5g13670-like [Camelina sativa]
Length=388

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/323 (48%), Positives = 227/323 (70%), Gaps = 4/323 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             LK AKP+  ++F+Q  YA  S+++K ALN GM+ ++ V YR  +A+V   PFA + ER  
Sbjct  11    LKRAKPFIAIVFIQCLYALMSIVAKLALNAGMSPHVLVAYRMAVASVLITPFAFVLERNT  70

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RPRMT  I L+I +L+L EPV++QNLYY+GMK TTATF +A+CN LPA+TF++A + +LE
Sbjct  71    RPRMTFKILLQIAILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACLFKLE  130

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHV---PQTQSIGPATEHDH  718
             +V I+  HSQ K+VGT + +GGAM+MT V+G++I LPWT+        + ++    + D 
Sbjct  131   EVTIKKRHSQAKLVGTMVAVGGAMLMTFVKGNVIELPWTNNSKGLNGHSDAMRIPKQDDI  190

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
              +G++M+ A CF WSC+ ILQA  L  Y A LSLT L+C+ G L++TVL L+ ER N  +
Sbjct  191   ARGSIMLVASCFSWSCYIILQAKILAQYQAELSLTALMCIMGMLEATVLGLIWERKNMSV  250

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             W +  D T LA +Y G++ SG+ YY+ G    E+GP FV+AFNPLSM++VAI+ +F+  E
Sbjct  251   WKIKPDVTLLASIYGGLV-SGLAYYVIGWASKERGPVFVSAFNPLSMVLVAILSTFIFLE  309

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
              +  G++ G+ VI++G+YLV+WG
Sbjct  310   NMYLGRVVGSFVIVIGIYLVLWG  332



>dbj|BAJ98418.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score =   335 bits (860),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/324 (50%), Positives = 221/324 (68%), Gaps = 4/324 (1%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L   KPY  ++ LQ+ +A   +I+ ++L  GM+H++ VVYRN++A     PFA+ FER +
Sbjct  8     LDDVKPYLAMVLLQVGFAGMYIIAVASLKAGMSHFVLVVYRNLVATAVMTPFAIYFERGL  67

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MTITIF+K+M LA LEPV+DQNLY+ G K T+A FATA+ N+LPA+TF+LA ILR+E
Sbjct  68    RPKMTITIFIKVMGLAFLEPVMDQNLYFMGAKLTSAGFATALVNILPAVTFVLALILRME  127

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKH----VPQTQSIGPATEHD  721
             KV +RSLHSQ KI GT LT+ GA++M L  G I+  PWT            + G A   D
Sbjct  128   KVRLRSLHSQAKIAGTVLTVAGAVLMVLYHGPIVQFPWTKGQHHATASGQGAGGAAAARD  187

Query  720   HVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYG  541
              + G +M+   C  W+CF+ILQ+ TL+SYPA LSLT LIC  G+L S  + LV ER N  
Sbjct  188   WLNGTIMVIIACVAWACFFILQSNTLRSYPAELSLTVLICGMGSLMSGAIALVAERANTQ  247

Query  540   IWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLA  361
              W + +DT     VY GI+ SGV YY+ G++  ++GP FVTAFNPL MI+ A++GS +L 
Sbjct  248   AWVIGFDTRLFTAVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAVMGSIILK  307

Query  360   EQLDFGKIFGAVVIIVGLYLVIWG  289
             E+++ G + GA +I+ GLY +IWG
Sbjct  308   EEINLGSVIGAAIIVGGLYFLIWG  331



>ref|XP_004290852.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=368

 Score =   334 bits (856),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/321 (51%), Positives = 229/321 (71%), Gaps = 2/321 (1%)
 Frame = -2

Query  1251  WLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERK  1072
             +LK  KPY  ++ LQ  YA   +IS  +   GM+H++  VYR+++A    APFA++ ERK
Sbjct  14    FLKKIKPYLAMVSLQFGYAGMYIISMVSFKHGMSHFVLSVYRHVVALCVIAPFALVLERK  73

Query  1071  IRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRL  892
             IRPRMT+ IFL+IMLL  LEPV+DQNLY+ GMKYT+ATFA+A+ NVLPAITF+LA   RL
Sbjct  74    IRPRMTLPIFLRIMLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFILALCFRL  133

Query  891   EKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVK  712
             E VN++ LHS  K++GT +T+ GAMIMTL +G II +     +  Q+ S   + +H  + 
Sbjct  134   ETVNVKKLHSLAKVIGTVVTLSGAMIMTLYKGPIIDIVRGHSNSAQSSSTESSDQH-WIA  192

Query  711   GAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWA  532
             G +M+ A C  W+ F+ILQ+ TLK YPA LSLT  IC+ G L+  V+TLV+ER N  +W 
Sbjct  193   GPLMLIASCGGWASFFILQSFTLKKYPAQLSLTAWICVMGVLEGGVVTLVMER-NMSVWV  251

Query  531   LHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQL  352
             + WD+  LA VY+G+I SG+ YY+ GV+  E+GP FVT+F+PL MI+ A++G+ +LAEQ+
Sbjct  252   IGWDSRLLASVYSGVICSGLAYYVQGVVNRERGPVFVTSFSPLCMIITAVLGAIVLAEQV  311

Query  351   DFGKIFGAVVIIVGLYLVIWG  289
               G I GA++I+ GLY V+WG
Sbjct  312   HLGSILGAILIVFGLYTVVWG  332



>gb|KCW65508.1| hypothetical protein EUGRSUZ_G02912 [Eucalyptus grandis]
Length=369

 Score =   334 bits (856),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 166/291 (57%), Positives = 209/291 (72%), Gaps = 2/291 (1%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             E  +R L   KPY  V+ LQ  +A  ++++K +LN+GMN ++FVVYR+  A    APFA+
Sbjct  6     ERVIRVLSRLKPYLAVVLLQFGFAGMAIVAKFSLNRGMNQHVFVVYRHAFAIAVVAPFAI  65

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             LFERK RP+MT ++FLKI+LL LLEPVIDQNL+Y GMKYTTA+F  AM N+LPA TFL+A
Sbjct  66    LFERKTRPKMTRSVFLKILLLGLLEPVIDQNLFYTGMKYTTASFTAAMSNMLPAFTFLMA  125

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATE  727
             W  RLE+++IRS HSQ KI+GT +TIGGAMIMTL +G ++ LPWT          G A  
Sbjct  126   WFFRLERLSIRSKHSQAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSTSAHVDLDGVA--  183

Query  726   HDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
                ++GA+MI AGCFCW+ F ILQAITLKSYPA L+LT LICM G  Q  V    +ER N
Sbjct  184   QKPIEGALMITAGCFCWASFIILQAITLKSYPAELTLTTLICMTGTFQGAVFAFAMERSN  243

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMI  394
             +  W++ +D   LA VY+GII SGV YYI GV+M  KGP F+TAFNPL M+
Sbjct  244   FAAWSIQFDVRLLAVVYSGIICSGVGYYIQGVVMQIKGPVFLTAFNPLHMV  294



>ref|XP_009620098.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana tomentosiformis]
Length=371

 Score =   334 bits (856),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 233/330 (71%), Gaps = 4/330 (1%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M  E    + + AKPY  ++ LQ  YA  ++I+K +LN+GM+HY+ VVYR+  A    AP
Sbjct  1     MEGECSCSFYQRAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++ ERKIRP+M++ +FL+I +L LL PVIDQN YYAG+KYT+ TF+ AM N+LPA+TF
Sbjct  61    FALILERKIRPKMSLMMFLQIFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPW-TSKHVPQTQSIG  739
             ++A + R+EKV+++    Q K++GT +T+ GAM+MTL +GH++ L W T+ +VP+    G
Sbjct  121   VMAVLCRMEKVDLKKFRCQAKVLGTIVTVAGAMLMTLYKGHVVNLLWSTNSNVPEVS--G  178

Query  738   PATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
               ++ D VKG++++      W+ F+ILQAIT++ Y A LSLT L+C  G LQS  +T V+
Sbjct  179   ANSDKDWVKGSILLIFATLAWASFFILQAITMRKYTAPLSLTALVCFLGTLQSIAVTFVM  238

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             E     +W + +D   LA  Y GI+ S + YY+ G++M ++GP FVTAF+PL MI+VAI+
Sbjct  239   EH-EPSVWTIGFDMNLLAAAYAGIVSSSIAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIM  297

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             GSF+LAE++  G I GAV+I+ GLY V+WG
Sbjct  298   GSFILAEKIYIGGILGAVLIVAGLYSVLWG  327



>ref|NP_196871.1| nodulin MtN21-like transporter UMAMIT 15 [Arabidopsis thaliana]
 sp|Q9FNA5.1|WTR39_ARATH RecName: Full=WAT1-related protein At5g13670 [Arabidopsis thaliana]
 dbj|BAB08694.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM60998.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AED91926.1| nodulin MtN21-like transporter UMAMIT 15 [Arabidopsis thaliana]
Length=377

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/322 (48%), Positives = 229/322 (71%), Gaps = 4/322 (1%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             + A+P+  ++F+Q  YA  S+++K ALN+GM+ ++ V YR  +A+    PFA++ ER  R
Sbjct  4     ERARPFIAIVFIQCLYALMSIVAKLALNKGMSPHVLVAYRMAVASALITPFALILERNTR  63

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             P++T  I L+I +L+L EPV++QNLYY+GMK TTATF +A+CN LPA+TF++A + +LEK
Sbjct  64    PKLTFKILLQIAILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACVFKLEK  123

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHV---PQTQSIGPATEHDHV  715
             V I   HSQ K+VGT + IGGAM+MT V+G++I LPWTS        T ++    + D  
Sbjct  124   VTIERRHSQAKLVGTMVAIGGAMLMTFVKGNVIELPWTSNSRGLNGHTHAMRIPKQADIA  183

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             +G++M+ A CF WSC+ ILQA  L  Y A LSLT L+C+ G L++TV+ L+ ER N  +W
Sbjct  184   RGSIMLVASCFSWSCYIILQAKILAQYKAELSLTALMCIMGMLEATVMGLIWERKNMSVW  243

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              ++ D T LA +Y G++ SG+ YY+ G    E+GP FV+AFNPLSM++VAI+ +F+  E+
Sbjct  244   KINPDVTLLASIYGGLV-SGLAYYVIGWASKERGPVFVSAFNPLSMVLVAILSTFVFLEK  302

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G++ G+VVI++G+YLV+WG
Sbjct  303   VYVGRVIGSVVIVIGIYLVLWG  324



>dbj|BAD35697.1| putative MtN21 [Oryza sativa Japonica Group]
Length=389

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 222/331 (67%), Gaps = 9/331 (3%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R L  AKPY  ++ LQ+ +A   ++S ++L +GMNH++ VVYRN++A V  APFA+L ER
Sbjct  5     RALSDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFALLLER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
              +RP+MT+ IFLKIM LA+LEPV+DQNLYY G K T+A FA+A+ N+LPA+TFLLA +LR
Sbjct  65    GVRPKMTLRIFLKIMGLAILEPVLDQNLYYMGAKLTSAGFASALVNILPAVTFLLAVLLR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH-  718
             +EKV +RSLHSQ KI GT  T+ GA++M +  G ++  PW+S                  
Sbjct  125   MEKVRLRSLHSQAKIAGTVFTVAGAVLMIMYHGPVVQFPWSSSASGSAGHHVDGAAAAAA  184

Query  717   --------VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLV  562
                     + G VM+   C CWS F+ILQ  TL+SYPA LSLT LIC+ G+  S  + LV
Sbjct  185   TASSASSWLNGTVMLVGSCVCWSGFFILQNNTLQSYPAELSLTALICVLGSAMSGAVALV  244

Query  561   VERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAI  382
              ER +  +W + +DT     VY+GI+ SGV YY+ G++   +GP FVTAF PL MI+ A+
Sbjct  245   AERRDMSVWVIGFDTRLFTAVYSGIVCSGVAYYVQGLVTRARGPVFVTAFQPLCMIITAV  304

Query  381   VGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +GS +L E++  G + GAV+I+VGLY +IWG
Sbjct  305   LGSTILKEEITLGSVIGAVIIVVGLYALIWG  335



>ref|XP_009800321.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana sylvestris]
Length=399

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 232/330 (70%), Gaps = 7/330 (2%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M  E    + + AKPY  ++ LQ  YA  ++I+K +LN+GM+HY+ VVYRN  A    AP
Sbjct  1     MEGECSCSFYQRAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRNAFATAVIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++ ERKIRP+M++ +FL+I +L LL PVID+N YYAG+KYT+ TF+ AM N+LPA+TF
Sbjct  61    FALILERKIRPKMSLMMFLQIFVLGLLGPVIDENFYYAGLKYTSPTFSCAMSNMLPAMTF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPW-TSKHVPQTQSIG  739
             ++A++ R+EKV+++    Q K++GT +T+ GAM+MTL +GH++ L W T+  VP+T S  
Sbjct  121   VMAFLCRMEKVDLKKFRCQAKVLGTIVTVAGAMLMTLYKGHVVNLLWSTNSSVPETNS--  178

Query  738   PATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
                + D  KG++++      W+ F+ILQAIT++ Y A LSLT L+C  G LQS  +T V+
Sbjct  179   ---DKDWFKGSILLIFATLVWASFFILQAITMRKYTAPLSLTALVCFMGTLQSIAVTFVM  235

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             +     +W + +D   LA  Y GI+ S + YY+ GV+M ++GP FVTAF+PL MI+VAI+
Sbjct  236   DH-KPSVWTIGFDINLLAAAYAGIVSSSIAYYVQGVVMEKRGPVFVTAFSPLMMIIVAIM  294

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             GSF+LAE++  G I GA++I+ GLY V+WG
Sbjct  295   GSFILAEKIYIGGILGAMLIVAGLYSVLWG  324



>ref|XP_004983289.1| PREDICTED: WAT1-related protein At4g08290-like [Setaria italica]
Length=364

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 225/320 (70%), Gaps = 3/320 (1%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             +  KPY  ++FLQ  +A   LIS ++L QGM+HY+ VVYRN +AAV  APFA+ FERK R
Sbjct  8     RKVKPYMAMVFLQFGFAGMFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFERKTR  67

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             P+MT++IF KI+ L LLEPV+DQN  Y G+  T+A+F++A+ N+LPA+TF+ A ILR+E+
Sbjct  68    PKMTLSIFFKILALGLLEPVLDQNFIYMGVNNTSASFSSALTNILPAVTFVNAIILRMER  127

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH-VKG  709
             +NI+   SQ KI GT +T+GGA++M L +G I+  PWT K V    S   A    H + G
Sbjct  128   INIKERRSQAKIAGTAITVGGALLMILFKGPIVNFPWT-KDVSHAVSDSGAHNGGHWLMG  186

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
               MI   CFCWS F+ILQ+ TL+SYP+ LSLT LIC  GA +S  + LV+ER +   W++
Sbjct  187   TFMILLSCFCWSAFFILQSYTLRSYPSELSLTTLICALGATESGAVALVMER-DTKTWSI  245

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              +D      +Y+GI+ SGV YY+ G+++ E+GP FVTAF+PL MI+V ++GS +L+E + 
Sbjct  246   GFDMRLFTAIYSGIMCSGVAYYVQGIVIKERGPVFVTAFSPLCMIIVTLLGSIILSEVVT  305

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G++ GA VI+ GLY +IWG
Sbjct  306   LGRLIGATVIVFGLYALIWG  325



>ref|XP_003542469.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=379

 Score =   333 bits (853),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 236/323 (73%), Gaps = 5/323 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
              W +  KP   V+ +Q  YAA  ++SK+A+N+GM++Y+FVVYR+ +A    AP A  F++
Sbjct  5     NWFERVKPLAAVVSMQFGYAAMDVLSKAAMNKGMSNYVFVVYRHAVAFFVMAPLAWFFDK  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K+RP+MT++IF+KI +L+LLEPVIDQNLY+ GMKYTTATFA A  N+LPAITF+ A ILR
Sbjct  65    KVRPKMTLSIFMKIAVLSLLEPVIDQNLYFLGMKYTTATFAVATTNMLPAITFIFACILR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHI-IGLPWTSKHVPQTQSIGPATEHDH  718
             LEK+ I+S+ SQ K+VGT  T+ GAM+MTL++G + +G   ++ H    Q  G + +H  
Sbjct  125   LEKIKIKSIRSQAKVVGTLATVSGAMVMTLLKGPVLLGSHRSNDH---GQHNGTSMQHT-  180

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             + G +MI  GCF W+CF ILQAITLK+YPA LSL+  IC+ G ++   + L++ERGN  +
Sbjct  181   ITGFIMITIGCFSWACFVILQAITLKTYPAELSLSAWICLMGTIEGAAVALIMERGNPSV  240

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             W+L  D   L  VY GI+ SG+ YY+ GV+M  +GP FVTAF+PL M++VA++  F+LAE
Sbjct  241   WSLKLDMKLLCAVYTGIVCSGMGYYLQGVVMKTRGPVFVTAFSPLCMVIVAVMSYFILAE  300

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             Q+  G++ GAV+I +GLY+V+WG
Sbjct  301   QVFLGRMIGAVIICLGLYVVVWG  323



>ref|XP_006349970.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum tuberosum]
Length=440

 Score =   335 bits (859),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/325 (50%), Positives = 231/325 (71%), Gaps = 5/325 (2%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             L  AKP+F V+FLQL  +   ++SK ALN+G ++Y++VVYR  +A +F APFA+  ++  
Sbjct  5     LIRAKPFFAVVFLQLGLSGMYILSKMALNEGSSNYVYVVYRQAVATLFMAPFAIFLDKGK  64

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MT +IF K++LL++LEPVIDQNLY  G+KYTTATFA AM N LPAITF+++WI R E
Sbjct  65    RPKMTFSIFAKLVLLSILEPVIDQNLYSLGLKYTTATFAAAMYNTLPAITFIMSWIFRQE  124

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGL-P----WTSKHVPQTQSIGPATEH  724
             KVN  S+ SQ KI+GT  T+GGAMIM LVRG  + L P    + + +    Q  G     
Sbjct  125   KVNFTSIGSQLKIIGTIATLGGAMIMMLVRGPEVQLFPTDDYYVNNNDASDQISGGINPI  184

Query  723   DHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNY  544
             D +KG++MI  GC   + F ILQ   L++YPA LSL   IC+ G ++  ++ +++ERGN 
Sbjct  185   DAIKGSLMIMLGCTSGAGFIILQTKILQTYPAELSLHTWICLLGTIEGGIMAMIMERGNS  244

Query  543   GIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFML  364
              +W ++WD+ FLA VY+GI  SG+ YYI GVI+ ++   F++AFNPL++++VAI+ S +L
Sbjct  245   AVWIINWDSKFLAVVYSGIFGSGLAYYIQGVILEDRSSLFISAFNPLNILIVAIISSIIL  304

Query  363   AEQLDFGKIFGAVVIIVGLYLVIWG  289
              EQ++ G+I G VVII+GLY+++WG
Sbjct  305   QEQMNLGRILGVVVIIIGLYIILWG  329



>gb|EMT33815.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=385

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/320 (49%), Positives = 220/320 (69%), Gaps = 0/320 (0%)
 Frame = -2

Query  1248  LKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKI  1069
             +   KPY  ++ LQ+ +A   +++ ++L +GM+H++ VVYRN++A    APFA+ FER +
Sbjct  6     VSDVKPYLAMVLLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLVATAVMAPFALYFERGL  65

Query  1068  RPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLE  889
             RP+MTITIF+KIM LA LEPV+DQNLYY G K T+A FA A+ N+LPA+TF+LA ILR+E
Sbjct  66    RPKMTITIFIKIMGLAFLEPVLDQNLYYMGAKLTSAGFAAALINILPAVTFVLALILRME  125

Query  888   KVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKG  709
             KV +RSLHSQ KI GT LT+ GA++M L  G  +  PWT      + +   A     +KG
Sbjct  126   KVRLRSLHSQAKIAGTVLTVAGAVLMILYHGPAVQFPWTKGQHHASGAAAGADAAAWLKG  185

Query  708   AVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWAL  529
              +M+ A C  WSCF++LQ+ TL+ YP+ LSLT LIC  G++ ST + LV ER N   W +
Sbjct  186   TIMVIAACVAWSCFFVLQSSTLRDYPSELSLTVLICGVGSVMSTGVALVAERANTQAWVI  245

Query  528   HWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLD  349
              +D        +G + SGV YY+ G++  ++GP FVTAFNPL MI+ A++GS +L E++ 
Sbjct  246   GFDARLFTSRSDGEVCSGVAYYVQGIVSKQRGPVFVTAFNPLCMIITAVMGSIILKEEIT  305

Query  348   FGKIFGAVVIIVGLYLVIWG  289
              G + GAV+I+VGLY +IWG
Sbjct  306   LGSVIGAVIIVVGLYFLIWG  325



>gb|EAZ00107.1| hypothetical protein OsI_22111 [Oryza sativa Indica Group]
Length=389

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 222/331 (67%), Gaps = 9/331 (3%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R L  AKPY  ++ LQ+ +A   ++S ++L +GMNH++ VVYRN++A V  APFA+L ER
Sbjct  5     RALSDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFALLLER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
              +RP+MT+ IFLKIM LA+LEPV+DQNLYY G K T+A FA+A+ N+LPA+TFLLA +LR
Sbjct  65    GVRPKMTVRIFLKIMGLAILEPVLDQNLYYMGAKLTSAGFASALVNILPAVTFLLAVLLR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH-  718
             +EKV +RSLHSQ KI GT  T+ GA++M +  G ++  PW+S                  
Sbjct  125   MEKVRLRSLHSQAKIAGTVFTVAGAVLMIMYHGPVVQFPWSSSASGSAGHHVDGAAAAAA  184

Query  717   --------VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLV  562
                     + G VM+   C CWS F+ILQ  TL+SYPA LSLT LIC+ G+  S  + LV
Sbjct  185   TASSASSWLNGTVMLVGSCVCWSGFFILQNNTLQSYPAELSLTALICVLGSAMSGAVALV  244

Query  561   VERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAI  382
              ER +  +W + +DT     VY+GI+ SGV YY+ G++   +GP FVTAF PL MI+ A+
Sbjct  245   AERRDMSVWVIGFDTRLFTAVYSGIVCSGVAYYVQGLVTRARGPVFVTAFQPLCMIITAV  304

Query  381   VGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +GS +L E++  G + GAV+I+VGLY +IWG
Sbjct  305   LGSTILKEEITLGSVIGAVIIVVGLYALIWG  335



>gb|KGN54575.1| hypothetical protein Csa_4G365050 [Cucumis sativus]
Length=374

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/377 (45%), Positives = 245/377 (65%), Gaps = 16/377 (4%)
 Frame = -2

Query  1275  MGNES----FVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAV  1108
             MG E+    F   ++  KPY  ++ LQ  YA   +I+   L +GMNHY+  VYR+++A +
Sbjct  1     MGAETGLAMFCGMIQKIKPYLAMVSLQFGYAGMYIITMLCLKKGMNHYVLAVYRHVVATI  60

Query  1107  FFAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLP  928
                PFA++ ERKIRP+MT+ IF +++LL  LEPV+DQNLYY G+K T+ATF +   N+LP
Sbjct  61    VITPFAIVLERKIRPKMTLGIFARVLLLGFLEPVLDQNLYYVGLKLTSATFTSVTINILP  120

Query  927   AITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGL-PWTSKHVPQT  751
             A+TF++A I RLE VN + + S  K+ GT +TIGGAM+MTL +G I+ +     +H    
Sbjct  121   AVTFIMALIFRLESVNFKKIRSIAKVAGTLVTIGGAMVMTLYKGPIVDIFHGHGRHAAHN  180

Query  750   QSIGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVL  571
              S   + +   V G +M+      WS F+ILQ+ TL+ YPA LSLT LIC+AGA++ +++
Sbjct  181   SSSSESADQHWVLGTLMLLGSIVGWSGFFILQSFTLRKYPAELSLTALICVAGAVEGSIV  240

Query  570   TLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIM  391
             TL++ER ++ +W + WD+  LA VY G+I SG+ YYI GV++ E+GP FVT+F PL MI+
Sbjct  241   TLIMER-DFTVWVIGWDSRLLAAVYTGVICSGLAYYIQGVVIRERGPVFVTSFTPLCMII  299

Query  390   VAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESI  211
              AI+GS +LAEQ+  G I GA+ I++GLYLV+WGK+KD            N L+N K + 
Sbjct  300   TAILGSIVLAEQIHLGSIIGAIFIVMGLYLVVWGKAKDHI----------NKLTNQKSNA  349

Query  210   LTKQSAEQKIDDTIKIR  160
              T+     + + T   R
Sbjct  350   ATELPITNEPETTAAER  366



>ref|XP_008802062.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=373

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 221/318 (69%), Gaps = 1/318 (0%)
 Frame = -2

Query  1242  HAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRP  1063
              AKPY  ++FLQ  ++   +IS + L +GM+HY+ VVYRN IAA    PFA+ FERK+RP
Sbjct  9     RAKPYMAMVFLQFGFSGMYVISVATLKRGMSHYVLVVYRNAIAAAVILPFALWFERKVRP  68

Query  1062  RMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKV  883
             +MT++ FLKIM L LLEPV+DQNLYY G K T A+F++A+ NVLPA+TFL A +LR+EK+
Sbjct  69    KMTVSNFLKIMALGLLEPVLDQNLYYMGAKNTNASFSSALYNVLPAVTFLSAIVLRMEKI  128

Query  882   NIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAV  703
             N++   SQ KI+GT +T+ GA++M L +G ++   WT        + G   +   + G  
Sbjct  129   NVKKRRSQAKIIGTLVTVVGALLMILYKGPVVEFIWTKGRSHHNNTAGSQDDSHWLAGVF  188

Query  702   MIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHW  523
             M+   CF WS F+ILQ+ TLKSYPA LSLT  IC  GA QS  + LV+ER +   W + +
Sbjct  189   MLLGSCFSWSAFFILQSNTLKSYPAELSLTVWICFMGAAQSGAVALVMER-SVKPWLIGF  247

Query  522   DTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFG  343
             D   L   Y+G++ SG+ YY+ G +M E+GP FVTAFNPL MI+VA++GS +LAE++  G
Sbjct  248   DMRLLTAAYSGVMCSGIAYYVQGKVMKERGPVFVTAFNPLCMIIVAVLGSIILAEEITLG  307

Query  342   KIFGAVVIIVGLYLVIWG  289
             ++ GA++I++GLY +IWG
Sbjct  308   RLIGAIIIVIGLYSLIWG  325



>ref|NP_001048238.1| Os02g0768300 [Oryza sativa Japonica Group]
 dbj|BAD16930.1| putative nodulin MtN21 [Oryza sativa Japonica Group]
 dbj|BAF10152.1| Os02g0768300 [Oryza sativa Japonica Group]
 dbj|BAG93404.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57869.1| hypothetical protein OsJ_08519 [Oryza sativa Japonica Group]
Length=384

 Score =   333 bits (853),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/323 (49%), Positives = 226/323 (70%), Gaps = 1/323 (0%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R +  AKPY  ++ LQ+ +A   +++ ++L +GM+H++ VVYRN+ A    APFA+ FER
Sbjct  5     RVMNDAKPYLAMILLQVGFAGMYVVAVASLKRGMSHFVLVVYRNLFATAVMAPFALWFER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             ++RPR+T+ IFLKIM LA+LEPV+DQNLYY G   T+A FA+A+ NVLPA+TF++A +LR
Sbjct  65    RVRPRLTLIIFLKIMGLAILEPVLDQNLYYMGANLTSAGFASALINVLPAVTFVMALVLR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS-KHVPQTQSIGPATEHDH  718
             +EKV ++S+HSQ KI GT  T+ GA++M L  G ++  PWT  +H       G A     
Sbjct  125   MEKVKLKSVHSQAKIAGTLFTVAGAVLMVLYHGPVVQFPWTKGQHHDGGSGAGGAAGGGF  184

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             ++G + I   C CWS F++LQ+ TL+SYPA LSLT LIC+ G++ S  + LV ER N   
Sbjct  185   LQGTIFIVVACVCWSGFFVLQSNTLQSYPAELSLTTLICLMGSVLSGTVALVAERHNTHA  244

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             W + +DT     VY GI+ SGV YY+ G++  ++GP FVTAFNPL MI+ AI+GS +L E
Sbjct  245   WLIGFDTRLFTCVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAIMGSIILKE  304

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             +++ G + GAV+I++GLY +IWG
Sbjct  305   EINLGSVIGAVIIVIGLYALIWG  327



>gb|EEC74071.1| hypothetical protein OsI_09081 [Oryza sativa Indica Group]
Length=384

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/323 (49%), Positives = 226/323 (70%), Gaps = 1/323 (0%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R +  AKPY  ++ LQ+ +A   +++ ++L +GM+H++ VVYRN+ A    APFA+ FER
Sbjct  5     RVMNDAKPYLAMILLQVGFAGMYVVAVASLKRGMSHFVLVVYRNLFATAVMAPFALWFER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             ++RPR+T+ IFLKIM LA+LEPV+DQNLYY G   T+A FA+A+ NVLPA+TF++A +LR
Sbjct  65    RVRPRLTLIIFLKIMGLAILEPVLDQNLYYMGANLTSAGFASALINVLPAVTFVMALVLR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS-KHVPQTQSIGPATEHDH  718
             +EKV ++S+HSQ KI GT  T+ GA++M L  G ++  PWT  +H       G A     
Sbjct  125   MEKVKLKSVHSQAKIAGTLFTVAGAVLMVLYHGPVVQFPWTKGQHHDGGSGAGGAAGGGF  184

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             ++G + I   C CWS F++LQ+ TL+SYPA LSLT LIC+ G++ S  + LV ER N   
Sbjct  185   LQGTIFIVVACVCWSGFFVLQSNTLQSYPAELSLTTLICLMGSVLSGAVALVAERHNTHA  244

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             W + +DT     VY GI+ SGV YY+ G++  ++GP FVTAFNPL MI+ AI+GS +L E
Sbjct  245   WLIGFDTRLFTCVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAIMGSIILKE  304

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             +++ G + GAV+I++GLY +IWG
Sbjct  305   EINLGSVIGAVIIVIGLYALIWG  327



>gb|EAZ36228.1| hypothetical protein OsJ_20548 [Oryza sativa Japonica Group]
Length=393

 Score =   333 bits (853),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 222/331 (67%), Gaps = 9/331 (3%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R L  AKPY  ++ LQ+ +A   ++S ++L +GMNH++ VVYRN++A V  APFA+L ER
Sbjct  5     RALSDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFALLLER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
              +RP+MT+ IFLKIM LA+LEPV+DQNLYY G K T+A FA+A+ N+LPA+TFLLA +LR
Sbjct  65    GVRPKMTLRIFLKIMGLAILEPVLDQNLYYMGAKLTSAGFASALVNILPAVTFLLAVLLR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH-  718
             +EKV +RSLHSQ KI GT  T+ GA++M +  G ++  PW+S                  
Sbjct  125   MEKVRLRSLHSQAKIAGTVFTVAGAVLMIMYHGPVVQFPWSSSASGSAGHHVDGAAAAAA  184

Query  717   --------VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLV  562
                     + G VM+   C CWS F+ILQ  TL+SYPA LSLT LIC+ G+  S  + LV
Sbjct  185   TASSASSWLNGTVMLVGSCVCWSGFFILQNNTLQSYPAELSLTALICVLGSAMSGAVALV  244

Query  561   VERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAI  382
              ER +  +W + +DT     VY+GI+ SGV YY+ G++   +GP FVTAF PL MI+ A+
Sbjct  245   AERRDMSVWVIGFDTRLFTAVYSGIVCSGVAYYVQGLVTRARGPVFVTAFQPLCMIITAV  304

Query  381   VGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +GS +L E++  G + GAV+I+VGLY +IWG
Sbjct  305   LGSTILKEEITLGSVIGAVIIVVGLYALIWG  335



>ref|XP_008391905.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At4g08300-like 
[Malus domestica]
 ref|XP_008351484.1| PREDICTED: WAT1-related protein At4g08300-like [Malus domestica]
Length=363

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 223/329 (68%), Gaps = 2/329 (1%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             MG      +L   KPY  ++ LQ  Y+   +IS  +   GM+H++  VYR+++A    AP
Sbjct  1     MGESKLSLFLIKIKPYLAMVSLQFGYSGMYIISMVSFKHGMSHFVLSVYRHVVAFCVIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA + ERK+RPRMT+ IFL+I+LL  LEPV+DQNLY+ GMKYT+ATFA+A+ NVLPAITF
Sbjct  61    FAFVLERKVRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++A   RLE VN++ LHS  K++GT +T+GGAMIMTL +G I+ +     H     S   
Sbjct  121   IMALCFRLETVNVKKLHSLAKVIGTVITVGGAMIMTLYKGPIVDIIRGHSH-SHNSSTTE  179

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
             ++E   + G +M+   C  W+ F+ILQ+ TLK YPA LSLT  IC+ G L+  V+T  VE
Sbjct  180   SSEQHWIAGPLMLLGSCGGWASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVE  239

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             R    +W + WD+  LA VY+G++ SG+ YY+ GV++ E+GP FVTAF+PL MI+ A +G
Sbjct  240   R-KLSVWVIGWDSRLLASVYSGVVCSGMAYYVQGVVIRERGPVFVTAFSPLCMIITAALG  298

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             + +LAEQ+  G + GA+ I+ GLY V+WG
Sbjct  299   AIVLAEQVHLGSVIGAICIVFGLYTVVWG  327



>ref|XP_003570554.1| PREDICTED: WAT1-related protein At1g44800-like [Brachypodium 
distachyon]
Length=398

 Score =   333 bits (853),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 220/334 (66%), Gaps = 21/334 (6%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             R L   KPY  ++ LQ+ +A   +++ ++L  GM+H++ VVYRN++A    APFA+ FER
Sbjct  5     RVLNDVKPYLAMVLLQVGFAGMYVVAVASLKGGMSHFVLVVYRNLVATAVMAPFALYFER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
               RP MTI +FLKIM LA LEPV+DQNLY+ G K T+A+FA+A+ N+LPA+TF+LA ILR
Sbjct  65    GQRPPMTIKVFLKIMGLAFLEPVLDQNLYFMGAKLTSASFASALINILPAVTFVLALILR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH-  718
             +EKV +RSLHSQ KI GT LT+ GA++M L  G  +  PWT          G A   +H 
Sbjct  125   MEKVRLRSLHSQAKIAGTVLTVAGAVLMILYHGPAVQFPWTK---------GRAGAANHG  175

Query  717   -----------VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVL  571
                        + G +M  A C  W+CF++LQ+ TL+SYPA LSLT LIC  G+L S  +
Sbjct  176   AGQGQGQGAGWLSGTIMTIAACVAWACFFVLQSSTLQSYPAELSLTVLICAVGSLMSGSV  235

Query  570   TLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIM  391
              LV ERGN   W + +DT     VY GI+ SGV YY+ G++  ++GP FVTAFNPL MI+
Sbjct  236   ALVAERGNTQAWVIGFDTRLFTAVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMII  295

Query  390   VAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
              +++GS +L E++  G + GA +I+ GLY +IWG
Sbjct  296   TSVMGSIILKEEITLGSVIGAAIIVAGLYFLIWG  329



>ref|XP_002302243.2| nodulin MtN21 family protein [Populus trichocarpa]
 gb|EEE81516.2| nodulin MtN21 family protein [Populus trichocarpa]
Length=383

 Score =   332 bits (851),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 164/334 (49%), Positives = 228/334 (68%), Gaps = 7/334 (2%)
 Frame = -2

Query  1275  MGN----ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAV  1108
             MGN    E     LK  KPY  ++ LQ  YA   +I+  +L  GM+HYI  VYR+++A +
Sbjct  1     MGNQTPCEKLYLGLKKVKPYLAMVSLQFGYAGMYIITMVSLKHGMSHYILAVYRHVVATI  60

Query  1107  FFAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLP  928
               APFA++ ERKIRP++T+ IFL+IM L  LEPV+DQNLYY GMKYT+ATFA+A  N LP
Sbjct  61    VIAPFALVLERKIRPKLTLPIFLRIMALGFLEPVLDQNLYYLGMKYTSATFASATVNALP  120

Query  927   AITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQ  748
             AITF++A I RLE VN + LHS  K+VGT +T+ GAM+MTL +G II     S+      
Sbjct  121   AITFIMALIFRLETVNFKKLHSAAKVVGTVITVTGAMVMTLYKGPIIDF-IRSQGAAHRG  179

Query  747   SIGPATEHDH-VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVL  571
             +   A+ + H + G +M+ A C  W+ F+ILQ+ TLK YPA LSLT LICM G ++   +
Sbjct  180   TTSNASGNQHWLTGTLMLLASCCGWASFFILQSFTLKKYPAELSLTALICMTGMVEGAAV  239

Query  570   TLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIM  391
             +LV+ER +   W + +D+  LA  Y+G++ SG+ YY+ GV++ +KGP FVT+F+PL MI+
Sbjct  240   SLVMER-DMSAWKIGFDSRLLAAAYSGVVCSGIAYYVQGVVIRKKGPVFVTSFSPLCMII  298

Query  390   VAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
              A +GS +L+EQ+  G I GAV+I+ GLY V+WG
Sbjct  299   TAALGSVVLSEQIRLGSIIGAVLIVFGLYTVVWG  332



>ref|XP_006482028.1| PREDICTED: WAT1-related protein At5g07050-like [Citrus sinensis]
Length=405

 Score =   333 bits (853),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 230/326 (71%), Gaps = 5/326 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
              +L+  KPY  ++ LQ  YA  ++I+K +LN+GM+HY+ VVYR+  A    APFA+L ER
Sbjct  9     NFLQRCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALLLER  68

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K+RP++T  IF+++ +L LL PVIDQN YYAG+K+T+ TF+ AM N+LPA+TF++A + R
Sbjct  69    KVRPKITFPIFMQLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCR  128

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPA----TE  727
             +EKV I+ +  Q K+VGT +T+ GAM+MT+ +G++I L W+      T S  PA    ++
Sbjct  129   MEKVEIKKIRCQAKMVGTIVTVAGAMLMTIYKGNVINLVWSQHIHSHTSSPVPAATTSSD  188

Query  726   HDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
              D +KG++++      W+ F+ILQA+T++ YPA LSLT ++C  G LQS  +T V+E   
Sbjct  189   KDWLKGSILLILATLAWASFFILQAVTMRRYPAHLSLTAIVCFLGTLQSIAVTFVMEH-K  247

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFM  367
               +W + WD   LA  Y GI+ SG+ YY+ G++M ++GP FVTAF+PL MI+VAI+GSF+
Sbjct  248   ASVWTIGWDMNLLAAAYAGIVSSGIAYYVQGLVMQKRGPVFVTAFSPLMMIIVAIMGSFI  307

Query  366   LAEQLDFGKIFGAVVIIVGLYLVIWG  289
             LAE++  G   GAVVI++GLY V+WG
Sbjct  308   LAEKIYVGGALGAVVIVIGLYAVLWG  333



>ref|XP_006364778.1| PREDICTED: WAT1-related protein At5g07050-like [Solanum tuberosum]
Length=382

 Score =   331 bits (849),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 231/334 (69%), Gaps = 2/334 (1%)
 Frame = -2

Query  1287  DTTIMGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAV  1108
             +   +G      + +  KPY  ++ LQ  YA  ++I+K +LN GM+HY+ VVYR+  A +
Sbjct  2     ENNKVGGGCLSNFYQRGKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATL  61

Query  1107  FFAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLP  928
               APFA+L ERK+RP+MT  +FL+I +L LL PVIDQN YYAG+K+T+ TF+ AM N+LP
Sbjct  62    AIAPFALLLERKLRPKMTFMMFLQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLP  121

Query  927   AITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPW-TSKHVPQT  751
             A+TF++A + R+EKV+I+ L  Q K++GT +T+ GAM+MTL +GH+I L W  + +    
Sbjct  122   AMTFVMAVLCRMEKVHIKKLRCQAKVIGTIVTVAGAMLMTLYKGHVINLVWANTNNTSNV  181

Query  750   QSIGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVL  571
                   ++ D +KG++++    F W+ F+ILQAIT++ Y A LSLT L+C  G LQS  +
Sbjct  182   SQSNETSDKDWLKGSILLIGATFAWASFFILQAITMRKYTAPLSLTALVCFMGTLQSIAV  241

Query  570   TLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIM  391
             TLV+E      WA+ +D   LA VY GI+ S + YY+ G++M ++GP FVTAF+PL MI+
Sbjct  242   TLVMEH-KPSAWAIGFDMNLLAAVYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMII  300

Query  390   VAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             VAI+GSF+LAE++  G + GAV+I+ GLY V+WG
Sbjct  301   VAIMGSFILAEKIYLGGVLGAVLIVAGLYSVLWG  334



>dbj|BAK04730.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   331 bits (848),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 228/322 (71%), Gaps = 6/322 (2%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             + A PY  ++FLQ  YA   L+S ++L QGM+HY+ VVYRN IAAV  APFA+ F+RK R
Sbjct  8     RKAMPYVAMVFLQFGYAGLFLVSVASLRQGMSHYVLVVYRNAIAAVAMAPFALWFDRKTR  67

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             P+MT+++F KI+ LALLEPV+DQN +Y G   T+A+F++A+ N+LPA+TF+ A ++R+E+
Sbjct  68    PKMTLSVFYKIVALALLEPVLDQNFFYIGAHNTSASFSSALTNILPAVTFVNAILIRMER  127

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH---V  715
             +NI+   SQ KI GT +T+GGA++M L  G +I  PWT KH   + ++     H     +
Sbjct  128   INIKERRSQAKIAGTLITVGGALLMVLFSGPVINFPWT-KHA-GSHAVTNTASHSSGCWL  185

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
              G  MI   CFCWS F+ILQ+ TL+SYP+ LSLT LIC  G +QS V+ LV+ER     W
Sbjct  186   LGIFMILLSCFCWSAFFILQSHTLRSYPSELSLTTLICTTGVVQSGVVALVMERDTKA-W  244

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
             A+ +D      VY+GI+ SGV YY+ G+++ E+GP F+TAF PL MI+V ++GSF+L+E 
Sbjct  245   AIGFDMRLFTAVYSGIMCSGVAYYVQGIVIQERGPVFITAFCPLCMIIVTVLGSFILSEV  304

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G+I GA++I+VGLY +IWG
Sbjct  305   ITLGRITGAMIIVVGLYALIWG  326



>ref|XP_002517269.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF45062.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=372

 Score =   331 bits (848),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 234/333 (70%), Gaps = 8/333 (2%)
 Frame = -2

Query  1272  GNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPF  1093
             GN     +++  KPY  ++ LQ  YA  ++I+K +LN+GM+HY+ VVYR+  A +  APF
Sbjct  3     GNGCLGSFIQRCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATLAIAPF  62

Query  1092  AMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFL  913
             A++ ERK+RP++T  +F++I +L LL PVIDQN YYAG+K+T+ TF+ AM N+LPA+TF+
Sbjct  63    ALVLERKVRPKITFPMFMQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFV  122

Query  912   LAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPA  733
             +A + R+EKV+I+ +  Q K++GT +T+ GAM+MTL +GH+I   W S+HV  +Q+  PA
Sbjct  123   MAVLCRMEKVDIKKVRCQAKVIGTIVTVAGAMLMTLYKGHVINFIW-SEHV-HSQTSAPA  180

Query  732   -----TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLT  568
                  ++ D +KG++++      W+ F+ILQA+TL+ Y A LSLT L+C  G LQS  +T
Sbjct  181   ATTGSSDKDWLKGSILLIIATLAWASFFILQAVTLRRYAAQLSLTSLVCFMGTLQSIAVT  240

Query  567   LVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMV  388
              V+E      W + WD   LA  Y GI+ SG+ YY+ G++M ++GP FVTAF+PL MI+V
Sbjct  241   FVMEH-KPSAWTIGWDMNLLAAAYAGIVSSGIAYYVQGLVMQKRGPVFVTAFSPLMMIIV  299

Query  387   AIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             AI+GSF+L E++  G + GAV+I+ GLY V+WG
Sbjct  300   AIMGSFILTEKIFLGGVLGAVLIVAGLYAVLWG  332



>ref|XP_009340894.1| PREDICTED: WAT1-related protein At1g21890-like [Pyrus x bretschneideri]
Length=363

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 222/329 (67%), Gaps = 2/329 (1%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             MG      +L   KPY  ++ LQ  Y+   +IS  +   GM+H++  VYR+++A    AP
Sbjct  1     MGESKLSLFLIKIKPYLAMISLQFGYSGMYIISMVSFKHGMSHFVLSVYRHVVAFCVIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA   ERKIRPRMT+ IFL+I+LL  LEPV+DQNLY+ GMKYT+ATFA+A+ NVLPAITF
Sbjct  61    FAFFLERKIRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++A    LE VN++ LHS  K++GT +T+GGAMIMTL +G I+ +     H   + + G 
Sbjct  121   IMALCFGLETVNVKKLHSLAKVIGTVITVGGAMIMTLYKGPIVDIIRGHSHSHNSSTTGS  180

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
               +H  + G +M+   C  W+ F+ILQ+ TLK YPA LSLT  IC+ G L+  V+T  VE
Sbjct  181   GEQH-WIAGPLMLIGSCGGWASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVE  239

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             R    +W + WD+  LA VY+G++ SG+ YY+ GV++ E+GP FVTAF+PL MI+ A +G
Sbjct  240   R-KLSVWVIGWDSRLLASVYSGVVCSGIAYYVQGVVIRERGPVFVTAFSPLCMIITAGLG  298

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             + +LAEQ+  G I GA+ I+ GLY V+WG
Sbjct  299   AIVLAEQVHLGSIIGAICIVFGLYTVVWG  327



>gb|KHN48995.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=379

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/323 (51%), Positives = 236/323 (73%), Gaps = 5/323 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
              W +  KP   V+ +Q  YAA  ++SK+A+N+GM++Y+FVVYR+ +A    AP A  F++
Sbjct  5     NWFERVKPLAAVVSMQFGYAAMDVLSKAAMNKGMSNYVFVVYRHAVAFFVMAPLAWFFDK  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K+RP+MT++IF+KI +L+LLEPVIDQNLY+ GMKYTTATFA A  N+LPAITF+ A ILR
Sbjct  65    KVRPKMTLSIFMKIAVLSLLEPVIDQNLYFLGMKYTTATFAVATTNMLPAITFIFACILR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHI-IGLPWTSKHVPQTQSIGPATEHDH  718
             LEK+ I+S+ SQ K+VGT  T+ GAM+MTL++G + +G   ++ H    Q  G + +H  
Sbjct  125   LEKIKIKSIRSQAKVVGTLATVSGAMVMTLLKGPVLLGSHRSNDH---GQHNGTSMQHT-  180

Query  717   VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGI  538
             + G +MI  GCF W+CF ILQAITLK+YPA LSL+  IC+ G ++   + L++ERGN  +
Sbjct  181   ITGFIMITIGCFSWACFVILQAITLKTYPAELSLSAWICLMGTIEGAAVALIMERGNPSV  240

Query  537   WALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAE  358
             W+L  D   L  VY GI+ SG+ YY+ GV++  +GP FVTAF+PL M++VA++  F+LAE
Sbjct  241   WSLKLDMKLLCAVYTGIVCSGMGYYLQGVVIKTRGPVFVTAFSPLCMVIVAVMSYFILAE  300

Query  357   QLDFGKIFGAVVIIVGLYLVIWG  289
             Q+  G++ GAV+I +GLY+V+WG
Sbjct  301   QVFLGRMIGAVIICLGLYVVVWG  323



>ref|XP_010916579.1| PREDICTED: WAT1-related protein At1g21890-like [Elaeis guineensis]
Length=376

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 218/316 (69%), Gaps = 1/316 (0%)
 Frame = -2

Query  1236  KPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIRPRM  1057
             KPY  ++FLQ  YA   LIS + L QGM+HY+ VVYRN IAA    PFA+ FERK RP+M
Sbjct  11    KPYLAMVFLQFGYAGMYLISVATLKQGMSHYVLVVYRNAIAAAVIFPFALWFERKARPKM  70

Query  1056  TITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEKVNI  877
             T++ FLKIM LALLEPV+DQN YY G K T A+FA+A+ NVLPA+TF+ A +LR+EK+ I
Sbjct  71    TVSNFLKIMALALLEPVLDQNFYYMGAKNTNASFASALYNVLPAVTFMNAILLRMEKIEI  130

Query  876   RSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDHVKGAVMI  697
             +   SQ KI+G  +T+ GA++M L +G ++   WT        + G   +   + G  M+
Sbjct  131   KKRRSQAKIIGALVTVVGALLMILYKGPVVEFIWTKGRNHHNNTAGSQDDGHWLAGVFML  190

Query  696   AAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIWALHWDT  517
                CFCWS F++LQ+ TLKSYPA LSLT  IC  GA+QS  + LV+ER +   W + +D 
Sbjct  191   LLSCFCWSAFFVLQSHTLKSYPAELSLTTWICSMGAVQSGAVALVMER-SAKPWLIGFDM  249

Query  516   TFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQLDFGKI  337
              FL   Y+GI+ SG+ YY+  ++M E+GP FVTAFNPL MI+VA++GS +L E++  G++
Sbjct  250   RFLTAAYSGIMCSGIAYYVQAIVMKERGPVFVTAFNPLCMIIVAVLGSIVLGEEITVGRV  309

Query  336   FGAVVIIVGLYLVIWG  289
              GA +I++GLY +IWG
Sbjct  310   IGASIIVIGLYSLIWG  325



>ref|XP_010544709.1| PREDICTED: WAT1-related protein At4g08290 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010544717.1| PREDICTED: WAT1-related protein At4g08290 isoform X2 [Tarenaya 
hassleriana]
Length=389

 Score =   330 bits (847),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/329 (48%), Positives = 227/329 (69%), Gaps = 7/329 (2%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
             +E F +W    KPY  ++ LQ   A   +I  + L++G N Y+ + YRN +AA+  +PFA
Sbjct  5     SEIFEKW----KPYVLMICLQFGGAGMYIILMATLSRGQNRYVLIFYRNAVAALVLSPFA  60

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             + FERK+RP+MT T+FL+IM L  LEP++DQ   Y GMK T+A++ +A+ N LP+ITF++
Sbjct  61    LFFERKVRPKMTFTVFLQIMALGFLEPILDQGFGYLGMKLTSASYTSAIMNALPSITFVI  120

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVP-QTQSIGPA  733
             A +LR EKVNI+ + SQ K++GT +T+GGA+ MTL +G ++ LPW+ +++     +    
Sbjct  121   ALVLRQEKVNIKEVRSQAKVIGTLVTLGGALAMTLYKGPVVPLPWSDQNLDGHNGNTNDT  180

Query  732   TEHDH-VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
              +H H + G ++I  GC  WS FY+LQ+IT+K YPA LSL+ LIC AGA QS  + LV+E
Sbjct  181   QDHAHWIAGTMLILLGCVAWSGFYVLQSITIKKYPAELSLSALICFAGAAQSLAVALVME  240

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             R + G WA+ WD    A +Y GII SG+ YY+ G++M  +GP FVTAFNPL M++VA++ 
Sbjct  241   RRSSG-WAVGWDARLFAPLYTGIISSGLTYYVQGMVMKTRGPVFVTAFNPLCMVLVAVLA  299

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             SF+L EQ+  G + G VVI VGLY V+WG
Sbjct  300   SFILHEQIHLGSVIGGVVIAVGLYSVVWG  328



>ref|XP_002489200.1| hypothetical protein SORBIDRAFT_0012s002110 [Sorghum bicolor]
 gb|EES20205.1| hypothetical protein SORBIDRAFT_0012s002110 [Sorghum bicolor]
Length=368

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 243/368 (66%), Gaps = 20/368 (5%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             +   PY  ++FLQL +A   LIS ++L QGM+HY+ VVYRN+ AA+  APFA+ FERK R
Sbjct  8     RKVMPYMAMVFLQLGFAGMFLISVASLRQGMSHYVLVVYRNVAAAIVMAPFALWFERKTR  67

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             P++++++F+KI+ L LLEPV+DQN  Y G+  T+A+FA+A+ N+LPA+TF+ A ILR+E+
Sbjct  68    PKLSLSVFIKILALGLLEPVLDQNFIYMGVNSTSASFASALTNILPALTFVNAIILRMER  127

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH---V  715
             +  +   S  KI GT +T+GGA++M L +G  +  PW SKHV    S+  +  H+    +
Sbjct  128   IETKERRSLAKIAGTAITVGGALLMILFKGPNVNCPW-SKHVIN-DSVSDSGAHNSGHWL  185

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
              G  MI   CFCWS F+ILQ+ TL+SYP GLSLT LIC  GA++S  + LV+ER     W
Sbjct  186   MGTFMILLSCFCWSAFFILQSYTLRSYPCGLSLTTLICATGAMESGAVALVMERDTKA-W  244

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
             ++ +D      VY+GI+ SGV YY+ G+++ E+GP FVTAF+PL MI+V ++GSF+L+E 
Sbjct  245   SIGFDIRLFTAVYSGIMCSGVAYYVQGIVIKERGPVFVTAFSPLCMIIVTVLGSFILSEV  304

Query  354   LDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESILTKQSAEQKIDD  175
             +  G++ GA VI+VGLY +IWGK+ D             ++ NNKE    + S E+    
Sbjct  305   VTLGRLIGATVIVVGLYALIWGKNMDHL----------KSIDNNKE----ENSFEKHKSF  350

Query  174   TIKIRTVD  151
              +   T D
Sbjct  351   ELSFSTSD  358



>ref|XP_008646318.1| PREDICTED: WAT1-related protein At1g44800-like [Zea mays]
 gb|AFW73640.1| hypothetical protein ZEAMMB73_930197 [Zea mays]
Length=394

 Score =   330 bits (847),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/337 (47%), Positives = 220/337 (65%), Gaps = 25/337 (7%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             + L   KPY  ++ LQ+ +A   +++ ++L +GM+H++ VVYRN+ A    APFA+ FER
Sbjct  5     KVLNDVKPYLAMVLLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLCATAVMAPFALWFER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
               RPRMTITIFLKIM LA+LEPV+DQNLYY G   T+A FA+A+ N+LPA+TF++A +LR
Sbjct  65    NARPRMTITIFLKIMGLAMLEPVLDQNLYYMGANLTSAGFASALINILPAVTFVMALVLR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHDH-  718
             +EKV +RS+HSQ KI GT LT+ GA++M L  G ++  PW+               HD  
Sbjct  125   MEKVRLRSVHSQAKIAGTVLTVAGAVLMVLYHGPVVQFPWSKGQ----------HHHDSA  174

Query  717   --------------VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQS  580
                           + G + I   C CWS F++LQA TLKSYPA LSLT LIC+ G+L S
Sbjct  175   GGQGANSAAAAGGFLTGIITIVIACVCWSAFFVLQANTLKSYPAELSLTALICLMGSLMS  234

Query  579   TVLTLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLS  400
               + LV ER N   W + +DT     VY GI+ SGV YY+ G++  ++GP FVTAFNPL 
Sbjct  235   GSVALVAERRNTQAWVIGFDTRLFTAVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLC  294

Query  399   MIMVAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             MI+ A++GS +L E++  G + GA +I++GLY +IWG
Sbjct  295   MIITAVMGSIILKEEITLGSVIGAAIIVLGLYALIWG  331



>gb|EYU20823.1| hypothetical protein MIMGU_mgv1a008005mg [Erythranthe guttata]
Length=388

 Score =   330 bits (846),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 232/326 (71%), Gaps = 5/326 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
              +++ AKPY  ++ LQ  YA  ++I+K +LN GM+HY+ VVYR+  A    APFA+L ER
Sbjct  7     NFMEKAKPYIAMICLQFGYAGMNIITKVSLNSGMSHYVLVVYRHAFATAAIAPFALLLER  66

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             K+RP++T TIF+++ +L LL PVIDQN YYAG+KYT+ TF+ AM N+LPA+TF++A + R
Sbjct  67    KVRPKITFTIFMQLFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMAVLCR  126

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPAT----E  727
             +EKV+I+ +  Q K++GT +T+ GAM+MT+ +GH+I + W++   P++ +  P+T    +
Sbjct  127   MEKVDIKKVRCQAKVIGTVVTVAGAMLMTVYKGHVINMFWSNYIHPRSNNNNPSTPQNAD  186

Query  726   HDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
              D + G++++      W+ F+ILQAITL+ Y A LSLT ++C  G LQS  +TLV+E   
Sbjct  187   KDWLMGSILLILATLAWASFFILQAITLRKYTAQLSLTAIVCFLGTLQSIAVTLVMEHKT  246

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFM  367
                W + +D   LA  Y GI+ S + YY+ G++M ++GP FVTAF+PL MI+VAI+GSF+
Sbjct  247   -DAWKIGFDMNLLAAAYAGIVSSSIAYYVQGLVMQKRGPVFVTAFSPLMMIIVAIMGSFI  305

Query  366   LAEQLDFGKIFGAVVIIVGLYLVIWG  289
             LAE +  G + GAV+I++GLY V+WG
Sbjct  306   LAENIYLGGVLGAVLIVIGLYSVLWG  331



>emb|CDP06236.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   330 bits (847),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/379 (44%), Positives = 244/379 (64%), Gaps = 13/379 (3%)
 Frame = -2

Query  1272  GNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPF  1093
             G      +   AKPYF ++ LQ  YA  ++I+K +LN+GM+HY+ VVYR+  A    APF
Sbjct  3     GKGCLGNFFHSAKPYFAMICLQFGYAGMNVITKVSLNRGMSHYVLVVYRHAFATAVIAPF  62

Query  1092  AMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFL  913
             A+  ERK+RP++T  IF++I +L LL PVIDQN YYAG+K+T+ TF+ AM N+LPA+TF+
Sbjct  63    AIFLERKVRPKITFPIFMQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFV  122

Query  912   LAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS---KHVPQTQSI  742
             +A + R+EKV+I+ +  Q K++GT +T+ GAM+MTL +GH+I L W+     H     + 
Sbjct  123   MAVLCRMEKVHIKKIRCQAKVIGTVVTVAGAMLMTLYKGHVINLVWSEHVQPHYSSAPAA  182

Query  741   GPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLV  562
                ++ D VKG++++      W+ F+ILQA T+K Y A LSLT L+C  G LQS  +T V
Sbjct  183   AAISDKDWVKGSILLILATLAWASFFILQAFTMKRYTAPLSLTSLVCFMGTLQSIAVTFV  242

Query  561   VERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAI  382
             +E     +W + WD   LA  Y GI+ S + YY+ G++M ++GP FVTAF+PL MI+VAI
Sbjct  243   MEH-KASVWTIGWDINLLAAAYAGIVSSSIAYYVQGLVMEKRGPVFVTAFSPLMMIIVAI  301

Query  381   VGSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksse--ddDNNALSNNKESIL  208
             +GSF+LAE++  G + GA++I+ GLY V+WGK K+     +    +       NN +S+L
Sbjct  302   MGSFILAEKIYVGGVLGAILIVFGLYSVLWGKYKEYQEKVADIIPEAVKGGAGNNSQSVL  361

Query  207   TKQSAEQKIDDTIKIRTVD  151
                     IDD I+   V+
Sbjct  362   A-------IDDDIEANIVE  373



>ref|XP_004249118.1| PREDICTED: WAT1-related protein At5g07050 [Solanum lycopersicum]
Length=383

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/338 (47%), Positives = 233/338 (69%), Gaps = 9/338 (3%)
 Frame = -2

Query  1287  DTTIMGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAV  1108
             +   +G      + +  KPY  ++ LQ  YA  ++I+K +LN GM+HY+ VVYR+  A +
Sbjct  2     ENNKVGGGCLSNFYQRGKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATL  61

Query  1107  FFAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLP  928
               APFA+L ERK+RP+MT  +F +I +L LL PVIDQN YYAG+K+T+ TF+ AM N+LP
Sbjct  62    AIAPFALLLERKLRPKMTFMMFFQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLP  121

Query  927   AITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPW-----TSKH  763
             A+TF++A + R+EKV+I+ L  Q K++GT +T+ GAM+MTL +GH+I L W     T+ +
Sbjct  122   AMTFVMAVLCRMEKVHIKKLRCQAKVIGTIVTVAGAMLMTLYKGHVINLVWSNNIHTNNN  181

Query  762   VPQTQSIGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQ  583
             V Q+      ++ D +KG++++    F W+ F+ILQAIT+K Y A LSLT L+C  G LQ
Sbjct  182   VSQSNE---TSDKDWLKGSILLIGATFAWASFFILQAITMKKYTAPLSLTTLVCFMGTLQ  238

Query  582   STVLTLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPL  403
             S  +TLV+E      WA+ +D   LA  Y GI+ S + YY+ G++M ++GP FVTAF+PL
Sbjct  239   SIAVTLVMEH-KPSAWAVGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPL  297

Query  402   SMIMVAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
              MI+VAI+GSF+LAE++  G + GAV+I+ GLY V+WG
Sbjct  298   MMIIVAIMGSFILAEKIYLGGVLGAVLIVAGLYSVLWG  335



>ref|XP_008444144.1| PREDICTED: WAT1-related protein At1g44800-like [Cucumis melo]
Length=374

 Score =   329 bits (844),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/377 (45%), Positives = 244/377 (65%), Gaps = 16/377 (4%)
 Frame = -2

Query  1275  MGNES----FVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAV  1108
             MG E+    F   ++  KPY  ++ LQ  YA   +I+   L +GMNHY+  VYR+++A +
Sbjct  1     MGAETGLAMFCGIIQKIKPYLAMVSLQFGYAGMYIITMLCLKKGMNHYVLAVYRHVVATI  60

Query  1107  FFAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLP  928
                PFA++ ERKIRP+MT+ IF +++LL  LEPV+DQNLYY G+K T+ATF +   N+LP
Sbjct  61    VIVPFAIVLERKIRPKMTLAIFARVLLLGFLEPVLDQNLYYVGLKLTSATFTSVTINILP  120

Query  927   AITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQ  748
             A+TF++A I RLE VN + + S  K+VGT +TIGGAM+MTL +G I+ +           
Sbjct  121   AVTFIMALIFRLESVNFKKIRSIAKVVGTLVTIGGAMVMTLYKGPIVDIFHGHGRHAAHH  180

Query  747   SIGPATEHDH-VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVL  571
             S    +   H V G +M+      WS F+ILQ+ TL+ YPA LSLT LIC+AGA++ +++
Sbjct  181   SSSSESADQHWVLGTLMLLGSIVGWSGFFILQSFTLRKYPAELSLTALICVAGAVEGSIV  240

Query  570   TLVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIM  391
             TL++ER ++ +W + WD+  LA VY G+I SG+ YYI GV++ E+GP FVT+F PL MI+
Sbjct  241   TLIMER-DFSVWVIGWDSRLLAAVYTGVICSGLAYYIQGVVIRERGPVFVTSFTPLCMII  299

Query  390   VAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESI  211
              AI+GS +LAEQ+  G I GA+ I++GLYLV+WGK+KD            N L+N K S 
Sbjct  300   TAILGSIVLAEQIHLGSIIGAIFIVMGLYLVVWGKAKDHL----------NKLTNQKSSA  349

Query  210   LTKQSAEQKIDDTIKIR  160
              T+     + + T   R
Sbjct  350   ATELPITTEPETTAAER  366



>ref|XP_009125930.1| PREDICTED: WAT1-related protein At5g13670-like [Brassica rapa]
Length=379

 Score =   329 bits (844),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 230/322 (71%), Gaps = 4/322 (1%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             + A+P+  ++F+Q  YA  S+++K ALNQGM+ ++ V YR  +AA    PFA++ ER  R
Sbjct  4     QKARPFIAIVFIQFLYALMSIVAKLALNQGMSPHVLVAYRMAVAAALITPFALILERNSR  63

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             PR+T  I  +I +L+L EPV++QNLYY+GMK TTATF +A+CN LPAITF++A I +LEK
Sbjct  64    PRLTFKILFQISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAITFIMACIFKLEK  123

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVP---QTQSIGPATEHDHV  715
             VNI+  HSQ K+ GT + IGGAM+MT V+G++I LPWTSK      Q+  +    + D  
Sbjct  124   VNIKRRHSQAKLAGTMVAIGGAMLMTFVKGNVIELPWTSKSRSYNGQSHVMNTPKQEDTG  183

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             KG++M+ A CF WSC+ ILQA  L SY A LSLT L+C  G L++TV+ L++ER N   W
Sbjct  184   KGSIMLVASCFTWSCYIILQANILNSYQAELSLTALMCCMGMLEATVMALILERNNMSAW  243

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              +H D   LA +Y G++ SG+ YYI+G    E+GP FV+AFNPLSM++VAI+ SF+  E+
Sbjct  244   KIHPDMRLLASIYGGLV-SGLSYYITGWASKERGPVFVSAFNPLSMVIVAILSSFIFLEK  302

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G++ G+VVI++G+YLV+WG
Sbjct  303   MYIGRVVGSVVIVIGIYLVLWG  324



>emb|CDX85633.1| BnaA02g01800D [Brassica napus]
Length=379

 Score =   329 bits (844),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 230/322 (71%), Gaps = 4/322 (1%)
 Frame = -2

Query  1245  KHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERKIR  1066
             + A+P+  ++F+Q  YA  S+++K ALNQGM+ ++ V YR  +A     PFA++ ER  R
Sbjct  4     QKARPFIAIVFIQFLYALMSIVAKLALNQGMSPHVLVAYRMAVATALITPFALILERNTR  63

Query  1065  PRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLEK  886
             PR+T  I  +I +++L EPV++QNLYY+GMK TTATF +A+CN LPAITF++A I +LEK
Sbjct  64    PRLTFKILFQISIMSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAITFIMACIFKLEK  123

Query  885   VNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVP---QTQSIGPATEHDHV  715
             VNI+  HSQ K+VGT + IGGAM+MT V+G++I LPWTSK      Q+  +    + D  
Sbjct  124   VNIKRRHSQAKLVGTMVAIGGAMLMTFVKGNVIELPWTSKSRSYNGQSHVMNTPKQEDTG  183

Query  714   KGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYGIW  535
             KG++M+ A CF WSC+ ILQA  L SY A LSLT L+C  G L++TV+ L++ER N   W
Sbjct  184   KGSIMLVASCFTWSCYIILQANILNSYQAELSLTALMCCMGMLEATVMALILERNNMSAW  243

Query  534   ALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLAEQ  355
              +H D   LA +Y G++ SG+ YYI+G    E+GP FV+AFNPLSM++VAI+ SF+  E+
Sbjct  244   KIHPDMRLLASIYGGLV-SGLSYYITGWASKERGPVFVSAFNPLSMVIVAILSSFIFLEK  302

Query  354   LDFGKIFGAVVIIVGLYLVIWG  289
             +  G++ G+VVI++G+YLV+WG
Sbjct  303   MYIGRVVGSVVIVIGIYLVLWG  324



>ref|XP_009621489.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Nicotiana 
tomentosiformis]
Length=397

 Score =   330 bits (845),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/327 (48%), Positives = 230/327 (70%), Gaps = 10/327 (3%)
 Frame = -2

Query  1251  WLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERK  1072
             + + AKPY  ++ LQ  YA  ++I+K +LN GM+HY+ VVYR+  A    APFA++ ERK
Sbjct  11    FFQRAKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAIAPFALVLERK  70

Query  1071  IRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRL  892
             +RP+MT  +FL+I +L LL PVIDQN YY G+K+T+ TF+ AM N+LPA+TF++A + R+
Sbjct  71    LRPKMTFMMFLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAMTFVMAVLCRM  130

Query  891   EKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT------SKHVPQTQSIGPAT  730
             EKV+I+ L  Q K+VGT +T+ GAM+MTL +GH+I L W+      + +VP+   +   T
Sbjct  131   EKVHIKKLRCQAKVVGTIVTVAGAMLMTLYKGHVINLVWSNNIHTNTSNVPEPNEV---T  187

Query  729   EHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
             + D +KG++++    F W+ F+ILQ +T++ Y A LSLT L+C  G LQS  +TLV+E  
Sbjct  188   DKDLLKGSILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSIAVTLVMEHK  247

Query  549   NYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSF  370
                 WA+ +D   LA  Y GI+ S + YY+ G++M ++GP FVTAF+PL MI+VAI+GSF
Sbjct  248   TSA-WAIGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSF  306

Query  369   MLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +LAE++  G + GAV+I+ GLY V+WG
Sbjct  307   ILAEKIYIGGVLGAVLIVAGLYSVLWG  333



>ref|XP_009344114.1| PREDICTED: WAT1-related protein At4g08300-like [Pyrus x bretschneideri]
Length=363

 Score =   328 bits (842),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 222/329 (67%), Gaps = 2/329 (1%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             MG      +L   KPY  ++ LQ  Y+   +IS  +   GM+H++  VYR+++A    AP
Sbjct  1     MGESKLSLFLIKIKPYLAMVSLQFGYSGMYIISMVSFKHGMSHFVLSVYRHVVAFCVIAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA + ERKIRPRMT+ IFL+I+LL  LEPV+DQNLY+ GMKYT+ATFA+A+ NVLPAITF
Sbjct  61    FAFVLERKIRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITF  120

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++A   RLE VN++ LHS  K++GT +T+GGAMIMTL +G I+ +           S   
Sbjct  121   IMALCFRLETVNVKKLHSLAKVIGTVITVGGAMIMTLYKGPIVDIIRGHSQ-SHNSSTTE  179

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
             ++E   + G +M+   C  W+ F+ILQ+ TLK YPA LSLT  IC+ G L+  V+T  VE
Sbjct  180   SSEQHWIAGPLMLLGSCGGWASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVE  239

Query  555   RGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVG  376
             R    +W + WD+  LA VY+G++ SG+ YY+ GV++ E+GP FVTAF+PL MI+ A +G
Sbjct  240   R-KLSVWVIGWDSRLLASVYSGVVCSGMAYYVQGVVIRERGPVFVTAFSPLCMIIPAALG  298

Query  375   SFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             + +LAEQ+  G I GA+ I+ GLY V+WG
Sbjct  299   AIVLAEQVHLGSIIGAICIVFGLYTVVWG  327



>ref|XP_010096633.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB65301.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=378

 Score =   329 bits (843),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 173/341 (51%), Positives = 225/341 (66%), Gaps = 33/341 (10%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M  +S  + LK AKP+  ++  Q+ YA  S+ISK ALNQGM+ ++ VVYR+ IAA   AP
Sbjct  1     MSKQSLAQMLKQAKPFLFLILQQVGYAGMSIISKFALNQGMSQHVLVVYRHAIAAAVTAP  60

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++ ER                     PV+DQNLYY GMK+TTATFATAMCNVLPA   
Sbjct  61    FAIVLER---------------------PVMDQNLYYTGMKFTTATFATAMCNVLPAFAL  99

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGP  736
             ++AWI RLEKVNIR L SQ K++GT +T+GGAM MTL  G I+ LPWT++     +S+  
Sbjct  100   IMAWIFRLEKVNIRKLPSQAKLIGTVVTVGGAMSMTLYNGPILNLPWTNQSTHHPESMIA  159

Query  735   ATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVE  556
                    KGA+MI AGC CWS F ILQAITLKSYPA LSLT  +C+ GA+Q +V+ L +E
Sbjct  160   KNNQVSAKGALMITAGCLCWSSFIILQAITLKSYPAELSLTAWMCLMGAVQGSVVALALE  219

Query  555   RGNYGIWALHWDTTFLAYVYN------------GIIRSGVVYYISGVIMNEKGPFFVTAF  412
              GN   W++   +  LA +Y+            GI RSG  YYI G++M EKGP FV AF
Sbjct  220   WGNPAAWSICSGSMILAALYSFLSFNVVDGIWQGIFRSGFAYYIQGLVMKEKGPVFVAAF  279

Query  411   NPLSMIMVAIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             NP+ +++V I+GSF+L+E +  G+I GA++IIVGLYLV+WG
Sbjct  280   NPVGLVIVVILGSFLLSEIMYLGRIIGAIIIIVGLYLVLWG  320



>ref|XP_009610629.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Nicotiana 
tomentosiformis]
Length=397

 Score =   329 bits (844),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 230/327 (70%), Gaps = 10/327 (3%)
 Frame = -2

Query  1251  WLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERK  1072
             + + AKPY  ++ LQ  YA  ++I+K +LN GM+HY+ VVYR+  A    APFA++ ERK
Sbjct  11    FFQRAKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAIAPFALVLERK  70

Query  1071  IRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRL  892
             +RP+MT  +FL+I +L LL PVIDQN YY G+K+T+ TF+ AM N+LPA+TF++A + R+
Sbjct  71    LRPKMTFMMFLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAMTFVMAVLCRM  130

Query  891   EKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT------SKHVPQTQSIGPAT  730
             EKV+I+ L  Q K+VGT +T+ GAM+MTL +GH+I L W+      + +VP+      AT
Sbjct  131   EKVHIKKLRCQAKVVGTIVTVAGAMLMTLYKGHVINLVWSNNIHTNTSNVPEPNE---AT  187

Query  729   EHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
             + D +KG++++    F W+ F+ILQ +T++ Y A LSLT L+C  G LQS  +TLV+E  
Sbjct  188   DKDWLKGSILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSIAVTLVMEHK  247

Query  549   NYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSF  370
                 WA+ +D   LA  Y GI+ S + YY+ G++M ++GP FVTAF+PL MI+VAI+GSF
Sbjct  248   TSA-WAIGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSF  306

Query  369   MLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +LAE++  G + GAV+I+ GLY V+WG
Sbjct  307   ILAEKIYLGGVLGAVLIVAGLYSVLWG  333



>ref|NP_001148990.1| nodulin protein [Zea mays]
 gb|ACG33741.1| nodulin protein [Zea mays]
 gb|AFW76688.1| nodulin protein [Zea mays]
Length=383

 Score =   329 bits (843),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 224/326 (69%), Gaps = 5/326 (2%)
 Frame = -2

Query  1254  RWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFER  1075
             + +   KPY  ++ LQ+ ++   ++S ++L +GMNH++ VVYRN++A V  APFA+LFER
Sbjct  5     KLMNDVKPYLAMVLLQVGFSGMYIVSVASLKRGMNHFVLVVYRNLVATVVMAPFALLFER  64

Query  1074  KIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILR  895
             ++RP+MT  IFLKIM LA+LEPV+DQN+YY G K T+ATFA+A+ N+LPAITFLLA  LR
Sbjct  65    RVRPKMTPLIFLKIMGLAVLEPVLDQNMYYLGAKLTSATFASALVNILPAITFLLALALR  124

Query  894   LEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTS----KHVPQTQSIGPATE  727
             +E++ +RSL SQ K+VGT  T+ GA++M L  G ++  PW++     HVP   ++   + 
Sbjct  125   MERLRLRSLRSQAKVVGTVCTVAGAVLMILYHGPVVPFPWSAGRLHHHVP-AAAVESQSS  183

Query  726   HDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGN  547
                + G  MI   C CWS F+ILQ+ TL+SYPA L+LT LIC  G++ +  + LV ER +
Sbjct  184   ASWLNGICMIIGSCLCWSGFFILQSNTLQSYPAELTLTTLICFLGSVLTGGVALVAERRD  243

Query  546   YGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFM  367
                W + +DT     VY+GI+ SGV +Y+ G++   +GP FVTAF PL MI+  ++GS +
Sbjct  244   MSAWVIGFDTRLFTAVYSGIVCSGVAFYVQGIVTQARGPVFVTAFQPLCMIITTVLGSTI  303

Query  366   LAEQLDFGKIFGAVVIIVGLYLVIWG  289
             L E+   G + GA +I+VGLY +IWG
Sbjct  304   LKEETTLGSVIGAAIIVVGLYCLIWG  329



>ref|XP_009409675.1| PREDICTED: WAT1-related protein At1g21890-like [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/324 (49%), Positives = 225/324 (69%), Gaps = 1/324 (0%)
 Frame = -2

Query  1260  FVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLF  1081
             FV  +   K Y  ++ LQ  YA   +IS +++ +GMNH++ VVYRN IAA+F APFA+ F
Sbjct  3     FVEVMMTVKAYVLMVLLQFGYAGMFVISVASIKRGMNHFVLVVYRNAIAALFIAPFALWF  62

Query  1080  ERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWI  901
             ERK RP MT+ IFLKI  LALLEPV+DQNLYY G   T+A FA+A+ N++PAITF++A +
Sbjct  63    ERKTRPEMTVIIFLKIAALALLEPVLDQNLYYMGANLTSAGFASALYNMIPAITFIMAIV  122

Query  900   LRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPATEHD  721
             LR+EK+ I+S HSQ KIVG+ +T+ GA++M L +G ++   W SK      +    +  +
Sbjct  123   LRIEKLRIKSRHSQAKIVGSLVTVVGALLMILYKGPVVEFVW-SKGRSHRDTATSQSSGN  181

Query  720   HVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERGNYG  541
              + G  ++   C CWS F+ILQ+ TL++Y A LSLT LIC+ GA  S V+TL VE  +  
Sbjct  182   WLTGIFLLLGSCLCWSSFFILQSNTLETYSAELSLTTLICLMGAAMSAVVTLAVEGFSAK  241

Query  540   IWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSFMLA  361
              W + WD   +  +Y+G++ SGV YY+ G++M E+GP +VTAFNPL MI+ A++GS +LA
Sbjct  242   PWTIGWDMRLVTAIYSGVVCSGVAYYVQGIVMKERGPVYVTAFNPLCMIITAVLGSIILA  301

Query  360   EQLDFGKIFGAVVIIVGLYLVIWG  289
             E++  G + GAV+I+VGLY +IWG
Sbjct  302   EEITLGSVIGAVIIVVGLYSLIWG  325



>ref|XP_010999362.1| PREDICTED: WAT1-related protein At4g08290 isoform X1 [Populus 
euphratica]
Length=363

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 226/333 (68%), Gaps = 4/333 (1%)
 Frame = -2

Query  1287  DTTIMGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAV  1108
             D T  G  + V       PY  ++ +Q   A + ++S  +LN+GMN Y+ +VYRN +AA+
Sbjct  3     DQTSAGKLTVV--FNKMTPYILMVCVQFGSAGNYILSMISLNRGMNRYVLIVYRNGVAAL  60

Query  1107  FFAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLP  928
               APFA+L ERK RP++T+ IFL+IM L  LEP++DQ   Y GM+YT+A+F +A+ N +P
Sbjct  61    VLAPFALLLERKTRPKITLPIFLRIMALGFLEPILDQGFSYLGMQYTSASFTSAIMNAVP  120

Query  927   AITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQ  748
             ++TF++A I RLE+V I+ + SQ K+VGT +T+GGA++MT+ +G +IGLPW+ K   Q  
Sbjct  121   SVTFVIALIFRLERVRIKEIRSQAKVVGTLVTLGGALLMTVYKGPVIGLPWSQK-TSQHG  179

Query  747   SIGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLT  568
             S   +++   V G +++  GC  WS FY+LQ  TLK YPA LSL  LIC+AG++QS  + 
Sbjct  180   STAASSDKHWVTGTLLLLVGCVSWSAFYVLQMETLKKYPAELSLASLICLAGSMQSLAIA  239

Query  567   LVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMV  388
             LVV   +   WA+ WDT     +Y GI+ SGV YY+ G++M  +GP FVTAFNPL MI+V
Sbjct  240   LVVAH-HPSSWAVGWDTRLFTPLYTGIVASGVTYYVQGLVMKTRGPVFVTAFNPLCMIIV  298

Query  387   AIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             A +GS +LAE+L  G + G ++I +GLY V+WG
Sbjct  299   AALGSLILAEKLHLGSVLGGIIIAIGLYSVVWG  331



>ref|XP_006339335.1| PREDICTED: WAT1-related protein At5g07050-like, partial [Solanum 
tuberosum]
Length=358

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/328 (47%), Positives = 227/328 (69%), Gaps = 2/328 (1%)
 Frame = -2

Query  1269  NESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFA  1090
              E    + + +KPY  ++ LQ  YA  ++I+K +LN+GM+HY+ VVYRN  A +  APFA
Sbjct  6     EECNCSFFQRSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRNAFATIVIAPFA  65

Query  1089  MLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLL  910
             ++ ERKIRP+MT+ +FL+I +L LL PVIDQN YYAG+K T+ TF+ AM N+LPA+TF++
Sbjct  66    LILERKIRPKMTLMMFLQIFVLGLLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAMTFVM  125

Query  909   AWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSK-HVPQTQSIGPA  733
             A + R+EKV+I+ +  Q K++GT +T+ GAM+MTL +GH++ L W++  +   TQ     
Sbjct  126   AVLCRMEKVDIKKIRCQAKVLGTIVTVCGAMLMTLYKGHVVNLIWSNNINSNDTQVTNKT  185

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
              + D VKG++ +    F W+ F+ILQ +T++ Y A +SLT L+C  G LQS  +T V+E 
Sbjct  186   YDKDWVKGSIQLIFATFAWASFFILQNMTMRKYTAPISLTALVCFMGTLQSIAVTFVMEH  245

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
              N  IW + +D   LA  Y GI+ S + YY+ G++M  +GP FVTAF+PL MI+V I+GS
Sbjct  246   KN-SIWIIGFDMNLLAAAYAGIVSSSIAYYVQGLVMETRGPVFVTAFSPLMMIIVTIMGS  304

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F+LAE +  G I GAV+I+ G+Y V+WG
Sbjct  305   FILAENIYIGGIIGAVLIVAGIYSVLWG  332



>ref|XP_009790909.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/327 (48%), Positives = 230/327 (70%), Gaps = 10/327 (3%)
 Frame = -2

Query  1251  WLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAMLFERK  1072
             + + AKPY  ++ LQ  YA  ++I+K +LN GM+HY+ VVYR+  A    APFA++ ERK
Sbjct  11    FFQRAKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAIAPFALVLERK  70

Query  1071  IRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRL  892
             +RP+MT  +FL+I +L LL PVIDQN YY G+K+T+ TF+ AM N+LPA+TF++A + R+
Sbjct  71    LRPKMTFMMFLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAMTFVMAVLCRM  130

Query  891   EKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWT------SKHVPQTQSIGPAT  730
             EKV+I+ L  Q K+VGT +T+ GAM+MTL +GH+I L W+      + +VP++      T
Sbjct  131   EKVHIKKLRCQAKVVGTIVTVAGAMLMTLYKGHVINLVWSNNIHTNTSNVPESNE---PT  187

Query  729   EHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVERG  550
             + D +KG++++    F W+ F+ILQ +T++ Y A LSLT L+C  G LQS  +TLV+E  
Sbjct  188   DKDWLKGSILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSIAVTLVMEH-  246

Query  549   NYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGSF  370
                 WA+ +D   LA  Y GI+ S + YY+ G++M ++GP FVTAF+PL MI+VAI+GSF
Sbjct  247   KASAWAIGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSF  306

Query  369   MLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             +LAE++  G + GAV+I+ GLY V+WG
Sbjct  307   ILAEKIYLGGVLGAVLIVAGLYSVLWG  333



>ref|XP_009788498.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana sylvestris]
Length=389

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/383 (45%), Positives = 247/383 (64%), Gaps = 15/383 (4%)
 Frame = -2

Query  1266  ESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPFAM  1087
             E    + + AKPY  ++ LQ  YA  ++I+K +LN+GM+HY+ VVYR+  A    APFA+
Sbjct  6     ECGCSFFQRAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAL  65

Query  1086  LFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLA  907
             + ERKIRP+M++ +FL+I +L LL PVIDQN YYAG+KYT+ TF+ AM N+LPA+TF++A
Sbjct  66    ILERKIRPKMSLMMFLQIFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMA  125

Query  906   WILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSI----G  739
              I R+EKV+I+ +  Q K++GT +T+ GAM+MTL +GH++ L W S H     S+    G
Sbjct  126   VICRMEKVDIKKVRCQAKVLGTIVTVAGAMLMTLYKGHVVNLLW-SNHTTINSSVQETSG  184

Query  738   PATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVV  559
               ++ D  KG++++      W+ F+ILQ I ++ Y A LSLT L+C  G LQS  +T V+
Sbjct  185   ANSDKDWFKGSILLIFATLAWASFFILQNIAMRKYTAPLSLTALVCFMGTLQSIAVTFVM  244

Query  558   ERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIV  379
             E     +W + +D   LA  Y GI+ S + YY+ GV+M ++GP FVTAF+PL MI+VA +
Sbjct  245   EH-KPSVWTIGFDMNLLAAAYAGIVSSSIAYYVQGVVMEKRGPVFVTAFSPLMMIIVATM  303

Query  378   GSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALS----NNKESI  211
             GSF+LAE++  G I GAV+I+ GLY V+WGK K+    +  E     A+     NN+  I
Sbjct  304   GSFILAEKIYIGGILGAVLIVAGLYSVLWGKYKEYKEKEIEEAIIPEAVKGVNGNNQMMI  363

Query  210   LTKQSA-----EQKIDDTIKIRT  157
             L    A      QK  D  KI+T
Sbjct  364   LPDNEAINDIEMQKNSDANKIQT  386



>ref|XP_004494994.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Cicer 
arietinum]
Length=330

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 225/332 (68%), Gaps = 23/332 (7%)
 Frame = -2

Query  1284  TTIMGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVF  1105
             T +M  +     ++   P+  VLFLQ  YA   ++SK+ALN+GM++Y+FVVYR+ +A + 
Sbjct  2     TIMMERQHRRNCIEKIMPFIAVLFLQFGYAVMDVLSKAALNKGMSNYVFVVYRHAVAFIV  61

Query  1104  FAPFAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPA  925
               PFA+ F++                     PVIDQNLY+ GMK+TTATFA +M N+LPA
Sbjct  62    VTPFALYFDK---------------------PVIDQNLYFLGMKFTTATFAASMSNILPA  100

Query  924   ITFLLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQS  745
             ITF+LA ILR+EK+ IRS+ +Q K+VGT  T+ GAM+MTL++G ++   + S       S
Sbjct  101   ITFILASILRIEKIKIRSIRTQAKVVGTIATVSGAMVMTLIKGPVLFGTFGSDSQNHHNS  160

Query  744   IGPATEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTL  565
              G +T+H  + GAVMI  GCF W+CF ILQAITL++YPA LSL+  IC+ G L+   + L
Sbjct  161   -GISTQHT-IIGAVMITLGCFSWACFIILQAITLETYPAALSLSSWICLLGTLEGAAVAL  218

Query  564   VVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVA  385
             VVERGNY +W++ WD   L+ +Y GI  SG+ YY+ GV+M  +GP FVT FNPL M++VA
Sbjct  219   VVERGNYSVWSIKWDVRLLSAIYTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPLCMVIVA  278

Query  384   IVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             I+G F+LAEQ+  G++ GA +I +GLYLV+WG
Sbjct  279   IMGYFILAEQMFLGRVVGAFIICLGLYLVVWG  310



>ref|XP_011041376.1| PREDICTED: WAT1-related protein At5g07050 [Populus euphratica]
Length=402

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 226/328 (69%), Gaps = 1/328 (0%)
 Frame = -2

Query  1272  GNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAPF  1093
             GN  F  + + +KPY  ++ LQ  YA  ++I+K +LN+GM+HY+ VVYR+  A    APF
Sbjct  3     GNGYFGSFFQRSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPF  62

Query  1092  AMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFL  913
             A++ ERK+RP++T  IF+++ +L LL PVIDQN YYAG+K+T+ TF+ AM N+LPA+TF+
Sbjct  63    AIILERKVRPKITFPIFMQMFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFV  122

Query  912   LAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRGHIIGLPWTSKHVPQTQSIGPA  733
             +A + R+E V+I+ +  Q K++GT +T+ GAM+MTL +G++I L W+     Q+ S+   
Sbjct  123   MAVLFRMEIVDIKKVRCQAKVIGTIVTVAGAMLMTLYKGNVINLIWSEHLHTQSSSVPET  182

Query  732   TEHDHVKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLTLVVER  553
             T  D +KG++++    F W+ F+ILQ +TL  Y A LSLT L+C  G LQS  +T V+E 
Sbjct  183   TNKDWIKGSILLIIATFAWASFFILQTVTLTRYSAHLSLTALVCFLGTLQSIAVTFVMEH  242

Query  552   GNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMVAIVGS  373
                  W + WD   LA  Y GI+ S + YY+ G++M + GP FVTAF+PL MI+VAI+GS
Sbjct  243   -KPSAWTIGWDMNLLAAAYAGIVTSSISYYVQGLVMQKTGPVFVTAFSPLMMIIVAIMGS  301

Query  372   FMLAEQLDFGKIFGAVVIIVGLYLVIWG  289
             F+LAE +  G + GA++I+ GLY V+WG
Sbjct  302   FILAENIYVGGVLGAILIVAGLYAVLWG  329



>ref|XP_007019030.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY16255.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=383

 Score =   327 bits (839),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/384 (45%), Positives = 245/384 (64%), Gaps = 30/384 (8%)
 Frame = -2

Query  1275  MGNESFVRWLKHAKPYFGVLFLQLSYAASSLISKSALNQGMNHYIFVVYRNIIAAVFFAP  1096
             M + +F   L  AK Y  ++FLQ  +A   +I+  +L QGMNHYI  VYR+++A +  AP
Sbjct  5     MQSGTFPVGLTRAKSYSAMIFLQFGFAGMYVITMFSLQQGMNHYILAVYRHLVATIVIAP  64

Query  1095  FAMLFERKIRPRMTITIFLKIMLLALLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITF  916
             FA++ ERKIRP++T+ +FL+I++L  LEPVIDQN+YY GMKYTTAT A+A  NVLPAITF
Sbjct  65    FALVLERKIRPKLTLPVFLRILVLGFLEPVIDQNVYYLGMKYTTATLASATVNVLPAITF  124

Query  915   LLAWILRLEKVNIRSLHSQGKIVGTTLTIGGAMIMTLVRG---HIIGLPWTSKHVPQTQS  745
             ++A I RLE+VN++ +HS  KI+GT + + GA+IMTL +G   + I L     H      
Sbjct  125   VMALIFRLERVNLKKVHSIAKIIGTVIMVPGAVIMTLYKGPAINFIKLQGGGHHGATN--  182

Query  744   IGPATEHDH-VKGAVMIAAGCFCWSCFYILQAITLKSYPAGLSLTCLICMAGALQSTVLT  568
                A E  H V G +M+ A C+ WS FYILQ+ TL+ YPA LSLT LIC  G +    ++
Sbjct  183   ---AAEAKHWVAGTLMLLARCWGWSGFYILQSFTLRMYPAELSLTALICFIGTIGGAAVS  239

Query  567   LVVERGNYGIWALHWDTTFLAYVYNGIIRSGVVYYISGVIMNEKGPFFVTAFNPLSMIMV  388
               VER +   W + WD + LA VY+G++ SG+ YY  GV++ E+GP FVTAF+PL MI+ 
Sbjct  240   FAVER-DMNAWKIGWDASLLAAVYSGVVCSGIAYYAQGVVLREQGPVFVTAFSPLCMIIT  298

Query  387   AIVGSFMLAEQLDFGKIFGAVVIIVGLYLVIWGkskdisssksseddDNNALSNNKESIL  208
             A +GSF+LAE++  G I G V+II GLY V+WGK                  S ++++  
Sbjct  299   AALGSFLLAEKVHLGSIIGTVIIICGLYTVLWGK------------------SKDQQNST  340

Query  207   TKQSAEQK--IDDTIKIRTVDDTV  142
             T +   Q+  I D+ K   ++D++
Sbjct  341   TDEGKLQELPITDSAKSIDIEDSI  364



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3637971831204