BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c43940_g1_i1 len=133 path=[1:0-132]

Length=133
                                                                      Score     E

ref|XP_006355629.1|  PREDICTED: protein SRG1-like                     68.2    4e-12   
ref|XP_008366013.1|  PREDICTED: protein SRG1-like                     67.0    7e-12   
ref|XP_004986102.1|  PREDICTED: S-norcoclaurine synthase 1-like       67.0    9e-12   
ref|XP_008366519.1|  PREDICTED: protein SRG1-like                     65.5    1e-11   
emb|CAN72012.1|  hypothetical protein VITISV_008971                   65.5    1e-11   Vitis vinifera
ref|XP_008359374.1|  PREDICTED: protein SRG1-like                     65.1    1e-11   
ref|XP_009360957.1|  PREDICTED: protein SRG1-like                     67.0    1e-11   
emb|CAN63126.1|  hypothetical protein VITISV_017242                   66.2    2e-11   Vitis vinifera
ref|XP_009352081.1|  PREDICTED: codeine O-demethylase-like            65.5    2e-11   
ref|XP_002269718.1|  PREDICTED: protein SRG1                          66.2    2e-11   Vitis vinifera
emb|CBI30778.3|  unnamed protein product                              64.3    3e-11   
ref|NP_001044707.1|  Os01g0832600                                     65.9    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006365610.1|  PREDICTED: codeine O-demethylase-like            65.5    3e-11   
ref|XP_009352088.1|  PREDICTED: codeine O-demethylase-like            65.1    4e-11   
ref|XP_006420284.1|  hypothetical protein CICLE_v10005497mg           64.7    4e-11   
emb|CAN73448.1|  hypothetical protein VITISV_030816                   64.7    5e-11   Vitis vinifera
emb|CBI16708.3|  unnamed protein product                              64.7    5e-11   
ref|XP_003516325.1|  PREDICTED: protein SRG1                          65.1    5e-11   
ref|XP_007213578.1|  hypothetical protein PRUPE_ppa014989mg           63.2    6e-11   
emb|CBI30788.3|  unnamed protein product                              64.3    7e-11   
ref|XP_002268288.1|  PREDICTED: protein SRG1                          65.1    7e-11   Vitis vinifera
emb|CBI16709.3|  unnamed protein product                              65.1    7e-11   
ref|XP_008371732.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  65.1    7e-11   
ref|NP_001141508.1|  uncharacterized protein LOC100273620             64.3    7e-11   Zea mays [maize]
ref|XP_002269432.1|  PREDICTED: protein SRG1                          64.7    7e-11   Vitis vinifera
ref|XP_004984849.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   65.1    7e-11   
ref|XP_011046706.1|  PREDICTED: codeine O-demethylase-like            64.7    7e-11   
emb|CAN72414.1|  hypothetical protein VITISV_032872                   65.1    7e-11   Vitis vinifera
gb|KDO37449.1|  hypothetical protein CISIN_1g040795mg                 62.0    8e-11   
ref|XP_009792316.1|  PREDICTED: protein SRG1-like                     64.7    8e-11   
ref|XP_006646452.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   64.7    9e-11   
emb|CBI30781.3|  unnamed protein product                              64.7    9e-11   
ref|XP_002969158.1|  2-oxoacid-dependent dioxygenase                  64.3    1e-10   
ref|XP_002973903.1|  2-oxoglutarate, iron(II)-dependent oxygenase     64.3    1e-10   
ref|XP_002519763.1|  Leucoanthocyanidin dioxygenase, putative         63.2    1e-10   Ricinus communis
emb|CBI30785.3|  unnamed protein product                              64.7    1e-10   
ref|XP_002270036.1|  PREDICTED: protein SRG1                          64.3    1e-10   Vitis vinifera
ref|XP_008667799.1|  PREDICTED: uncharacterized protein LOC100273...  64.3    1e-10   
ref|XP_002270288.1|  PREDICTED: protein SRG1                          64.3    1e-10   Vitis vinifera
ref|XP_006432904.1|  hypothetical protein CICLE_v10001623mg           63.5    1e-10   
ref|XP_002270514.1|  PREDICTED: protein SRG1-like                     64.3    1e-10   Vitis vinifera
ref|XP_007022032.1|  Senescence-related gene 1                        64.3    1e-10   
emb|CBI30787.3|  unnamed protein product                              63.5    1e-10   
ref|XP_009376717.1|  PREDICTED: protein SRG1-like                     64.3    1e-10   
ref|NP_001242069.1|  uncharacterized protein LOC100777264             64.3    1e-10   
emb|CBI30794.3|  unnamed protein product                              62.0    1e-10   
ref|XP_006489681.1|  PREDICTED: protein SRG1-like                     64.3    1e-10   
emb|CBI30795.3|  unnamed protein product                              64.7    1e-10   
ref|XP_002519764.1|  1-aminocyclopropane-1-carboxylate oxidase, p...  62.4    1e-10   Ricinus communis
ref|XP_010540138.1|  PREDICTED: protein SRG1-like                     64.3    1e-10   
ref|XP_008361457.1|  PREDICTED: protein SRG1-like                     62.0    1e-10   
gb|KDO43333.1|  hypothetical protein CISIN_1g022160mg                 63.5    1e-10   
ref|XP_009376720.1|  PREDICTED: protein SRG1-like isoform X1          63.9    1e-10   
ref|XP_004134920.1|  PREDICTED: protein SRG1-like                     63.9    1e-10   
ref|XP_008356069.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  63.9    1e-10   
ref|XP_009376718.1|  PREDICTED: protein SRG1-like isoform X1          63.9    1e-10   
gb|KHN19470.1|  Protein SRG1                                          63.9    1e-10   
gb|KGN49350.1|  hypothetical protein Csa_6G520480                     62.0    1e-10   
ref|XP_009376719.1|  PREDICTED: protein SRG1-like isoform X2          63.9    2e-10   
ref|XP_002519766.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  63.9    2e-10   Ricinus communis
emb|CBI30792.3|  unnamed protein product                              63.2    2e-10   
ref|XP_003614575.1|  SRG1-like protein                                63.9    2e-10   
ref|XP_004233006.1|  PREDICTED: protein SRG1-like                     63.9    2e-10   
ref|XP_008366518.1|  PREDICTED: protein SRG1-like                     63.9    2e-10   
gb|AFN53719.1|  putative Fe(II) oxygenase superfamily protein         65.1    2e-10   
emb|CBI30786.3|  unnamed protein product                              63.2    2e-10   
gb|AFG48473.1|  hypothetical protein 2_5499_01                        61.6    2e-10   
ref|XP_009782598.1|  PREDICTED: thebaine 6-O-demethylase-like         62.0    2e-10   
emb|CAN62525.1|  hypothetical protein VITISV_002347                   63.5    2e-10   Vitis vinifera
ref|XP_006489639.1|  PREDICTED: protein SRG1-like                     63.5    2e-10   
emb|CBI30784.3|  unnamed protein product                              63.9    2e-10   
ref|XP_004233861.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  64.7    2e-10   
emb|CBI30791.3|  unnamed protein product                              63.9    2e-10   
ref|XP_002267208.1|  PREDICTED: protein SRG1                          63.5    2e-10   Vitis vinifera
ref|XP_002270474.1|  PREDICTED: protein SRG1                          63.5    2e-10   Vitis vinifera
ref|XP_006432900.1|  hypothetical protein CICLE_v10002117mg           62.8    2e-10   
ref|XP_009376708.1|  PREDICTED: protein SRG1-like                     63.5    2e-10   
ref|XP_002300323.2|  hypothetical protein POPTR_0001s36520g           63.5    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006442330.1|  hypothetical protein CICLE_v10020843mg           63.5    2e-10   
ref|XP_003561738.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  63.5    2e-10   
ref|XP_006477806.1|  PREDICTED: protein SRG1-like                     63.5    2e-10   
ref|XP_009376721.1|  PREDICTED: protein SRG1-like isoform X2          63.5    2e-10   
ref|XP_006442333.1|  hypothetical protein CICLE_v10020840mg           63.5    2e-10   
emb|CBI30783.3|  unnamed protein product                              61.6    2e-10   
ref|XP_006420337.1|  hypothetical protein CICLE_v10005281mg           63.2    2e-10   
ref|XP_002271009.1|  PREDICTED: protein SRG1                          63.2    2e-10   Vitis vinifera
ref|XP_006355625.1|  PREDICTED: protein SRG1-like                     63.5    2e-10   
ref|XP_003632981.1|  PREDICTED: protein SRG1-like                     63.2    2e-10   
ref|XP_003632980.1|  PREDICTED: protein SRG1-like                     63.2    2e-10   
ref|XP_010476836.1|  PREDICTED: protein SRG1-like                     63.2    2e-10   
ref|XP_006494098.1|  PREDICTED: protein SRG1-like                     62.4    2e-10   
ref|XP_010655797.1|  PREDICTED: protein SRG1-like                     63.2    2e-10   
ref|XP_002270078.1|  PREDICTED: protein SRG1                          63.2    3e-10   Vitis vinifera
emb|CBI30782.3|  unnamed protein product                              63.2    3e-10   
ref|XP_007013636.1|  Senescence-related gene 1                        63.2    3e-10   
ref|XP_011085301.1|  PREDICTED: protein SRG1-like                     63.2    3e-10   
ref|XP_006486392.1|  PREDICTED: codeine O-demethylase-like            61.2    3e-10   
ref|XP_010057205.1|  PREDICTED: protein SRG1-like                     63.2    3e-10   
ref|XP_009361472.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  63.2    3e-10   
ref|XP_006432905.1|  hypothetical protein CICLE_v10001623mg           63.2    3e-10   
ref|XP_011045561.1|  PREDICTED: protein SRG1-like                     63.2    3e-10   
ref|XP_007029339.1|  Senescence-related gene 1                        63.2    3e-10   
ref|XP_010057194.1|  PREDICTED: codeine O-demethylase-like            62.8    3e-10   
ref|XP_007025225.1|  Senescence-related gene 1                        62.8    3e-10   
ref|XP_010057212.1|  PREDICTED: protein SRG1-like                     62.8    3e-10   
gb|KCW74257.1|  hypothetical protein EUGRSUZ_E02903                   62.8    4e-10   
ref|XP_011001178.1|  PREDICTED: protein SRG1-like                     62.8    4e-10   
ref|XP_006494096.1|  PREDICTED: codeine O-demethylase-like isofor...  62.0    4e-10   
ref|XP_010498040.1|  PREDICTED: protein SRG1-like                     62.8    4e-10   
ref|XP_007211481.1|  hypothetical protein PRUPE_ppa007600mg           62.8    4e-10   
gb|KCW74238.1|  hypothetical protein EUGRSUZ_E02876                   62.8    4e-10   
ref|XP_010459260.1|  PREDICTED: protein SRG1-like                     62.8    4e-10   
ref|XP_010537691.1|  PREDICTED: protein SRG1-like isoform X1          62.8    4e-10   
ref|XP_006305429.1|  hypothetical protein CARUB_v10009827mg           62.4    4e-10   
gb|EYU28156.1|  hypothetical protein MIMGU_mgv1a009322mg              62.4    4e-10   
ref|XP_002321354.2|  hypothetical protein POPTR_0015s00510g           60.8    4e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006495452.1|  PREDICTED: protein SRG1-like                     60.8    5e-10   
ref|XP_007029342.1|  Senescence-related gene 1                        62.4    5e-10   
ref|XP_010919592.1|  PREDICTED: S-norcoclaurine synthase 1-like       62.4    5e-10   
ref|XP_006355630.1|  PREDICTED: protein SRG1-like                     62.4    5e-10   
emb|CBI33959.3|  unnamed protein product                              60.1    5e-10   
ref|XP_008439692.1|  PREDICTED: codeine O-demethylase-like isofor...  62.0    5e-10   
ref|XP_008802804.1|  PREDICTED: S-norcoclaurine synthase 1-like       62.4    5e-10   
emb|CDP14578.1|  unnamed protein product                              62.0    5e-10   
ref|XP_002465421.1|  hypothetical protein SORBIDRAFT_01g038520        62.4    6e-10   Sorghum bicolor [broomcorn]
ref|XP_002268794.1|  PREDICTED: protein SRG1-like                     62.4    6e-10   Vitis vinifera
emb|CBI24603.3|  unnamed protein product                              61.6    6e-10   
ref|XP_006432901.1|  hypothetical protein CICLE_v10001620mg           62.0    6e-10   
ref|XP_002989580.1|  2-oxoglutarate-iron(II)-dependent oxygenase      62.0    7e-10   
ref|XP_006291351.1|  hypothetical protein CARUB_v10017490mg           62.0    7e-10   
ref|XP_006494099.1|  PREDICTED: protein SRG1-like                     62.0    7e-10   
ref|XP_010240927.1|  PREDICTED: gibberellin 2-beta-dioxygenase 8-...  62.0    7e-10   
ref|XP_006477893.1|  PREDICTED: protein SRG1-like                     61.6    7e-10   
gb|KFK43894.1|  hypothetical protein AALP_AA1G187900                  62.0    7e-10   
ref|XP_008660253.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  62.4    7e-10   
gb|KDO41546.1|  hypothetical protein CISIN_1g046507mg                 60.1    7e-10   
ref|XP_007022024.1|  Senescence-related gene 1                        62.0    8e-10   
ref|XP_006452693.1|  hypothetical protein CICLE_v10008745mg           62.0    8e-10   
emb|CDP18104.1|  unnamed protein product                              59.7    8e-10   
ref|XP_010273388.1|  PREDICTED: protein SRG1-like                     62.0    8e-10   
ref|XP_008226353.1|  PREDICTED: protein SRG1-like                     62.0    8e-10   
ref|XP_010476835.1|  PREDICTED: protein SRG1                          62.0    8e-10   
ref|XP_006494095.1|  PREDICTED: codeine O-demethylase-like isofor...  61.2    8e-10   
ref|XP_007022033.1|  Senescence-related gene 1                        62.8    9e-10   
ref|XP_010095126.1|  Codeine O-demethylase                            62.0    9e-10   
ref|XP_004294174.1|  PREDICTED: protein SRG1-like                     62.0    9e-10   
gb|KGN49353.1|  hypothetical protein Csa_6G521000                     61.6    9e-10   
emb|CAN72515.1|  hypothetical protein VITISV_005838                   61.6    9e-10   Vitis vinifera
ref|XP_006442335.1|  hypothetical protein CICLE_v10020844mg           61.6    9e-10   
ref|XP_007025217.1|  Senescence-related gene 1                        61.6    9e-10   
ref|XP_002279355.1|  PREDICTED: S-norcoclaurine synthase 1            61.6    9e-10   Vitis vinifera
ref|XP_007214442.1|  hypothetical protein PRUPE_ppa024861mg           61.6    1e-09   
ref|XP_007025221.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  62.0    1e-09   
emb|CDX92689.1|  BnaC07g39470D                                        61.6    1e-09   
ref|XP_002270138.1|  PREDICTED: protein SRG1                          61.6    1e-09   Vitis vinifera
ref|XP_006432906.1|  hypothetical protein CICLE_v10001648mg           61.6    1e-09   
ref|XP_011096570.1|  PREDICTED: protein SRG1-like                     61.6    1e-09   
ref|XP_003524845.1|  PREDICTED: protein SRG1-like                     61.6    1e-09   
ref|XP_007211480.1|  hypothetical protein PRUPE_ppa007597mg           61.6    1e-09   
gb|KEH27886.1|  2OG-Fe(II) oxygenase family oxidoreductase            61.6    1e-09   
gb|KDP21182.1|  hypothetical protein JCGZ_21653                       61.6    1e-09   
gb|KDP21831.1|  hypothetical protein JCGZ_00618                       61.6    1e-09   
ref|XP_006467560.1|  PREDICTED: protein SRG1-like                     61.6    1e-09   
ref|XP_010027975.1|  PREDICTED: protein SRG1-like                     61.6    1e-09   
ref|XP_006442332.1|  hypothetical protein CICLE_v10024371mg           61.2    1e-09   
ref|XP_006477805.1|  PREDICTED: protein SRG1-like                     62.0    1e-09   
gb|KHN25971.1|  Protein SRG1                                          62.0    1e-09   
emb|CBI33968.3|  unnamed protein product                              60.8    1e-09   
ref|XP_004488976.1|  PREDICTED: protein SRG1-like                     61.2    1e-09   
gb|AFK40954.1|  unknown                                               60.1    1e-09   
ref|XP_009376707.1|  PREDICTED: protein SRG1-like                     61.6    1e-09   
gb|KDO78011.1|  hypothetical protein CISIN_1g017887mg                 60.8    1e-09   
emb|CDP18686.1|  unnamed protein product                              61.6    1e-09   
ref|XP_010053023.1|  PREDICTED: codeine O-demethylase-like            61.2    1e-09   
ref|NP_173145.1|  Fe(II)/ascorbate oxidase family protein SRG1        61.2    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003547191.1|  PREDICTED: protein SRG1-like                     61.2    1e-09   
ref|XP_006355578.1|  PREDICTED: protein SRG1-like                     61.2    1e-09   
ref|XP_006355577.1|  PREDICTED: protein SRG1-like                     61.2    1e-09   
gb|KHF98196.1|  Protein SRG1 -like protein                            61.2    1e-09   
ref|XP_010095129.1|  Protein SRG1                                     61.2    1e-09   
ref|XP_008345138.1|  PREDICTED: protein SRG1-like                     61.2    1e-09   
ref|XP_002267405.1|  PREDICTED: protein SRG1 isoform X1               61.2    1e-09   Vitis vinifera
emb|CAN60619.1|  hypothetical protein VITISV_010885                   61.2    1e-09   Vitis vinifera
ref|XP_002279610.1|  PREDICTED: S-norcoclaurine synthase 1-like       61.2    1e-09   Vitis vinifera
ref|XP_008439690.1|  PREDICTED: protein SRG1-like                     61.2    1e-09   
gb|AFN53718.1|  putative flavonol synthase                            59.7    1e-09   
ref|XP_010267885.1|  PREDICTED: gibberellin 2-beta-dioxygenase 8-...  60.8    1e-09   
ref|XP_002300322.2|  hypothetical protein POPTR_0001s36500g           59.3    1e-09   Populus trichocarpa [western balsam poplar]
gb|KDP21186.1|  hypothetical protein JCGZ_21657                       61.2    1e-09   
ref|XP_002890198.1|  hypothetical protein ARALYDRAFT_889094           61.2    2e-09   
ref|XP_010057200.1|  PREDICTED: protein SRG1-like isoform X2          61.2    2e-09   
gb|KCW77264.1|  hypothetical protein EUGRSUZ_D01621                   61.2    2e-09   
gb|KDO39143.1|  hypothetical protein CISIN_1g0448911mg                59.3    2e-09   
gb|EMT03128.1|  S-norcoclaurine synthase 1                            61.2    2e-09   
ref|XP_004134919.1|  PREDICTED: protein SRG1-like                     60.8    2e-09   
emb|CDP18685.1|  unnamed protein product                              58.9    2e-09   
emb|CDP14581.1|  unnamed protein product                              60.5    2e-09   
ref|XP_006416751.1|  hypothetical protein EUTSA_v10008010mg           60.8    2e-09   
ref|XP_009149139.1|  PREDICTED: protein SRG1-like                     60.8    2e-09   
emb|CDP14579.1|  unnamed protein product                              60.8    2e-09   
ref|XP_006467559.1|  PREDICTED: protein SRG1-like isoform X2          60.8    2e-09   
ref|XP_010545548.1|  PREDICTED: gibberellin 2-beta-dioxygenase 7 ...  60.8    2e-09   
ref|XP_010057207.1|  PREDICTED: protein SRG1-like isoform X2          60.8    2e-09   
ref|XP_004233003.1|  PREDICTED: protein SRG1-like                     60.8    2e-09   
gb|EMS47228.1|  putative 2-oxoglutarate/Fe(II)-dependent dioxygenase  59.7    2e-09   
ref|XP_002300451.1|  SENESCENCE-RELATED GENE 1 family protein         60.8    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_007025218.1|  Senescence-related gene 1, putative              60.8    2e-09   
gb|KDO41545.1|  hypothetical protein CISIN_1g0456441mg                58.9    2e-09   
ref|XP_010057206.1|  PREDICTED: protein SRG1-like isoform X1          60.8    2e-09   
gb|EMT02970.1|  Protein SRG1                                          60.8    2e-09   
ref|XP_002528475.1|  Leucoanthocyanidin dioxygenase, putative         60.8    2e-09   Ricinus communis
ref|XP_006467558.1|  PREDICTED: protein SRG1-like isoform X1          60.8    2e-09   
gb|ACH60103.1|  ACC oxidase                                           58.5    2e-09   Pseudotsuga menziesii
gb|AFK44282.1|  unknown                                               58.2    2e-09   
gb|KDO52128.1|  hypothetical protein CISIN_1g035879mg                 60.5    2e-09   
gb|ACH60102.1|  ACC oxidase                                           58.5    2e-09   Pseudotsuga menziesii
ref|XP_006494094.1|  PREDICTED: codeine O-demethylase-like isofor...  60.8    2e-09   
ref|XP_004134607.1|  PREDICTED: protein SRG1-like                     60.8    2e-09   
ref|XP_006449603.1|  hypothetical protein CICLE_v10015853mg           60.5    2e-09   
gb|KHG23078.1|  Codeine O-demethylase                                 60.8    2e-09   
emb|CDP21819.1|  unnamed protein product                              58.5    2e-09   
ref|XP_006477808.1|  PREDICTED: protein SRG1-like                     60.5    2e-09   
emb|CDY35138.1|  BnaA06g11480D                                        60.5    2e-09   
ref|XP_011003288.1|  PREDICTED: flavanone 3-dioxygenase               60.5    2e-09   
gb|KDO41913.1|  hypothetical protein CISIN_1g0264532mg                58.5    2e-09   
gb|AFK45789.1|  unknown                                               58.9    3e-09   
gb|KDP21181.1|  hypothetical protein JCGZ_21652                       60.5    3e-09   
ref|XP_002532986.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  60.5    3e-09   Ricinus communis
ref|XP_007025222.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  60.5    3e-09   
ref|XP_007025223.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  60.5    3e-09   
gb|KEH38517.1|  2OG-Fe(II) oxygenase family oxidoreductase            60.5    3e-09   
ref|XP_007013635.1|  Senescence-related gene 1, putative              59.7    3e-09   
gb|ACH60101.1|  ACC oxidase                                           58.2    3e-09   Pseudotsuga menziesii
gb|AFK45966.1|  unknown                                               60.5    3e-09   
gb|KHN06939.1|  Protein SRG1                                          60.5    3e-09   
gb|KCW74258.1|  hypothetical protein EUGRSUZ_E02905                   59.3    3e-09   
emb|CDP21600.1|  unnamed protein product                              58.5    3e-09   
ref|XP_003638405.1|  Protein SRG1                                     60.5    3e-09   
emb|CDX81796.1|  BnaC08g38050D                                        60.5    3e-09   
gb|KEH27895.1|  2OG-Fe(II) oxygenase family oxidoreductase            60.5    3e-09   
gb|KDO69142.1|  hypothetical protein CISIN_1g047368mg                 60.5    3e-09   
ref|XP_009772022.1|  PREDICTED: protein SRG1-like                     60.5    3e-09   
ref|XP_006435645.1|  hypothetical protein CICLE_v10033449mg           60.5    3e-09   
emb|CDY24860.1|  BnaA08g14500D                                        59.3    3e-09   
ref|XP_004502767.1|  PREDICTED: hyoscyamine 6-dioxygenase-like        60.1    3e-09   
ref|XP_004303202.1|  PREDICTED: protein SRG1-like                     60.1    3e-09   
ref|XP_002441510.1|  hypothetical protein SORBIDRAFT_09g028360        60.5    3e-09   Sorghum bicolor [broomcorn]
gb|KDP23860.1|  hypothetical protein JCGZ_27165                       60.1    3e-09   
ref|XP_002300453.1|  SENESCENCE-RELATED GENE 1 family protein         60.1    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_002270646.2|  PREDICTED: protein SRG1-like                     60.8    3e-09   Vitis vinifera
ref|XP_002964234.1|  oxidoreductase                                   60.1    3e-09   
ref|XP_009610880.1|  PREDICTED: protein SRG1-like                     60.1    3e-09   
ref|XP_008371733.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  60.1    3e-09   
ref|XP_008675983.1|  PREDICTED: S-norcoclaurine synthase 1-like       59.7    3e-09   
ref|XP_006403040.1|  hypothetical protein EUTSA_v10006163mg           59.3    3e-09   
gb|AAR89005.1|  putative oxidoreductase                               60.8    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006449601.1|  hypothetical protein CICLE_v10015767mg           60.1    3e-09   
ref|XP_009772021.1|  PREDICTED: protein SRG1-like                     60.1    4e-09   
ref|XP_010498039.1|  PREDICTED: protein SRG1-like                     60.1    4e-09   
tpg|DAA54956.1|  TPA: hypothetical protein ZEAMMB73_256851            60.1    4e-09   
ref|NP_001240998.1|  uncharacterized protein LOC100786574             60.1    4e-09   
gb|KCW74239.1|  hypothetical protein EUGRSUZ_E02878                   59.3    4e-09   
ref|XP_004490336.1|  PREDICTED: protein SRG1-like                     60.1    4e-09   
gb|KHG25230.1|  Protein SRG1 -like protein                            60.1    4e-09   
ref|XP_004515983.1|  PREDICTED: protein SRG1-like                     60.1    4e-09   
ref|XP_009384465.1|  PREDICTED: S-norcoclaurine synthase 1-like       59.7    4e-09   
ref|XP_009610881.1|  PREDICTED: protein SRG1-like                     60.1    4e-09   
ref|XP_010057211.1|  PREDICTED: protein SRG1-like                     60.1    4e-09   
ref|XP_002318498.2|  hypothetical protein POPTR_0012s00660g           58.2    4e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006442326.1|  hypothetical protein CICLE_v10023825mg           58.9    4e-09   
gb|AAT92093.1|  GA 2-oxidase 1                                        59.7    4e-09   Nerium oleander [rose-bay]
dbj|BAJ89823.1|  predicted protein                                    59.7    4e-09   
ref|XP_008373604.1|  PREDICTED: S-norcoclaurine synthase 1-like       59.7    4e-09   
gb|KCW74251.1|  hypothetical protein EUGRSUZ_E02892                   59.7    5e-09   
ref|XP_002981076.1|  2-oxoacid-dependent dioxygenase                  58.2    5e-09   
ref|XP_004504603.1|  PREDICTED: protein SRG1-like                     59.7    5e-09   
ref|XP_007149498.1|  hypothetical protein PHAVU_005G075400g           59.7    5e-09   
emb|CDP20446.1|  unnamed protein product                              57.8    5e-09   
gb|AFK47220.1|  unknown                                               59.3    5e-09   
emb|CDP21498.1|  unnamed protein product                              58.9    5e-09   
emb|CDX89425.1|  BnaA01g14680D                                        57.8    5e-09   
gb|EMT22046.1|  Flavonol synthase/flavanone 3-hydroxylase             59.7    5e-09   
ref|XP_006452692.1|  hypothetical protein CICLE_v10009358mg           58.2    5e-09   
gb|KHN35200.1|  Gibberellin 2-beta-dioxygenase 8                      59.3    5e-09   
gb|KDP21184.1|  hypothetical protein JCGZ_21655                       59.7    5e-09   
emb|CDX92691.1|  BnaC07g39490D                                        57.4    5e-09   
emb|CDY40002.1|  BnaC05g13130D                                        59.3    5e-09   
emb|CAN71932.1|  hypothetical protein VITISV_013419                   59.7    6e-09   
ref|XP_007149497.1|  hypothetical protein PHAVU_005G075300g           57.4    6e-09   
ref|XP_007153159.1|  hypothetical protein PHAVU_003G011800g           59.3    6e-09   
gb|KEH17541.1|  2OG-Fe(II) oxygenase family oxidoreductase            57.4    6e-09   
ref|XP_009109220.1|  PREDICTED: protein SRG1-like isoform X2          59.3    6e-09   
ref|XP_009387185.1|  PREDICTED: protein SRG1-like                     58.9    6e-09   
gb|KDP21180.1|  hypothetical protein JCGZ_21651                       59.3    6e-09   
gb|KHG06473.1|  Protein SRG1 -like protein                            59.7    6e-09   
ref|XP_001796759.1|  hypothetical protein SNOG_06387                  59.7    6e-09   
ref|XP_010427401.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  59.7    6e-09   
gb|KHG25222.1|  Codeine O-demethylase                                 59.3    6e-09   
ref|XP_011085300.1|  PREDICTED: protein SRG1-like                     59.3    6e-09   
ref|XP_002270667.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2      59.3    6e-09   
ref|XP_010919856.1|  PREDICTED: S-norcoclaurine synthase 1-like       59.3    6e-09   
gb|ACG44904.1|  flavonol synthase/flavanone 3-hydroxylase             59.7    6e-09   
gb|KEH22932.1|  2OG-Fe(II) oxygenase family oxidoreductase            59.3    6e-09   
ref|XP_003614582.1|  Protein SRG1                                     57.4    6e-09   
ref|XP_009404656.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  59.3    6e-09   
ref|XP_010104366.1|  S-norcoclaurine synthase 1                       59.3    6e-09   
gb|ABK22292.1|  unknown                                               57.8    6e-09   
gb|KDO78008.1|  hypothetical protein CISIN_1g018099mg                 59.3    6e-09   
emb|CDP14583.1|  unnamed protein product                              58.9    6e-09   
ref|XP_006355624.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  59.3    6e-09   
ref|XP_008784673.1|  PREDICTED: S-norcoclaurine synthase 1-like       59.3    6e-09   
ref|XP_008387797.1|  PREDICTED: protein SRG1-like                     57.4    6e-09   
ref|XP_003538628.1|  PREDICTED: gibberellin 2-beta-dioxygenase 8-...  59.3    6e-09   
gb|KHN28200.1|  Gibberellin 2-beta-dioxygenase 2                      58.2    7e-09   
ref|XP_010053577.1|  PREDICTED: S-norcoclaurine synthase 1-like       59.3    7e-09   
ref|XP_002442102.1|  hypothetical protein SORBIDRAFT_08g011960        59.3    7e-09   
ref|XP_010104367.1|  S-norcoclaurine synthase 1                       59.3    7e-09   
ref|XP_006468196.1|  PREDICTED: protein SRG1-like                     59.3    7e-09   
ref|XP_009109219.1|  PREDICTED: protein SRG1-like isoform X1          59.3    7e-09   
ref|XP_002457722.1|  hypothetical protein SORBIDRAFT_03g012370        59.3    7e-09   
ref|XP_010057195.1|  PREDICTED: protein SRG1-like isoform X1          59.3    7e-09   
ref|XP_011085296.1|  PREDICTED: protein SRG1-like                     59.3    7e-09   
ref|XP_002878055.1|  oxidoreductase                                   59.3    7e-09   
ref|XP_010525534.1|  PREDICTED: protein SRG1-like                     59.3    7e-09   
ref|XP_008225388.1|  PREDICTED: protein SRG1-like                     59.3    7e-09   
gb|KHN03259.1|  Gibberellin 2-beta-dioxygenase 2                      57.8    7e-09   
ref|XP_010057210.1|  PREDICTED: protein SRG1-like                     59.3    7e-09   
ref|XP_010057198.1|  PREDICTED: protein SRG1-like isoform X2          58.9    7e-09   
ref|XP_007214463.1|  hypothetical protein PRUPE_ppa023992mg           59.3    8e-09   
ref|XP_010059076.1|  PREDICTED: codeine O-demethylase-like            59.3    8e-09   
ref|XP_006432916.1|  hypothetical protein CICLE_v10001622mg           59.3    8e-09   
ref|XP_003540518.1|  PREDICTED: protein SRG1-like                     59.3    8e-09   
ref|XP_010665638.1|  PREDICTED: protein SRG1-like                     59.3    8e-09   
ref|WP_024307339.1|  2OG-Fe(II) oxygenase                             58.9    8e-09   
ref|XP_011085299.1|  PREDICTED: protein SRG1-like                     58.9    8e-09   
ref|XP_006449602.1|  hypothetical protein CICLE_v10018344mg           59.3    8e-09   
ref|XP_010057201.1|  PREDICTED: protein SRG1-like                     58.9    8e-09   
ref|XP_009371222.1|  PREDICTED: S-norcoclaurine synthase 1-like       58.9    8e-09   
gb|KDP22220.1|  hypothetical protein JCGZ_26051                       58.9    8e-09   
ref|XP_006432911.1|  hypothetical protein CICLE_v10001626mg           58.9    8e-09   
gb|EEE59328.1|  hypothetical protein OsJ_11403                        58.9    8e-09   
gb|EEE58851.1|  hypothetical protein OsJ_10442                        59.3    8e-09   
ref|XP_002271080.1|  PREDICTED: protein SRG1                          58.9    8e-09   
ref|XP_010059077.1|  PREDICTED: codeine O-demethylase-like            58.9    8e-09   
gb|KDO39329.1|  hypothetical protein CISIN_1g018221mg                 58.9    8e-09   
gb|KCW77900.1|  hypothetical protein EUGRSUZ_D02158                   58.5    8e-09   
ref|XP_009117729.1|  PREDICTED: protein SRG1                          58.9    8e-09   
gb|KEH16982.1|  flavonol synthase/flavanone 3-hydroxylase             57.8    8e-09   
gb|EAY89569.1|  hypothetical protein OsI_11101                        59.3    9e-09   
ref|NP_001049794.1|  Os03g0289800                                     59.3    9e-09   
emb|CDP04983.1|  unnamed protein product                              58.9    9e-09   
ref|XP_010665636.1|  PREDICTED: protein SRG1-like                     58.9    9e-09   
ref|XP_003546739.1|  PREDICTED: protein SRG1                          58.9    9e-09   
gb|EAY90597.1|  hypothetical protein OsI_12197                        58.9    9e-09   
ref|NP_001050453.2|  Os03g0439500                                     58.9    9e-09   
ref|XP_004963604.1|  PREDICTED: gibberellin 2-beta-dioxygenase-like   58.9    9e-09   
emb|CDY21770.1|  BnaA09g45210D                                        58.5    9e-09   
ref|XP_003567249.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  58.9    9e-09   
ref|XP_010059078.1|  PREDICTED: uncharacterized protein LOC104446988  59.7    9e-09   
emb|CDY11068.1|  BnaA03g47270D                                        58.9    9e-09   
ref|XP_009387721.1|  PREDICTED: protein SRG1-like                     57.8    1e-08   
ref|XP_009802658.1|  PREDICTED: gibberellin 2-beta-dioxygenase 8-...  57.0    1e-08   
ref|XP_010028519.1|  PREDICTED: protein SRG1-like isoform X1          58.9    1e-08   
gb|ABK23713.1|  unknown                                               58.9    1e-08   
ref|XP_010057217.1|  PREDICTED: protein SRG1-like isoform X2          58.9    1e-08   
ref|XP_010057197.1|  PREDICTED: protein SRG1-like isoform X1          58.9    1e-08   
emb|CDY21769.1|  BnaA09g45200D                                        58.9    1e-08   
gb|EMT07770.1|  S-norcoclaurine synthase 1                            58.9    1e-08   
ref|XP_011035927.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   58.9    1e-08   
emb|CDY52350.1|  BnaA08g30850D                                        58.2    1e-08   
ref|XP_010551102.1|  PREDICTED: gibberellin 2-beta-dioxygenase 4      58.5    1e-08   
ref|XP_009338589.1|  PREDICTED: protein SRG1-like                     58.9    1e-08   
gb|KEH27901.1|  flavonol synthase/flavanone 3-hydroxylase             58.9    1e-08   
emb|CDO99823.1|  unnamed protein product                              58.9    1e-08   
ref|XP_008347068.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  58.9    1e-08   
gb|KHN09848.1|  Gibberellin 2-beta-dioxygenase 8                      57.0    1e-08   
ref|XP_008369927.1|  PREDICTED: codeine O-demethylase-like            56.6    1e-08   
gb|KHN00215.1|  Protein SRG1                                          57.8    1e-08   
ref|XP_006579891.1|  PREDICTED: codeine O-demethylase-like            57.8    1e-08   
ref|XP_010089920.1|  Naringenin,2-oxoglutarate 3-dioxygenase          58.5    1e-08   
ref|XP_007157175.1|  hypothetical protein PHAVU_002G049000g           58.5    1e-08   
ref|XP_009338608.1|  PREDICTED: protein SRG1-like                     58.5    1e-08   
gb|ACN29258.1|  unknown                                               57.0    1e-08   
ref|XP_010919857.1|  PREDICTED: S-norcoclaurine synthase 1-like       58.9    1e-08   
ref|XP_009137512.1|  PREDICTED: protein SRG1-like                     58.5    1e-08   
ref|XP_010057202.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  58.9    1e-08   
gb|KDP32875.1|  hypothetical protein JCGZ_12167                       58.5    1e-08   
ref|XP_002279404.1|  PREDICTED: S-norcoclaurine synthase 1            58.5    1e-08   
emb|CDY08973.1|  BnaC08g12030D                                        57.8    1e-08   
ref|XP_003560598.1|  PREDICTED: S-norcoclaurine synthase 1-like       58.5    1e-08   
gb|AFK37891.1|  unknown                                               58.2    1e-08   
ref|XP_001759966.1|  predicted protein                                58.5    1e-08   
ref|XP_010664098.1|  PREDICTED: S-norcoclaurine synthase 1 isofor...  58.5    1e-08   
gb|KEH17523.1|  flavonol synthase/flavanone 3-hydroxylase             56.6    1e-08   
ref|XP_009419671.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  58.5    1e-08   
ref|XP_006355571.1|  PREDICTED: protein SRG1-like                     58.5    1e-08   
ref|NP_001268435.1|  gibberellin 2-beta-dioxygenase 8-like            58.5    1e-08   
ref|XP_002279422.2|  PREDICTED: S-norcoclaurine synthase 1 isofor...  58.5    1e-08   
ref|XP_010024676.1|  PREDICTED: protein SRG1                          58.5    1e-08   
emb|CDX94459.1|  BnaC01g17250D                                        57.4    1e-08   
ref|XP_006584377.1|  PREDICTED: protein SRG1-like                     58.5    1e-08   
gb|KDO54061.1|  hypothetical protein CISIN_1g018035mg                 58.5    1e-08   
ref|XP_006428590.1|  hypothetical protein CICLE_v10012028mg           58.5    1e-08   
ref|XP_006355572.1|  PREDICTED: protein SRG1-like                     58.5    1e-08   
ref|XP_010057215.1|  PREDICTED: protein SRG1-like isoform X2          58.5    1e-08   
ref|XP_004986813.1|  PREDICTED: S-norcoclaurine synthase 1-like       57.8    1e-08   
ref|XP_008809847.1|  PREDICTED: gibberellin 2-beta-dioxygenase 8      58.5    1e-08   
ref|XP_007218144.1|  hypothetical protein PRUPE_ppa007291mg           58.5    1e-08   
ref|XP_009117731.1|  PREDICTED: protein SRG1-like                     58.5    1e-08   
gb|KCW74243.1|  hypothetical protein EUGRSUZ_E02880                   57.8    1e-08   
ref|XP_003614583.1|  Protein SRG1                                     58.5    1e-08   
gb|ADE75592.1|  unknown                                               57.8    1e-08   
ref|XP_008347271.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  56.6    1e-08   
gb|KHN25972.1|  Codeine O-demethylase                                 58.5    1e-08   
ref|XP_009382431.1|  PREDICTED: S-norcoclaurine synthase 1-like       58.5    1e-08   
ref|XP_002468701.1|  hypothetical protein SORBIDRAFT_01g050490        58.5    1e-08   
ref|XP_006287961.1|  hypothetical protein CARUB_v10001196mg           58.5    1e-08   
ref|XP_008387515.1|  PREDICTED: LOW QUALITY PROTEIN: probable 2-o...  58.5    1e-08   
ref|XP_010558984.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2      58.5    1e-08   
ref|XP_009125611.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  58.5    1e-08   
ref|XP_007159373.1|  hypothetical protein PHAVU_002G232800g           58.5    1e-08   
ref|XP_011044510.1|  PREDICTED: protein SRG1 isoform X2               58.5    1e-08   
ref|XP_006452694.1|  hypothetical protein CICLE_v10010627mg           58.2    1e-08   
ref|XP_010516190.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  58.5    1e-08   
gb|EMT08383.1|  S-norcoclaurine synthase 1                            58.5    1e-08   
ref|XP_002987104.1|  2-oxoglutarate-iron(II)-dependent oxygenase      58.2    1e-08   
ref|XP_006442325.1|  hypothetical protein CICLE_v10020838mg           58.5    1e-08   
ref|XP_010057199.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  58.5    1e-08   
gb|KHG20563.1|  S-norcoclaurine synthase 1                            57.4    1e-08   
ref|XP_007042329.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  58.5    1e-08   
ref|XP_002869680.1|  oxidoreductase                                   58.5    1e-08   
gb|ACU17663.1|  unknown                                               57.0    1e-08   
ref|XP_009405644.1|  PREDICTED: gibberellin 2-beta-dioxygenase 8      58.2    1e-08   
ref|NP_001065363.2|  Os10g0558400                                     58.5    1e-08   
emb|CDX76423.1|  BnaA08g09770D                                        56.6    1e-08   
emb|CDY47108.1|  BnaC03g64300D                                        56.6    1e-08   
ref|XP_010504468.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  58.5    1e-08   
ref|XP_006477804.1|  PREDICTED: protein SRG1-like                     58.2    1e-08   
ref|XP_006442327.1|  hypothetical protein CICLE_v10020829mg           58.2    1e-08   
ref|XP_003528604.1|  PREDICTED: gibberellin 2-beta-dioxygenase 2-...  58.2    1e-08   
gb|KDO52127.1|  hypothetical protein CISIN_1g045260mg                 58.2    1e-08   
ref|XP_006644154.1|  PREDICTED: protein SRG1-like                     58.2    2e-08   
ref|XP_003638403.1|  Protein SRG1                                     56.6    2e-08   
ref|XP_006399020.1|  hypothetical protein EUTSA_v10013861mg           58.2    2e-08   
ref|XP_004233004.1|  PREDICTED: protein SRG1-like                     58.2    2e-08   
gb|AAM61665.1|  leucoanthocyanidin dioxygenase-like protein           58.2    2e-08   
ref|XP_003550570.1|  PREDICTED: gibberellin 2-beta-dioxygenase 2-...  58.2    2e-08   
ref|XP_006573183.1|  PREDICTED: protein SRG1-like isoform X2          58.2    2e-08   
ref|NP_196179.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...  58.2    2e-08   
ref|XP_010541508.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygenase  58.2    2e-08   
ref|XP_008232058.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  58.2    2e-08   
gb|ACH60110.1|  ACC oxidase                                           55.8    2e-08   
ref|XP_007026685.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  58.2    2e-08   
gb|KHN04712.1|  S-norcoclaurine synthase 1                            58.2    2e-08   
ref|XP_011090939.1|  PREDICTED: protein SRG1                          58.2    2e-08   
ref|XP_010273389.1|  PREDICTED: protein SRG1-like                     58.2    2e-08   
emb|CDY14105.1|  BnaC02g02220D                                        58.2    2e-08   
ref|XP_010267325.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  58.2    2e-08   
gb|KCW74246.1|  hypothetical protein EUGRSUZ_E02883                   57.4    2e-08   
gb|EMT22994.1|  Leucoanthocyanidin dioxygenase                        58.2    2e-08   
gb|AAP54987.2|  oxidoreductase, 2OG-Fe oxygenase family protein       58.5    2e-08   
emb|CAN69330.1|  hypothetical protein VITISV_016336                   58.2    2e-08   
ref|XP_002314207.1|  hypothetical protein POPTR_0009s03100g           58.2    2e-08   
ref|XP_003556637.1|  PREDICTED: protein SRG1-like                     58.2    2e-08   
ref|XP_010267324.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  58.2    2e-08   
ref|XP_002985408.1|  2-oxoglutarate-iron(II)-dependent oxygenase      58.2    2e-08   
ref|XP_009382428.1|  PREDICTED: S-norcoclaurine synthase 1-like       58.2    2e-08   
ref|XP_003517890.1|  PREDICTED: protein SRG1-like isoform X1          58.2    2e-08   
ref|XP_010241650.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  58.2    2e-08   
ref|XP_008387794.1|  PREDICTED: protein SRG1-like                     58.2    2e-08   
ref|NP_191156.1|  jasmonate-regulated protein JRG21                   58.2    2e-08   
emb|CDP20388.1|  unnamed protein product                              57.8    2e-08   
ref|XP_003542959.2|  PREDICTED: codeine O-demethylase-like            58.2    2e-08   
ref|XP_011028238.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  58.2    2e-08   
sp|D4N501.1|DIOX2_PAPSO  RecName: Full=Probable 2-oxoglutarate/Fe...  58.2    2e-08   
ref|XP_003610659.1|  Gibberellin 2-beta-dioxygenase                   57.8    2e-08   
ref|XP_009610869.1|  PREDICTED: protein SRG1-like isoform X2          57.4    2e-08   
ref|XP_004246595.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1      58.2    2e-08   
emb|CDM84843.1|  unnamed protein product                              58.2    2e-08   
ref|XP_003529253.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  57.8    2e-08   
emb|CBI33962.3|  unnamed protein product                              58.5    2e-08   
ref|XP_003556632.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  57.8    2e-08   
gb|KHN47359.1|  Protein SRG1                                          57.8    2e-08   
emb|CBI30780.3|  unnamed protein product                              57.8    2e-08   
ref|XP_006348073.1|  PREDICTED: gibberellin 2-beta-dioxygenase 8-...  57.8    2e-08   
ref|XP_004233005.2|  PREDICTED: codeine O-demethylase-like            57.8    2e-08   
emb|CBI32479.3|  unnamed protein product                              55.1    2e-08   
ref|XP_002279625.1|  PREDICTED: S-norcoclaurine synthase 1            57.8    2e-08   
ref|XP_010317349.1|  PREDICTED: protein SRG1-like                     55.1    2e-08   
ref|XP_009109951.1|  PREDICTED: gibberellin 20 oxidase 2-like         56.2    2e-08   
ref|XP_007155081.1|  hypothetical protein PHAVU_003G171600g           57.8    2e-08   
gb|AHW42451.1|  GA2ox1                                                57.8    2e-08   
ref|XP_002269890.1|  PREDICTED: protein SRG1                          57.8    2e-08   
ref|XP_009610868.1|  PREDICTED: protein SRG1-like isoform X1          57.8    2e-08   
ref|XP_010498038.1|  PREDICTED: protein SRG1-like                     57.8    2e-08   
ref|XP_010253753.1|  PREDICTED: protein SRG1-like                     57.8    2e-08   
ref|XP_003560597.1|  PREDICTED: S-norcoclaurine synthase 1-like       57.8    2e-08   
gb|KEH16106.1|  flavonol synthase/flavanone 3-hydroxylase             57.8    2e-08   
gb|KEH19984.1|  flavonol synthase/flavanone 3-hydroxylase             57.8    2e-08   
emb|CDP20503.1|  unnamed protein product                              57.8    2e-08   



>ref|XP_006355629.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=366

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G WIPV   PDAFVVNIGDILEI +NG+YKS+EHR +
Sbjct  251  LQIKKD-GAWIPVPYRPDAFVVNIGDILEIVTNGIYKSIEHRAI  293



>ref|XP_008366013.1| PREDICTED: protein SRG1-like [Malus domestica]
Length=304

 Score = 67.0 bits (162),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K  DG W+PV+ H DAFVVN+GDI E+ SNG+YKS+EHRVM
Sbjct  193  LQIK-KDGVWMPVKFHKDAFVVNVGDIXEMLSNGVYKSIEHRVM  235



>ref|XP_004986102.1| PREDICTED: S-norcoclaurine synthase 1-like [Setaria italica]
Length=349

 Score = 67.0 bits (162),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQVK DDG+W+PV     AFVVN+GDIL+IF+NG Y+S+EHR +
Sbjct  239  LQVKRDDGSWVPVRPLQGAFVVNVGDILQIFTNGRYRSIEHRAV  282



>ref|XP_008366519.1| PREDICTED: protein SRG1-like, partial [Malus domestica]
Length=197

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W+PV+  PDAF+VNIGDILEI +NG Y+S+EHR
Sbjct  84   LQVKKD-GIWVPVKPLPDAFIVNIGDILEIITNGTYRSIEHR  124



>emb|CAN72012.1| hypothetical protein VITISV_008971 [Vitis vinifera]
Length=226

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ++  DG WIP+   P+AF+VNIGDILEIFSNG+YKS+EHR 
Sbjct  110  LQIR-KDGMWIPITPLPNAFIVNIGDILEIFSNGIYKSIEHRA  151



>ref|XP_008359374.1| PREDICTED: protein SRG1-like, partial [Malus domestica]
Length=196

 Score = 65.1 bits (157),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W+PV+  PDAF+VNIGDILEI +NG Y+S+EHR
Sbjct  83   LQVKKD-GIWVPVKPLPDAFIVNIGDILEIITNGTYRSIEHR  123



>ref|XP_009360957.1| PREDICTED: protein SRG1-like [Pyrus x bretschneideri]
Length=365

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K  DG W+PV  H DAFVVN+GDI E+ SNG+YKS+EHRVM
Sbjct  254  LQIK-KDGVWMPVNFHKDAFVVNVGDIFEMLSNGVYKSIEHRVM  296



>emb|CAN63126.1| hypothetical protein VITISV_017242 [Vitis vinifera]
Length=338

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQVK D G WIPV   PDAFVVN+GDILEI SNG+Y S+EHR +
Sbjct  223  LQVKKD-GVWIPVNFLPDAFVVNLGDILEIVSNGIYNSIEHRAV  265



>ref|XP_009352081.1| PREDICTED: codeine O-demethylase-like [Pyrus x bretschneideri]
Length=302

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G W+PV +  DAFVVN+GDI E+ SNG+YKSVEHRVM
Sbjct  194  LQIKKD-GAWMPVNIQKDAFVVNVGDIFEMLSNGVYKSVEHRVM  236



>ref|XP_002269718.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=362

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQVK D G WIPV   PDAFVVN+GDILEI SNG+Y S+EHR +
Sbjct  247  LQVKKD-GVWIPVNFLPDAFVVNLGDILEIVSNGIYNSIEHRAV  289



>emb|CBI30778.3| unnamed protein product [Vitis vinifera]
Length=187

 Score = 64.3 bits (155),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK D G WIPV   PDAFVVN+GDILEI SNG+Y S+EHR 
Sbjct  72   LQVKKD-GVWIPVNFLPDAFVVNLGDILEIVSNGIYNSIEHRA  113



>ref|NP_001044707.1| Os01g0832600 [Oryza sativa Japonica Group]
 dbj|BAD73770.1| putative anthocyanidin synthase [Oryza sativa Japonica Group]
 dbj|BAF06621.1| Os01g0832600 [Oryza sativa Japonica Group]
 gb|EEC71744.1| hypothetical protein OsI_04312 [Oryza sativa Indica Group]
 gb|EEE55628.1| hypothetical protein OsJ_03968 [Oryza sativa Japonica Group]
Length=366

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQV+  DG+W+ V+  PDAF+VN+GD +EI SN +YKSVEHRV+
Sbjct  249  LQVRRRDGHWVTVQPLPDAFIVNVGDQIEILSNSMYKSVEHRVI  292



>ref|XP_006365610.1| PREDICTED: codeine O-demethylase-like [Solanum tuberosum]
Length=319

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK  DG WIPVE  P+AFVVNIGDILEI+SNG+YKS EH+V
Sbjct  209  LQVK-QDGVWIPVEFIPNAFVVNIGDILEIWSNGVYKSPEHKV  250



>ref|XP_009352088.1| PREDICTED: codeine O-demethylase-like [Pyrus x bretschneideri]
Length=302

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G W+PV    DAFVVN+GDI E+ SNG+YKS+EHRVM
Sbjct  194  LQIKKD-GAWMPVNFQKDAFVVNVGDIFEMLSNGVYKSIEHRVM  236



>ref|XP_006420284.1| hypothetical protein CICLE_v10005497mg [Citrus clementina]
 gb|ESR33524.1| hypothetical protein CICLE_v10005497mg [Citrus clementina]
Length=307

 Score = 64.7 bits (156),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+PV   PDAF++N+GDILE+F+NG+Y+S+EHR
Sbjct  192  LQIKKD-GMWVPVIPLPDAFIINVGDILEVFTNGIYRSIEHR  232



>emb|CAN73448.1| hypothetical protein VITISV_030816 [Vitis vinifera]
Length=289

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GDILEI SNG+Y S+EHR
Sbjct  177  LQIKKD-GVWIPVSFLPDALVVNVGDILEILSNGVYTSIEHR  217



>emb|CBI16708.3| unnamed protein product [Vitis vinifera]
Length=316

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++  DG WIP+   P+AF+VNIGDILEIFSNG+YKS+EHR +
Sbjct  200  LQIR-KDGMWIPITPLPNAFIVNIGDILEIFSNGIYKSIEHRAV  242



>ref|XP_003516325.1| PREDICTED: protein SRG1 [Glycine max]
 gb|KHN03628.1| Protein SRG1 [Glycine soja]
Length=350

 Score = 65.1 bits (157),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D GNWIPV+  P+AFV+N+GDILEI +NG+Y+S+EHR 
Sbjct  241  LQIKKD-GNWIPVKPLPNAFVINVGDILEILTNGIYRSIEHRA  282



>ref|XP_007213578.1| hypothetical protein PRUPE_ppa014989mg, partial [Prunus persica]
 gb|EMJ14777.1| hypothetical protein PRUPE_ppa014989mg, partial [Prunus persica]
Length=160

 Score = 63.2 bits (152),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK  DG W+PV+  PDAF+VNIGDILEI +NG+Y+S+EHR 
Sbjct  52   LQVK-KDGIWVPVKPLPDAFIVNIGDILEIQTNGIYRSIEHRA  93



>emb|CBI30788.3| unnamed protein product [Vitis vinifera]
Length=304

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GDILEI SNG+Y S+EHR
Sbjct  192  LQIKKD-GVWIPVSFLPDALVVNVGDILEILSNGVYTSIEHR  232



>ref|XP_002268288.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=364

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++  DG WIP+   P+AF+VNIGDILEIFSNG+YKS+EHR +
Sbjct  248  LQIR-KDGMWIPITPLPNAFIVNIGDILEIFSNGIYKSIEHRAV  290



>emb|CBI16709.3| unnamed protein product [Vitis vinifera]
Length=367

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++  DG WIP+   P+AF+VNIGDILEIFSNG+YKS+EHR +
Sbjct  251  LQIR-KDGMWIPITPLPNAFIVNIGDILEIFSNGIYKSIEHRAV  293



>ref|XP_008371732.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
[Malus domestica]
Length=364

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G W+PV    DAFVVN+GDI E+ SNG+YKS+EHR M
Sbjct  256  LQIKKD-GAWMPVNFQKDAFVVNVGDIFEMLSNGVYKSIEHRAM  298



>ref|NP_001141508.1| uncharacterized protein LOC100273620 [Zea mays]
 gb|ACF86518.1| unknown [Zea mays]
Length=315

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQV++ DG WI VE  PDAF+VN+GD +++ SN  YKSVEHRV
Sbjct  189  LQVRSPDGQWIVVEPVPDAFIVNVGDQIQVLSNAAYKSVEHRV  231



>ref|XP_002269432.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=348

 Score = 64.7 bits (156),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++  DG WIP+   P+AF+VNIGDILEIFSNG+YKS+EHR +
Sbjct  232  LQIR-KDGMWIPITPLPNAFIVNIGDILEIFSNGIYKSIEHRAV  274



>ref|XP_004984849.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Setaria italica]
Length=378

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQV++ DG WI VE  PDAF+VN+GD +++ SN  YKSVEHRV
Sbjct  251  LQVRSPDGQWITVEPVPDAFIVNVGDQIQVLSNAAYKSVEHRV  293



>ref|XP_011046706.1| PREDICTED: codeine O-demethylase-like [Populus euphratica]
Length=365

 Score = 64.7 bits (156),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G WIPV+  PDA VVN+GDILEI SNG+YKS+EHRV
Sbjct  246  LQIKRD-GVWIPVKFIPDALVVNVGDILEILSNGVYKSIEHRV  287



>emb|CAN72414.1| hypothetical protein VITISV_032872 [Vitis vinifera]
Length=395

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++  DG WIP+   P+AF+VNIGDILEIFSNG+YKS+EHR +
Sbjct  279  LQIR-KDGMWIPITPLPNAFIVNIGDILEIFSNGIYKSIEHRAV  321



>gb|KDO37449.1| hypothetical protein CISIN_1g040795mg, partial [Citrus sinensis]
Length=114

 Score = 62.0 bits (149),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K  DG W+ V+  PDAFVVNIGD LEIF+NG Y+S+EHR  
Sbjct  2    LQIK-KDGKWVAVKPLPDAFVVNIGDALEIFTNGTYRSIEHRAT  44



>ref|XP_009792316.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=371

 Score = 64.7 bits (156),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
             QVK D G WIPV   P+AFVVN+GDILE+ SNGLYKS+EHR
Sbjct  257  FQVKKD-GVWIPVHFLPNAFVVNLGDILEVSSNGLYKSIEHR  297



>ref|XP_006646452.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Oryza brachyantha]
Length=380

 Score = 64.7 bits (156),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQV+  DG+W+ V+  PDAF+VN+GD ++I SN +YKSVEHRV+
Sbjct  264  LQVRRRDGHWVTVQPLPDAFIVNVGDQIQILSNSMYKSVEHRVI  307



>emb|CBI30781.3| unnamed protein product [Vitis vinifera]
Length=393

 Score = 64.7 bits (156),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GDILEI SNG+Y S+EHR
Sbjct  281  LQIKKD-GVWIPVSFLPDALVVNVGDILEILSNGVYTSIEHR  321



>ref|XP_002969158.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
 gb|EFJ30274.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
Length=335

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ + G W PV+  PDAFVVNIGDILE+ SNG+YKSVEHR
Sbjct  232  LQIRKN-GEWKPVKSMPDAFVVNIGDILEVMSNGIYKSVEHR  272



>ref|XP_002973903.1| 2-oxoglutarate, iron(II)-dependent oxygenase [Selaginella moellendorffii]
 gb|EFJ24858.1| 2-oxoglutarate, iron(II)-dependent oxygenase [Selaginella moellendorffii]
Length=335

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ + G W PV+  PDAFVVNIGDILE+ SNG+YKSVEHR
Sbjct  232  LQIRKN-GEWKPVKSMPDAFVVNIGDILEVMSNGIYKSVEHR  272



>ref|XP_002519763.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF42736.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=251

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G ++PV+  PDAF++N+GDILE+ +NG+YKSVEHR
Sbjct  139  LQVKKD-GKYVPVKPLPDAFIINVGDILEVVTNGIYKSVEHR  179



>emb|CBI30785.3| unnamed protein product [Vitis vinifera]
Length=424

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GDILEI SNG+Y S+EHR
Sbjct  312  LQIKKD-GVWIPVSFLPDALVVNVGDILEILSNGVYTSIEHR  352



>ref|XP_002270036.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=359

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GDILEI SNG+Y S+EHR
Sbjct  247  LQIKKD-GVWIPVSFLPDALVVNVGDILEILSNGVYTSIEHR  287



>ref|XP_008667799.1| PREDICTED: uncharacterized protein LOC100273620 isoform X1 [Zea 
mays]
 tpg|DAA44842.1| TPA: hypothetical protein ZEAMMB73_078381 [Zea mays]
Length=376

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQV++ DG WI VE  PDAF+VN+GD +++ SN  YKSVEHRV
Sbjct  250  LQVRSPDGQWIVVEPVPDAFIVNVGDQIQVLSNAAYKSVEHRV  292



>ref|XP_002270288.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=359

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GDILEI SNG+Y S+EHR
Sbjct  247  LQIKKD-GVWIPVSFLPDALVVNVGDILEILSNGVYTSIEHR  287



>ref|XP_006432904.1| hypothetical protein CICLE_v10001623mg [Citrus clementina]
 gb|ESR46144.1| hypothetical protein CICLE_v10001623mg [Citrus clementina]
Length=278

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G W+ V+  PDAF+VNIGD LEIF+NG Y+S+EHRV
Sbjct  166  LQIKKD-GKWVAVKPLPDAFIVNIGDALEIFTNGTYRSIEHRV  207



>ref|XP_002270514.1| PREDICTED: protein SRG1-like [Vitis vinifera]
Length=359

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GDILEI SNG+Y S+EHR
Sbjct  247  LQIKKD-GVWIPVSFLPDALVVNVGDILEILSNGVYTSIEHR  287



>ref|XP_007022032.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13557.1| Senescence-related gene 1 [Theobroma cacao]
Length=375

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W+PV+  P+AF+VNIGDILEI +NG+Y+S+EHR
Sbjct  268  LQVKKD-GKWVPVKPLPNAFIVNIGDILEIITNGVYRSIEHR  308



>emb|CBI30787.3| unnamed protein product [Vitis vinifera]
Length=301

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  192  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  232



>ref|XP_009376717.1| PREDICTED: protein SRG1-like [Pyrus x bretschneideri]
Length=363

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W+PV+  PDAF+VNIGD+LEI +NG Y+S+EHR
Sbjct  255  LQVKKD-GIWVPVKPLPDAFIVNIGDVLEIITNGTYRSIEHR  295



>ref|NP_001242069.1| uncharacterized protein LOC100777264 [Glycine max]
 gb|ACU23067.1| unknown [Glycine max]
Length=358

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+ T DG W+P++  P+AF++NIGD+LEI SNG+Y+SVEHR M
Sbjct  251  LQI-TKDGMWVPIKPLPNAFIINIGDMLEIISNGIYRSVEHRAM  293



>emb|CBI30794.3| unnamed protein product [Vitis vinifera]
Length=141

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ + G WIPV+  P+AFV+N+GDI+EI SNG+Y S+EHRVM
Sbjct  26   LQIRKE-GRWIPVKPLPNAFVINVGDIMEIVSNGVYHSIEHRVM  68



>ref|XP_006489681.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=362

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+PV   PDAF++N+GDILE+F+NG+Y+S+EHR
Sbjct  247  LQIKKD-GMWVPVIPLPDAFIINVGDILEVFTNGIYRSIEHR  287



>emb|CBI30795.3| unnamed protein product [Vitis vinifera]
Length=492

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ + G W+PV+  P+AFVVNIGDI+EI SNG+Y+S+EHR M
Sbjct  377  LQIRKE-GRWVPVKPLPNAFVVNIGDIMEIVSNGIYQSIEHRAM  419



>ref|XP_002519764.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
 gb|EEF42737.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
Length=213

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV+  P+AF++NIGD+LEI +NG+Y+S+EHR
Sbjct  100  LQIKKD-GFWIPVQPIPNAFIINIGDMLEILTNGIYRSIEHR  140



>ref|XP_010540138.1| PREDICTED: protein SRG1-like [Tarenaya hassleriana]
Length=387

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G W+PV+  P+AF+VNIGDILEI +NG Y+SVEHR M
Sbjct  280  LQIKKD-GKWVPVKPLPNAFIVNIGDILEIITNGTYRSVEHRAM  322



>ref|XP_008361457.1| PREDICTED: protein SRG1-like [Malus domestica]
Length=163

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQVK  DG W+PV+  PDAF+VNIGD+LE+ +NG Y+S+EHR +
Sbjct  55   LQVK-KDGIWVPVKPLPDAFIVNIGDVLEVITNGTYRSIEHRAI  97



>gb|KDO43333.1| hypothetical protein CISIN_1g022160mg [Citrus sinensis]
Length=301

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+P++  PDAF++NIGD+LEI +NG+Y+S+EHR
Sbjct  194  LQIKKD-GMWVPIKPLPDAFIINIGDVLEIITNGIYRSIEHR  234



>ref|XP_009376720.1| PREDICTED: protein SRG1-like isoform X1 [Pyrus x bretschneideri]
Length=360

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W+PV+  PDAF+VNIGD+LEI +NG Y+S+EHR
Sbjct  252  LQVKKD-GIWVPVKPLPDAFIVNIGDVLEIITNGTYRSIEHR  292



>ref|XP_004134920.1| PREDICTED: protein SRG1-like [Cucumis sativus]
 ref|XP_004168647.1| PREDICTED: protein SRG1-like [Cucumis sativus]
Length=351

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W PV   PDAF+VN+GDI+EI SNGLY S+EHR
Sbjct  234  LQVKKD-GIWFPVSFIPDAFIVNLGDIIEIISNGLYNSIEHR  274



>ref|XP_008356069.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
[Malus domestica]
Length=364

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G W+PV    DAFVVN+GDI E+ SNG+YKS+EHR M
Sbjct  256  LQIKKD-GAWMPVNFQKDAFVVNVGDIFEMLSNGVYKSIEHRAM  298



>ref|XP_009376718.1| PREDICTED: protein SRG1-like isoform X1 [Pyrus x bretschneideri]
Length=363

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W+PV+  PDAF+VNIGD+LEI +NG Y+S+EHR
Sbjct  255  LQVKKD-GIWVPVKPLPDAFIVNIGDVLEIITNGTYRSIEHR  295



>gb|KHN19470.1| Protein SRG1 [Glycine soja]
Length=358

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  14   TDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            T DG W+P++  P+AF++NIGD+LEI SNG+Y+SVEHR M
Sbjct  254  TKDGMWVPIKPLPNAFIINIGDMLEIISNGIYRSVEHRAM  293



>gb|KGN49350.1| hypothetical protein Csa_6G520480 [Cucumis sativus]
Length=186

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK  DG W PV   PDAF+VN+GDI+EI SNGLY S+EHR 
Sbjct  69   LQVK-KDGIWFPVSFIPDAFIVNLGDIIEIISNGLYNSIEHRA  110



>ref|XP_009376719.1| PREDICTED: protein SRG1-like isoform X2 [Pyrus x bretschneideri]
Length=360

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W+PV+  PDAF+VNIGD+LEI +NG Y+S+EHR
Sbjct  252  LQVKKD-GIWVPVKPLPDAFIVNIGDVLEIITNGTYRSIEHR  292



>ref|XP_002519766.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF42739.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=366

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ D GNWIPV+  PDAFV+NIGD LEI +NG+Y S+EHR
Sbjct  248  LQIRKD-GNWIPVKPLPDAFVINIGDSLEIMTNGIYPSIEHR  288



>emb|CBI30792.3| unnamed protein product [Vitis vinifera]
Length=307

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  192  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  232



>ref|XP_003614575.1| SRG1-like protein [Medicago truncatula]
 gb|AES97533.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=355

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++  DG WIPV+  P+AFVVN+GD+LEIF+NG+Y+S+EHR
Sbjct  242  LQIR-KDGQWIPVQPLPNAFVVNLGDMLEIFTNGIYRSIEHR  282



>ref|XP_004233006.1| PREDICTED: protein SRG1-like [Solanum lycopersicum]
Length=359

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIP+E  P+AF+VN+GD  EIFSNG+YKS+EHR
Sbjct  244  LQIKKD-GIWIPIEPLPNAFIVNVGDAFEIFSNGIYKSIEHR  284



>ref|XP_008366518.1| PREDICTED: protein SRG1-like [Malus domestica]
Length=365

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W+PV+  PDAF+VNIGD+LEI +NG Y+S+EHR
Sbjct  257  LQVKKD-GIWVPVKPLPDAFIVNIGDVLEIITNGTYRSIEHR  297



>gb|AFN53719.1| putative Fe(II) oxygenase superfamily protein [Linum usitatissimum]
Length=1022

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK +DG W+PV   PDA +VN+GDILEI SNG+YKSVEHR
Sbjct  255  LQVK-NDGYWVPVTPLPDALIVNVGDILEIVSNGVYKSVEHR  295


 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK +DG W+PV   PDA +VN+GDILEI SNG+YKSVEHR
Sbjct  397  LQVK-NDGYWVPVTPLPDALIVNVGDILEIVSNGVYKSVEHR  437



>emb|CBI30786.3| unnamed protein product [Vitis vinifera]
Length=307

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  192  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  232



>gb|AFG48473.1| hypothetical protein 2_5499_01, partial [Pinus taeda]
 gb|AFG48474.1| hypothetical protein 2_5499_01, partial [Pinus taeda]
Length=135

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQVK  DG WI V+  P++FV+N+GD ++++SNG Y+SVEHRV+
Sbjct  79   LQVKRKDGEWIGVKPMPNSFVINVGDCMQVWSNGKYESVEHRVV  122



>ref|XP_009782598.1| PREDICTED: thebaine 6-O-demethylase-like [Nicotiana sylvestris]
Length=184

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIP+   P+AFVVNI D+LEI +NG+YKSVEHR
Sbjct  68   LQIKKD-GAWIPITPLPNAFVVNIADMLEILTNGIYKSVEHR  108



>emb|CAN62525.1| hypothetical protein VITISV_002347 [Vitis vinifera]
Length=356

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  247  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  287



>ref|XP_006489639.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=356

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+P++  PDAF++NIGD+LEI +NG+Y+S+EHR
Sbjct  249  LQIKKD-GMWVPIKPLPDAFIINIGDVLEIITNGIYRSIEHR  289



>emb|CBI30784.3| unnamed protein product [Vitis vinifera]
Length=446

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  143  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  183



>ref|XP_004233861.2| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101257141 
[Solanum lycopersicum]
Length=1114

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G W PV   PDAFVVNIGDILEI +NG+YKS EHR +
Sbjct  249  LQIKKD-GAWTPVPYLPDAFVVNIGDILEILTNGIYKSTEHRAI  291


 Score = 63.2 bits (152),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +2

Query  2     LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEH  124
             LQ+K D G WIPV   PDAFVVNIGDILEI +NG+YKS++H
Sbjct  1007  LQIKKD-GAWIPVPYLPDAFVVNIGDILEIVTNGIYKSIDH  1046


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQV+ DD  W+P++  P+A +VNIGD++EI SNG+Y+S+EHR +
Sbjct  616  LQVRKDD-IWVPIKPLPNALIVNIGDMMEILSNGVYRSIEHRAI  658



>emb|CBI30791.3| unnamed protein product [Vitis vinifera]
Length=398

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  283  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  323



>ref|XP_002267208.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=357

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV + PDA VVN+GDILEI SNG+Y S+EHR
Sbjct  248  LQIKKD-GVWIPVNVLPDALVVNVGDILEIVSNGMYTSIEHR  288



>ref|XP_002270474.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=355

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  246  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  286



>ref|XP_006432900.1| hypothetical protein CICLE_v10002117mg [Citrus clementina]
 gb|ESR46140.1| hypothetical protein CICLE_v10002117mg [Citrus clementina]
Length=278

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+ V   PDAF+VNIGDILE+F+NG Y+S+EHR
Sbjct  166  LQIKKD-GKWVAVRPLPDAFIVNIGDILEVFTNGTYRSIEHR  206



>ref|XP_009376708.1| PREDICTED: protein SRG1-like [Pyrus x bretschneideri]
Length=367

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W+PV+  PDAF+VNIGD+LEI +NG Y+S+EHR
Sbjct  259  LQVKKD-GIWVPVKPLPDAFIVNIGDVLEIITNGTYRSIEHR  299



>ref|XP_002300323.2| hypothetical protein POPTR_0001s36520g [Populus trichocarpa]
 gb|EEE85128.2| hypothetical protein POPTR_0001s36520g [Populus trichocarpa]
Length=365

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G WIPV+  PDA VVN+GDILEI SNG+YKS+EHR 
Sbjct  246  LQIKRD-GVWIPVKFIPDALVVNVGDILEILSNGVYKSIEHRA  287



>ref|XP_006442330.1| hypothetical protein CICLE_v10020843mg [Citrus clementina]
 gb|ESR55570.1| hypothetical protein CICLE_v10020843mg [Citrus clementina]
Length=355

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQVK D G WIPV   PDAF+VNIGD LEI +NG Y+S+EHR +
Sbjct  243  LQVKKD-GKWIPVTPLPDAFIVNIGDTLEIITNGTYRSIEHRAV  285



>ref|XP_003561738.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Brachypodium 
distachyon]
Length=367

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQV+  DG+WI V+  PDAF+VN+GD +++ SN  YKSVEHRV
Sbjct  254  LQVRNKDGHWITVDPVPDAFIVNVGDQIQVLSNAAYKSVEHRV  296



>ref|XP_006477806.1| PREDICTED: protein SRG1-like [Citrus sinensis]
 ref|XP_006477807.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=355

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQVK D G WIPV   PDAF+VNIGD LEI +NG Y+S+EHR +
Sbjct  243  LQVKKD-GKWIPVTPLPDAFIVNIGDTLEIITNGTYRSIEHRAV  285



>ref|XP_009376721.1| PREDICTED: protein SRG1-like isoform X2 [Pyrus x bretschneideri]
Length=360

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W+PV+  PDAF+VNIGD+LE+ +NG Y+S+EHR
Sbjct  252  LQVKKD-GIWVPVKPLPDAFIVNIGDVLEVITNGTYRSIEHR  292



>ref|XP_006442333.1| hypothetical protein CICLE_v10020840mg [Citrus clementina]
 gb|ESR55573.1| hypothetical protein CICLE_v10020840mg [Citrus clementina]
Length=355

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQVK D G WIPV   PDAF+VNIGD LEI +NG Y+S+EHR +
Sbjct  243  LQVKKD-GKWIPVTPLPDAFIVNIGDTLEIITNGTYRSIEHRAV  285



>emb|CBI30783.3| unnamed protein product [Vitis vinifera]
Length=192

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   P A VVNIGDILEI SNG+Y S+EHR
Sbjct  67   LQIKKD-GVWIPVSFLPGALVVNIGDILEILSNGVYTSIEHR  107



>ref|XP_006420337.1| hypothetical protein CICLE_v10005281mg [Citrus clementina]
 gb|ESR33577.1| hypothetical protein CICLE_v10005281mg [Citrus clementina]
Length=356

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+P++  PDAF++NIGD+LEI +NG+Y+S+EHR
Sbjct  249  LQIKKD-GMWVPIKPLPDAFIINIGDVLEIITNGIYRSIEHR  289



>ref|XP_002271009.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=362

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  247  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  287



>ref|XP_006355625.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=366

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G WIPV   PDAFVVNIGDILEI +N +YKS+EHR +
Sbjct  251  LQIKKD-GAWIPVPYCPDAFVVNIGDILEIVTNRIYKSIEHRAI  293



>ref|XP_003632981.1| PREDICTED: protein SRG1-like [Vitis vinifera]
Length=362

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  247  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  287



>ref|XP_003632980.1| PREDICTED: protein SRG1-like [Vitis vinifera]
Length=363

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  248  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  288



>ref|XP_010476836.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=358

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK +DG WIPV+  P+AF+VNIGDILEI +NG Y+S+EHR
Sbjct  251  LQVK-NDGKWIPVKPLPNAFIVNIGDILEIITNGTYRSIEHR  291



>ref|XP_006494098.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=278

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+ V+  PDAFVVNIGD LEIF+NG Y+S+EHR
Sbjct  166  LQIKKD-GKWVAVKPLPDAFVVNIGDALEIFTNGTYRSIEHR  206



>ref|XP_010655797.1| PREDICTED: protein SRG1-like [Vitis vinifera]
Length=359

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  257  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  297



>ref|XP_002270078.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=362

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  247  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  287



>emb|CBI30782.3| unnamed protein product [Vitis vinifera]
Length=371

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   PDA VVN+GD+LEI SNG+Y S+EHR
Sbjct  247  LQIKKD-GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHR  287



>ref|XP_007013636.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY31255.1| Senescence-related gene 1 [Theobroma cacao]
Length=356

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ D G WIP++  P+AFV+NIGDILEI SNG+Y+S+EHR
Sbjct  249  LQIRKD-GAWIPIKPLPNAFVINIGDILEIVSNGIYRSIEHR  289



>ref|XP_011085301.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=352

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   P+AFV+NIGDILEI++NG Y+S+EHR
Sbjct  245  LQIKKD-GAWIPVSPLPNAFVINIGDILEIWTNGAYRSIEHR  285



>ref|XP_006486392.1| PREDICTED: codeine O-demethylase-like [Citrus sinensis]
Length=165

 Score = 61.2 bits (147),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K  D +WIPV+  PDA VVNIGD+ E+ SNGLYKSVEHR +
Sbjct  57   LQIKHKD-SWIPVKPIPDAIVVNIGDVAEVLSNGLYKSVEHRAV  99



>ref|XP_010057205.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74248.1| hypothetical protein EUGRSUZ_E02888 [Eucalyptus grandis]
Length=370

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+KT+ G W+PV+  P+AFVVN+GDILEI +NG Y+S+EHR
Sbjct  251  LQIKTE-GKWVPVKPLPNAFVVNVGDILEIVTNGTYRSIEHR  291



>ref|XP_009361472.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
[Pyrus x bretschneideri]
Length=377

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ + G+W+ VE HP++FVVN+GD LEIFSNG YKSV HRV+
Sbjct  266  LQIQ-NQGSWVTVEPHPNSFVVNVGDHLEIFSNGRYKSVVHRVL  308



>ref|XP_006432905.1| hypothetical protein CICLE_v10001623mg [Citrus clementina]
 ref|XP_006494091.1| PREDICTED: protein SRG1-like [Citrus sinensis]
 gb|ESR46145.1| hypothetical protein CICLE_v10001623mg [Citrus clementina]
Length=359

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G W+ V+  PDAF+VNIGD LEIF+NG Y+S+EHRV
Sbjct  247  LQIKKD-GKWVAVKPLPDAFIVNIGDALEIFTNGTYRSIEHRV  288



>ref|XP_011045561.1| PREDICTED: protein SRG1-like [Populus euphratica]
Length=359

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ D G W+P++  P+AFVVN+GDILEI +NG+Y+S+EHR
Sbjct  247  LQIRKD-GKWVPIKALPNAFVVNVGDILEIVTNGVYRSIEHR  287



>ref|XP_007029339.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY09841.1| Senescence-related gene 1 [Theobroma cacao]
Length=362

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G W P+ + PDAFVVN+GDIL+IFSNG+Y S+EH+V
Sbjct  247  LQIKKD-GLWFPLNIKPDAFVVNVGDILQIFSNGVYHSIEHKV  288



>ref|XP_010057194.1| PREDICTED: codeine O-demethylase-like [Eucalyptus grandis]
Length=342

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
             Q+K D G W PV   P+AFVVN+GD++EI SNGLY S+EHRV
Sbjct  224  FQIKKD-GVWAPVHFLPNAFVVNVGDVMEILSNGLYSSIEHRV  265



>ref|XP_007025225.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY27847.1| Senescence-related gene 1 [Theobroma cacao]
Length=347

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ++   G W PV   PDAFVVN+GDILEIFSNG+Y+S+EHR 
Sbjct  232  LQIR-KGGVWFPVSFVPDAFVVNVGDILEIFSNGIYRSIEHRA  273



>ref|XP_010057212.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
Length=360

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ D G WIPV+  PDAF++N+GDI+EI +NG+Y+S+EHR
Sbjct  248  LQIRKD-GKWIPVKPLPDAFIINVGDIVEIITNGIYQSIEHR  288



>gb|KCW74257.1| hypothetical protein EUGRSUZ_E02903 [Eucalyptus grandis]
Length=334

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ D G WIPV+  PDAF++N+GDI+EI +NG+Y+S+EHR
Sbjct  222  LQIRKD-GKWIPVKPLPDAFIINVGDIVEIITNGIYQSIEHR  262



>ref|XP_011001178.1| PREDICTED: protein SRG1-like [Populus euphratica]
Length=368

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            L+V+  DG WI VE  PDAF++NIGDI++++SN  Y+SVEHRVM
Sbjct  240  LEVRKKDGEWIRVEPTPDAFIINIGDIIQVWSNDAYESVEHRVM  283



>ref|XP_006494096.1| PREDICTED: codeine O-demethylase-like isoform X3 [Citrus sinensis]
Length=278

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+ V+  PDAFVVNIGD LEIF+NG Y+S+EHR
Sbjct  166  LQIKKD-GKWVAVKPLPDAFVVNIGDALEIFTNGTYRSIEHR  206



>ref|XP_010498040.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=358

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K +DG WIPV+  P+AF+VNIGDILEI +NG Y+S+EHR
Sbjct  251  LQIK-NDGKWIPVKPLPNAFIVNIGDILEIITNGTYRSIEHR  291



>ref|XP_007211481.1| hypothetical protein PRUPE_ppa007600mg [Prunus persica]
 gb|EMJ12680.1| hypothetical protein PRUPE_ppa007600mg [Prunus persica]
Length=362

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK D G W+PV+  PDAF+VNIGDILEI +NG+Y+S+EHR 
Sbjct  255  LQVKKD-GIWVPVKPLPDAFIVNIGDILEIQTNGIYRSIEHRA  296



>gb|KCW74238.1| hypothetical protein EUGRSUZ_E02876 [Eucalyptus grandis]
Length=366

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
             Q+K D G W PV   P+AFVVN+GD++EI SNGLY S+EHRV
Sbjct  248  FQIKKD-GVWAPVHFLPNAFVVNVGDVMEILSNGLYSSIEHRV  289



>ref|XP_010459260.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=358

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K +DG WIPV+  P+AF+VNIGDILEI +NG Y+S+EHR
Sbjct  251  LQIK-NDGKWIPVKPLPNAFIVNIGDILEIITNGTYRSIEHR  291



>ref|XP_010537691.1| PREDICTED: protein SRG1-like isoform X1 [Tarenaya hassleriana]
Length=355

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G W+PV+  PDAFVVN+GDI+EI +NG Y+SVEHR M
Sbjct  248  LQIKKD-GGWVPVKPLPDAFVVNVGDIIEIVNNGEYQSVEHRAM  290



>ref|XP_006305429.1| hypothetical protein CARUB_v10009827mg [Capsella rubella]
 gb|EOA38327.1| hypothetical protein CARUB_v10009827mg [Capsella rubella]
Length=309

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+PV+  P+AF+VNIGD+LEI +NG Y+S+EHR
Sbjct  202  LQIKKD-GKWVPVKPQPNAFIVNIGDVLEIITNGTYRSIEHR  242



>gb|EYU28156.1| hypothetical protein MIMGU_mgv1a009322mg [Erythranthe guttata]
Length=345

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
             Q+K + G W+PV+  PDAF VN+GDI+EI SNGLYKS+EHR
Sbjct  239  FQIKRN-GVWLPVKFLPDAFAVNLGDIIEILSNGLYKSIEHR  279



>ref|XP_002321354.2| hypothetical protein POPTR_0015s00510g [Populus trichocarpa]
 gb|EEF05481.2| hypothetical protein POPTR_0015s00510g [Populus trichocarpa]
Length=195

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQV   DG W+ V  HPDAFV+NIGD L+  SNG YKSV HR +
Sbjct  87   LQVLLKDGKWVAVNPHPDAFVINIGDQLQALSNGRYKSVWHRAI  130



>ref|XP_006495452.1| PREDICTED: protein SRG1-like, partial [Citrus sinensis]
Length=218

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K  DG WIPV   PDAF+VNIGD LEI +NG Y S+EHR +
Sbjct  139  LQIK-KDGKWIPVTPLPDAFIVNIGDTLEIITNGTYPSIEHRAV  181



>ref|XP_007029342.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY09844.1| Senescence-related gene 1 [Theobroma cacao]
Length=362

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G W P+ ++PDAF+VN+GDIL+IFSNG+Y S+EH+V
Sbjct  247  LQIKKD-GLWFPLNINPDAFIVNVGDILQIFSNGVYHSIEHKV  288



>ref|XP_010919592.1| PREDICTED: S-norcoclaurine synthase 1-like [Elaeis guineensis]
Length=352

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K ++G W+PV+  P AF+VN+GD+ EIFSNG YKS+EHR +
Sbjct  244  LQIK-NNGKWVPVKPLPGAFIVNVGDVFEIFSNGRYKSIEHRAV  286



>ref|XP_006355630.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=355

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIP+   P+AFVVN+GD LEIFSNG+YKS+EHR
Sbjct  247  LQIKKD-GIWIPILPLPNAFVVNVGDALEIFSNGIYKSIEHR  287



>emb|CBI33959.3| unnamed protein product [Vitis vinifera]
Length=131

 Score = 60.1 bits (144),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K + G WIP+   P AF+VNIGDILEI SNG YKS+EHR +
Sbjct  22   LQIKRN-GKWIPIRPVPGAFIVNIGDILEIMSNGEYKSIEHRAV  64



>ref|XP_008439692.1| PREDICTED: codeine O-demethylase-like isoform X1 [Cucumis melo]
Length=308

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK  DG W PV   PDAF+VN+GDI+EI SNGLY S+EHR 
Sbjct  191  LQVK-KDGIWFPVSFIPDAFIVNVGDIIEIISNGLYNSIEHRA  232



>ref|XP_008802804.1| PREDICTED: S-norcoclaurine synthase 1-like [Phoenix dactylifera]
Length=351

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K + G W+PV+  P AF+VN+GDI EIFSNG YKS+EHR +
Sbjct  245  LQIKKN-GKWVPVKPLPGAFIVNVGDIFEIFSNGRYKSIEHRAV  287



>emb|CDP14578.1| unnamed protein product [Coffea canephora]
Length=306

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
             QVK D G WIPV + P+AFVV +GDILEI SNG YKSVEHR
Sbjct  192  FQVKKD-GVWIPVNILPNAFVVIVGDILEILSNGTYKSVEHR  232



>ref|XP_002465421.1| hypothetical protein SORBIDRAFT_01g038520 [Sorghum bicolor]
 gb|EER92419.1| hypothetical protein SORBIDRAFT_01g038520 [Sorghum bicolor]
Length=383

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQV++ DG WI V+  PDAF+VN+GD +++ SN  YKSVEHRV
Sbjct  258  LQVRSPDGQWIIVDPVPDAFIVNVGDQIQVLSNASYKSVEHRV  300



>ref|XP_002268794.1| PREDICTED: protein SRG1-like [Vitis vinifera]
Length=369

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ + G W+PV+  P+AFVVNIGDI+EI SNG+Y+S+EHR M
Sbjct  254  LQIRKE-GRWVPVKPLPNAFVVNIGDIMEIVSNGIYQSIEHRAM  296



>emb|CBI24603.3| unnamed protein product [Vitis vinifera]
Length=308

 Score = 61.6 bits (148),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G WIPV + PDA VVN+GDILEI SNG+Y S+EHR 
Sbjct  199  LQIKKD-GVWIPVNVLPDALVVNVGDILEIVSNGMYTSIEHRA  240



>ref|XP_006432901.1| hypothetical protein CICLE_v10001620mg [Citrus clementina]
 gb|ESR46141.1| hypothetical protein CICLE_v10001620mg [Citrus clementina]
Length=359

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+ V+  PDAFVVNIGD LEIF+NG Y+S+EHR
Sbjct  247  LQIKKD-GKWVAVKPLPDAFVVNIGDALEIFTNGTYRSIEHR  287



>ref|XP_002989580.1| 2-oxoglutarate-iron(II)-dependent oxygenase [Selaginella moellendorffii]
 gb|EFJ09456.1| 2-oxoglutarate-iron(II)-dependent oxygenase [Selaginella moellendorffii]
Length=365

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQV  +DG WIPV+  P AFVVN+GD L++ SNG YKSVEHRV+
Sbjct  253  LQV-LNDGQWIPVKPLPGAFVVNVGDQLQVLSNGKYKSVEHRVV  295



>ref|XP_006291351.1| hypothetical protein CARUB_v10017490mg [Capsella rubella]
 gb|EOA24249.1| hypothetical protein CARUB_v10017490mg [Capsella rubella]
Length=364

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQV+  D  WI VEL P AF+VNIGD +++ SN +YKSVEHRV+
Sbjct  254  LQVRGSDDAWITVELAPHAFIVNIGDQIQMLSNSIYKSVEHRVI  297



>ref|XP_006494099.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=359

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G W+ V   PDAF+VNIGDILE+F+NG Y+S+EHR 
Sbjct  247  LQIKKD-GKWVAVRPLPDAFIVNIGDILEVFTNGTYRSIEHRA  288



>ref|XP_010240927.1| PREDICTED: gibberellin 2-beta-dioxygenase 8-like [Nelumbo nucifera]
 ref|XP_010240928.1| PREDICTED: gibberellin 2-beta-dioxygenase 8-like [Nelumbo nucifera]
Length=352

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  20   DGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            DG WI V+ +PDA +VNIGD+ E +SNG+YKSV+HRVM
Sbjct  249  DGRWITVKPNPDALIVNIGDLFEAWSNGVYKSVQHRVM  286



>ref|XP_006477893.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=302

 Score = 61.6 bits (148),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G WIPV   PDAF+VNIGD LEI +NG Y S+EHR +
Sbjct  190  LQIKKD-GKWIPVTPLPDAFIVNIGDTLEIITNGTYPSIEHRAV  232



>gb|KFK43894.1| hypothetical protein AALP_AA1G187900 [Arabis alpina]
Length=358

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W+PV+  P+AF+VNIGD+LEI +NG Y+S+EHR
Sbjct  251  LQVKKD-GKWVPVKPLPNAFIVNIGDVLEIITNGTYRSIEHR  291



>ref|XP_008660253.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Zea 
mays]
 gb|AFW88710.1| hypothetical protein ZEAMMB73_081304 [Zea mays]
Length=407

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQV+  DG WI V+  PDAF+VNIGD +++ SN  YKSVEHRV
Sbjct  265  LQVRGPDGQWIIVDPVPDAFIVNIGDQIQVLSNAAYKSVEHRV  307



>gb|KDO41546.1| hypothetical protein CISIN_1g046507mg [Citrus sinensis]
Length=187

 Score = 60.1 bits (144),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K  DG WIPV   P+AFVVNIG +LEI +NG Y+S+EHRV+
Sbjct  67   LQIK-KDGKWIPVTPFPNAFVVNIGVVLEIVTNGTYRSIEHRVI  109



>ref|XP_007022024.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13549.1| Senescence-related gene 1 [Theobroma cacao]
Length=351

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W PV+  PDAF+VN+GDILE+ +NG Y+S+EHR
Sbjct  244  LQIKKD-GKWTPVKPLPDAFIVNVGDILEMVTNGAYRSIEHR  284



>ref|XP_006452693.1| hypothetical protein CICLE_v10008745mg [Citrus clementina]
 gb|ESR65933.1| hypothetical protein CICLE_v10008745mg [Citrus clementina]
Length=359

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+ V+  PDAFVVNIGD LEIF+NG Y+S+EHR
Sbjct  247  LQIKKD-GKWVAVKPLPDAFVVNIGDALEIFTNGTYRSIEHR  287



>emb|CDP18104.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 59.7 bits (143),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K   G W+PV   P+AF+VN+GDILEI +NG+YKSVEHR
Sbjct  61   LQIKKA-GAWVPVVPLPNAFIVNVGDILEIVTNGIYKSVEHR  101



>ref|XP_010273388.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=366

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQV+ D G W+PV+  P+AF++NIGDILEIF+NG Y+S+EH+
Sbjct  252  LQVRKD-GMWVPVKPLPNAFIINIGDILEIFTNGTYRSIEHQ  292



>ref|XP_008226353.1| PREDICTED: protein SRG1-like [Prunus mume]
Length=363

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQV+  DG W+PV+  PDAF+VNIGDILEI +NG+Y+S+EHR 
Sbjct  255  LQVR-KDGIWVPVKPLPDAFIVNIGDILEIQTNGIYRSIEHRA  296



>ref|XP_010476835.1| PREDICTED: protein SRG1 [Camelina sativa]
Length=359

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV+  P+AF+VNIGD+LEI +NG Y+S+EHR
Sbjct  252  LQIKKD-GKWIPVKPLPNAFIVNIGDVLEIITNGTYRSIEHR  292



>ref|XP_006494095.1| PREDICTED: codeine O-demethylase-like isoform X2 [Citrus sinensis]
Length=288

 Score = 61.2 bits (147),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W  V+  PDAF+VN+GD+LEIF+NG Y+S+EHR
Sbjct  176  LQIKKD-GKWFAVKPLPDAFIVNVGDVLEIFTNGTYRSIEHR  216



>ref|XP_007022033.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13558.1| Senescence-related gene 1 [Theobroma cacao]
Length=639

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK  DG W+PV+  P+AF+VNIGD+LEI +NG+Y+S+EHR 
Sbjct  219  LQVK-KDGKWVPVKPLPNAFIVNIGDVLEIITNGVYRSIEHRA  260


 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK  DG W+PV+  P++F+VNIGD LE+ +NG Y S+EHR 
Sbjct  532  LQVK-KDGKWVPVKPLPNSFIVNIGDALEVITNGAYCSIEHRA  573



>ref|XP_010095126.1| Codeine O-demethylase [Morus notabilis]
 gb|EXB58292.1| Codeine O-demethylase [Morus notabilis]
Length=369

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G WIPV    DA +VN+GDILEI SNG YKS+EHRVM
Sbjct  250  LQIKKD-GVWIPVNFLQDALMVNVGDILEIMSNGAYKSIEHRVM  292



>ref|XP_004294174.1| PREDICTED: protein SRG1-like [Fragaria vesca subsp. vesca]
Length=375

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D GNW+PV+  P+AF+VNIGD LEI +NG Y+S+EHR +
Sbjct  268  LQIKKD-GNWLPVKPLPEAFIVNIGDALEIKTNGTYRSIEHRAI  310



>gb|KGN49353.1| hypothetical protein Csa_6G521000 [Cucumis sativus]
Length=327

 Score = 61.6 bits (148),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ++ D G W PV+  P+AFVVNIGDILEI +NG+Y+S+EHR 
Sbjct  217  LQIRKD-GRWTPVKPLPNAFVVNIGDILEIITNGIYRSIEHRA  258



>emb|CAN72515.1| hypothetical protein VITISV_005838 [Vitis vinifera]
Length=360

 Score = 61.6 bits (148),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   P A VVNIGDILEI SNG+Y S+EHR
Sbjct  245  LQIKKD-GVWIPVSFLPXALVVNIGDILEILSNGVYTSIEHR  285



>ref|XP_006442335.1| hypothetical protein CICLE_v10020844mg [Citrus clementina]
 gb|ESR55575.1| hypothetical protein CICLE_v10020844mg [Citrus clementina]
Length=355

 Score = 61.6 bits (148),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G WIPV   PDAF+VNIGD LEI +NG Y S+EHR +
Sbjct  243  LQIKKD-GKWIPVTPLPDAFIVNIGDTLEIITNGTYPSIEHRAV  285



>ref|XP_007025217.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY27839.1| Senescence-related gene 1 [Theobroma cacao]
Length=368

 Score = 61.6 bits (148),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ++ D G WIPV+  P+AFV+NIGDI+EI SNG+Y+S+EHR 
Sbjct  250  LQIRKD-GTWIPVKPLPNAFVINIGDIVEIVSNGIYRSIEHRA  291



>ref|XP_002279355.1| PREDICTED: S-norcoclaurine synthase 1 [Vitis vinifera]
 emb|CBI33958.3| unnamed protein product [Vitis vinifera]
Length=353

 Score = 61.6 bits (148),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K + G WIP+   P AF+VNIGDILEI SNG YKS+EHR +
Sbjct  245  LQIKKN-GKWIPIRPVPGAFIVNIGDILEIMSNGEYKSIEHRAV  287



>ref|XP_007214442.1| hypothetical protein PRUPE_ppa024861mg [Prunus persica]
 gb|EMJ15641.1| hypothetical protein PRUPE_ppa024861mg [Prunus persica]
Length=362

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK D G W+PV+  PDAF+VN+GDILEI +NG+Y+S+EHR 
Sbjct  253  LQVKKD-GIWVPVKPLPDAFIVNVGDILEIQTNGVYRSIEHRA  294



>ref|XP_007025221.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY27843.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 1 [Theobroma cacao]
Length=445

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ D G W+ ++  P+AFVVNIGDI+EI SNG+Y+S+EHR M
Sbjct  330  LQIRKD-GKWVSIKPLPNAFVVNIGDIMEIVSNGIYRSIEHRAM  372



>emb|CDX92689.1| BnaC07g39470D [Brassica napus]
Length=359

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+PV+  P+AF+VNIGD+LEI +NG YKS+EHR
Sbjct  252  LQIKKD-GKWVPVKPLPNAFIVNIGDMLEIITNGTYKSIEHR  292



>ref|XP_002270138.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=362

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV   P A VVNIGDILEI SNG+Y S+EHR
Sbjct  247  LQIKKD-GVWIPVSFLPGALVVNIGDILEILSNGVYTSIEHR  287



>ref|XP_006432906.1| hypothetical protein CICLE_v10001648mg [Citrus clementina]
 gb|ESR46146.1| hypothetical protein CICLE_v10001648mg [Citrus clementina]
Length=356

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G W  V+  PDAF+VN+GD+LEIFSNG Y+S+EHR 
Sbjct  247  LQIKKD-GKWFAVKPLPDAFIVNVGDVLEIFSNGTYRSIEHRA  288



>ref|XP_011096570.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=337

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
             QVK  DG W+PV   P AFVVNIGD+ EI SNGLYKS+EHRV
Sbjct  231  FQVK-KDGVWLPVSPLPHAFVVNIGDVTEILSNGLYKSIEHRV  272



>ref|XP_003524845.1| PREDICTED: protein SRG1-like [Glycine max]
Length=359

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G+WIP++  P+AF+VN+GD++EI +NG+Y+S+EHR
Sbjct  244  LQIKID-GSWIPIKPLPNAFIVNLGDMMEIMTNGIYRSIEHR  284



>ref|XP_007211480.1| hypothetical protein PRUPE_ppa007597mg [Prunus persica]
 gb|EMJ12679.1| hypothetical protein PRUPE_ppa007597mg [Prunus persica]
Length=362

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK  DG W+PV+  PDAF+VN+GDILEI +NG+Y+S+EHR 
Sbjct  253  LQVK-KDGIWVPVKPLPDAFIVNVGDILEIQTNGVYRSIEHRA  294



>gb|KEH27886.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=353

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ++  DG WIPV+  P+AFV+NIGD+LEI +NG+Y+S+EHR 
Sbjct  241  LQIR-KDGQWIPVQPLPNAFVINIGDMLEIVTNGIYRSIEHRA  282



>gb|KDP21182.1| hypothetical protein JCGZ_21653 [Jatropha curcas]
Length=359

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQV+  +G WIPV+  P+AFVVNIGD+LEI SNG+Y+S+EHR 
Sbjct  252  LQVR-KEGKWIPVKPLPNAFVVNIGDLLEIVSNGVYRSIEHRA  293



>gb|KDP21831.1| hypothetical protein JCGZ_00618 [Jatropha curcas]
Length=358

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G W PV   PD+ VVNIGDILEI SNG+Y S+EH+V+
Sbjct  246  LQIKKD-GRWSPVTFFPDSLVVNIGDILEILSNGIYNSIEHKVL  288



>ref|XP_006467560.1| PREDICTED: protein SRG1-like [Citrus sinensis]
 gb|KDO78007.1| hypothetical protein CISIN_1g017637mg [Citrus sinensis]
Length=368

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            L++K D G WIP  + PDA +VN+GDILEI SNG+Y+SVEHR
Sbjct  255  LEIKKD-GVWIPAHILPDALLVNVGDILEIMSNGVYRSVEHR  295



>ref|XP_010027975.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW54630.1| hypothetical protein EUGRSUZ_I00575 [Eucalyptus grandis]
Length=364

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K + G W+PV+   +AFVVNIGDI+EIFSNG+Y+S+EHR
Sbjct  253  LQIKRE-GRWVPVKPLHNAFVVNIGDIMEIFSNGIYRSIEHR  293



>ref|XP_006442332.1| hypothetical protein CICLE_v10024371mg, partial [Citrus clementina]
 gb|ESR55572.1| hypothetical protein CICLE_v10024371mg, partial [Citrus clementina]
Length=338

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G WIPV   P+AFVVNIG +LEI +NG Y+S+EHRV+
Sbjct  226  LQIKKD-GKWIPVTPFPNAFVVNIGVVLEIVTNGTYRSIEHRVI  268



>ref|XP_006477805.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=431

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G WIPV   P+AF+VN+GDI+EI +NG Y+S+EHRV
Sbjct  319  LQIKKD-GVWIPVTPLPNAFIVNVGDIMEIITNGKYRSIEHRV  360



>gb|KHN25971.1| Protein SRG1 [Glycine soja]
Length=483

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G+WIP++  P+AF+VN+GD++EI +NG+Y+S+EHR
Sbjct  368  LQIKID-GSWIPIKPLPNAFIVNLGDMMEIMTNGIYRSIEHR  408



>emb|CBI33968.3| unnamed protein product [Vitis vinifera]
Length=300

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K + G W+P+   PDAF+VNIGDI+EI SNG YKS+EHR 
Sbjct  192  LQIKKN-GKWVPIRPVPDAFIVNIGDIIEIMSNGEYKSIEHRA  233



>ref|XP_004488976.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=355

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQV+  DG W+PV+  P+AF+VNIGDILEI +NG+Y+S+EHR 
Sbjct  248  LQVR-KDGMWVPVKPLPNAFIVNIGDILEIITNGIYRSIEHRA  289



>gb|AFK40954.1| unknown [Lotus japonicus]
Length=237

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ D G WIP++  P+AF++NIGD+LEI +NG+Y+S+EHR
Sbjct  126  LQIRKD-GMWIPIKPLPEAFIINIGDMLEIMTNGVYRSIEHR  166



>ref|XP_009376707.1| PREDICTED: protein SRG1-like [Pyrus x bretschneideri]
Length=372

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W PV+  PDAF+VNIGDILEI +NG Y S+EHR
Sbjct  259  LQVKKD-GIWFPVKPLPDAFIVNIGDILEIITNGTYHSIEHR  299



>gb|KDO78011.1| hypothetical protein CISIN_1g017887mg [Citrus sinensis]
Length=292

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ + G W+PV+  P+AFV+NIGDI+EI SNG+Y+S+EHR +
Sbjct  178  LQIR-NQGRWVPVKPLPNAFVINIGDIMEIVSNGIYRSIEHRAL  220



>emb|CDP18686.1| unnamed protein product [Coffea canephora]
Length=418

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K   G W+PV   P+AF+VN+GDILEI +NG+YKSVEHRV
Sbjct  306  LQIKKA-GAWVPVVPLPNAFIVNVGDILEIVTNGIYKSVEHRV  347



>ref|XP_010053023.1| PREDICTED: codeine O-demethylase-like [Eucalyptus grandis]
Length=342

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
             Q+K D G W PV   P+AFVVN+GD++EI SNGLY S+EHR
Sbjct  224  FQIKKD-GVWAPVHFLPNAFVVNVGDVMEILSNGLYSSIEHR  264



>ref|NP_173145.1| Fe(II)/ascorbate oxidase family protein SRG1 [Arabidopsis thaliana]
 sp|Q39224.1|SRG1_ARATH RecName: Full=Protein SRG1; Short=AtSRG1; AltName: Full=Protein 
SENESCENCE-RELATED GENE 1 [Arabidopsis thaliana]
 gb|AAD50032.1|AC007651_27 SRG1 Protein [Arabidopsis thaliana]
 emb|CAA55654.1| SRG1 [Arabidopsis thaliana]
 gb|AAK82564.1| F6I1.30/F6I1.30 [Arabidopsis thaliana]
 gb|AAM98100.1| At1g17020/F6I1.30 [Arabidopsis thaliana]
 gb|AEE29531.1| Fe(II)/ascorbate oxidase family protein SRG1 [Arabidopsis thaliana]
Length=358

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+PV+  P+AF+VNIGD+LEI +NG Y+S+EHR
Sbjct  251  LQIKKD-GKWVPVKPLPNAFIVNIGDVLEIITNGTYRSIEHR  291



>ref|XP_003547191.1| PREDICTED: protein SRG1-like [Glycine max]
Length=372

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K   G WIPV +  DA ++NIGDILEI SNGLYKSVEHR +
Sbjct  249  LQIKKH-GIWIPVNVASDALILNIGDILEIMSNGLYKSVEHRAI  291



>ref|XP_006355578.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=366

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G WIP+   PDAFV+NIGDI+EI +NG Y+S+EHR 
Sbjct  251  LQIKKD-GMWIPISPLPDAFVINIGDIMEIVTNGAYRSIEHRA  292



>ref|XP_006355577.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=359

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ D G W P+E  P+AF+VN+GD  EIFSNG+YKS+EHR
Sbjct  244  LQIRKD-GIWTPIEPLPNAFIVNVGDAFEIFSNGIYKSIEHR  284



>gb|KHF98196.1| Protein SRG1 -like protein [Gossypium arboreum]
Length=362

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQV+ D G W+P+   P+AFVVNIGDI+EI SNG+Y+S+EHR +
Sbjct  247  LQVRKD-GKWVPIMPLPNAFVVNIGDIMEILSNGIYRSIEHRAV  289



>ref|XP_010095129.1| Protein SRG1 [Morus notabilis]
 gb|EXB58295.1| Protein SRG1 [Morus notabilis]
Length=367

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ++  DG WIPV+  P+AF+VN+GDILEI +NG+Y+S+EHR 
Sbjct  253  LQIR-KDGMWIPVKPLPNAFIVNVGDILEILTNGIYRSIEHRA  294



>ref|XP_008345138.1| PREDICTED: protein SRG1-like, partial [Malus domestica]
Length=368

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQVK D G W+P++  P AFVVNIGDILEI +NG Y+S+EHR
Sbjct  268  LQVKRD-GIWVPIKPLPXAFVVNIGDILEILTNGTYRSIEHR  308



>ref|XP_002267405.1| PREDICTED: protein SRG1 isoform X1 [Vitis vinifera]
 emb|CBI24604.3| unnamed protein product [Vitis vinifera]
Length=356

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV L  DA VVN+GDILEI SNG+Y S+EHR
Sbjct  247  LQIKKD-GVWIPVNLLQDALVVNVGDILEIVSNGMYTSIEHR  287



>emb|CAN60619.1| hypothetical protein VITISV_010885 [Vitis vinifera]
Length=356

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIPV L  DA VVN+GDILEI SNG+Y S+EHR
Sbjct  247  LQIKKD-GVWIPVNLLQDALVVNVGDILEIVSNGMYTSIEHR  287



>ref|XP_002279610.1| PREDICTED: S-norcoclaurine synthase 1-like [Vitis vinifera]
Length=355

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K + G W+P+   PDAF+VNIGDI+EI SNG YKS+EHR 
Sbjct  247  LQIKKN-GKWVPIRPVPDAFIVNIGDIIEIMSNGEYKSIEHRA  288



>ref|XP_008439690.1| PREDICTED: protein SRG1-like [Cucumis melo]
Length=377

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ++ D G WI V+  P+AFVVNIGDI+EI SNG+YKS+EHRV
Sbjct  262  LQIRKD-GRWIAVKPLPNAFVVNIGDIMEIVSNGVYKSIEHRV  303



>gb|AFN53718.1| putative flavonol synthase [Linum usitatissimum]
Length=234

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ D G W+P++   +AFVVNIGDI+EI SNG+Y+S+EHR
Sbjct  117  LQIRKD-GKWVPIKPLLNAFVVNIGDIMEIMSNGVYRSIEHR  157



>ref|XP_010267885.1| PREDICTED: gibberellin 2-beta-dioxygenase 8-like [Nelumbo nucifera]
Length=332

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  20   DGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            DG WI V+ +P+A ++NIGD+ E +SNGLYKSV+HRVM
Sbjct  232  DGRWITVKPNPEALIINIGDLFEAWSNGLYKSVQHRVM  269



>ref|XP_002300322.2| hypothetical protein POPTR_0001s36500g [Populus trichocarpa]
 gb|EEE85127.2| hypothetical protein POPTR_0001s36500g [Populus trichocarpa]
Length=182

 Score = 59.3 bits (142),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++   G WIPV+  P+AFV+NIGD+LEI +NG+Y+S EHR
Sbjct  67   LQIRKS-GKWIPVQPLPNAFVINIGDMLEIVTNGIYRSTEHR  107



>gb|KDP21186.1| hypothetical protein JCGZ_21657 [Jatropha curcas]
Length=364

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K + G W+PV+  P+AF+VN+GDILEI +NG+Y+S+EHR
Sbjct  249  LQIKKN-GKWVPVKPLPNAFIVNVGDILEIVTNGIYRSIEHR  289



>ref|XP_002890198.1| hypothetical protein ARALYDRAFT_889094 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66457.1| hypothetical protein ARALYDRAFT_889094 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+PV+  P+AF+VNIGD+LEI +NG Y+S+EHR
Sbjct  251  LQIKKD-GKWVPVKPIPNAFIVNIGDVLEIITNGTYRSIEHR  291



>ref|XP_010057200.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=364

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQV+ + G W+P++  P+AFVVN+GDILEI  NG Y+S+EHR M
Sbjct  256  LQVRKE-GKWVPIKPLPNAFVVNVGDILEIVMNGTYRSIEHRAM  298



>gb|KCW77264.1| hypothetical protein EUGRSUZ_D01621 [Eucalyptus grandis]
Length=366

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
             Q+K D G W PV   P+AFVVN+GD++EI SNGLY S+EHR
Sbjct  248  FQIKKD-GVWAPVHFLPNAFVVNVGDVMEILSNGLYSSIEHR  288



>gb|KDO39143.1| hypothetical protein CISIN_1g0448911mg, partial [Citrus sinensis]
Length=211

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIP+   P+AF+VN+GDI+EI +NG Y+S+EHR
Sbjct  108  LQIKKD-GMWIPLTPLPNAFLVNVGDIMEIITNGKYRSIEHR  148



>gb|EMT03128.1| S-norcoclaurine synthase 1 [Aegilops tauschii]
Length=395

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K  D  W+PV+ HP A VVN+GD LEI +NG Y+S+EHRV
Sbjct  287  LQIKRQDA-WVPVKPHPKALVVNVGDFLEILTNGKYQSIEHRV  328



>ref|XP_004134919.1| PREDICTED: protein SRG1-like [Cucumis sativus]
 ref|XP_004155625.1| PREDICTED: protein SRG1-like [Cucumis sativus]
Length=358

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ++ D G W PV+  P+AFVVNIGDILEI +NG+Y+S+EHR 
Sbjct  248  LQIRKD-GRWTPVKPLPNAFVVNIGDILEIITNGIYRSIEHRA  289



>emb|CDP18685.1| unnamed protein product [Coffea canephora]
Length=162

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K   G W+PV   P+AF+VN+GDILEI +NG+YKSVEHR
Sbjct  50   LQIKKA-GAWVPVVPLPNAFIVNVGDILEIVTNGIYKSVEHR  90



>emb|CDP14581.1| unnamed protein product [Coffea canephora]
Length=307

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK  +G WIPV + PDAFVV+IGD +EIFSNG+YKS+ HR 
Sbjct  192  LQVK-KNGVWIPVNILPDAFVVHIGDAMEIFSNGIYKSIVHRA  233



>ref|XP_006416751.1| hypothetical protein EUTSA_v10008010mg [Eutrema salsugineum]
 gb|ESQ35104.1| hypothetical protein EUTSA_v10008010mg [Eutrema salsugineum]
Length=360

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+PV+  P+AF+VNIGD+LEI +NG Y+S+EHR
Sbjct  253  LQIKKD-GKWVPVKPLPNAFIVNIGDVLEIVTNGTYRSIEHR  293



>ref|XP_009149139.1| PREDICTED: protein SRG1-like [Brassica rapa]
Length=360

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G W+ V+  P+AF+VN+GD+LEI +NG+YKS+EHRV+
Sbjct  252  LQIKKD-GKWVFVKPLPNAFIVNVGDVLEIITNGIYKSIEHRVV  294



>emb|CDP14579.1| unnamed protein product [Coffea canephora]
Length=365

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ++ D G W+PV   PDA +VN+GDI+EI SNGLY+S+EHR 
Sbjct  250  LQIRKD-GRWLPVTPLPDALIVNVGDIIEILSNGLYRSIEHRA  291



>ref|XP_006467559.1| PREDICTED: protein SRG1-like isoform X2 [Citrus sinensis]
 gb|KDO78010.1| hypothetical protein CISIN_1g017887mg [Citrus sinensis]
Length=337

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ + G W+PV+  P+AFV+NIGDI+EI SNG+Y+S+EHR +
Sbjct  223  LQIR-NQGRWVPVKPLPNAFVINIGDIMEIVSNGIYRSIEHRAL  265



>ref|XP_010545548.1| PREDICTED: gibberellin 2-beta-dioxygenase 7 isoform X1 [Tarenaya 
hassleriana]
Length=337

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  17   DDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            +DG W+ V+  PDA +VNIGD+ ++ SNGLYKS+EHRV+
Sbjct  234  NDGRWLAVKPRPDALIVNIGDLFQVLSNGLYKSIEHRVV  272



>ref|XP_010057207.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=363

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K + G W+PV+  P+AFVVN+GDILEI +NG Y+S+EHR
Sbjct  244  LQIKKE-GKWVPVKPLPNAFVVNVGDILEIVTNGAYRSIEHR  284



>ref|XP_004233003.1| PREDICTED: protein SRG1-like [Solanum lycopersicum]
Length=366

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G WIP+   PDAF++NIGDI+EI +NG Y+S+EHR +
Sbjct  251  LQIKKD-GMWIPISPLPDAFIINIGDIMEIVTNGAYRSIEHRAV  293



>gb|EMS47228.1| putative 2-oxoglutarate/Fe(II)-dependent dioxygenase [Triticum 
urartu]
Length=253

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK D G WI V+  PDAF+VN+GD +++ SN  YKSVEHRV
Sbjct  139  LQVKKD-GQWITVDPVPDAFIVNVGDQIQVLSNAAYKSVEHRV  180



>ref|XP_002300451.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
 gb|EEE85256.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
Length=359

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ D G W+P++  P+AFVVN+GDILEI +NG Y+S+EHR
Sbjct  247  LQLRKD-GKWVPIKPLPNAFVVNVGDILEIVTNGAYRSIEHR  287



>ref|XP_007025218.1| Senescence-related gene 1, putative [Theobroma cacao]
 gb|EOY27840.1| Senescence-related gene 1, putative [Theobroma cacao]
Length=357

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ D G W+P++  PDAFVVNIGDI+E+ +NG+Y S+EHR
Sbjct  248  LQIRKD-GAWVPIKPLPDAFVVNIGDIMELVTNGIYGSIEHR  288



>gb|KDO41545.1| hypothetical protein CISIN_1g0456441mg, partial [Citrus sinensis]
Length=207

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K  DG WIPV   P+AFVVNIG +LEI +NG Y+S+EHRV+
Sbjct  95   LQIK-KDGKWIPVTPVPNAFVVNIGVVLEIVTNGTYRSIEHRVI  137



>ref|XP_010057206.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
 gb|KCW74250.1| hypothetical protein EUGRSUZ_E02891 [Eucalyptus grandis]
Length=370

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K + G W+PV+  P+AFVVN+GDILEI +NG Y+S+EHR
Sbjct  251  LQIKKE-GKWVPVKPLPNAFVVNVGDILEIVTNGAYRSIEHR  291



>gb|EMT02970.1| Protein SRG1 [Aegilops tauschii]
Length=349

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K + G+W+PV+  P AF+VNIGD+LE+F+NG Y+S+EHR +
Sbjct  242  LQIKRN-GSWLPVKPVPGAFIVNIGDMLEVFTNGRYRSIEHRAV  284



>ref|XP_002528475.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF33892.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=364

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+PV+  P+AFV+NIGDILEI +NG+Y+S+ HR
Sbjct  252  LQIKKD-GKWVPVKPLPNAFVINIGDILEIITNGIYRSILHR  292



>ref|XP_006467558.1| PREDICTED: protein SRG1-like isoform X1 [Citrus sinensis]
 gb|KDO78009.1| hypothetical protein CISIN_1g017887mg [Citrus sinensis]
Length=364

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ + G W+PV+  P+AFV+NIGDI+EI SNG+Y+S+EHR +
Sbjct  250  LQIR-NQGRWVPVKPLPNAFVINIGDIMEIVSNGIYRSIEHRAL  292



>gb|ACH60103.1| ACC oxidase [Pseudotsuga menziesii]
 gb|ACH60113.1| ACC oxidase [Pseudotsuga macrocarpa]
Length=126

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQV+ D GNWIPVE  P   V+NIGD++E+ SNG YKS++HR +
Sbjct  19   LQVRKD-GNWIPVEPIPGGLVINIGDMVEVMSNGKYKSIDHRAV  61



>gb|AFK44282.1| unknown [Lotus japonicus]
Length=117

 Score = 58.2 bits (139),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++  DG W+P++   +AFV+NIGD+LEI +NG+Y+S+EHR M
Sbjct  4    LQIR-KDGIWVPIKPLSNAFVINIGDMLEILTNGIYRSIEHRAM  46



>gb|KDO52128.1| hypothetical protein CISIN_1g035879mg [Citrus sinensis]
Length=356

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K  DG WIPV   P+AF+VNIGDI+EI +NG Y+S+EHRV
Sbjct  244  LQIK-KDGVWIPVTPLPNAFIVNIGDIMEIITNGKYRSIEHRV  285



>gb|ACH60102.1| ACC oxidase [Pseudotsuga menziesii]
 gb|ACH60104.1| ACC oxidase [Pseudotsuga menziesii]
 gb|ACH60106.1| ACC oxidase [Pseudotsuga menziesii]
 gb|ACH60107.1| ACC oxidase [Pseudotsuga menziesii]
Length=126

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQV+ D GNWIPVE  P   V+NIGD++E+ SNG YKS++HR +
Sbjct  19   LQVRKD-GNWIPVEPIPGGLVINIGDMVEVMSNGKYKSIDHRAV  61



>ref|XP_006494094.1| PREDICTED: codeine O-demethylase-like isoform X1 [Citrus sinensis]
Length=359

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G W  V+  PDAF+VN+GD+LEIF+NG Y+S+EHR 
Sbjct  247  LQIKKD-GKWFAVKPLPDAFIVNVGDVLEIFTNGTYRSIEHRA  288



>ref|XP_004134607.1| PREDICTED: protein SRG1-like [Cucumis sativus]
 ref|XP_004155534.1| PREDICTED: protein SRG1-like [Cucumis sativus]
 gb|KGN49352.1| hypothetical protein Csa_6G520990 [Cucumis sativus]
Length=364

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ++  DG W+ V+  P+AFVVNIGDI+EI SNG+YKS+EHRV
Sbjct  249  LQIR-KDGRWVSVKPLPNAFVVNIGDIMEIVSNGVYKSIEHRV  290



>ref|XP_006449603.1| hypothetical protein CICLE_v10015853mg [Citrus clementina]
 gb|ESR62843.1| hypothetical protein CICLE_v10015853mg [Citrus clementina]
Length=337

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ + G W+PV   P+AFVVNIGDI+EI SNG+Y+S+EHR +
Sbjct  223  LQIR-NQGRWVPVNPLPNAFVVNIGDIMEIVSNGIYRSIEHRAL  265



>gb|KHG23078.1| Codeine O-demethylase [Gossypium arboreum]
Length=367

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            L+VK + G W P  ++PDAFVVN+GDI +IFSNG+Y S+EH+V
Sbjct  253  LEVKKN-GLWFPFNVNPDAFVVNVGDIFQIFSNGVYHSIEHKV  294



>emb|CDP21819.1| unnamed protein product [Coffea canephora]
Length=149

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K   G W+PV   P+AF++N+GDILEI +NG+YKSVEHR 
Sbjct  37   LQIK-KAGGWVPVVPLPNAFIINVGDILEIVTNGIYKSVEHRA  78



>ref|XP_006477808.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=355

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K +DG WIP+   P+AF+VNIGD LEI +NG Y+S+EHR +
Sbjct  243  LQIK-NDGKWIPITPLPNAFIVNIGDTLEIITNGTYRSIEHRAI  285



>emb|CDY35138.1| BnaA06g11480D [Brassica napus]
Length=367

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G W+ V+  P+AF+VN+GD+LEI +NG+YKS+EHRV+
Sbjct  259  LQIKKD-GKWVFVKPLPNAFIVNVGDVLEIITNGIYKSIEHRVV  301



>ref|XP_011003288.1| PREDICTED: flavanone 3-dioxygenase [Populus euphratica]
Length=338

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQV   DG W+ V  HPDAFV+NIGD L+  SNG YKSV HR +
Sbjct  230  LQVLLKDGKWVAVNPHPDAFVINIGDQLQALSNGRYKSVWHRAI  273



>gb|KDO41913.1| hypothetical protein CISIN_1g0264532mg, partial [Citrus sinensis]
Length=155

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K D G W  V+  PDA +VN+GD+LEIFSNG Y+++EHR +
Sbjct  113  LQIKKD-GKWFAVKPLPDALIVNVGDVLEIFSNGTYRNIEHRAL  155



>gb|AFK45789.1| unknown [Medicago truncatula]
Length=206

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIP++   +AFV+NIGD+LEI +NG+Y+S+EHR
Sbjct  96   LQIKKD-GMWIPIKPLTNAFVINIGDMLEIMTNGIYRSIEHR  136



>gb|KDP21181.1| hypothetical protein JCGZ_21652 [Jatropha curcas]
Length=366

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQV+ + G WIPV+  P+AFVVNIGD++EI SNG+Y+S+EHR 
Sbjct  252  LQVRKE-GKWIPVKPLPNAFVVNIGDMMEIVSNGVYRSIEHRA  293



>ref|XP_002532986.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF29394.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=368

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ++ D G W+P++  P+AFVVN+GD++EI SNG+Y+S+EHR 
Sbjct  255  LQIRKD-GRWVPIKPLPNAFVVNVGDMMEIMSNGVYRSIEHRA  296



>ref|XP_007025222.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY27844.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
Length=366

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ D G W+ ++  P+AFVVNIGDI+EI SNG+Y+S+EHR M
Sbjct  251  LQIRKD-GKWVSIKPLPNAFVVNIGDIMEIVSNGIYRSIEHRAM  293



>ref|XP_007025223.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 3 [Theobroma cacao]
 gb|EOY27845.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 3 [Theobroma cacao]
Length=343

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ D G W+ ++  P+AFVVNIGDI+EI SNG+Y+S+EHR M
Sbjct  228  LQIRKD-GKWVSIKPLPNAFVVNIGDIMEIVSNGIYRSIEHRAM  270



>gb|KEH38517.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=359

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ D G W+PV+  P+AF+VNIGD+LEI +NG+Y+S+EHR +
Sbjct  248  LQIRKD-GMWVPVKPLPNAFIVNIGDVLEILTNGIYRSIEHRAI  290



>ref|XP_007013635.1| Senescence-related gene 1, putative [Theobroma cacao]
 gb|EOY31254.1| Senescence-related gene 1, putative [Theobroma cacao]
Length=285

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  20   DGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            +G WIPV+  P+AFV+NIGDI+EI SNG+Y+S+EHR 
Sbjct  175  NGTWIPVKPLPNAFVINIGDIMEIVSNGIYRSIEHRA  211



>gb|ACH60101.1| ACC oxidase [Pseudotsuga menziesii]
 gb|ACH60105.1| ACC oxidase [Pseudotsuga menziesii]
 gb|ACH60108.1| ACC oxidase [Pseudotsuga menziesii]
 gb|ACH60109.1| ACC oxidase [Pseudotsuga menziesii]
 gb|ACH60111.1| ACC oxidase [Pseudotsuga menziesii]
 gb|ACH60112.1| ACC oxidase [Pseudotsuga menziesii]
Length=126

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQV+ D GNWIPVE  P   V+NIGD++E+ SNG YKS++HR +
Sbjct  19   LQVRKD-GNWIPVEPIPGGLVINIGDMVEVMSNGKYKSIDHRAV  61



>gb|AFK45966.1| unknown [Medicago truncatula]
Length=353

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G W+P+   P+AFVVNIGD+LEI +NG+Y+S+EHR 
Sbjct  240  LQIKKD-GMWVPINPLPNAFVVNIGDLLEIMTNGIYRSIEHRA  281



>gb|KHN06939.1| Protein SRG1 [Glycine soja]
Length=372

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K   G WIPV +  DA ++NIGDILE+ SNGLYKSVEHR +
Sbjct  249  LQIKKH-GIWIPVNVASDALILNIGDILELMSNGLYKSVEHRAI  291



>gb|KCW74258.1| hypothetical protein EUGRSUZ_E02905 [Eucalyptus grandis]
Length=253

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ++ D G W+PV+  P AF++N+GD++EI +NG+Y+S+EHR
Sbjct  141  LQIRKD-GKWVPVKPLPGAFIINVGDVVEIITNGIYQSIEHR  181



>emb|CDP21600.1| unnamed protein product [Coffea canephora]
Length=173

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K   G W+PV   P+AF VN+GDILEI +NG+YKSVEHR
Sbjct  61   LQIKKA-GAWVPVVPLPNAFTVNVGDILEIVTNGIYKSVEHR  101



>ref|XP_003638405.1| Protein SRG1 [Medicago truncatula]
Length=359

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ++ D G W+PV+  P+AF+VNIGD+LEI +NG+Y+S+EHR +
Sbjct  248  LQIRKD-GMWVPVKPLPNAFIVNIGDVLEILTNGIYRSIEHRAI  290



>emb|CDX81796.1| BnaC08g38050D [Brassica napus]
Length=358

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G W+PV+  P+AF+VNIGD++EI +NG Y+S+EHR
Sbjct  251  LQIKKD-GKWVPVKPLPNAFIVNIGDVIEIITNGTYRSIEHR  291



>gb|KEH27895.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=353

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ+K D G W+P+   P+AFVVNIGD+LEI +NG+Y+S+EHR 
Sbjct  240  LQIKKD-GMWVPINPLPNAFVVNIGDLLEIMTNGIYRSIEHRA  281



>gb|KDO69142.1| hypothetical protein CISIN_1g047368mg [Citrus sinensis]
Length=365

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K  D +WIPV+  PDA VVNIGD+ E+ SNGLYKSVEHR +
Sbjct  257  LQIKHKD-SWIPVKPIPDAIVVNIGDVAEVLSNGLYKSVEHRAV  299



>ref|XP_009772022.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=365

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K D G WIP+   P+AF++NIGDILEI +NG Y+S+EHR
Sbjct  250  LQIKKD-GMWIPISPLPNAFIINIGDILEIVTNGTYRSIEHR  290



>ref|XP_006435645.1| hypothetical protein CICLE_v10033449mg [Citrus clementina]
 gb|ESR48885.1| hypothetical protein CICLE_v10033449mg [Citrus clementina]
Length=365

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K  D +WIPV+  PDA VVNIGD+ E+ SNGLYKSVEHR +
Sbjct  257  LQIKHKD-SWIPVKPIPDAIVVNIGDVAEVLSNGLYKSVEHRAV  299



>emb|CDY24860.1| BnaA08g14500D [Brassica napus]
Length=267

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K + G W+PV+  P+AFVVNIGD+LEI +NG Y+S+EHR
Sbjct  160  LQIKKN-GKWVPVKPLPNAFVVNIGDVLEIITNGSYRSIEHR  200



>ref|XP_004502767.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Cicer arietinum]
Length=340

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  20   DGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            DGNW+ V  HPDAFV+NIGD ++  SNGLYKSV HR +
Sbjct  235  DGNWLAVHPHPDAFVINIGDQIQALSNGLYKSVWHRAV  272



>ref|XP_004303202.1| PREDICTED: protein SRG1-like [Fragaria vesca subsp. vesca]
Length=340

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQ++ D+  W+PV L  DAFVVN+GDILEI +NG+YKSVEHRV
Sbjct  250  LQIRKDEV-WLPVCLDHDAFVVNLGDILEILTNGIYKSVEHRV  291



>ref|XP_002441510.1| hypothetical protein SORBIDRAFT_09g028360 [Sorghum bicolor]
 gb|EES19940.1| hypothetical protein SORBIDRAFT_09g028360 [Sorghum bicolor]
Length=366

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRVM  133
            LQ+K  DG W+PV   P++F VN+GD L++ +NG +KSV+HRV+
Sbjct  216  LQIKLRDGRWVPVPPAPESFFVNVGDALQVLTNGRFKSVKHRVV  259



>gb|KDP23860.1| hypothetical protein JCGZ_27165 [Jatropha curcas]
Length=362

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  20   DGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            DGNWIPV+  P+AFVVNIGDILEI +NG Y+S+ HR 
Sbjct  255  DGNWIPVKPLPNAFVVNIGDILEIITNGAYRSILHRA  291



>ref|XP_002300453.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
 gb|EEE85258.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
Length=355

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHRV  130
            LQVK  DG W+PV+  P+AF+ N+GDILEI +NG Y+S+EHR 
Sbjct  248  LQVK-KDGKWVPVKPLPNAFIFNVGDILEIITNGTYRSIEHRA  289



>ref|XP_002270646.2| PREDICTED: protein SRG1-like [Vitis vinifera]
Length=474

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    LQVKTDDGNWIPVELHPDAFVVNIGDILEIFSNGLYKSVEHR  127
            LQ+K +DG WIPV   PDA VVNIGDILE+  +G+Y S+EHR
Sbjct  247  LQIK-NDGVWIPVSFLPDALVVNIGDILEVSPHGVYTSIEHR  287



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512165903184