BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c43865_g1_i1 len=568 path=[1:0-567]

Length=568
                                                                      Score     E

ref|XP_009771192.1|  PREDICTED: protein RADIALIS-like 3                 141   2e-39   
ref|XP_011083673.1|  PREDICTED: protein RADIALIS-like 3                 138   2e-38   
ref|XP_009616919.1|  PREDICTED: protein RADIALIS-like 6 isoform X1      137   4e-38   
ref|XP_009611761.1|  PREDICTED: protein RADIALIS-like 5                 137   6e-38   
ref|XP_009761204.1|  PREDICTED: protein RADIALIS-like 1                 134   1e-36   
ref|XP_004252792.1|  PREDICTED: protein RADIALIS-like 3                 132   7e-36   
emb|CDP07503.1|  unnamed protein product                                132   7e-36   
ref|XP_009607881.1|  PREDICTED: protein RADIALIS-like 5                 131   1e-35   
ref|XP_004238608.1|  PREDICTED: protein RADIALIS-like 6                 130   2e-35   
ref|XP_006342582.1|  PREDICTED: protein RADIALIS-like 6-like            130   3e-35   
ref|XP_009774057.1|  PREDICTED: protein RADIALIS-like 5                 130   3e-35   
ref|XP_006341953.1|  PREDICTED: protein RADIALIS-like 6-like            129   1e-34   
ref|XP_009616920.1|  PREDICTED: protein RADIALIS-like 6 isoform X2      128   2e-34   
ref|XP_011074553.1|  PREDICTED: protein RADIALIS-like 3                 124   9e-33   
gb|EYU32775.1|  hypothetical protein MIMGU_mgv1a016932mg                121   9e-32   
ref|XP_006339257.1|  PREDICTED: protein RADIALIS-like 1-like            121   1e-31   
gb|EYU45174.1|  hypothetical protein MIMGU_mgv1a024515mg                120   4e-31   
ref|XP_004249320.1|  PREDICTED: protein RADIALIS-like 1                 119   7e-31   
ref|XP_009605567.1|  PREDICTED: protein RADIALIS-like 1                 118   1e-30   
emb|CAN68999.1|  hypothetical protein VITISV_033596                     116   1e-29   Vitis vinifera
ref|XP_003631660.1|  PREDICTED: protein RADIALIS-like 1                 114   4e-29   
emb|CBI32595.3|  unnamed protein product                                114   5e-29   
ref|XP_008220818.1|  PREDICTED: protein RADIALIS-like 6                 114   8e-29   
ref|XP_010254802.1|  PREDICTED: protein RADIALIS-like 3                 114   9e-29   
ref|XP_009796752.1|  PREDICTED: protein RADIALIS-like 1                 112   2e-28   
ref|XP_004291870.1|  PREDICTED: protein RADIALIS-like 6-like            112   2e-28   
ref|XP_011028852.1|  PREDICTED: protein RADIALIS-like 5                 112   3e-28   
ref|XP_009106182.1|  PREDICTED: protein RADIALIS-like 6                 112   3e-28   
ref|XP_009336185.1|  PREDICTED: protein RADIALIS-like 3                 112   3e-28   
ref|XP_009365547.1|  PREDICTED: protein RADIALIS-like 3                 110   2e-27   
ref|XP_010060956.1|  PREDICTED: protein RADIALIS-like 3                 110   2e-27   
ref|XP_010088924.1|  DnaJ homolog subfamily C member 2                  110   3e-27   
ref|XP_010061304.1|  PREDICTED: protein RADIALIS-like 3 isoform X1      108   9e-27   
gb|KFK41962.1|  hypothetical protein AALP_AA2G194600                    108   9e-27   
ref|XP_010102066.1|  DnaJ homolog subfamily C member 2                  108   9e-27   
ref|XP_009364936.1|  PREDICTED: protein RADIALIS-like 6                 108   1e-26   
ref|XP_002300766.1|  myb family transcription factor family protein     107   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_002510392.1|  DNA binding protein, putative                      107   4e-26   Ricinus communis
ref|XP_011092800.1|  PREDICTED: transcription factor RADIALIS-like      107   4e-26   
ref|XP_002282280.1|  PREDICTED: protein RADIALIS-like 3                 107   4e-26   Vitis vinifera
ref|XP_006390328.1|  hypothetical protein EUTSA_v10019367mg             107   4e-26   
ref|XP_009117377.1|  PREDICTED: protein RADIALIS-like 2                 106   9e-26   
ref|XP_003631666.1|  PREDICTED: protein RADIALIS-like 3                 105   1e-25   
ref|NP_001077825.1|  protein RADIALIS-like 6                            105   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008388050.1|  PREDICTED: protein RADIALIS-like 6                 105   2e-25   
ref|XP_011004014.1|  PREDICTED: protein RADIALIS-like 3                 105   3e-25   
ref|XP_009128087.1|  PREDICTED: protein RADIALIS-like 6                 104   3e-25   
ref|XP_006423283.1|  hypothetical protein CICLE_v10029669mg             104   3e-25   
ref|XP_006284830.1|  hypothetical protein CARUB_v10006110mg             104   3e-25   
ref|XP_002889017.1|  myb family transcription factor                    104   3e-25   
ref|XP_010446463.1|  PREDICTED: protein RADIALIS-like 1                 104   3e-25   
gb|KFK30501.1|  hypothetical protein AALP_AA7G270400                    104   4e-25   
ref|XP_007160753.1|  hypothetical protein PHAVU_001G014300g             104   4e-25   
ref|XP_002868895.1|  DNA binding protein                                104   4e-25   
ref|NP_195636.2|  protein RAD-like 1                                    104   5e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ABI14756.1|  AtRL1                                                   103   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878564.1|  hypothetical protein ARALYDRAFT_481032             103   6e-25   
ref|XP_002305430.1|  myb family transcription factor family protein     103   6e-25   Populus trichocarpa [western balsam poplar]
gb|KDP38508.1|  hypothetical protein JCGZ_04433                         103   6e-25   
ref|XP_007042186.1|  Homeodomain-like superfamily protein               105   9e-25   
emb|CDY01398.1|  BnaA07g11710D                                          103   1e-24   
gb|EPS66061.1|  hypothetical protein M569_08717                         103   1e-24   
ref|XP_002303127.1|  myb family transcription factor family protein     103   1e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010437040.1|  PREDICTED: protein RADIALIS-like 1                 103   1e-24   
emb|CDY45420.1|  BnaA07g32000D                                          102   1e-24   
ref|XP_008378460.1|  PREDICTED: transcription factor RADIALIS-like      103   1e-24   
ref|XP_008241676.1|  PREDICTED: protein RADIALIS-like 3                 102   2e-24   
ref|XP_008220806.1|  PREDICTED: protein RADIALIS-like 3                 102   2e-24   
ref|XP_008444724.1|  PREDICTED: protein RADIALIS-like 4                 102   2e-24   
ref|XP_004152694.1|  PREDICTED: protein RADIALIS-like 6-like            102   3e-24   
ref|XP_006295299.1|  hypothetical protein CARUB_v10024389mg             102   3e-24   
ref|XP_007224604.1|  hypothetical protein PRUPE_ppa026982mg             101   3e-24   
ref|XP_010664694.1|  PREDICTED: protein RADIALIS-like 3 isoform X1      101   4e-24   
gb|KDP38516.1|  hypothetical protein JCGZ_04441                         101   4e-24   
ref|XP_009371599.1|  PREDICTED: protein RADIALIS-like 4                 101   5e-24   
gb|KHN41969.1|  hypothetical protein glysoja_003709                     100   5e-24   
ref|XP_006473504.1|  PREDICTED: protein RADIALIS-like 6-like            101   6e-24   
ref|XP_007225405.1|  hypothetical protein PRUPE_ppa024375mg             101   6e-24   
ref|XP_004961116.1|  PREDICTED: protein RADIALIS-like 3-like            101   7e-24   
ref|XP_009364794.1|  PREDICTED: protein RADIALIS-like 3                 100   7e-24   
ref|XP_010431894.1|  PREDICTED: protein RADIALIS-like 1                 101   7e-24   
ref|XP_006404620.1|  hypothetical protein EUTSA_v10000389mg             100   8e-24   
ref|XP_004289671.1|  PREDICTED: transcription factor RADIALIS-like      100   9e-24   
ref|NP_179759.1|  MYB transcription factor RSM1                         100   9e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010254825.1|  PREDICTED: protein RADIALIS-like 3 isoform X2      100   9e-24   
ref|XP_008388061.1|  PREDICTED: protein RADIALIS-like 3                 100   9e-24   
ref|XP_011024437.1|  PREDICTED: protein RADIALIS-like 3                 100   1e-23   
ref|XP_010690864.1|  PREDICTED: protein RADIALIS-like 3                 100   1e-23   
ref|XP_010061305.1|  PREDICTED: protein RADIALIS-like 3 isoform X2    99.8    2e-23   
gb|KFK44084.1|  hypothetical protein AALP_AA1G213900                    100   2e-23   
ref|XP_010416923.1|  PREDICTED: protein RADIALIS-like 2                 100   2e-23   
ref|XP_010936699.1|  PREDICTED: protein RADIALIS-like 3                 100   2e-23   
gb|KFK32873.1|  hypothetical protein AALP_AA6G298600                    100   2e-23   
gb|KHG28372.1|  DnaJ subfamily C member 2                             99.8    2e-23   
ref|XP_009134002.1|  PREDICTED: protein RADIALIS-like 2 isoform X4    99.8    2e-23   
ref|XP_007017546.1|  DnaJ subfamily C member 2                        99.8    2e-23   
ref|XP_009594360.1|  PREDICTED: protein RADIALIS-like 1               99.4    2e-23   
gb|KDO84575.1|  hypothetical protein CISIN_1g041475mg                   101   3e-23   
ref|XP_010539897.1|  PREDICTED: protein RADIALIS-like 5               99.4    3e-23   
ref|XP_007017563.1|  RAD-like 6                                       99.4    3e-23   
gb|KHN36107.1|  hypothetical protein glysoja_003230                   99.4    3e-23   
ref|XP_008465612.1|  PREDICTED: protein RADIALIS-like 3               99.0    3e-23   
ref|XP_002282461.1|  PREDICTED: protein RADIALIS-like 3 isoform X2    99.0    3e-23   Vitis vinifera
ref|XP_006383186.1|  hypothetical protein POPTR_0005s12390g           99.0    4e-23   
ref|XP_007201464.1|  hypothetical protein PRUPE_ppa014060mg           99.0    4e-23   
ref|XP_003545280.1|  PREDICTED: protein RADIALIS-like 1-like isof...  99.0    4e-23   
ref|NP_177661.1|  protein RADIALIS-like 6                             99.8    5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304325.1|  hypothetical protein CARUB_v10010724mg           99.0    5e-23   
ref|XP_006473515.1|  PREDICTED: protein RADIALIS-like 6-like          99.0    5e-23   
ref|XP_003523829.1|  PREDICTED: protein RADIALIS-like 2-like          98.6    5e-23   
gb|KEH40146.1|  MYB family transcription factor                       98.6    6e-23   
ref|XP_006654838.1|  PREDICTED: protein RADIALIS-like 1-like          98.6    6e-23   
ref|XP_006595936.1|  PREDICTED: protein RADIALIS-like 1-like isof...  98.2    7e-23   
gb|AES94986.2|  MYB family transcription factor                       97.4    7e-23   
ref|XP_007204842.1|  hypothetical protein PRUPE_ppa026779mg           98.2    8e-23   
ref|XP_010471632.1|  PREDICTED: protein RADIALIS-like 6               98.2    8e-23   
ref|XP_003569420.1|  PREDICTED: protein RADIALIS-like 4               98.2    9e-23   
ref|XP_010555296.1|  PREDICTED: protein RADIALIS-like 2               98.2    9e-23   
ref|XP_007131828.1|  hypothetical protein PHAVU_011G044900g           98.2    9e-23   
ref|XP_006581206.1|  PREDICTED: protein RADIALIS-like 2-like          97.8    1e-22   
gb|ABH02884.1|  MYB transcription factor MYB164                       98.2    1e-22   Glycine max [soybeans]
ref|XP_004509270.1|  PREDICTED: protein RADIALIS-like 1-like          97.1    1e-22   
ref|XP_003540679.1|  PREDICTED: protein RADIALIS-like 1-like          97.8    2e-22   
ref|XP_007156953.1|  hypothetical protein PHAVU_002G031300g           96.7    2e-22   
gb|ABI14752.1|  myb-like protein RL3                                  97.4    2e-22   Antirrhinum majus [garden snapdragon]
ref|XP_010416394.1|  PREDICTED: protein RADIALIS-like 6               97.4    2e-22   
ref|XP_010263639.1|  PREDICTED: protein RADIALIS-like 3               97.4    2e-22   
ref|XP_004147867.1|  PREDICTED: protein RADIALIS-like 1-like          97.4    2e-22   
ref|XP_008800712.1|  PREDICTED: protein RADIALIS-like 3               97.4    2e-22   
ref|XP_009785808.1|  PREDICTED: protein RADIALIS-like 1               96.7    2e-22   
ref|XP_010254824.1|  PREDICTED: protein RADIALIS-like 1 isoform X1    97.8    3e-22   
gb|KHN12708.1|  hypothetical protein glysoja_008671                   97.1    3e-22   
emb|CDY62533.1|  BnaA02g35960D                                        97.1    3e-22   
ref|XP_010028595.1|  PREDICTED: protein RADIALIS-like 1               96.7    3e-22   
gb|ABK96643.1|  unknown                                               96.7    3e-22   Populus trichocarpa x Populus deltoides
ref|XP_004499158.1|  PREDICTED: protein RADIALIS-like 5-like          96.7    4e-22   
ref|XP_010429089.1|  PREDICTED: protein RADIALIS-like 2               96.7    4e-22   
ref|NP_564087.2|  protein RADIALIS-like 5                             96.7    4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002310812.1|  hypothetical protein POPTR_0007s13000g           95.9    4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010428536.1|  PREDICTED: protein RADIALIS-like 6               96.7    4e-22   
ref|XP_010102082.1|  DnaJ homolog subfamily C member 1                96.3    4e-22   
gb|EPS58348.1|  hypothetical protein M569_16468                       96.3    4e-22   
ref|XP_010498374.1|  PREDICTED: protein RADIALIS-like 5               96.7    4e-22   
ref|XP_008782489.1|  PREDICTED: protein RADIALIS-like 3 isoform X1    96.3    4e-22   
ref|XP_003612028.1|  MYB transcription factor MYB164                  95.9    5e-22   
ref|XP_003629426.1|  MYB transcription factor MYB164                  95.5    5e-22   
emb|CDY13797.1|  BnaA09g42990D                                        96.7    5e-22   
emb|CDY59758.1|  BnaC08g49320D                                        96.3    5e-22   
ref|XP_006434998.1|  hypothetical protein CICLE_v10003726mg           95.9    5e-22   
ref|XP_011037522.1|  PREDICTED: protein RADIALIS-like 2               95.9    5e-22   
ref|XP_007136596.1|  hypothetical protein PHAVU_009G058100g           96.3    5e-22   
ref|XP_010089027.1|  hypothetical protein L484_020313                 96.3    5e-22   
emb|CAB43640.1|  putative protein                                     96.3    5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380360.1|  PREDICTED: protein RADIALIS-like 3               96.3    6e-22   
ref|XP_007156943.1|  hypothetical protein PHAVU_002G030400g           96.3    6e-22   
gb|KHG17860.1|  DnaJ subfamily C member 2                             95.9    7e-22   
ref|XP_003629427.1|  RAD                                              95.1    7e-22   
emb|CDP07510.1|  unnamed protein product                              95.9    7e-22   
ref|XP_010060952.1|  PREDICTED: protein RADIALIS-like 3               95.9    7e-22   
gb|AGT17349.1|  hypothetical protein SHCRBa_078_K12_R_140             95.5    8e-22   
ref|XP_010029788.1|  PREDICTED: protein RADIALIS-like 4               95.1    9e-22   
ref|XP_003537885.2|  PREDICTED: protein RADIALIS-like 1-like          95.5    1e-21   
ref|XP_011083676.1|  PREDICTED: protein RADIALIS-like 4               95.5    1e-21   
gb|AEV91165.1|  MYB-related protein                                   95.5    1e-21   
gb|KHN08900.1|  hypothetical protein glysoja_029477                   95.5    1e-21   
emb|CAN75513.1|  hypothetical protein VITISV_020771                   97.4    1e-21   Vitis vinifera
ref|XP_002441574.1|  hypothetical protein SORBIDRAFT_09g029560        95.1    1e-21   Sorghum bicolor [broomcorn]
ref|XP_008364991.1|  PREDICTED: protein RADIALIS-like 3               95.1    1e-21   
gb|KHN00535.1|  hypothetical protein glysoja_000203                   94.4    1e-21   
emb|CDY59631.1|  BnaC07g48440D                                        95.1    1e-21   
ref|XP_009340740.1|  PREDICTED: protein RADIALIS-like 3               94.4    2e-21   
ref|XP_008795931.1|  PREDICTED: protein RADIALIS-like 3               94.7    2e-21   
ref|XP_009340748.1|  PREDICTED: protein RADIALIS-like 4               94.7    2e-21   
ref|XP_009140298.1|  PREDICTED: protein RADIALIS-like 2               94.7    2e-21   
ref|XP_011003722.1|  PREDICTED: protein RADIALIS-like 3               94.4    2e-21   
ref|XP_007042177.1|  DnaJ subfamily C member 2                        95.9    2e-21   
ref|XP_006878579.1|  hypothetical protein AMTR_s00011p00247840        94.7    2e-21   
ref|XP_011025788.1|  PREDICTED: protein RADIALIS-like 3               94.7    2e-21   
ref|XP_009779120.1|  PREDICTED: protein RADIALIS-like 4               94.4    2e-21   
ref|XP_006573585.1|  PREDICTED: protein RADIALIS-like 1-like          95.1    2e-21   
ref|NP_001056421.1|  Os05g0579600                                     94.4    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010095252.1|  hypothetical protein L484_014592                 94.0    3e-21   
ref|XP_009103382.1|  PREDICTED: protein RADIALIS-like 5               94.4    3e-21   
sp|Q58FS3.1|RAD_ANTMA  RecName: Full=Transcription factor RADIALIS    94.4    3e-21   Antirrhinum majus [garden snapdragon]
ref|XP_009347537.1|  PREDICTED: protein RADIALIS-like 4               94.4    3e-21   
emb|CDY42615.1|  BnaC01g00270D                                        94.4    3e-21   
ref|XP_006303004.1|  hypothetical protein CARUB_v10021157mg           95.1    3e-21   
ref|XP_010477169.1|  PREDICTED: protein RADIALIS-like 5               94.4    3e-21   
ref|XP_009107919.1|  PREDICTED: protein RADIALIS-like 1               94.4    3e-21   
ref|XP_004500809.1|  PREDICTED: protein RADIALIS-like 6-like          93.6    3e-21   
ref|XP_006416498.1|  hypothetical protein EUTSA_v10009748mg           94.4    3e-21   
ref|XP_011037518.1|  PREDICTED: protein RADIALIS-like 4 isoform X1    94.0    3e-21   
ref|XP_009406294.1|  PREDICTED: protein RADIALIS-like 3               93.6    4e-21   
ref|XP_002310232.1|  hypothetical protein POPTR_0007s12860g           94.0    4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010690880.1|  PREDICTED: protein RADIALIS-like 2               93.6    4e-21   
gb|KHN36130.1|  DnaJ like subfamily C member 2                        94.0    4e-21   
emb|CDY41968.1|  BnaA01g05400D                                        94.0    4e-21   
ref|XP_002456020.1|  hypothetical protein SORBIDRAFT_03g028960        93.6    5e-21   Sorghum bicolor [broomcorn]
ref|NP_001236080.1|  MYB transcription factor MYB142                  93.6    5e-21   
ref|XP_008447023.1|  PREDICTED: protein RADIALIS-like 3               93.6    6e-21   
ref|XP_007156054.1|  hypothetical protein PHAVU_003G254400g           92.4    6e-21   
ref|XP_009602671.1|  PREDICTED: protein RADIALIS-like 4               93.6    6e-21   
ref|XP_009149439.1|  PREDICTED: protein RADIALIS-like 5               93.6    6e-21   
ref|XP_008800710.1|  PREDICTED: protein RADIALIS-like 1               92.8    6e-21   
ref|XP_004292033.1|  PREDICTED: protein RADIALIS-like 6-like          93.2    8e-21   
ref|XP_002306110.2|  hypothetical protein POPTR_0004s16320g           93.2    8e-21   Populus trichocarpa [western balsam poplar]
gb|KHN11104.1|  hypothetical protein glysoja_033658                   92.0    9e-21   
emb|CDY39383.1|  BnaC05g15040D                                        92.8    9e-21   
ref|XP_009603278.1|  PREDICTED: protein RADIALIS-like 1               92.4    9e-21   
ref|XP_004969265.1|  PREDICTED: protein RADIALIS-like 3-like          92.8    9e-21   
ref|XP_011048444.1|  PREDICTED: protein RADIALIS-like 1               92.4    1e-20   
ref|XP_008338442.1|  PREDICTED: protein RADIALIS-like 1               92.4    1e-20   
gb|ADE77540.1|  unknown                                               92.8    1e-20   
gb|KDP26264.1|  hypothetical protein JCGZ_22436                       92.0    1e-20   
gb|ABM97744.1|  RAD                                                   92.0    1e-20   Oreocharis leiophylla
gb|KDO84586.1|  hypothetical protein CISIN_1g034673mg                 92.0    2e-20   
ref|XP_004961115.1|  PREDICTED: protein RADIALIS-like 3-like          92.0    2e-20   
ref|XP_011025809.1|  PREDICTED: protein RADIALIS-like 3               91.7    2e-20   
gb|EMS68204.1|  DnaJ homolog subfamily C member 2                     92.0    2e-20   
ref|XP_009786616.1|  PREDICTED: protein RADIALIS-like 1               91.3    2e-20   
ref|XP_010497645.1|  PREDICTED: protein RADIALIS-like 2               91.7    3e-20   
ref|XP_002509490.1|  DNA binding protein, putative                    92.0    3e-20   Ricinus communis
gb|ABI14753.1|  myb-like protein RL4                                  91.3    3e-20   Antirrhinum majus [garden snapdragon]
ref|XP_010940077.1|  PREDICTED: protein RADIALIS-like 3               91.7    3e-20   
ref|XP_010649137.1|  PREDICTED: protein RADIALIS-like 3               91.3    3e-20   
gb|KDP46257.1|  hypothetical protein JCGZ_10097                       91.3    3e-20   
ref|XP_009801639.1|  PREDICTED: protein RADIALIS-like 3               90.5    3e-20   
ref|XP_010088931.1|  hypothetical protein L484_018558                 92.0    3e-20   
ref|XP_011048394.1|  PREDICTED: protein RADIALIS-like 4               91.7    3e-20   
ref|XP_003547982.1|  PREDICTED: protein RADIALIS-like 1-like          90.9    3e-20   
ref|XP_011099630.1|  PREDICTED: protein RADIALIS-like 3               90.9    4e-20   
ref|XP_004501011.1|  PREDICTED: protein RADIALIS-like 1-like          91.3    4e-20   
emb|CBI17505.3|  unnamed protein product                              90.5    4e-20   
ref|XP_008352458.1|  PREDICTED: protein RADIALIS-like 4               90.9    4e-20   
ref|XP_008241690.1|  PREDICTED: protein RADIALIS-like 4               90.9    4e-20   
ref|XP_009390189.1|  PREDICTED: protein RADIALIS-like 3               90.9    4e-20   
ref|XP_008800711.1|  PREDICTED: protein RADIALIS-like 3               90.5    4e-20   
ref|NP_001151113.1|  LOC100284746                                     90.9    4e-20   Zea mays [maize]
ref|XP_009134001.1|  PREDICTED: protein RADIALIS-like 2 isoform X3    91.3    4e-20   
ref|XP_006575120.1|  PREDICTED: protein RADIALIS-like 1-like          90.9    4e-20   
gb|KHN41108.1|  hypothetical protein glysoja_013450                   91.7    4e-20   
ref|XP_007145477.1|  hypothetical protein PHAVU_007G242300g           90.9    4e-20   
ref|XP_009378514.1|  PREDICTED: protein RADIALIS-like 3               91.3    4e-20   
ref|XP_002313794.1|  myb family transcription factor family protein   90.9    5e-20   Populus trichocarpa [western balsam poplar]
gb|KHN25378.1|  hypothetical protein glysoja_010295                   90.9    5e-20   
ref|XP_009134000.1|  PREDICTED: protein RADIALIS-like 2 isoform X2    91.3    5e-20   
gb|AAD39593.1|AC007858_7  10A19I.8                                    94.0    6e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009396486.1|  PREDICTED: protein RADIALIS-like 3               90.1    6e-20   
ref|XP_002521210.1|  DNA binding protein, putative                    90.1    6e-20   Ricinus communis
ref|XP_010028603.1|  PREDICTED: protein RADIALIS-like 3               90.5    7e-20   
ref|XP_007136600.1|  hypothetical protein PHAVU_009G058500g           90.5    7e-20   
ref|XP_004287896.1|  PREDICTED: protein RADIALIS-like 1-like          90.5    7e-20   
ref|XP_006411728.1|  hypothetical protein EUTSA_v10027169mg           90.5    8e-20   
ref|XP_007156055.1|  hypothetical protein PHAVU_003G254500g           89.7    8e-20   
ref|XP_008338377.1|  PREDICTED: protein RADIALIS-like 4               90.1    8e-20   
ref|XP_009133999.1|  PREDICTED: protein RADIALIS-like 2 isoform X1    91.7    8e-20   
ref|NP_001147409.1|  RADIALIS                                         90.5    8e-20   Zea mays [maize]
ref|XP_006595898.1|  PREDICTED: protein RADIALIS-like 3-like          90.1    8e-20   
gb|EYU42615.1|  hypothetical protein MIMGU_mgv1a017293mg              90.1    9e-20   
ref|XP_006425671.1|  hypothetical protein CICLE_v10026848mg           90.1    1e-19   
emb|CDX83196.1|  BnaA03g23100D                                        90.9    1e-19   
ref|XP_006590687.1|  PREDICTED: protein RADIALIS-like 1-like          90.9    1e-19   
ref|XP_006467147.1|  PREDICTED: protein RADIALIS-like 5-like          90.1    1e-19   
ref|XP_006655628.1|  PREDICTED: protein RADIALIS-like 3-like          90.5    1e-19   
ref|XP_003523825.1|  PREDICTED: protein RADIALIS-like 1-like          89.7    1e-19   
gb|KHN00534.1|  hypothetical protein glysoja_000202                   89.4    1e-19   
ref|XP_004151090.1|  PREDICTED: protein RADIALIS-like 6-like          90.1    1e-19   
ref|XP_003518389.1|  PREDICTED: protein RADIALIS-like 6-like          89.7    1e-19   
gb|KDO36093.1|  hypothetical protein CISIN_1g041937mg                 89.7    1e-19   
ref|XP_004287888.1|  PREDICTED: protein RADIALIS-like 6-like          89.4    1e-19   
gb|KHN14528.1|  hypothetical protein glysoja_027137                   89.4    2e-19   
ref|XP_003603930.1|  DnaJ homolog subfamily C member                  89.4    2e-19   
gb|ABR28346.1|  MYB transcription factor MYB114                       89.4    2e-19   
ref|XP_009618694.1|  PREDICTED: protein RADIALIS-like 2               89.0    2e-19   
ref|XP_004152778.1|  PREDICTED: protein RADIALIS-like 6-like          89.4    2e-19   
ref|XP_004509271.1|  PREDICTED: protein RADIALIS-like 1-like          88.6    2e-19   
ref|XP_008810721.1|  PREDICTED: protein RADIALIS-like 1               88.6    2e-19   
ref|XP_011037519.1|  PREDICTED: protein RADIALIS-like 4 isoform X2    89.0    2e-19   
ref|XP_009760253.1|  PREDICTED: protein RADIALIS-like 3               89.0    2e-19   
ref|XP_003521116.1|  PREDICTED: protein RADIALIS-like 1-like          89.0    3e-19   
ref|XP_009371617.1|  PREDICTED: protein RADIALIS-like 4               88.6    3e-19   
ref|XP_002310233.1|  hypothetical protein POPTR_0007s12870g           88.6    3e-19   
ref|XP_007141400.1|  hypothetical protein PHAVU_008G192200g           89.0    3e-19   
ref|NP_001233849.1|  SANT/MYB domain protein                          88.6    3e-19   
ref|XP_011025785.1|  PREDICTED: protein RADIALIS-like 4               88.6    3e-19   
ref|XP_008812249.1|  PREDICTED: protein RADIALIS-like 4               88.6    4e-19   
gb|AAD39594.1|AC007858_8  10A19I.9                                    89.4    4e-19   
ref|XP_004232415.1|  PREDICTED: protein RADIALIS-like 5               88.2    4e-19   
emb|CDP02018.1|  unnamed protein product                              88.2    4e-19   
gb|EAY99167.1|  hypothetical protein OsI_21126                        89.0    4e-19   
ref|XP_007148839.1|  hypothetical protein PHAVU_005G018500g           88.6    4e-19   
gb|KEH36157.1|  MYB family transcription factor                       88.2    4e-19   
ref|XP_003528087.1|  PREDICTED: uncharacterized LOC100786029          88.2    5e-19   
ref|XP_010927372.1|  PREDICTED: protein RADIALIS-like 1               90.1    5e-19   
ref|XP_006577923.1|  PREDICTED: protein RADIALIS-like 6-like isof...  88.2    5e-19   
gb|EEE64814.1|  hypothetical protein OsJ_19670                        88.6    5e-19   
ref|XP_006423271.1|  hypothetical protein CICLE_v10029663mg           88.2    6e-19   
ref|XP_009342796.1|  PREDICTED: transcription factor RADIALIS iso...  87.8    6e-19   
ref|XP_008236907.1|  PREDICTED: protein RADIALIS-like 3               88.2    6e-19   
ref|XP_010230972.1|  PREDICTED: protein RADIALIS-like 3               88.2    6e-19   
ref|XP_006577922.1|  PREDICTED: protein RADIALIS-like 6-like isof...  88.2    6e-19   
ref|XP_007162062.1|  hypothetical protein PHAVU_001G120400g           89.0    6e-19   
ref|XP_010263653.1|  PREDICTED: protein RADIALIS-like 3               87.8    7e-19   
ref|XP_002510401.1|  DNA binding protein, putative                    87.8    7e-19   
gb|KHN33753.1|  DnaJ like subfamily C member 2                        88.6    7e-19   
ref|XP_008236902.1|  PREDICTED: protein RADIALIS-like 1               87.0    7e-19   
ref|XP_007200670.1|  hypothetical protein PRUPE_ppa015823mg           87.8    8e-19   
ref|XP_006282757.1|  hypothetical protein CARUB_v10006084mg           87.8    9e-19   
gb|AFK49069.1|  unknown                                               87.4    9e-19   
ref|XP_008347407.1|  PREDICTED: transcription factor RADIALIS-like    87.0    9e-19   
emb|CDX99575.1|  BnaC04g33320D                                        87.8    9e-19   
ref|XP_004304977.1|  PREDICTED: protein RADIALIS-like 1-like          88.2    9e-19   
ref|XP_007046939.1|  RAD-like 1                                       87.8    9e-19   
gb|KHN41976.1|  DnaJ like subfamily C member 2                        87.4    1e-18   
ref|XP_004147863.1|  PREDICTED: protein RADIALIS-like 3-like          87.4    1e-18   
ref|XP_008650058.1|  PREDICTED: protein RADIALIS-like 3               87.8    1e-18   
ref|XP_007203252.1|  hypothetical protein PRUPE_ppa019533mg           87.0    1e-18   
ref|XP_010548326.1|  PREDICTED: protein RADIALIS-like 3               87.0    1e-18   
ref|XP_006425660.1|  hypothetical protein CICLE_v10026862mg           87.0    1e-18   
gb|EPS58871.1|  hypothetical protein M569_15942                       86.3    1e-18   
gb|EMS56253.1|  DnaJ homolog subfamily C member 2                     87.4    1e-18   
ref|XP_003631667.1|  PREDICTED: protein RADIALIS-like 3               86.7    1e-18   
ref|XP_003629431.1|  SANT/MYB protein                                 86.3    2e-18   
ref|XP_009411227.1|  PREDICTED: protein RADIALIS-like 4               86.7    2e-18   
emb|CDX69233.1|  BnaC01g02200D                                        86.3    2e-18   
emb|CDO97041.1|  unnamed protein product                              86.7    2e-18   
ref|XP_004969264.1|  PREDICTED: protein RADIALIS-like 3-like          86.7    2e-18   
gb|AGT17350.1|  hypothetical protein SHCRBa_078_K12_R_170             87.4    2e-18   
ref|XP_002441575.1|  hypothetical protein SORBIDRAFT_09g029575        86.3    2e-18   
dbj|BAJ85631.1|  predicted protein                                    86.7    2e-18   
emb|CDP02010.1|  unnamed protein product                              86.3    2e-18   
ref|XP_002509493.1|  transcription factor, putative                   85.9    2e-18   
ref|XP_009143738.1|  PREDICTED: protein RADIALIS-like 3               85.9    3e-18   
ref|XP_008810736.1|  PREDICTED: protein RADIALIS-like 3               86.7    3e-18   
gb|EMT00143.1|  DnaJ homolog subfamily C member 2                     86.3    3e-18   
gb|EMS66288.1|  DnaJ homolog subfamily C member 2                     86.3    3e-18   
gb|ADZ73427.1|  MYB transcription factor                              85.5    3e-18   
ref|XP_009791349.1|  PREDICTED: protein RADIALIS-like 5               86.3    3e-18   
ref|XP_002869031.1|  At4g36570                                        85.9    3e-18   
gb|KGN62599.1|  hypothetical protein Csa_2G361640                     86.3    3e-18   
ref|XP_004231423.1|  PREDICTED: transcription factor RADIALIS         85.9    3e-18   
ref|XP_010523610.1|  PREDICTED: protein RADIALIS-like 6               85.9    3e-18   
ref|XP_003611998.1|  MYB transcription factor MYB164                  86.3    3e-18   
ref|XP_006340632.1|  PREDICTED: protein RADIALIS-like 6-like          85.5    3e-18   
emb|CDY15877.1|  BnaA04g12340D                                        87.0    4e-18   
ref|XP_009400078.1|  PREDICTED: protein RADIALIS-like 4 isoform X3    85.5    4e-18   
gb|ABI14755.1|  myb-like protein RL2                                  85.1    4e-18   
ref|XP_010679739.1|  PREDICTED: protein RADIALIS-like 1               85.5    4e-18   
ref|XP_006411987.1|  hypothetical protein EUTSA_v10026710mg           85.5    4e-18   
ref|XP_007163428.1|  hypothetical protein PHAVU_001G233900g           85.5    4e-18   
ref|XP_006423270.1|  hypothetical protein CICLE_v10029663mg           85.5    4e-18   
ref|XP_009390408.1|  PREDICTED: protein RADIALIS-like 3               85.5    5e-18   
ref|XP_009400077.1|  PREDICTED: protein RADIALIS-like 4 isoform X2    85.5    5e-18   
dbj|BAB90737.1|  hypothetical protein                                 85.5    5e-18   
ref|XP_008444713.1|  PREDICTED: protein RADIALIS-like 4               85.5    5e-18   
gb|KDP24350.1|  hypothetical protein JCGZ_25646                       86.3    6e-18   
ref|XP_002307660.2|  myb family transcription factor family protein   85.1    7e-18   
ref|XP_009109324.1|  PREDICTED: protein RADIALIS-like 3               84.7    7e-18   
ref|XP_009419867.1|  PREDICTED: protein RADIALIS-like 3               84.7    7e-18   
ref|XP_003598418.1|  RADIALIS                                         85.1    7e-18   
gb|EYU32780.1|  hypothetical protein MIMGU_mgv1a024989mg              85.5    7e-18   
ref|XP_009400076.1|  PREDICTED: protein RADIALIS-like 4 isoform X1    85.1    8e-18   
ref|NP_001043662.1|  Os01g0635200                                     84.7    9e-18   
ref|XP_002458271.1|  hypothetical protein SORBIDRAFT_03g030330        84.7    9e-18   
gb|KHG24713.1|  DnaJ subfamily C member 1                             84.3    9e-18   
ref|XP_011088407.1|  PREDICTED: protein RADIALIS-like 4               84.7    1e-17   
ref|XP_009396625.1|  PREDICTED: protein RADIALIS-like 3               85.9    1e-17   
ref|XP_002884127.1|  DNA binding protein                              84.3    1e-17   
ref|XP_009586717.1|  PREDICTED: protein RADIALIS-like 5               84.7    1e-17   
gb|EYU40174.1|  hypothetical protein MIMGU_mgv1a019621mg              83.6    1e-17   
gb|EAY75088.1|  hypothetical protein OsI_02982                        84.0    2e-17   
ref|XP_006298896.1|  hypothetical protein CARUB_v10015016mg           83.6    2e-17   
ref|XP_004151116.1|  PREDICTED: transcription factor RADIALIS-like    83.6    2e-17   
ref|XP_010446777.1|  PREDICTED: protein RADIALIS-like 3               83.6    2e-17   
ref|XP_004173942.1|  PREDICTED: protein RADIALIS-like 6-like          84.0    2e-17   
ref|XP_009389415.1|  PREDICTED: protein RADIALIS-like 3               83.6    2e-17   
ref|XP_011088399.1|  PREDICTED: transcription factor RADIALIS-like    83.6    2e-17   
gb|KEH36162.1|  MYB family transcription factor                       83.2    3e-17   
ref|XP_006435008.1|  hypothetical protein CICLE_v10003620mg           83.6    3e-17   
gb|KFK40224.1|  hypothetical protein AALP_AA3G346800                  83.2    3e-17   
ref|XP_009102249.1|  PREDICTED: protein RADIALIS-like 4               83.2    3e-17   
gb|EYU37803.1|  hypothetical protein MIMGU_mgv1a024317mg              83.2    3e-17   
ref|XP_004230980.1|  PREDICTED: protein RADIALIS-like 4               83.2    4e-17   
ref|XP_006365108.1|  PREDICTED: transcription factor RADIALIS-like    83.2    4e-17   
ref|XP_010523611.1|  PREDICTED: protein RADIALIS-like 6               82.8    4e-17   
ref|XP_009378510.1|  PREDICTED: protein RADIALIS-like 1               82.8    4e-17   
ref|XP_006365112.1|  PREDICTED: protein RADIALIS-like 5-like          82.8    4e-17   
ref|XP_008675304.1|  PREDICTED: protein RADIALIS-like 3               83.6    4e-17   
ref|XP_010029804.1|  PREDICTED: protein RADIALIS-like 6               82.8    6e-17   
ref|XP_008447024.1|  PREDICTED: protein RADIALIS-like 1               82.4    6e-17   
gb|ABN08550.1|  Homeodomain-related                                   82.4    6e-17   
tpg|DAA58425.1|  TPA: putative MYB DNA-binding domain superfamily...  83.6    7e-17   
ref|XP_008782490.1|  PREDICTED: protein RADIALIS-like 5 isoform X2    82.0    7e-17   
gb|EYU42614.1|  hypothetical protein MIMGU_mgv1a021827mg              82.0    8e-17   
ref|XP_006409166.1|  hypothetical protein EUTSA_v10023187mg           82.4    8e-17   
ref|XP_010432165.1|  PREDICTED: protein RADIALIS-like 3               81.6    9e-17   
ref|XP_002313044.2|  hypothetical protein POPTR_0009s11990g           82.8    1e-16   
ref|XP_006341944.1|  PREDICTED: protein RADIALIS-like 1-like          82.0    1e-16   
gb|KDP46261.1|  hypothetical protein JCGZ_10101                       82.0    1e-16   
ref|NP_001148292.1|  SANT/MYB protein                                 81.6    1e-16   
ref|XP_009405682.1|  PREDICTED: protein RADIALIS-like 3               81.6    1e-16   
ref|XP_011092801.1|  PREDICTED: protein RADIALIS-like 1               81.6    1e-16   
gb|KGN44080.1|  hypothetical protein Csa_7G170600                     81.3    1e-16   
gb|EEE55045.1|  hypothetical protein OsJ_02736                        81.3    2e-16   
ref|XP_004969431.1|  PREDICTED: protein RADIALIS-like 3-like          81.3    2e-16   
gb|KHN41254.1|  hypothetical protein glysoja_017298                   81.3    2e-16   
ref|XP_008447025.1|  PREDICTED: protein RADIALIS-like 1               80.9    2e-16   
emb|CDY46299.1|  BnaA07g02020D                                        80.9    2e-16   
ref|XP_004238300.1|  PREDICTED: protein RADIALIS-like 3               81.3    2e-16   
ref|XP_003527513.1|  PREDICTED: protein RADIALIS-like 1-like isof...  81.3    2e-16   
gb|AHB59612.1|  putative MYB-related protein 26                       80.9    2e-16   
ref|XP_006840264.1|  hypothetical protein AMTR_s00045p00040070        81.3    3e-16   
ref|XP_006582375.1|  PREDICTED: protein RADIALIS-like 1-like isof...  81.6    4e-16   
ref|XP_006646177.1|  PREDICTED: protein RADIALIS-like 3-like          80.5    4e-16   
gb|KHN45858.1|  hypothetical protein glysoja_023081                   80.1    4e-16   
ref|XP_010531038.1|  PREDICTED: protein RADIALIS-like 3               80.1    4e-16   
ref|XP_010414205.1|  PREDICTED: protein RADIALIS-like 4               80.1    5e-16   
gb|ABH02889.1|  MYB transcription factor MYB97                        80.1    5e-16   
ref|XP_003554832.1|  PREDICTED: transcription factor RADIALIS-like    79.7    5e-16   
ref|XP_010467643.1|  PREDICTED: protein RADIALIS-like 4               79.7    5e-16   
ref|XP_009337308.1|  PREDICTED: transcription factor DIVARICATA-like  83.2    6e-16   
ref|XP_009346883.1|  PREDICTED: transcription factor DIVARICATA-like  83.2    6e-16   
ref|XP_008349577.1|  PREDICTED: transcription factor DIVARICATA-like  83.2    6e-16   
ref|XP_007150886.1|  hypothetical protein PHAVU_004G002400g           79.3    8e-16   
gb|KHN19694.1|  DnaJ like subfamily C member 2                        79.3    8e-16   
ref|XP_008447026.1|  PREDICTED: protein RADIALIS-like 1               79.0    1e-15   
ref|XP_004501008.1|  PREDICTED: protein RADIALIS-like 1-like          79.3    1e-15   
ref|XP_008810724.1|  PREDICTED: protein RADIALIS-like 4               78.6    1e-15   
ref|XP_006288437.1|  hypothetical protein CARUB_v10001695mg           82.0    1e-15   
gb|KGN44073.1|  hypothetical protein Csa_7G168060                     79.0    1e-15   
ref|XP_004151125.1|  PREDICTED: transcription factor RADIALIS-like    78.6    1e-15   
ref|XP_003522889.2|  PREDICTED: protein RADIALIS-like 1-like          79.3    1e-15   
gb|KHN17912.1|  hypothetical protein glysoja_017963                   79.0    2e-15   
ref|XP_004150820.1|  PREDICTED: transcription factor RADIALIS-like    78.6    2e-15   
gb|KHN12318.1|  hypothetical protein glysoja_034410                   78.6    2e-15   
gb|EYU45166.1|  hypothetical protein MIMGU_mgv1a021320mg              78.6    2e-15   
gb|ABH02926.1|  MYB transcription factor MYB137                       79.0    2e-15   
gb|KEH34188.1|  MYB transcription factor MYB51                        81.6    3e-15   
ref|XP_010256655.1|  PREDICTED: transcription factor DIVARICATA-like  81.6    3e-15   
ref|XP_003537461.1|  PREDICTED: protein RADIALIS-like 6-like          79.3    3e-15   
gb|KHN22248.1|  hypothetical protein glysoja_022004                   77.4    4e-15   
ref|XP_002454420.1|  hypothetical protein SORBIDRAFT_04g030510        77.8    4e-15   
ref|XP_008460938.1|  PREDICTED: protein RADIALIS-like 2               78.2    4e-15   
ref|XP_010452485.1|  PREDICTED: transcription factor DIVARICATA-like  80.1    5e-15   
ref|NP_196198.1|  duplicated SANT DNA-binding domain-containing p...  80.5    5e-15   
ref|XP_010491116.1|  PREDICTED: transcription factor DIVARICATA-like  80.1    6e-15   
ref|XP_010423428.1|  PREDICTED: transcription factor DIVARICATA-like  80.1    6e-15   
ref|XP_003538252.1|  PREDICTED: transcription factor DIVARICATA       80.5    6e-15   
ref|XP_003624937.1|  hypothetical protein MTR_7g089210                77.0    6e-15   
ref|XP_009407033.1|  PREDICTED: protein RADIALIS-like 4               77.8    7e-15   
ref|XP_004499797.1|  PREDICTED: protein RADIALIS-like 1-like          77.0    7e-15   
gb|KHN07576.1|  hypothetical protein glysoja_019683                   77.0    8e-15   
ref|XP_002456019.1|  hypothetical protein SORBIDRAFT_03g028950        77.0    8e-15   
ref|XP_004490951.1|  PREDICTED: transcription factor DIVARICATA-like  79.3    1e-14   
ref|XP_009588768.1|  PREDICTED: protein RADIALIS-like 3               76.6    1e-14   
ref|XP_007146740.1|  hypothetical protein PHAVU_006G065700g           79.3    1e-14   
gb|KHN46169.1|  Transcription factor MYB1R1                           79.0    1e-14   
ref|XP_009396744.1|  PREDICTED: protein RADIALIS-like 3               75.5    2e-14   
ref|XP_010262772.1|  PREDICTED: transcription factor DIVARICATA-like  79.0    2e-14   
ref|XP_004148844.1|  PREDICTED: transcription factor RADIALIS-like    76.3    2e-14   
gb|ACR09746.1|  DIV1A protein                                         79.0    2e-14   
ref|XP_003519244.1|  PREDICTED: transcription factor DIVARICATA       79.0    2e-14   
ref|XP_003551300.1|  PREDICTED: transcription factor DIVARICATA-like  79.3    2e-14   
gb|KHN13083.1|  Transcription factor MYB1R1                           79.0    2e-14   
ref|XP_006574483.1|  PREDICTED: MYB transcription factor MYB83 is...  79.0    2e-14   
ref|XP_002866297.1|  myb family transcription factor                  78.6    2e-14   
dbj|BAK05134.1|  predicted protein                                    75.5    2e-14   
ref|XP_010535415.1|  PREDICTED: transcription factor DIVARICATA i...  77.4    2e-14   
ref|XP_009374277.1|  PREDICTED: transcription factor DIVARICATA-like  78.6    2e-14   
emb|CDY29227.1|  BnaA06g25300D                                        75.5    2e-14   
ref|XP_010535414.1|  PREDICTED: transcription factor DIVARICATA i...  78.2    2e-14   
ref|NP_200698.1|  homeodomain-like transcriptional regulator          78.6    2e-14   
ref|XP_004302668.1|  PREDICTED: transcription factor DIVARICATA-like  78.6    3e-14   
ref|XP_003615578.1|  DnaJ homolog subfamily C member                  78.6    3e-14   
gb|EMS46581.1|  hypothetical protein TRIUR3_05650                     75.5    3e-14   
ref|XP_007046916.1|  RAD-like 6                                       76.6    3e-14   
ref|XP_009120398.1|  PREDICTED: transcription factor DIVARICATA       78.2    3e-14   
ref|XP_004490575.1|  PREDICTED: transcription factor DIVARICATA-like  78.2    3e-14   
ref|XP_004173613.1|  PREDICTED: transcription factor DIVARICATA-like  77.4    3e-14   
ref|XP_002873224.1|  myb family transcription factor                  77.8    3e-14   
gb|KHN30676.1|  Transcription factor MYB1R1                           78.6    3e-14   
ref|XP_004500230.1|  PREDICTED: transcription factor DIVARICATA-l...  78.6    3e-14   
ref|XP_007141798.1|  hypothetical protein PHAVU_008G226600g           78.2    4e-14   
ref|XP_009150735.1|  PREDICTED: protein RADIALIS-like 4               74.7    4e-14   
gb|KHN40049.1|  Transcription factor MYB1R1                           78.2    4e-14   
ref|XP_008463216.1|  PREDICTED: transcription factor DIVARICATA       77.8    4e-14   
ref|XP_006573343.1|  PREDICTED: transcription factor DIVARICATA-l...  78.2    4e-14   
gb|KFK25008.1|  hypothetical protein AALP_AA8G054600                  77.4    4e-14   
gb|AFX97759.1|  DNA binding protein                                   74.3    4e-14   
gb|ABH02903.1|  MYB transcription factor MYB51                        77.4    5e-14   
ref|NP_001240137.1|  MYB transcription factor MYB51                   77.8    5e-14   
ref|XP_003516340.1|  PREDICTED: transcription factor DIVARICATA-l...  78.2    5e-14   
ref|NP_001267652.1|  transcription factor DIVARICATA-like             77.8    5e-14   
gb|EAY87222.1|  hypothetical protein OsI_08624                        74.7    5e-14   
gb|KHN02156.1|  Transcription factor MYB1R1                           77.8    5e-14   
ref|XP_006401027.1|  hypothetical protein EUTSA_v10014270mg           77.8    5e-14   
ref|XP_004294268.1|  PREDICTED: transcription factor DIVARICATA-like  77.8    5e-14   
ref|XP_006573344.1|  PREDICTED: transcription factor DIVARICATA-l...  77.8    5e-14   
ref|NP_001047870.1|  Os02g0706400                                     74.7    5e-14   
gb|KHN45529.1|  Transcription factor MYB1R1                           77.8    5e-14   



>ref|XP_009771192.1| PREDICTED: protein RADIALIS-like 3 [Nicotiana sylvestris]
Length=89

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 79/90 (88%), Gaps = 2/90 (2%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            MASWT +QNKKFEEALA++DKETPDRWH IAR V GKS EEVRR YE+L KDIMQIEN +
Sbjct  1    MASWTTRQNKKFEEALALFDKETPDRWHNIARCVGGKSAEEVRRHYELLLKDIMQIENGQ  60

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            VPLPNY+A  S+SRG+A NEQRLL+NLKL+
Sbjct  61   VPLPNYKAVGSNSRGYA-NEQRLLKNLKLQ  89



>ref|XP_011083673.1| PREDICTED: protein RADIALIS-like 3 [Sesamum indicum]
Length=101

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 78/89 (88%), Gaps = 2/89 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEV  298
            ++WT+KQNK+FEEALA+YDK+TPDRWH IAR VG KS EEVRR YEIL KDIMQIE D+V
Sbjct  14   SAWTSKQNKQFEEALAMYDKDTPDRWHNIARAVGGKSAEEVRRHYEILVKDIMQIETDQV  73

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKLR  385
            P+PNYRA  S+SRG+  NEQRLL+NLKL+
Sbjct  74   PIPNYRAMGSNSRGYG-NEQRLLKNLKLQ  101



>ref|XP_009616919.1| PREDICTED: protein RADIALIS-like 6 isoform X1 [Nicotiana tomentosiformis]
Length=88

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 77/90 (86%), Gaps = 3/90 (3%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            MASWT +QNKKFEEALA++DKETPDRWH IAR V GKS EEVRR YE+L KDIMQIEN  
Sbjct  1    MASWTTRQNKKFEEALALFDKETPDRWHNIARCVGGKSAEEVRRHYELLVKDIMQIENGH  60

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            VPLPNY+A ES+SR   +NEQRLL+NLKLR
Sbjct  61   VPLPNYKAVESNSR--YANEQRLLKNLKLR  88



>ref|XP_009611761.1| PREDICTED: protein RADIALIS-like 5 [Nicotiana tomentosiformis]
Length=89

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (86%), Gaps = 2/90 (2%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDE  295
            MA+WTAKQNKKFEEALA+YDK+T DRW+ IAR VG KS EEVRR YE+L KDIMQIEND+
Sbjct  1    MATWTAKQNKKFEEALALYDKDTSDRWNNIARCVGGKSAEEVRRHYELLVKDIMQIENDQ  60

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            VPLPNYR   S  RG+A NEQRL++NLKL+
Sbjct  61   VPLPNYRTAGSDGRGYA-NEQRLMKNLKLQ  89



>ref|XP_009761204.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana sylvestris]
Length=89

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 76/90 (84%), Gaps = 2/90 (2%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDE  295
            MA+WTAKQNKKFEEALA+YDK+T DRW+ IAR VG KS EEVRR YE+L KDIMQIEND+
Sbjct  1    MANWTAKQNKKFEEALALYDKDTCDRWNNIARCVGGKSAEEVRRHYELLVKDIMQIENDQ  60

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            VPLPNYR   S  R +A NEQRL++NLKL+
Sbjct  61   VPLPNYRTAGSDGRSYA-NEQRLMKNLKLQ  89



>ref|XP_004252792.1| PREDICTED: protein RADIALIS-like 3 [Solanum lycopersicum]
Length=88

 Score =   132 bits (331),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDE  295
            MA+WT  QNKKFEEALA++DK+TPDRWH IAR VG KS EEV+R YE+L KD+MQIEND+
Sbjct  1    MANWTKNQNKKFEEALALFDKDTPDRWHNIARCVGGKSAEEVKRHYELLVKDVMQIENDQ  60

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKL  382
            VPLPNYR   S+ R + SNEQRL++NL+L
Sbjct  61   VPLPNYRGASSNGRSY-SNEQRLMQNLRL  88



>emb|CDP07503.1| unnamed protein product [Coffea canephora]
Length=101

 Score =   132 bits (332),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 2/87 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK+FEEALA YDK+TPDRW+ IAR VG KS EEVRR YE+L KDIMQIE+D+VPL
Sbjct  16   WTAKQNKQFEEALATYDKDTPDRWYNIARAVGGKSEEEVRRHYEVLVKDIMQIESDQVPL  75

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNYR+  S+ RG+A NEQRLL+NLKL+
Sbjct  76   PNYRSMASNGRGYA-NEQRLLKNLKLQ  101



>ref|XP_009607881.1| PREDICTED: protein RADIALIS-like 5 [Nicotiana tomentosiformis]
Length=89

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 2/90 (2%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            MASWT KQ K+FEEALA+YD++TPDRWH IAR V GKS EEVRR YE+L KDIMQI+ND+
Sbjct  1    MASWTTKQKKRFEEALALYDRDTPDRWHNIARSVGGKSAEEVRRHYELLLKDIMQIKNDQ  60

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            VPLP Y+  +++ RG+A NEQRLL+NLKL+
Sbjct  61   VPLPKYKPAQTNVRGYA-NEQRLLKNLKLQ  89



>ref|XP_004238608.1| PREDICTED: protein RADIALIS-like 6 [Solanum lycopersicum]
Length=91

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 77/91 (85%), Gaps = 2/91 (2%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            MASWTA+QNKKFEEALA+YD++TPDRWH IAR V GKS  EV+R YE+L KDIMQIEN +
Sbjct  1    MASWTARQNKKFEEALALYDRDTPDRWHNIARCVGGKSAAEVKRHYEVLVKDIMQIENGQ  60

Query  296  VPLPNYR-ATESSSRGFASNEQRLLRNLKLR  385
            VPLPNY+ A E+++R   +NE RLL+NLKL+
Sbjct  61   VPLPNYKAAAETNNRSGYANEHRLLKNLKLQ  91



>ref|XP_006342582.1| PREDICTED: protein RADIALIS-like 6-like [Solanum tuberosum]
Length=88

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            MA+WT  QNKKFEEALA++DK+TPDRWH IAR V GKS EEV+R YE+L KD+M+IEND+
Sbjct  1    MANWTKNQNKKFEEALALFDKDTPDRWHNIARCVGGKSAEEVKRHYELLVKDVMKIENDQ  60

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKL  382
            VPLPNYR   S+ R +A NEQRL++NL+L
Sbjct  61   VPLPNYRGASSNGRSYA-NEQRLMQNLRL  88



>ref|XP_009774057.1| PREDICTED: protein RADIALIS-like 5 [Nicotiana sylvestris]
Length=89

 Score =   130 bits (326),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 2/90 (2%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            M SWT KQNK+FEEALA+YD++TPDRWH IAR V GKS EEVRR Y++L KDIMQIEND+
Sbjct  1    MGSWTTKQNKRFEEALALYDRDTPDRWHNIARSVGGKSAEEVRRHYKLLLKDIMQIENDQ  60

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            VPLP Y+  +++ R +A NEQRLL+NLKL+
Sbjct  61   VPLPKYKPAQTNVRAYA-NEQRLLKNLKLQ  89



>ref|XP_006341953.1| PREDICTED: protein RADIALIS-like 6-like [Solanum tuberosum]
Length=91

 Score =   129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 76/91 (84%), Gaps = 2/91 (2%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            MASWT++QNKKFEEALA+YD++TPDRWH IAR V GKS  EV+R Y +L KDIMQIEN +
Sbjct  1    MASWTSRQNKKFEEALALYDRDTPDRWHNIARCVGGKSAAEVKRHYGVLVKDIMQIENGQ  60

Query  296  VPLPNYR-ATESSSRGFASNEQRLLRNLKLR  385
            VPLPNY+ A E++SR   +NE RLL+NLKL+
Sbjct  61   VPLPNYKAAAETNSRSGYANEHRLLKNLKLQ  91



>ref|XP_009616920.1| PREDICTED: protein RADIALIS-like 6 isoform X2 [Nicotiana tomentosiformis]
Length=82

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 72/90 (80%), Gaps = 9/90 (10%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            MASWT +QNKKFEEALA++DKETPDRWH IAR V GKS EEVRR YE+L KDIMQIEN  
Sbjct  1    MASWTTRQNKKFEEALALFDKETPDRWHNIARCVGGKSAEEVRRHYELLVKDIMQIENGH  60

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            VPLPNY+A ES+S        RLL+NLKLR
Sbjct  61   VPLPNYKAVESNS--------RLLKNLKLR  82



>ref|XP_011074553.1| PREDICTED: protein RADIALIS-like 3 [Sesamum indicum]
Length=100

 Score =   124 bits (311),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 74/87 (85%), Gaps = 3/87 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK+FE+ALA+YDK+TPDRWH IAR V GK+ EEVRR YE LEKDIM+IE D+VP+
Sbjct  16   WTPKQNKQFEDALAMYDKDTPDRWHNIARAVSGKTAEEVRRHYEALEKDIMKIETDQVPI  75

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNY+A  ++ RG+  NEQRLL+NLKL+
Sbjct  76   PNYKAM-ANGRGYG-NEQRLLKNLKLQ  100



>gb|EYU32775.1| hypothetical protein MIMGU_mgv1a016932mg [Erythranthe guttata]
Length=100

 Score =   121 bits (304),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 75/86 (87%), Gaps = 3/86 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK+FEEA+A++D++TPDRWH IAR V GKS EEVRR YE LEKDIM+IE D+VP+
Sbjct  17   WTAKQNKQFEEAIAMFDRDTPDRWHNIARQVSGKSAEEVRRHYEALEKDIMKIETDQVPI  76

Query  305  PNYRATESSSRGFASNEQRLLRNLKL  382
            PNY++  S++RG+ SN+ RL++NLKL
Sbjct  77   PNYKSI-SNARGY-SNDHRLMKNLKL  100



>ref|XP_006339257.1| PREDICTED: protein RADIALIS-like 1-like [Solanum tuberosum]
Length=93

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 78/94 (83%), Gaps = 5/94 (5%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKET-PDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIEN  289
            +  +WT KQNKKFEEA+ +YDK+   ++WH IARYVG KS+EEVRR Y++L KDI QIEN
Sbjct  1    MATNWTTKQNKKFEEAIVMYDKDNNGEKWHNIARYVGGKSVEEVRRHYDLLIKDITQIEN  60

Query  290  DEVPLPNYRAT--ESSSRGFASNEQRLLRNLKLR  385
            D+VPLPNYR T  ++++RG+A NEQRLL+NLKL+
Sbjct  61   DQVPLPNYRTTSDQTNARGYA-NEQRLLKNLKLQ  93



>gb|EYU45174.1| hypothetical protein MIMGU_mgv1a024515mg [Erythranthe guttata]
Length=99

 Score =   120 bits (300),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 3/84 (4%)
 Frame = +2

Query  137  KQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPLPNY  313
            KQNK+FEEALA YDKETPDRWH IAR V GKS +EVRR YE L KDIMQIE D+VP+PNY
Sbjct  17   KQNKQFEEALAKYDKETPDRWHNIARSVGGKSADEVRRHYEALVKDIMQIETDQVPIPNY  76

Query  314  RATESSSRGFASNEQRLLRNLKLR  385
            RA  +++RG+ SNEQRL++NLKL+
Sbjct  77   RAI-ANTRGY-SNEQRLMKNLKLQ  98



>ref|XP_004249320.1| PREDICTED: protein RADIALIS-like 1 [Solanum lycopersicum]
Length=93

 Score =   119 bits (298),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 77/94 (82%), Gaps = 5/94 (5%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKET-PDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIEN  289
            +  +WT KQNKKFEEAL +YDK+   ++WH IARYVG KS+EEVRR Y++L KDI QIEN
Sbjct  1    MSQNWTTKQNKKFEEALVMYDKDNNGEKWHNIARYVGGKSVEEVRRHYDLLLKDITQIEN  60

Query  290  DEVPLPNYRAT--ESSSRGFASNEQRLLRNLKLR  385
             +VPLPNYR T  ++++RG+A NEQRLL+NLKL+
Sbjct  61   GQVPLPNYRTTSDQTNARGYA-NEQRLLKNLKLQ  93



>ref|XP_009605567.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana tomentosiformis]
Length=94

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 4/94 (4%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETP-DRWHKIARYVG-KSIEEVRRQYEILEKDIMQIEN  289
            +  +WT KQNK+FEEAL +YDK T  +RW  IA+YVG KS+EEV+R YE+L KDI QIEN
Sbjct  1    MATNWTTKQNKRFEEALVMYDKGTSSERWQNIAKYVGGKSVEEVKRHYELLVKDITQIEN  60

Query  290  DEVPLPNYRAT--ESSSRGFASNEQRLLRNLKLR  385
             +VPLPNYR T  ES++RG  +NEQRLL+NL L+
Sbjct  61   GQVPLPNYRTTTAESNARGGYANEQRLLKNLSLQ  94



>emb|CAN68999.1| hypothetical protein VITISV_033596 [Vitis vinifera]
Length=96

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FEEALA+YDK+TPDRW+ +AR VG K++EEV+R YEIL +DI  I++D+VP 
Sbjct  10   WTAKQNKAFEEALAVYDKDTPDRWYNVARAVGGKTVEEVKRHYEILVEDIKSIDSDKVPF  69

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNY+ T +SSR   S++++ + NLKLR
Sbjct  70   PNYKTTGASSRSNMSDQEKRMMNLKLR  96



>ref|XP_003631660.1| PREDICTED: protein RADIALIS-like 1 [Vitis vinifera]
Length=101

 Score =   114 bits (286),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FEEALA+YDK+TPDRW+ +AR VG K++EEV+R YEIL +DI  I++D+VP 
Sbjct  15   WTAKQNKAFEEALAVYDKDTPDRWYNVARAVGGKTVEEVKRHYEILVEDIKSIDSDKVPF  74

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNY+ T +S R   S++++ + NLKLR
Sbjct  75   PNYKTTGASGRSNMSDQEKRMMNLKLR  101



>emb|CBI32595.3| unnamed protein product [Vitis vinifera]
Length=111

 Score =   114 bits (286),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FEEALA+YDK+TPDRW+ +AR VG K++EEV+R YEIL +DI  I++D+VP 
Sbjct  25   WTAKQNKAFEEALAVYDKDTPDRWYNVARAVGGKTVEEVKRHYEILVEDIKSIDSDKVPF  84

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNY+ T +S R   S++++ + NLKLR
Sbjct  85   PNYKTTGASGRSNMSDQEKRMMNLKLR  111



>ref|XP_008220818.1| PREDICTED: protein RADIALIS-like 6 [Prunus mume]
Length=97

 Score =   114 bits (284),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE+ALA+YDK+T DRWH +A+ VG KS+EEV+R YEIL +D+M IE+ +VP+
Sbjct  12   WTPKQNKLFEKALAVYDKDTQDRWHNVAKAVGGKSVEEVKRHYEILVQDLMHIESGQVPI  71

Query  305  PNYRATESSSRGFASNEQRLLRNLKL  382
            PNY+ T SS      +EQRL++NLK+
Sbjct  72   PNYKGTGSSGSRGIGDEQRLMKNLKI  97



>ref|XP_010254802.1| PREDICTED: protein RADIALIS-like 3 [Nelumbo nucifera]
Length=99

 Score =   114 bits (284),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE+ALA+YDK+TPDRWH +AR VG KS EEV+R YEIL +D+  IE+ +VP 
Sbjct  13   WTPKQNKLFEKALALYDKDTPDRWHNVARAVGGKSAEEVKRHYEILIEDLKYIESGQVPF  72

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNYR++ S S+G    EQRLL+ LKL+
Sbjct  73   PNYRSSGSHSKGIGDEEQRLLKYLKLQ  99



>ref|XP_009796752.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana sylvestris]
Length=95

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 74/95 (78%), Gaps = 5/95 (5%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETP-DRWHKIARYVG-KSIEEVRRQYEILEKDIMQIEN  289
            + ++WT KQNK+FEEAL +YDK T  +R   IA+YVG KS+EEVRR Y++L KDI QIEN
Sbjct  1    MASNWTTKQNKRFEEALVMYDKGTSSERLQNIAKYVGGKSVEEVRRHYDLLVKDITQIEN  60

Query  290  DEVPLPNYRAT---ESSSRGFASNEQRLLRNLKLR  385
             +VPLPNYR T   E+++RG  +NEQRLL+NL L+
Sbjct  61   GQVPLPNYRTTTTAETNARGRYANEQRLLKNLSLQ  95



>ref|XP_004291870.1| PREDICTED: protein RADIALIS-like 6-like [Fragaria vesca subsp. 
vesca]
Length=101

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 69/87 (79%), Gaps = 2/87 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE+ALA+YDK+T DRWH +A+ V GKS EEV+R YEIL +D+M IE+ +V +
Sbjct  15   WTPKQNKLFEKALAVYDKDTQDRWHNVAKAVGGKSAEEVKRHYEILVQDLMHIESGQVAI  74

Query  305  PNYRATE-SSSRGFASNEQRLLRNLKL  382
            PNYR T  SSSRG A  EQRL++NLK+
Sbjct  75   PNYRTTTGSSSRGNADYEQRLMKNLKI  101



>ref|XP_011028852.1| PREDICTED: protein RADIALIS-like 5 [Populus euphratica]
Length=99

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 2/89 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEV  298
            +SWTAKQNK FE+ALA+YDK+TPDRW  +A+ VG KS EEV+R Y+ L +D++ IE+ +V
Sbjct  12   SSWTAKQNKLFEKALAVYDKDTPDRWQNVAKAVGSKSAEEVKRHYDRLVEDLVYIESGQV  71

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKLR  385
            PLPNY+ T SS RG    EQRL RNLKL+
Sbjct  72   PLPNYKPTGSSGRGLV-EEQRLTRNLKLQ  99



>ref|XP_009106182.1| PREDICTED: protein RADIALIS-like 6 [Brassica rapa]
 emb|CDX73153.1| BnaC06g36010D [Brassica napus]
Length=95

 Score =   112 bits (280),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK FE ALA+YDK+TPDRWH +A+ VG KS EEV+R Y+IL +D++ IE   V
Sbjct  8    SSWTFKQNKMFERALAVYDKDTPDRWHNVAKAVGGKSAEEVKRHYDILVEDLINIETGRV  67

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKL  382
            PLPNY+  ES+SRG      RL++NLK+
Sbjct  68   PLPNYKTFESNSRGINDFNTRLMKNLKI  95



>ref|XP_009336185.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
Length=97

 Score =   112 bits (280),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 72/95 (76%), Gaps = 7/95 (7%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIEND  292
            + +SWT KQNK FE+ALA+YDK+T DRWH +A  V GK++EEV+R YEIL  D+M IE+ 
Sbjct  4    VSSSWTPKQNKLFEKALAVYDKDTQDRWHNVAEAVGGKTVEEVKRHYEILVHDLMHIESG  63

Query  293  EVPLPNYRATESSS-----RGFASNEQRLLRNLKL  382
            +VP+PNY+A  SS      RGF  +EQRL++NLK+
Sbjct  64   QVPIPNYKAAGSSGSNGSNRGFG-DEQRLMKNLKI  97



>ref|XP_009365547.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
Length=101

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 5/95 (5%)
 Frame = +2

Query  110  RLLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQI  283
            R L +SWT K+NK FE ALA+YDK+T DRWH +A+ V  GK+ EEV+R YEIL  D+M I
Sbjct  8    RNLNSSWTPKENKLFEMALAVYDKDTQDRWHNVAKAVGGGKTAEEVKRHYEILVHDLMHI  67

Query  284  ENDEVPLPNYRAT--ESSSRGFASNEQRLLRNLKL  382
            E+ +VP+PNY++    SS+RGF  +EQRL++NLK+
Sbjct  68   ESGQVPIPNYKSAGGSSSNRGFG-DEQRLMKNLKI  101



>ref|XP_010060956.1| PREDICTED: protein RADIALIS-like 3 [Eucalyptus grandis]
 gb|KCW67855.1| hypothetical protein EUGRSUZ_F01576 [Eucalyptus grandis]
Length=101

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 6/90 (7%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG--KSIEEVRRQYEILEKDIMQIENDEVP  301
            WT  QNK FE ALA+YDK+TPDRWH +AR VG  KS EEV+R+Y++L +D+M IE+ +VP
Sbjct  13   WTPMQNKMFERALALYDKDTPDRWHNVARAVGGNKSAEEVKRRYDMLVQDVMSIESGQVP  72

Query  302  LPNYRATESS---SRGFASNEQRLLRNLKL  382
            LP YRA+ +S   SR  A +EQR+LRNLK+
Sbjct  73   LPKYRASSASYGTSRAMA-DEQRMLRNLKI  101



>ref|XP_010088924.1| DnaJ homolog subfamily C member 2 [Morus notabilis]
 gb|EXB37128.1| DnaJ homolog subfamily C member 2 [Morus notabilis]
Length=95

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            M++WTAKQNK FE+ALA+YDK+TPDRW+ +A+ V GK+ EEV+R YE+L +D+  IE+ +
Sbjct  6    MSTWTAKQNKAFEKALAVYDKDTPDRWYNVAKAVGGKTAEEVKRHYELLLEDVKHIESGQ  65

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            VP P YR T  S++G  + +++ LRNLKL+
Sbjct  66   VPFPYYRTTGGSNQGNTNEDEKRLRNLKLQ  95



>ref|XP_010061304.1| PREDICTED: protein RADIALIS-like 3 isoform X1 [Eucalyptus grandis]
 gb|KCW68235.1| hypothetical protein EUGRSUZ_F01887 [Eucalyptus grandis]
Length=87

 Score =   108 bits (270),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 70/91 (77%), Gaps = 7/91 (8%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIEN  289
            + ASWT +QNK+FEEALA+YD+ TPDRW ++AR V  GKS+EEVRR YE+L +D+++IE+
Sbjct  1    MAASWTREQNKRFEEALALYDENTPDRWQRVARAVGDGKSVEEVRRHYEVLVRDLVRIES  60

Query  290  DEVPLPNYRATESSSRGFASNEQRLLRNLKL  382
             ++PLPNYR ++ S         RLLRN++L
Sbjct  61   GQIPLPNYRGSDQS-----DESSRLLRNMRL  86



>gb|KFK41962.1| hypothetical protein AALP_AA2G194600 [Arabis alpina]
Length=98

 Score =   108 bits (270),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVP  301
            +WT KQNK FE ALA+YDK+TPDRWH +A+ V GK+ EEV+R Y+IL +D++ IE   VP
Sbjct  11   TWTFKQNKMFERALAVYDKDTPDRWHNVAKAVGGKTAEEVKRHYDILVEDLINIETGRVP  70

Query  302  LPNYRAT-ESSSRGFASNEQRLLRNLKL  382
            LPNY+ T ES+SRG    + RL++NLK+
Sbjct  71   LPNYKKTYESNSRGLNDFDSRLMKNLKI  98



>ref|XP_010102066.1| DnaJ homolog subfamily C member 2 [Morus notabilis]
 gb|EXB91916.1| DnaJ homolog subfamily C member 2 [Morus notabilis]
Length=94

 Score =   108 bits (270),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 72/90 (80%), Gaps = 3/90 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WTAKQNK FE ALAIYDK++PDRWH +AR V GK++EEV+R YE+L +D+ +IE  EV
Sbjct  4    STWTAKQNKLFENALAIYDKDSPDRWHNLARAVGGKTVEEVKRHYEMLVEDVNKIEAGEV  63

Query  299  PLPNYRATESSSRGFAS--NEQRLLRNLKL  382
            PLPNYR   ++++ + S  +E++ LRNLKL
Sbjct  64   PLPNYRKIGANNKAYNSFMDEEQRLRNLKL  93



>ref|XP_009364936.1| PREDICTED: protein RADIALIS-like 6 [Pyrus x bretschneideri]
Length=91

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 69/91 (76%), Gaps = 7/91 (8%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE+ALA YDK+T DRWH +A+ V GK++EEV+R YEIL  D+M IE+ +VP+
Sbjct  2    WTPKQNKLFEKALAEYDKDTQDRWHNVAKAVGGKTVEEVKRHYEILVHDLMHIESGQVPI  61

Query  305  PNYRATESSS-----RGFASNEQRLLRNLKL  382
            PNY+A  SS      RGF  +EQRL++NLK+
Sbjct  62   PNYKAAGSSGSNGSNRGFG-DEQRLMKNLKI  91



>ref|XP_002300766.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE80039.1| myb family transcription factor family protein [Populus trichocarpa]
Length=99

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 69/89 (78%), Gaps = 2/89 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWTAKQNK FE+ALA+YDK+TPDRW  +A+ V GKS EEV+R Y+ L +D++ IE+ + 
Sbjct  12   SSWTAKQNKLFEKALAVYDKDTPDRWQNVAKAVGGKSPEEVKRHYDRLVEDLVYIESGQA  71

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKLR  385
            PLPNY+ + S+ RG    EQRL RNLKL+
Sbjct  72   PLPNYKPSGSNGRGLVE-EQRLTRNLKLQ  99



>ref|XP_002510392.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF52579.1| DNA binding protein, putative [Ricinus communis]
Length=95

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK FE ALAIYDK+TPDRWH +AR V GK+IEEV+R YE+L +D+ +IE   V
Sbjct  5    SSWTPKQNKLFENALAIYDKDTPDRWHNLARAVGGKTIEEVKRHYELLVEDVREIEAGHV  64

Query  299  PLPNYRATESSSRGFAS--NEQRLLRNLKLR  385
            PLPNY+     S+G+ S   E++ L+ LKL+
Sbjct  65   PLPNYKKAGLGSKGYCSFVEEEQRLKGLKLQ  95



>ref|XP_011092800.1| PREDICTED: transcription factor RADIALIS-like [Sesamum indicum]
Length=101

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WTAK+NK FE+ALA+YDK+TPDRW  +AR V G++ EEVRR Y+IL +DI  IE+  V
Sbjct  12   SAWTAKENKDFEKALAVYDKDTPDRWANVARAVGGRTEEEVRRHYDILVEDINCIESGRV  71

Query  299  PLPNYRATESSSRGFA-SNEQRLLRNLKLR  385
            P PNYR T SS  G+  +NE++ ++NLKL+
Sbjct  72   PFPNYRTTSSSGGGYMRNNEEQRMKNLKLQ  101



>ref|XP_002282280.1| PREDICTED: protein RADIALIS-like 3 [Vitis vinifera]
 emb|CBI19708.3| unnamed protein product [Vitis vinifera]
Length=102

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FEEALA+YDK TPDRW  IA+ VG KS EEV+R YEILE+D+M IEN +VPL
Sbjct  16   WTQKQNKLFEEALALYDKNTPDRWANIAKAVGGKSAEEVKRHYEILEQDVMHIENGQVPL  75

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            P YR+T SSS G    ++ LL+NLKLR
Sbjct  76   PIYRSTGSSSGGSVDEQRHLLKNLKLR  102



>ref|XP_006390328.1| hypothetical protein EUTSA_v10019367mg [Eutrema salsugineum]
 gb|ESQ27614.1| hypothetical protein EUTSA_v10019367mg [Eutrema salsugineum]
Length=97

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE ALA+YDK+TPDRWH +A  VG KS EEV+R Y+IL +D++ IE   VPL
Sbjct  12   WTFKQNKMFERALAVYDKDTPDRWHNVANAVGGKSAEEVKRHYDILVEDLISIETGRVPL  71

Query  305  PNYRATESSSRGFASNEQRLLRNLKL  382
            PNY+  ES+SR       RL++NLK+
Sbjct  72   PNYKTFESNSRAINDFNTRLMKNLKI  97



>ref|XP_009117377.1| PREDICTED: protein RADIALIS-like 2 [Brassica rapa]
Length=100

 Score =   106 bits (264),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
             SWT KQNK FE ALA YD++TPDRW+ +AR VG +  +E +RQY+IL +DI  IEN  V
Sbjct  12   GSWTVKQNKAFERALATYDEDTPDRWYNVARAVGGTTPDEAKRQYDILVRDIESIENGHV  71

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKLR  385
            P PNY+ T  S++G   +E++ +RN+KL+
Sbjct  72   PFPNYKTTGGSTKGRLRDEEKRMRNMKLQ  100



>ref|XP_003631666.1| PREDICTED: protein RADIALIS-like 3 [Vitis vinifera]
 emb|CBI32600.3| unnamed protein product [Vitis vinifera]
Length=96

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +2

Query  110  RLLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIE  286
            R+    WT+KQNK FE+ALA+YDK+TPDRW  +A+ V GKS EEV+R YEIL +D+  IE
Sbjct  6    RMGSGLWTSKQNKLFEKALALYDKDTPDRWQNVAKAVGGKSAEEVKRHYEILIEDLKHIE  65

Query  287  NDEVPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            +  VP+PNY++T S+S G    EQRLL+ +KL+
Sbjct  66   SGHVPIPNYKSTGSNSIG--DQEQRLLKCIKLQ  96



>ref|NP_001077825.1| protein RADIALIS-like 6 [Arabidopsis thaliana]
 sp|Q1A173.1|RADL6_ARATH RecName: Full=Protein RADIALIS-like 6; Short=AtRL6; Short=Protein 
RAD-like 6; AltName: Full=Protein RADIALIS-LIKE SANT/MYB 
3; Short=Protein RSM3 [Arabidopsis thaliana]
 gb|ABD24442.1| RAD-like protein 6 [Arabidopsis thaliana]
 gb|AEE35694.1| protein RADIALIS-like 6 [Arabidopsis thaliana]
Length=97

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +2

Query  110  RLLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIE  286
            R  ++ WT  QNK FE ALA+YDK+TPDRWH +A+ VG K++EEV+R Y+IL +D++ IE
Sbjct  6    RSSISPWTFSQNKMFERALAVYDKDTPDRWHNVAKAVGGKTVEEVKRHYDILVEDLINIE  65

Query  287  NDEVPLPNYRATESSSRGFASNEQRLLRNLKL  382
               VPLPNY+  ES+SR     + R ++NLK+
Sbjct  66   TGRVPLPNYKTFESNSRSINDFDTRKMKNLKI  97



>ref|XP_008388050.1| PREDICTED: protein RADIALIS-like 6 [Malus domestica]
Length=104

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 70/92 (76%), Gaps = 8/92 (9%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE+ALA+YDK+T DRWH +A+ V GK++EEV+R YEIL  D+M IE+ +VP+
Sbjct  14   WTPKQNKLFEKALAVYDKDTQDRWHNVAKAVDGKTVEEVKRHYEILVHDLMHIESGQVPI  73

Query  305  PNYRAT------ESSSRGFASNEQRLLRNLKL  382
            PNY+AT        S+RG   +EQRL++NLK+
Sbjct  74   PNYKATGSSSSSNGSNRGLG-DEQRLMKNLKI  104



>ref|XP_011004014.1| PREDICTED: protein RADIALIS-like 3 [Populus euphratica]
Length=99

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE+ALA+YDK+TPDRW  +A+ V GKS EEV+  Y+ L +D+  IE+ + PL
Sbjct  14   WTPKQNKLFEKALAVYDKDTPDRWQNVAKAVGGKSAEEVKMHYDRLVEDLTYIESGQAPL  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNY+ + S+SRG A  EQRL+RNLKL+
Sbjct  74   PNYKPSGSNSRGLAE-EQRLMRNLKLQ  99



>ref|XP_009128087.1| PREDICTED: protein RADIALIS-like 6 [Brassica rapa]
Length=96

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT +QNK FE ALA+YDK+TPDRWH +A  V GKS EEV+R Y+IL +D++ IE   VPL
Sbjct  12   WTFRQNKMFERALAVYDKDTPDRWHNVANAVGGKSAEEVKRHYDILVEDLISIETGRVPL  71

Query  305  PNYRATESSSRGFASNEQRLLRNLKL  382
            PNY+ T+S+SRG    + RL++N+K+
Sbjct  72   PNYK-TKSNSRGINDLDTRLMKNMKI  96



>ref|XP_006423283.1| hypothetical protein CICLE_v10029669mg [Citrus clementina]
 ref|XP_006469147.1| PREDICTED: protein RADIALIS-like 6-like [Citrus sinensis]
 gb|ESR36523.1| hypothetical protein CICLE_v10029669mg [Citrus clementina]
 gb|KDO47527.1| hypothetical protein CISIN_1g034427mg [Citrus sinensis]
Length=95

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 71/92 (77%), Gaps = 4/92 (4%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIEN  289
            L ++WT K+NK FE+ALA+YDKETPDRW  IA+ V  GK++EEV++ YEIL  D+ +IE 
Sbjct  6    LSSTWTPKENKLFEKALALYDKETPDRWQNIAKAVGGGKTVEEVKKHYEILVDDLNRIEA  65

Query  290  DEVPLPNYRATESSSRGFASNEQRLLRNLKLR  385
              VP+PNY++  SS    A+NE+R+L+NLKL+
Sbjct  66   GRVPIPNYKSPGSSYN--AANEERILKNLKLQ  95



>ref|XP_006284830.1| hypothetical protein CARUB_v10006110mg [Capsella rubella]
 gb|EOA17728.1| hypothetical protein CARUB_v10006110mg [Capsella rubella]
Length=100

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA YD++TP+RW+ +A+ VG K+ EEV+R YE+L +DI  IEN  VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWYNVAKVVGGKTTEEVKRHYELLVQDINSIENGHVPF  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNYRA+   + G  S+E++ +R+++L+
Sbjct  74   PNYRASGGCTNGRLSHEEKRMRDMRLQ  100



>ref|XP_002889017.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65276.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=95

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT  QNK FE ALA+YDK+TPDRWH +A+ V GK++EEV+R Y+IL +D++ IE   VPL
Sbjct  12   WTFNQNKMFERALAVYDKDTPDRWHNVAKAVGGKTVEEVKRHYDILVEDLINIETGRVPL  71

Query  305  PNYRATESSSRGFASNEQRLLRNL  376
            PNY+  ES+SRG    + R ++NL
Sbjct  72   PNYKTFESNSRGVNDFDTRKMKNL  95



>ref|XP_010446463.1| PREDICTED: protein RADIALIS-like 1 [Camelina sativa]
Length=100

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA YD++TP+RW  IA+ VG K+ EEV+R YE+L +DI  IEN  VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWQNIAKVVGGKTTEEVKRHYELLVQDINNIENGHVPF  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNYR +   + G  + E+R +RN++L+
Sbjct  74   PNYRTSGGCTNGRLNQEERRMRNMRLQ  100



>gb|KFK30501.1| hypothetical protein AALP_AA7G270400 [Arabis alpina]
Length=100

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA YD++TP+RWH +A+ V GK+ EEV+R YE+L +DI  IEN  VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWHNVAKLVGGKTTEEVKRHYELLVQDINNIENGHVPF  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNY+ + S + G    E++ +RN++L+
Sbjct  74   PNYKTSGSCTNGRLIQEEKRMRNMRLQ  100



>ref|XP_007160753.1| hypothetical protein PHAVU_001G014300g [Phaseolus vulgaris]
 gb|ESW32747.1| hypothetical protein PHAVU_001G014300g [Phaseolus vulgaris]
Length=98

 Score =   104 bits (259),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 9/98 (9%)
 Frame = +2

Query  119  MAS---WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIE  286
            MAS   WT KQNKKFE ALAIYDK+TPDRW  +AR V GK++EEV+R YE+L  D+ QIE
Sbjct  1    MASSSVWTTKQNKKFENALAIYDKDTPDRWQNLARAVGGKTVEEVKRHYEMLVDDLKQIE  60

Query  287  NDEVPLPNYR---ATESSS-RGFA-SNEQRLLRNLKLR  385
               VPLPNYR   ATE  S RG++  NE++ ++ L LR
Sbjct  61   EGHVPLPNYRKVAATEGGSIRGYSYMNEEQRMKVLSLR  98



>ref|XP_002868895.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45154.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=100

 Score =   104 bits (259),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA YD++TP+RW  +A+ VG K+ EEV+R YE+L +DI  IEN  VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLVQDINNIENGHVPF  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNYR +   + G  S E++ +RN++L+
Sbjct  74   PNYRTSGGCTNGRLSQEEKRMRNMRLQ  100



>ref|NP_195636.2| protein RAD-like 1 [Arabidopsis thaliana]
 sp|F4JVB8.1|RADL1_ARATH RecName: Full=Protein RADIALIS-like 1; Short=AtRL1; Short=Protein 
RAD-like 1; AltName: Full=Protein RADIALIS-LIKE SANT/MYB 
2; Short=Protein RSM2 [Arabidopsis thaliana]
 gb|AEE87043.1| protein RAD-like 1 [Arabidopsis thaliana]
Length=100

 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA YD++TP+RW  +A+ VG K+ EEV+R YE+L +DI  IEN  VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLVQDINSIENGHVPF  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNYR +   + G  S E++ +RN++L+
Sbjct  74   PNYRTSGGCTNGRLSQEEKRMRNMRLQ  100



>gb|ABI14756.1| AtRL1 [Arabidopsis thaliana]
Length=98

 Score =   103 bits (258),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA YD++TP+RW  +A+ VG K+ EEV+R YE+L +DI  IEN  VP 
Sbjct  12   WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLVQDINSIENGHVPF  71

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNYR +   + G  S E++ +RN++L+
Sbjct  72   PNYRTSGGCTNGRLSQEEKRMRNMRLQ  98



>ref|XP_002878564.1| hypothetical protein ARALYDRAFT_481032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54823.1| hypothetical protein ARALYDRAFT_481032 [Arabidopsis lyrata subsp. 
lyrata]
Length=96

 Score =   103 bits (258),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SWT KQNK FE ALA+YD++TPDRWH IAR V GK+ EE +RQY++L +DI  IEN  V
Sbjct  7    GSWTVKQNKAFERALAVYDQDTPDRWHNIARSVGGKTPEEAKRQYDLLVRDIESIENGHV  66

Query  299  PLPNYRATES-SSRGFASNEQRLLRNLKLR  385
            P P+Y+ T   S+RG   +E++ +R++KL+
Sbjct  67   PFPDYKTTTGNSNRGRLRDEEKRMRSMKLQ  96



>ref|XP_002305430.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE85941.1| myb family transcription factor family protein [Populus trichocarpa]
Length=99

 Score =   103 bits (258),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTA+QNK FE ALA+YD++TPDRWH +AR V GK+ EEV+R YEIL +D+  IE+  VP 
Sbjct  14   WTAQQNKAFERALAVYDRDTPDRWHNVARAVGGKTAEEVKRHYEILVEDVKHIESGRVPF  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNYR T ++     + E+++++N+KL+
Sbjct  74   PNYRTTGANGHS-KTGEEKMMKNMKLQ  99



>gb|KDP38508.1| hypothetical protein JCGZ_04433 [Jatropha curcas]
Length=96

 Score =   103 bits (258),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 71/90 (79%), Gaps = 2/90 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK FE ALAIYD++TPDRWH +AR V GK++EEV+R YE+L +D+ QIE  +V
Sbjct  7    SSWTPKQNKLFENALAIYDRDTPDRWHNLARAVGGKTVEEVKRHYELLVEDVRQIEAGQV  66

Query  299  PLPNYRATESSSRGFA-SNEQRLLRNLKLR  385
            PLPNYR    +++ ++  +E++ L++LKL+
Sbjct  67   PLPNYRKAGLTAKPYSFMDEEKRLKSLKLQ  96



>ref|XP_007042186.1| Homeodomain-like superfamily protein [Theobroma cacao]
 gb|EOX98017.1| Homeodomain-like superfamily protein [Theobroma cacao]
Length=156

 Score =   105 bits (261),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE ALA+YDK+TPDRW+ +A+ V GK+ EEV+R YE+L +D+  IE+ +VP 
Sbjct  14   WTAKQNKDFERALAVYDKDTPDRWYNVAKAVGGKTAEEVKRHYELLVQDVKHIESGQVPF  73

Query  305  PNYRATESSSRGFASNEQRLL  367
            PNYR +  +SRG AS+E++ L
Sbjct  74   PNYRTSAGNSRGNASDEEKNL  94



>emb|CDY01398.1| BnaA07g11710D [Brassica napus]
Length=93

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 69/93 (74%), Gaps = 3/93 (3%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIEND  292
            + +SWT+KQNK FE ALA+YDK+TPDRW  +A+ VG KS EEV+R Y+IL +D+M IE D
Sbjct  1    MSSSWTSKQNKIFERALAVYDKDTPDRWQNVAKAVGNKSAEEVKRHYDILVEDLMNIEQD  60

Query  293  EVPLPNYRATE--SSSRGFASNEQRLLRNLKLR  385
             VPLP Y+  +  + SRG    + RL++N++++
Sbjct  61   LVPLPKYKTVDVGNKSRGINDYDLRLMKNMRIQ  93



>gb|EPS66061.1| hypothetical protein M569_08717 [Genlisea aurea]
Length=107

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 68/97 (70%), Gaps = 10/97 (10%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVP  301
             W+AKQNK+FEEALA YDK+TPDRWH IA+ V GKS+EEV + YE LE+DIM+IE  +VP
Sbjct  11   GWSAKQNKQFEEALAEYDKDTPDRWHNIAKIVGGKSVEEVMKHYEALERDIMKIEAGQVP  70

Query  302  LPNY--------RATESSSRGFAS-NEQRLLRNLKLR  385
            +PNY         +    SRG A  N  R ++NL+L+
Sbjct  71   IPNYPPINFAAKPSPPPQSRGVADVNLNRFVKNLRLQ  107



>ref|XP_002303127.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|ABK93523.1| unknown [Populus trichocarpa]
 gb|EEE82400.1| myb family transcription factor family protein [Populus trichocarpa]
Length=96

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 70/90 (78%), Gaps = 3/90 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDEVP  301
            ++WT+KQNK FE ALAIYD+E+PDRWH +AR VGK++EEV++ Y++L +D+ QIE  E+P
Sbjct  6    SNWTSKQNKLFENALAIYDQESPDRWHNLARAVGKTVEEVKKHYQMLVEDVQQIEAGEIP  65

Query  302  LPNY-RATESSSRGFASNEQRL--LRNLKL  382
            LPNY R + +S++ +  N+ +   ++NL L
Sbjct  66   LPNYTRRSGASNKSYHCNDDQAQRVKNLNL  95



>ref|XP_010437040.1| PREDICTED: protein RADIALIS-like 1 [Camelina sativa]
Length=100

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA YD++TP+RW  +A+ VG K+ EEV+R YE+L +DI  IEN  VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLVQDINNIENGHVPF  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNYR +   + G  + E++ +RN++L+
Sbjct  74   PNYRTSGGCTNGRLNQEEKRMRNMRLQ  100



>emb|CDY45420.1| BnaA07g32000D [Brassica napus]
Length=88

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK FE ALA+YDK+TPDRWH +A+ V GKS EEV+R Y+IL +D++ IE   V
Sbjct  8    SSWTFKQNKMFERALAVYDKDTPDRWHNVAKAVGGKSAEEVKRHYDILVEDLINIETGRV  67

Query  299  PLPNYRATESSSRG  340
            PLPNY+  ES+SRG
Sbjct  68   PLPNYKTFESNSRG  81



>ref|XP_008378460.1| PREDICTED: transcription factor RADIALIS-like [Malus domestica]
 ref|XP_009342795.1| PREDICTED: transcription factor RADIALIS isoform X1 [Pyrus x 
bretschneideri]
Length=102

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA+YDK+T DRW+ +A+ V GK+ EEV+R YE+L +D+  IE+ +VP 
Sbjct  15   WTAKQNKAFEKALAVYDKDTADRWYNVAKAVGGKTPEEVKRHYEVLVEDVKHIESGQVPF  74

Query  305  PNYRATESSSRG-FASNEQRLLRNLKL  382
            P+YR T  +S G   S+E++ +RNLKL
Sbjct  75   PDYRTTGGNSHGHHMSDEEKRMRNLKL  101



>ref|XP_008241676.1| PREDICTED: protein RADIALIS-like 3 [Prunus mume]
Length=95

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEVP  301
            +WTAKQNK FE ALA YD+ETPDRWHKIAR VG +  EEV+RQYEIL  DI +IE+ +VP
Sbjct  12   NWTAKQNKLFENALATYDEETPDRWHKIARIVGGTTEEEVKRQYEILLSDIKRIESGKVP  71

Query  302  LPNYRATESSSRGFASNEQRLLRNLKL  382
            LP YR   +S+    SNE++ L+ LKL
Sbjct  72   LPKYRKVGASN---ISNEEKRLKILKL  95



>ref|XP_008220806.1| PREDICTED: protein RADIALIS-like 3 [Prunus mume]
Length=99

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 72/95 (76%), Gaps = 7/95 (7%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SWT++QNK FE ALA+YDK+TPDRWH +AR V GKS+EEV+R YE+L +D+ +IE  EV
Sbjct  5    GSWTSRQNKMFENALAVYDKDTPDRWHNLARAVGGKSVEEVKRHYEMLVEDVNKIEAGEV  64

Query  299  PLPNYR---ATESSSRGFASN---EQRLLRNLKLR  385
            PLPNYR   A   + + ++++   E++ +++LKL+
Sbjct  65   PLPNYRKPGAAAGNGKAYSNSMDIEEQRMKSLKLQ  99



>ref|XP_008444724.1| PREDICTED: protein RADIALIS-like 4 [Cucumis melo]
Length=101

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNKKFE+AL +Y ++TPDRW K+AR V GK+ EEV+R Y+IL +D+M IE+ +VPL
Sbjct  16   WTLKQNKKFEDALVLYPEDTPDRWQKVARAVGGKTAEEVKRHYDILLQDLMHIESGKVPL  75

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNY+    +   +  +EQRL++NLKL+
Sbjct  76   PNYKPVVPNGSMY-DDEQRLMKNLKLQ  101



>ref|XP_004152694.1| PREDICTED: protein RADIALIS-like 6-like [Cucumis sativus]
 ref|XP_004165398.1| PREDICTED: protein RADIALIS-like 6-like [Cucumis sativus]
 gb|KGN62607.1| hypothetical protein Csa_2G361710 [Cucumis sativus]
Length=101

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNKKFE+AL +Y ++TPDRW K+AR V GK+ EEV+R Y+IL +D+M IE+ +VPL
Sbjct  16   WTLKQNKKFEDALVLYPEDTPDRWQKVARAVGGKTPEEVKRHYDILLQDLMHIESGKVPL  75

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNY+    +   +  +EQRL++NLKL+
Sbjct  76   PNYKPIAPNGSMY-DDEQRLMKNLKLQ  101



>ref|XP_006295299.1| hypothetical protein CARUB_v10024389mg [Capsella rubella]
 gb|EOA28197.1| hypothetical protein CARUB_v10024389mg [Capsella rubella]
Length=101

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE ALA+YD++TPDRW+ +AR V GK+ EE +RQY++L +DI  IEN  VP 
Sbjct  15   WTVKQNKAFERALAVYDQDTPDRWYNVARAVGGKTPEEAKRQYDLLVRDIESIENGHVPF  74

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            P+Y+ T +++RG   +E++ +R++KL+
Sbjct  75   PDYKTTGATNRGRLRDEEKRMRSMKLQ  101



>ref|XP_007224604.1| hypothetical protein PRUPE_ppa026982mg, partial [Prunus persica]
 gb|EMJ25803.1| hypothetical protein PRUPE_ppa026982mg, partial [Prunus persica]
Length=89

 Score =   101 bits (252),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE+ALA+YDK+T DRWH +A+ V GKS+EEV+R YEIL +D+M IE+ +VP+
Sbjct  12   WTPKQNKLFEKALAVYDKDTQDRWHNVAKAVGGKSVEEVKRHYEILVQDLMHIESGQVPI  71

Query  305  PNYRATESS-SRGFASNE  355
            PNY+ T SS SRG    +
Sbjct  72   PNYKGTGSSGSRGIGDEQ  89



>ref|XP_010664694.1| PREDICTED: protein RADIALIS-like 3 isoform X1 [Vitis vinifera]
Length=94

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVP  301
            +WT KQNK FE AL +YDK+TPDRW  +AR VG K++EEV+R YE+L +D+  IE+ +VP
Sbjct  7    NWTTKQNKLFENALVMYDKDTPDRWQNMARAVGGKTVEEVKRHYEMLVEDVKHIESGQVP  66

Query  302  LPNYRATESSSRGFASN-EQRLLRNLKL  382
            LPNYR   +S++G++ N E++ L+ LKL
Sbjct  67   LPNYRKAGASNKGYSFNDEEQRLKYLKL  94



>gb|KDP38516.1| hypothetical protein JCGZ_04441 [Jatropha curcas]
Length=94

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVP  301
            +WT KQNK FE+ALA+YDK+TPDRWH +A+ V GKS EEV+R Y+ L +D+M IE+ + P
Sbjct  16   NWTPKQNKLFEKALAVYDKDTPDRWHNVAKAVGGKSPEEVKRHYDRLVEDLMYIESGQAP  75

Query  302  LPNYRATESSSRGFASNEQR  361
            LPNYRAT S+ RG    EQR
Sbjct  76   LPNYRATGSNGRGIGE-EQR  94



>ref|XP_009371599.1| PREDICTED: protein RADIALIS-like 4 [Pyrus x bretschneideri]
Length=97

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 65/88 (74%), Gaps = 4/88 (5%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
            ++WTAKQNK FE ALA YD+ETPDRWH IAR VG +  EEV+RQYEIL  DI +IE+ +V
Sbjct  13   STWTAKQNKSFEIALATYDRETPDRWHNIARVVGGTTEEEVKRQYEILLADINRIESGKV  72

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKL  382
            PLP YR    SS    S+E++ L+ LKL
Sbjct  73   PLPKYRKVGESS---ISSEEKRLKALKL  97



>gb|KHN41969.1| hypothetical protein glysoja_003709 [Glycine soja]
Length=69

 Score =   100 bits (250),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDE  295
            + +SWT +QNK FEEALAIYD+ETPDRW  +AR VGKS+E+V+R YEIL++DI +IE  +
Sbjct  1    MASSWTPRQNKLFEEALAIYDRETPDRWQNVARVVGKSVEDVKRHYEILKEDIKRIERGQ  60

Query  296  VPLPNYRAT  322
            +PLPNY  +
Sbjct  61   IPLPNYAGS  69



>ref|XP_006473504.1| PREDICTED: protein RADIALIS-like 6-like [Citrus sinensis]
Length=100

 Score =   101 bits (251),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 69/92 (75%), Gaps = 5/92 (5%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WTAKQNK FE ALAIYDK+TPDRWH +AR V GK++EEV+R YE+L +D+ +IE  E+
Sbjct  6    STWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEI  65

Query  299  PLPNYRATESSSRGFA----SNEQRLLRNLKL  382
            PLP+Y+    +++  +     NE++ L+ L+L
Sbjct  66   PLPDYKKIGGTNKAHSYINMDNEEQRLKTLRL  97



>ref|XP_007225405.1| hypothetical protein PRUPE_ppa024375mg [Prunus persica]
 gb|EMJ26604.1| hypothetical protein PRUPE_ppa024375mg [Prunus persica]
Length=99

 Score =   101 bits (251),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 72/95 (76%), Gaps = 7/95 (7%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SWT++QNK FE ALA+YDK+TPDRWH +AR V GKS+EEV++ YE+L +D+ +IE  EV
Sbjct  5    GSWTSRQNKMFENALAVYDKDTPDRWHNLARAVGGKSVEEVKKHYEMLVEDVNKIEAGEV  64

Query  299  PLPNYR---ATESSSRGFASN---EQRLLRNLKLR  385
            PLPNYR   A   + + ++++   E++ +++LKL+
Sbjct  65   PLPNYRKPAAAAGNGKAYSNSMDIEEQRMKSLKLQ  99



>ref|XP_004961116.1| PREDICTED: protein RADIALIS-like 3-like [Setaria italica]
Length=99

 Score =   101 bits (251),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            A WT KQNK FE+ALA+YDK+TPDRWH IAR V GKS EEVRR YE+LE+D+  IE+ +V
Sbjct  14   AQWTKKQNKLFEQALAVYDKDTPDRWHNIARAVGGKSAEEVRRYYELLEEDVKHIESGKV  73

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKL  382
            P P YR    +  G    E   LR+LK+
Sbjct  74   PFPAYRCPGGA--GTLGYEADRLRHLKI  99



>ref|XP_009364794.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
 ref|XP_009336315.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
Length=94

 Score =   100 bits (250),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SWTA+QNK FE ALA+YDK+TPDRWH +AR V GKS+EEV+R Y++L +D+ +IE  EV
Sbjct  5    GSWTARQNKLFENALAVYDKDTPDRWHNLARAVGGKSVEEVKRHYQMLVEDVSKIEAGEV  64

Query  299  PLPNYRATESSS  334
            PLPNYR +   S
Sbjct  65   PLPNYRKSGGGS  76



>ref|XP_010431894.1| PREDICTED: protein RADIALIS-like 1 [Camelina sativa]
Length=100

 Score =   101 bits (251),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA YD++TP+RW  +A+ VG K+ EEV R YE+L +DI  IEN  VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVTRHYELLVQDINSIENGHVPF  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNYR +   + G  ++E++ +RN++L+
Sbjct  74   PNYRTSGGCNDGRLNHEEKRMRNMRLQ  100



>ref|XP_006404620.1| hypothetical protein EUTSA_v10000389mg [Eutrema salsugineum]
 gb|ESQ46073.1| hypothetical protein EUTSA_v10000389mg [Eutrema salsugineum]
Length=100

 Score =   100 bits (250),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SWT KQNK FE ALA YD++TPDRW+ +AR V GK+ EE +RQY++L +DI  IEN  V
Sbjct  12   GSWTVKQNKAFERALATYDQDTPDRWYNVARAVGGKTPEEAKRQYDLLVRDIESIENGHV  71

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKLR  385
            P P+Y++   S++G   +E++ +R+++L+
Sbjct  72   PFPDYKSNGGSTKGRLRDEEKRMRSMRLQ  100



>ref|XP_004289671.1| PREDICTED: transcription factor RADIALIS-like [Fragaria vesca 
subsp. vesca]
Length=100

 Score =   100 bits (250),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA+YDK+TPDRW+ +AR VG K+ EEV+R Y++L +D+  IE+ +VP 
Sbjct  15   WTAKQNKAFEKALALYDKDTPDRWYNVARAVGNKTPEEVKRHYDLLVEDVKHIESGQVPF  74

Query  305  PNYRATESSSRGFASNEQRLLRNLKL  382
            P+YR T   S     +E++ +RNLKL
Sbjct  75   PDYR-TSGGSGNIGHDEEKRMRNLKL  99



>ref|NP_179759.1| MYB transcription factor RSM1 [Arabidopsis thaliana]
 sp|Q9SIJ5.1|RADL2_ARATH RecName: Full=Protein RADIALIS-like 2; Short=AtRL2; Short=Protein 
RAD-like 2; AltName: Full=Protein MATERNAL EFFECT EMBRYO 
ARREST 3; AltName: Full=Protein RADIALIS-LIKE SANT/MYB 1; 
Short=Protein RSM1 [Arabidopsis thaliana]
 gb|AAD23640.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40381.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAP40504.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAS09996.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAF01371.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07207.1| protein RADIALIS-like 2 [Arabidopsis thaliana]
Length=101

 Score =   100 bits (250),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE ALA+YD++TPDRWH +AR V GK+ EE +RQY++L +DI  IEN  VP 
Sbjct  14   WTVKQNKAFERALAVYDQDTPDRWHNVARAVGGKTPEEAKRQYDLLVRDIESIENGHVPF  73

Query  305  PNYRATES-SSRGFASNEQRLLRNLKLR  385
            P+Y+ T   S+RG   +E++ +R++KL+
Sbjct  74   PDYKTTTGNSNRGRLRDEEKRMRSMKLQ  101



>ref|XP_010254825.1| PREDICTED: protein RADIALIS-like 3 isoform X2 [Nelumbo nucifera]
Length=101

 Score =   100 bits (250),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 4/84 (5%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVP  301
            +WTAKQNK FE+ALAIYDK+TPDRW  IA+ V GK++EEV+R YEIL +D+  IE+ +VP
Sbjct  13   TWTAKQNKLFEKALAIYDKDTPDRWQNIAKAVGGKTVEEVKRHYEILIEDLNHIESGKVP  72

Query  302  LPNYRATESS---SRGFASNEQRL  364
             PNY+ T  +   S G A  EQRL
Sbjct  73   FPNYKMTGGNNNKSNGVAEEEQRL  96



>ref|XP_008388061.1| PREDICTED: protein RADIALIS-like 3 [Malus domestica]
Length=96

 Score =   100 bits (250),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SWTA+QNK FE ALA+YDK+TPDRWH +AR V GKS+EEV+R Y++L +D+ +IE  EV
Sbjct  5    GSWTARQNKLFENALAVYDKDTPDRWHNLARAVGGKSVEEVKRHYQMLVEDVSKIEAGEV  64

Query  299  PLPNYRATESSS  334
            PLPNYR +   S
Sbjct  65   PLPNYRRSGGGS  76



>ref|XP_011024437.1| PREDICTED: protein RADIALIS-like 3 [Populus euphratica]
Length=96

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 70/90 (78%), Gaps = 3/90 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDEVP  301
            ++WT+KQNK FE ALAIYD+E+PDRWH +AR VGK++EEV++ Y++L +D+ QIE  E+P
Sbjct  6    SNWTSKQNKLFENALAIYDQESPDRWHHLARAVGKTVEEVKKHYQMLVEDVQQIEAGEIP  65

Query  302  LPNY-RATESSSRGFAS--NEQRLLRNLKL  382
            LPNY R + +S++ +    ++ + ++NL L
Sbjct  66   LPNYTRRSGASNKSYHCIDDQAKRVKNLNL  95



>ref|XP_010690864.1| PREDICTED: protein RADIALIS-like 3 [Beta vulgaris subsp. vulgaris]
Length=101

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK+FE ALA+YDK+T DRW  +AR V GKS EEV+R YEIL +D+ QIE   VP 
Sbjct  16   WTAKQNKQFERALALYDKDTKDRWQNVARLVEGKSAEEVKRHYEILLEDLHQIEAGRVPF  75

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNYR   ++S  F + EQR LR L+L+
Sbjct  76   PNYRQNAANSMNF-NEEQRQLRYLRLQ  101



>ref|XP_010061305.1| PREDICTED: protein RADIALIS-like 3 isoform X2 [Eucalyptus grandis]
 gb|KCW68236.1| hypothetical protein EUGRSUZ_F01887 [Eucalyptus grandis]
Length=82

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 59/70 (84%), Gaps = 2/70 (3%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIEN  289
            + ASWT +QNK+FEEALA+YD+ TPDRW ++AR V  GKS+EEVRR YE+L +D+++IE+
Sbjct  1    MAASWTREQNKRFEEALALYDENTPDRWQRVARAVGDGKSVEEVRRHYEVLVRDLVRIES  60

Query  290  DEVPLPNYRA  319
             ++PLPNYR 
Sbjct  61   GQIPLPNYRG  70



>gb|KFK44084.1| hypothetical protein AALP_AA1G213900 [Arabis alpina]
Length=95

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK FE ALA+YDK+TPDRW  +A+ VG KS EEV+R Y+IL +D+  IE D V
Sbjct  5    SSWTFKQNKLFERALAVYDKDTPDRWQNVAKAVGSKSAEEVKRHYDILVEDLRNIEQDLV  64

Query  299  PLPNYRATE--SSSRGFASNEQRLLRNLKLR  385
            PLP Y+  +  S SRG    + RL++NL+++
Sbjct  65   PLPRYKTVDVGSKSRGINDFDLRLMKNLRIQ  95



>ref|XP_010416923.1| PREDICTED: protein RADIALIS-like 2 [Camelina sativa]
 ref|XP_010472163.1| PREDICTED: protein RADIALIS-like 2 [Camelina sativa]
Length=103

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 67/89 (75%), Gaps = 3/89 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE ALA+YD++TPDRW+ +AR V GK+ EE +RQYE+L +DI  IEN  VP 
Sbjct  15   WTVKQNKAFERALAVYDQDTPDRWYNVARAVGGKTPEEAKRQYELLVRDIESIENGHVPF  74

Query  305  PNYRATESSSRGFA--SNEQRLLRNLKLR  385
            P+Y+ T +++RG     +E++ +R++KL+
Sbjct  75   PDYKTTGATNRGGGRLRDEEKRMRSMKLQ  103



>ref|XP_010936699.1| PREDICTED: protein RADIALIS-like 3 [Elaeis guineensis]
Length=95

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 6/86 (7%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE ALA+YDK+TPDRWH +AR V GKS EEV+R YE+L +D+  IE+ +VP 
Sbjct  14   WTPKQNKLFERALAVYDKDTPDRWHNVARAVGGKSAEEVKRHYELLVEDLKNIESGQVPF  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKL  382
            PNY     + R  AS+E++ LRNLKL
Sbjct  74   PNY-----NIRPSASDEEQRLRNLKL  94



>gb|KFK32873.1| hypothetical protein AALP_AA6G298600 [Arabis alpina]
Length=101

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 2/90 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SWT KQNK FE ALA YD++TPDRWH +AR V GK+ EE +RQY++L  DI  IEN  V
Sbjct  12   GSWTVKQNKAFERALATYDQDTPDRWHNVARAVGGKTPEEAKRQYDLLVLDIESIENGHV  71

Query  299  PLPNYRATESS-SRGFASNEQRLLRNLKLR  385
            P P+Y+ T    +RG   +E++ +R++KL+
Sbjct  72   PFPDYKTTTGGNTRGRLRDEEKRMRSMKLQ  101



>gb|KHG28372.1| DnaJ subfamily C member 2 [Gossypium arboreum]
Length=93

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 3/90 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK FE AL IYDK+TPDRWH +AR V GK++EEV+  Y+ L +DI QIE+ +V
Sbjct  5    SSWTPKQNKLFENALVIYDKDTPDRWHNLARAVGGKTVEEVKLHYQNLVEDIQQIESGQV  64

Query  299  PLPNY-RATESSSRGFASNEQRLLRNLKLR  385
            PLP Y +A E+    F   EQR +RNL+L+
Sbjct  65   PLPPYKKAGENKGYNFMDGEQR-MRNLRLQ  93



>ref|XP_009134002.1| PREDICTED: protein RADIALIS-like 2 isoform X4 [Brassica rapa]
Length=100

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
             SWT KQNK FE ALA YD++TPDRW+ +AR VG +  +E +RQY++L +DI  I+N  V
Sbjct  12   GSWTVKQNKAFERALATYDQDTPDRWYNVARAVGGTTPDEAKRQYDLLVRDIEIIDNGHV  71

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKLR  385
            P PNY  T   ++G   +E++ +RN+KL+
Sbjct  72   PFPNYTTTGGRTKGRLRDEEKRMRNMKLQ  100



>ref|XP_007017546.1| DnaJ subfamily C member 2 [Theobroma cacao]
 gb|EOY14771.1| DnaJ subfamily C member 2 [Theobroma cacao]
Length=92

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 3/89 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WT KQNK FE ALAIYDK+TPDRWH +AR V GK++EEV+  YE L +DI QIE+ +V
Sbjct  5    STWTPKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKMHYENLVEDIKQIESGQV  64

Query  299  PLPNYRATESSSRGFA-SNEQRLLRNLKL  382
            PLP Y+     S+G++  +E++ LRNL+L
Sbjct  65   PLPPYKKA-GGSKGYSYMDEEQRLRNLRL  92



>ref|XP_009594360.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana tomentosiformis]
Length=87

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTA+QNK FE+ALA+YDK+TPDRW  +AR V GK+ EEV+R YEIL +D+M IEN  VP 
Sbjct  12   WTAEQNKAFEKALAVYDKDTPDRWSNVARAVGGKTAEEVKRHYEILVQDVMSIENGRVPF  71

Query  305  PNYRATESS  331
            PNYR T   
Sbjct  72   PNYRTTTGG  80



>gb|KDO84575.1| hypothetical protein CISIN_1g041475mg [Citrus sinensis]
Length=153

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 69/92 (75%), Gaps = 5/92 (5%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WTAKQNK FE ALAIYDK+TPDRWH +AR V GK++EEV+R YE+L +D+ +IE  E+
Sbjct  59   STWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEI  118

Query  299  PLPNYRATESSSRGFA----SNEQRLLRNLKL  382
            PLP+Y+    +++  +     NE++ L+ L+L
Sbjct  119  PLPDYKKIGGTNKAHSYINMDNEEQRLKTLRL  150



>ref|XP_010539897.1| PREDICTED: protein RADIALIS-like 5 [Tarenaya hassleriana]
Length=93

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 4/88 (5%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WT KQNKKFE+ALA+YDK+TPDRW  +A+ V GKS EEV+  Y+IL +D+M IE D V
Sbjct  9    STWTTKQNKKFEKALAVYDKDTPDRWENVAKAVGGKSPEEVKHHYDILVEDLMNIERDRV  68

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKL  382
            PLP Y+     SR     + RL++NLK+
Sbjct  69   PLPKYKTL---SRRIDDFDSRLMKNLKI  93



>ref|XP_007017563.1| RAD-like 6 [Theobroma cacao]
 gb|EOY14788.1| RAD-like 6 [Theobroma cacao]
Length=86

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE+ALA+YDK+TPDRW K+A  VG KS EEVRR YEIL  D+M IE+ +VP+
Sbjct  16   WTPKQNKLFEKALAVYDKDTPDRWQKVAAAVGEKSAEEVRRHYEILVADLMYIESGQVPI  75

Query  305  PNYRATESSSR  337
            PNYR+T S+ R
Sbjct  76   PNYRSTGSNRR  86



>gb|KHN36107.1| hypothetical protein glysoja_003230 [Glycine soja]
Length=84

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDE  295
            + +SWT +QNK FEEALAI+D+ETPDRW  +AR VGKS+E+V+R YEIL++DI +IE  +
Sbjct  1    MASSWTPRQNKLFEEALAIHDRETPDRWQNVARVVGKSVEDVKRHYEILKEDIKRIERGQ  60

Query  296  VPLPNYRATE  325
            +PLPNY   E
Sbjct  61   IPLPNYTGME  70



>ref|XP_008465612.1| PREDICTED: protein RADIALIS-like 3 [Cucumis melo]
Length=87

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 3/83 (4%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WTAKQNK FE ALAIYDK+TP+RWH +AR V GK+ EEV+R YE L +D+ +IE  +V
Sbjct  5    SNWTAKQNKVFENALAIYDKDTPERWHNLARAVGGKTAEEVKRHYERLVEDVNKIETGQV  64

Query  299  PLPNYRATESSSRGFA--SNEQR  361
            P PNYR +  ++RGF     EQR
Sbjct  65   PFPNYRRSGPAARGFCFLDQEQR  87



>ref|XP_002282461.1| PREDICTED: protein RADIALIS-like 3 isoform X2 [Vitis vinifera]
 emb|CBI19701.3| unnamed protein product [Vitis vinifera]
Length=91

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVP  301
            +WT KQNK FE AL +YDK+TPDRW  +AR VG K++EEV+R YE+L +D+  IE+ +VP
Sbjct  7    NWTTKQNKLFENALVMYDKDTPDRWQNMARAVGGKTVEEVKRHYEMLVEDVKHIESGQVP  66

Query  302  LPNYRATESSSRGFASNEQ  358
            LPNYR   +S++G++ N++
Sbjct  67   LPNYRKAGASNKGYSFNDE  85



>ref|XP_006383186.1| hypothetical protein POPTR_0005s12390g [Populus trichocarpa]
 gb|ERP60983.1| hypothetical protein POPTR_0005s12390g [Populus trichocarpa]
Length=85

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +2

Query  110  RLLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIE  286
            R   +SWT KQNK FE+ALA+YDK+TPDRWH +A+ V GKS EEV R YEIL KD+ +IE
Sbjct  10   RNCSSSWTPKQNKLFEKALALYDKDTPDRWHNVAKAVGGKSAEEVERHYEILIKDVREIE  69

Query  287  NDEVPLPNYRATESSS  334
            +  VP PNYR++ +S+
Sbjct  70   SGRVPFPNYRSSGNSN  85



>ref|XP_007201464.1| hypothetical protein PRUPE_ppa014060mg [Prunus persica]
 gb|EMJ02663.1| hypothetical protein PRUPE_ppa014060mg [Prunus persica]
Length=89

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 67/90 (74%), Gaps = 7/90 (8%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            M+SWTAKQNK FE+ALA+YDK+T DRW+ +A+ V GK+ EEV+R YE L +D+  IE+ +
Sbjct  6    MSSWTAKQNKAFEKALALYDKDTADRWYNVAKAVGGKTPEEVKRHYERLVEDVKHIESGQ  65

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            VP P+YR T        ++E++ +RNLKLR
Sbjct  66   VPFPDYRTT------GGNDEEKRMRNLKLR  89



>ref|XP_003545280.1| PREDICTED: protein RADIALIS-like 1-like isoform X1 [Glycine max]
 gb|KHN20978.1| DnaJ like subfamily C member 2 [Glycine soja]
Length=98

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 7/88 (8%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WT KQNKKFE ALAIYD++TPDRW  +AR V GK++EEV+R YE+L  D+ QIE   V
Sbjct  5    SAWTTKQNKKFENALAIYDRDTPDRWQNLARAVGGKTVEEVKRHYEMLVDDLKQIEEGHV  64

Query  299  PLPNYRATESSSRG------FASNEQRL  364
            PLPNYR   ++  G      +   EQR+
Sbjct  65   PLPNYRNAAATGGGSIRGYSYMDEEQRM  92



>ref|NP_177661.1| protein RADIALIS-like 6 [Arabidopsis thaliana]
 gb|AAG12684.1|AC025814_8 myb-related protein; 20671-21051 [Arabidopsis thaliana]
 gb|AAS09995.1| MYB transcription factor [Arabidopsis thaliana]
 gb|ABG48447.1| At1g75250 [Arabidopsis thaliana]
 gb|AEE35693.1| protein RADIALIS-like 6 [Arabidopsis thaliana]
Length=126

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            ++ WT  QNK FE ALA+YDK+TPDRWH +A+ V GK++EEV+R Y+IL +D++ IE   
Sbjct  9    ISPWTFSQNKMFERALAVYDKDTPDRWHNVAKAVGGKTVEEVKRHYDILVEDLINIETGR  68

Query  296  VPLPNYRATESSSRGFASNEQRLL  367
            VPLPNY+  ES+SR     + R +
Sbjct  69   VPLPNYKTFESNSRSINDFDTRYI  92



>ref|XP_006304325.1| hypothetical protein CARUB_v10010724mg [Capsella rubella]
 gb|EOA37223.1| hypothetical protein CARUB_v10010724mg [Capsella rubella]
Length=100

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = +2

Query  137  KQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPLPNY  313
            KQNK FE ALA+YDK+TPDRW  +A+ VG KS+EEV+R Y+IL +D+M IE D VPLP Y
Sbjct  15   KQNKMFERALAVYDKDTPDRWQNVAKAVGSKSVEEVKRHYDILVEDLMNIEQDLVPLPKY  74

Query  314  R--ATESSSRGFASNEQRLLRNLKLR  385
            +  A  S SRG    + RL++N++++
Sbjct  75   KTVAVGSKSRGINDFDLRLMKNMRIQ  100



>ref|XP_006473515.1| PREDICTED: protein RADIALIS-like 6-like [Citrus sinensis]
Length=103

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIENDE  295
            ++WT +QNKKFE ALA+YDK+TPDRW  +AR V  GKS ++V+R Y+ L +D++ IE+ +
Sbjct  15   STWTPEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQ  74

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKL  382
             PLPNY+ T ++  G  ++  RL++NLKL
Sbjct  75   FPLPNYKNTGNNCIGILADAPRLMKNLKL  103



>ref|XP_003523829.1| PREDICTED: protein RADIALIS-like 2-like [Glycine max]
 gb|KHN45854.1| hypothetical protein glysoja_023077 [Glycine soja]
Length=91

 Score = 98.6 bits (244),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 66/89 (74%), Gaps = 5/89 (6%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVP  301
             WT KQNK+FE ALAI+DK+TPDRWH +AR V GK++EEV+R YE L +D+ +IE   VP
Sbjct  6    GWTPKQNKRFENALAIFDKDTPDRWHTVARAVGGKTVEEVKRHYEKLVEDVKKIEEGHVP  65

Query  302  LPNYRATESSSRGFA-SNEQRLLRNLKLR  385
            LPNYR   S++RG+   +E+  ++ L L+
Sbjct  66   LPNYR---SAARGYGYMDEETRMKALSLQ  91



>gb|KEH40146.1| MYB family transcription factor [Medicago truncatula]
Length=93

 Score = 98.6 bits (244),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WT KQNK+FE ALAIYDK+TPDRW K+AR V GK++EEV+R YE+L +D+ QIE   V
Sbjct  5    SAWTTKQNKRFENALAIYDKDTPDRWQKLARAVGGKTVEEVKRHYEMLVEDLKQIEEGHV  64

Query  299  PLPNYR-ATESSSRGFASNEQRL  364
            PLP YR A       ++  EQRL
Sbjct  65   PLPKYRNAATIKGYNYSDEEQRL  87



>ref|XP_006654838.1| PREDICTED: protein RADIALIS-like 1-like [Oryza brachyantha]
Length=97

 Score = 98.6 bits (244),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 63/91 (69%), Gaps = 4/91 (4%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIENDE  295
            A WT KQNK FE+ALA+YDKETPDRWH IAR V  GKS EEV+R YE+L +DI  IE+ +
Sbjct  7    AQWTPKQNKLFEQALAVYDKETPDRWHNIARAVGGGKSAEEVKRYYELLVEDINHIESGK  66

Query  296  VPLPNYRATESSSRGFAS--NEQRLLRNLKL  382
            VP P YR    ++   AS   +   L++LK+
Sbjct  67   VPFPAYRCPTGAAAAHASLGCQTERLKHLKI  97



>ref|XP_006595936.1| PREDICTED: protein RADIALIS-like 1-like isoform X2 [Glycine max]
Length=82

 Score = 98.2 bits (243),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WT KQNKKFE ALAIYD++TPDRW  +AR V GK++EEV+R YE+L  D+ QIE   V
Sbjct  5    SAWTTKQNKKFENALAIYDRDTPDRWQNLARAVGGKTVEEVKRHYEMLVDDLKQIEEGHV  64

Query  299  PLPNYRATESSSRG  340
            PLPNYR   ++  G
Sbjct  65   PLPNYRNAAATGGG  78



>gb|AES94986.2| MYB family transcription factor [Medicago truncatula]
Length=64

 Score = 97.4 bits (241),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDEV  298
            MASWTA+QNK FEEALAIYD+ETPDRWH +A+ VGKS+E+V+R YEIL++DI +IE  EV
Sbjct  1    MASWTARQNKLFEEALAIYDRETPDRWHNVAKVVGKSVEDVKRHYEILKEDIKRIERGEV  60

Query  299  PLP  307
              P
Sbjct  61   AYP  63



>ref|XP_007204842.1| hypothetical protein PRUPE_ppa026779mg [Prunus persica]
 gb|EMJ06041.1| hypothetical protein PRUPE_ppa026779mg [Prunus persica]
Length=91

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 4/80 (5%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEVP  301
            +WTAKQNK FE ALA YD+ETPDRWHKIAR VG +  EEV+RQYEIL  DI +IE+ +VP
Sbjct  14   TWTAKQNKLFENALATYDEETPDRWHKIARIVGGTTEEEVKRQYEILLSDIKRIESGKVP  73

Query  302  LPNYRATESSSRGFASNEQR  361
            LP YR   +S+    SNE++
Sbjct  74   LPKYRKVGTSN---ISNEEK  90



>ref|XP_010471632.1| PREDICTED: protein RADIALIS-like 6 [Camelina sativa]
Length=100

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT  QNK FE ALAIYDK+TPDRWH +A+ + GKS+EEV+R Y+IL +D++ IE   VPL
Sbjct  13   WTFDQNKMFERALAIYDKDTPDRWHNVAKAIEGKSVEEVKRHYDILVEDLINIETGRVPL  72

Query  305  PNY--RATESSSRGFASNEQRLLRNLKL  382
            P Y  +   S SRG      R+++NLK+
Sbjct  73   PKYKNKTFNSKSRGTNDLNSRMMKNLKI  100



>ref|XP_003569420.1| PREDICTED: protein RADIALIS-like 4 [Brachypodium distachyon]
Length=96

 Score = 98.2 bits (243),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK+FE+ALA+YDKETPDRWH IAR V GK+ +EV+R YE+L +D+  IE  +VP 
Sbjct  13   WTAKQNKQFEQALAVYDKETPDRWHNIARSVGGKTADEVKRYYELLVRDVKHIEAGKVPF  72

Query  305  PNYRATESSSRGFASNEQRLLRNLKL  382
            P YR   + +   A  E   LR+LK+
Sbjct  73   PAYRCPPAGA--MADYEADRLRHLKI  96



>ref|XP_010555296.1| PREDICTED: protein RADIALIS-like 2 [Tarenaya hassleriana]
Length=100

 Score = 98.2 bits (243),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 63/88 (72%), Gaps = 1/88 (1%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVP  301
            SWTAKQNK FE ALAIYD +TPDRW+ +A+ V GK+ +E ++ YE+L +D+  IE   VP
Sbjct  13   SWTAKQNKAFERALAIYDTDTPDRWYNVAKAVGGKTPDEAKQHYELLVRDVDSIEKGHVP  72

Query  302  LPNYRATESSSRGFASNEQRLLRNLKLR  385
             P+Y+ T  S  G  + E++ +RNLKL+
Sbjct  73   FPDYKNTGGSIYGKLTGEEKRMRNLKLQ  100



>ref|XP_007131828.1| hypothetical protein PHAVU_011G044900g [Phaseolus vulgaris]
 gb|ESW03822.1| hypothetical protein PHAVU_011G044900g [Phaseolus vulgaris]
Length=100

 Score = 98.2 bits (243),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK FE+ALA YDK+TPDRW  +A  VG KS +EV+R YEIL +D+  IE+  V
Sbjct  14   SSWTPKQNKLFEKALAKYDKDTPDRWQNVATAVGDKSPDEVKRHYEILLEDLRHIESGHV  73

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKL  382
            PLP YR+T SS+     +E+RLL+ LKL
Sbjct  74   PLPKYRSTGSSTN--VDDEERLLKYLKL  99



>ref|XP_006581206.1| PREDICTED: protein RADIALIS-like 2-like [Glycine max]
Length=91

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 59/81 (73%), Gaps = 2/81 (2%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVP  301
             WT KQNK+FE ALAI+DK+TPDRWH +AR V GK++EEV+R YE L +D+ +IE   VP
Sbjct  6    GWTPKQNKRFENALAIFDKDTPDRWHTVARAVGGKTVEEVKRHYEKLVEDVKEIEEGHVP  65

Query  302  LPNYRATESSSRGFASNEQRL  364
            LPNYR+  +   G+   E R+
Sbjct  66   LPNYRSA-ARGHGYMDEENRM  85



>gb|ABH02884.1| MYB transcription factor MYB164 [Glycine max]
Length=100

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WT KQNKKFE ALAIYD++TPDRW  +AR V GK++EEV+R YE+L  D+ QIE   V
Sbjct  8    SAWTTKQNKKFENALAIYDRDTPDRWQNLARAVGGKTVEEVKRHYEMLVDDLKQIEEGHV  67

Query  299  PLPNYRATESSSRG  340
            PLPNYR   ++  G
Sbjct  68   PLPNYRNAAATGGG  81



>ref|XP_004509270.1| PREDICTED: protein RADIALIS-like 1-like [Cicer arietinum]
Length=69

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDE  295
            + +SWTA+QNK FE+ALA+YD+ETPDRWH +A+ VG+S+E+V+R YEIL++D+ +IE+  
Sbjct  1    MASSWTARQNKLFEQALALYDRETPDRWHNVAKAVGRSVEDVKRHYEILKQDVQRIEHGH  60

Query  296  VPLPNYR  316
            +P P Y+
Sbjct  61   IPFPPYK  67



>ref|XP_003540679.1| PREDICTED: protein RADIALIS-like 1-like [Glycine max]
Length=100

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK FE+ALA YDK+TPDRW  +A+ V GKS +EV+R YEIL +D+  IE+  V
Sbjct  14   SSWTPKQNKLFEKALAKYDKDTPDRWQNVAKAVGGKSADEVKRHYEILLEDLRHIESGHV  73

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKL  382
            PLP Y++T SS+      E+RLL+ LKL
Sbjct  74   PLPKYKSTGSSTN--VEEEERLLKYLKL  99



>ref|XP_007156953.1| hypothetical protein PHAVU_002G031300g [Phaseolus vulgaris]
 gb|ESW28947.1| hypothetical protein PHAVU_002G031300g [Phaseolus vulgaris]
Length=69

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDE  295
            + +SWT +QNK FEEALA YD++TPD+W  +AR VGKS+EEV+R +EIL++D+ +IE  +
Sbjct  1    MASSWTPRQNKLFEEALATYDRDTPDKWQNVARVVGKSVEEVKRHFEILKEDVKRIERGQ  60

Query  296  VPLPNYRAT  322
            VPLPNY  +
Sbjct  61   VPLPNYTGS  69



>gb|ABI14752.1| myb-like protein RL3 [Antirrhinum majus]
Length=90

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK+FEEALA+Y  +TPD W  IAR V GKS EE+RR YE+L K+IM+IE D+VP+
Sbjct  11   WTQKQNKQFEEALAMYGNDTPDCWQNIARKVGGKSAEEIRRHYEVLVKEIMKIETDQVPI  70

Query  305  PNY-RATESSSRGFAS  349
            PNY +   S+SRG+ +
Sbjct  71   PNYNKVKGSNSRGYGN  86



>ref|XP_010416394.1| PREDICTED: protein RADIALIS-like 6 [Camelina sativa]
Length=100

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT  QNK FE ALAIYDK+TPDRWH +A+ V GKS+EEV+R Y+IL +D++ IE   VPL
Sbjct  13   WTFDQNKMFERALAIYDKDTPDRWHNVAKAVEGKSVEEVKRHYDILVEDLINIETGRVPL  72

Query  305  PNYRATESSSRGFASNE--QRLLRNLKL  382
            P Y+     S+   +N+   R+++NLK+
Sbjct  73   PKYKNKTFDSKSRVTNDLNSRMMKNLKI  100



>ref|XP_010263639.1| PREDICTED: protein RADIALIS-like 3 [Nelumbo nucifera]
Length=100

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVP  301
            +WT KQNK FE+ALA+YDK+TPDRW  +A+ VG KS EEV+R YEIL +D+  IE+ +VP
Sbjct  13   TWTPKQNKLFEKALALYDKDTPDRWQNVAKAVGGKSAEEVKRHYEILIEDLKHIESGKVP  72

Query  302  LPNYRATESSSRGFASNEQRLLRNLKLR  385
             PNY+++ SSS+G    EQRLL  LKL+
Sbjct  73   FPNYKSSGSSSQGIGDEEQRLLEYLKLQ  100



>ref|XP_004147867.1| PREDICTED: protein RADIALIS-like 1-like [Cucumis sativus]
 ref|XP_004154839.1| PREDICTED: protein RADIALIS-like 1-like [Cucumis sativus]
 gb|KGN59962.1| hypothetical protein Csa_3G857030 [Cucumis sativus]
Length=94

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 67/90 (74%), Gaps = 4/90 (4%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WTAKQNK FE ALAIYDK+TP+RW  +AR V GK+ EEV+R YE L +D+ +IE  +V
Sbjct  5    SNWTAKQNKVFENALAIYDKDTPERWQNLARAVGGKTAEEVKRHYERLVEDVNKIETGQV  64

Query  299  PLPNYRATESSSRG--FASNEQRLLRNLKL  382
            P PNYR +  ++RG  F   EQR +R+L+L
Sbjct  65   PFPNYRRSVPAARGFYFLDQEQR-MRSLQL  93



>ref|XP_008800712.1| PREDICTED: protein RADIALIS-like 3 [Phoenix dactylifera]
Length=102

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 3/87 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT K+NK FE+ALA YDKETPDRWHK+A+ V GK+ EEV+R YE+L +DI  IE   VP 
Sbjct  16   WTLKENKLFEQALAKYDKETPDRWHKVAQAVGGKTPEEVKRHYELLVEDIKHIEAGHVPF  75

Query  305  PNYRATES-SSRGFASNEQRLLRNLKL  382
            PNY ++ S   R  A  EQR L+NLKL
Sbjct  76   PNYGSSSSMGGRRVAREEQR-LKNLKL  101



>ref|XP_009785808.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana sylvestris]
Length=89

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SWTA+QNK FE+ALA+YDK+TPDRW  +AR V GK+ EEV+R YEIL +D+M IEN  V
Sbjct  10   GSWTAEQNKAFEKALAVYDKDTPDRWSNVARAVGGKTAEEVKRHYEILVQDVMSIENGRV  69

Query  299  PLPNY  313
            P PNY
Sbjct  70   PFPNY  74



>ref|XP_010254824.1| PREDICTED: protein RADIALIS-like 1 isoform X1 [Nelumbo nucifera]
Length=122

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 4/84 (5%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVP  301
            +WTAKQNK FE+ALAIYDK+TPDRW  IA+ V GK++EEV+R YEIL +D+  IE+ +VP
Sbjct  13   TWTAKQNKLFEKALAIYDKDTPDRWQNIAKAVGGKTVEEVKRHYEILIEDLNHIESGKVP  72

Query  302  LPNYRATESS---SRGFASNEQRL  364
             PNY+ T  +   S G A  EQ +
Sbjct  73   FPNYKMTGGNNNKSNGVAEEEQSV  96



>gb|KHN12708.1| hypothetical protein glysoja_008671 [Glycine soja]
Length=97

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 64/91 (70%), Gaps = 7/91 (8%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WT KQNKKFE ALAIYD+ETPD W  + R V GK++EEV+R YE+L  D+ QIE   V
Sbjct  5    SAWTTKQNKKFENALAIYDRETPDLWKNLVRAVGGKTVEEVKRHYEMLVDDLKQIEEGHV  64

Query  299  PLPNYR---ATESSS-RGFA--SNEQRLLRN  373
            PLPNYR   AT  SS RG++    EQRL  N
Sbjct  65   PLPNYRNVAATGGSSIRGYSYMEEEQRLKSN  95



>emb|CDY62533.1| BnaA02g35960D [Brassica napus]
Length=101

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT +QNK FE ALA+YDK+TPDRWH +A  V GKS EEV+R Y+IL +D++ IE   VPL
Sbjct  12   WTFRQNKMFERALAVYDKDTPDRWHNVANAVGGKSAEEVKRHYDILVEDLISIETGRVPL  71

Query  305  PNYRATESSSRGFASNEQRLL  367
            PNY+ T+S+SRG    + R L
Sbjct  72   PNYK-TKSNSRGINDLDTRYL  91



>ref|XP_010028595.1| PREDICTED: protein RADIALIS-like 1 [Eucalyptus grandis]
 gb|KCW55358.1| hypothetical protein EUGRSUZ_I01273 [Eucalyptus grandis]
Length=85

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FEEALA+YDK+TPDRWH +A+ V GK+ EEV+R YE+L +D+  IE+  VP 
Sbjct  13   WTAKQNKAFEEALAVYDKDTPDRWHNVAKAVGGKTAEEVKRHYELLVEDVKHIESGRVPF  72

Query  305  PNYRAT  322
            PNYR T
Sbjct  73   PNYRTT  78



>gb|ABK96643.1| unknown [Populus trichocarpa x Populus deltoides]
Length=96

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDEVP  301
            ++WT+KQNK FE ALAI D+E+PDRWH +AR VGK++EEV++ Y++L +D+ QIE  E+P
Sbjct  6    SNWTSKQNKLFENALAICDQESPDRWHNLARAVGKTVEEVKKHYQMLVEDVQQIEAGEIP  65

Query  302  LPNY-RATESSSRGF  343
            LPNY R + +S++ +
Sbjct  66   LPNYTRRSGASNKSY  80



>ref|XP_004499158.1| PREDICTED: protein RADIALIS-like 5-like [Cicer arietinum]
Length=97

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 6/87 (7%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK+FE ALAIYDK+TPDRW K+AR V GK++EEV+R YEIL +D+  IE   V
Sbjct  5    SSWTPKQNKRFENALAIYDKDTPDRWQKLARAVGGKTVEEVKRHYEILVEDLKHIEQGLV  64

Query  299  PLPNYR-----ATESSSRGFASNEQRL  364
            PLP YR      +   S  +   EQRL
Sbjct  65   PLPKYRNASTIGSSIKSYSYIDEEQRL  91



>ref|XP_010429089.1| PREDICTED: protein RADIALIS-like 2 [Camelina sativa]
Length=103

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 66/89 (74%), Gaps = 3/89 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE ALA+YD++TPDRW+ +AR V GK+ EE +RQYE+L +DI  IEN  VP 
Sbjct  15   WTVKQNKAFERALAVYDQDTPDRWYNVARAVGGKTPEEAKRQYELLVRDIESIENGHVPF  74

Query  305  PNYRATESSSRGFA--SNEQRLLRNLKLR  385
             +Y+ T +++RG     +E++ +R++KL+
Sbjct  75   SDYKTTGATNRGGGRLRDEEKRMRSMKLQ  103



>ref|NP_564087.2| protein RADIALIS-like 5 [Arabidopsis thaliana]
 sp|Q8GW75.1|RADL5_ARATH RecName: Full=Protein RADIALIS-like 5; Short=AtRL5; Short=Protein 
RAD-like 5; AltName: Full=Protein RADIALIS-LIKE SANT/MYB 
4; Short=Protein RSM4 [Arabidopsis thaliana]
 dbj|BAC43610.1| putative myb-related protein [Arabidopsis thaliana]
 gb|AAO64077.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAS09994.1| MYB transcription factor [Arabidopsis thaliana]
 gb|ABD24443.1| RAD-like protein 5 [Arabidopsis thaliana]
 gb|AEE29862.1| protein RADIALIS-like 5 [Arabidopsis thaliana]
Length=100

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = +2

Query  137  KQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPLPNY  313
            KQNK FE ALA+YDK+TPDRW  +A+ VG KS EEV+R Y+IL +D+M IE D VPLP Y
Sbjct  15   KQNKMFERALAVYDKDTPDRWQNVAKAVGSKSAEEVKRHYDILVEDLMNIEQDLVPLPKY  74

Query  314  RATE--SSSRGFASNEQRLLRNLKLR  385
            +  +  S SRG    + RL++N++++
Sbjct  75   KTVDVGSKSRGIDDFDLRLMKNMRIQ  100



>ref|XP_002310812.1| hypothetical protein POPTR_0007s13000g [Populus trichocarpa]
 gb|EEE91262.1| hypothetical protein POPTR_0007s13000g [Populus trichocarpa]
Length=78

 Score = 95.9 bits (237),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            + SWT KQNK FE+ALA++DK+TPDRWH +A+ V GKS EEV+R YEIL KD+ +IE+  
Sbjct  6    LTSWTPKQNKLFEKALALHDKDTPDRWHNVAKAVGGKSAEEVKRHYEILIKDVREIESGR  65

Query  296  VPLPNYRATESSS  334
            VP PNYR++ + +
Sbjct  66   VPFPNYRSSGNGN  78



>ref|XP_010428536.1| PREDICTED: protein RADIALIS-like 6 [Camelina sativa]
Length=100

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT  QNK FE ALAIYDK+TPDRWH +A+ V GKS+EEV+R Y+IL +D++ IE   VPL
Sbjct  13   WTFDQNKMFERALAIYDKDTPDRWHNVAKAVEGKSVEEVKRHYDILVEDLINIETGRVPL  72

Query  305  PNY--RATESSSRGFASNEQRLLRNLKL  382
            P Y  +  +S SR       R+++NLK+
Sbjct  73   PKYKNKTFDSKSRVVNDLNSRMMKNLKI  100



>ref|XP_010102082.1| DnaJ homolog subfamily C member 1 [Morus notabilis]
 gb|EXB91932.1| DnaJ homolog subfamily C member 1 [Morus notabilis]
Length=94

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK FE ALA+YDK+ PDRW  +A+ V GK+ EEV+R Y+IL +D++ IE+ + 
Sbjct  14   SSWTPKQNKLFEMALAVYDKDAPDRWQNVAKAVGGKTAEEVKRHYDILVQDLINIESGQF  73

Query  299  PLPNYRATESSSRGFASNEQR  361
            P+PNYR   S+  G   +EQR
Sbjct  74   PIPNYRGARSNPAGGFGDEQR  94



>gb|EPS58348.1| hypothetical protein M569_16468 [Genlisea aurea]
Length=93

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WTAKQNK FE+ALA YD++TPDRW  +AR V GKS+E+V+R Y+ L +DI  IE+ +V
Sbjct  5    STWTAKQNKAFEDALATYDRDTPDRWQNLARAVGGKSVEDVKRHYQKLVQDINHIESGKV  64

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKLR  385
            P+PNYR T +     A  +++ +  LKL+
Sbjct  65   PVPNYRDTNNGYSKMAEAQEQRMTYLKLQ  93



>ref|XP_010498374.1| PREDICTED: protein RADIALIS-like 5 [Camelina sativa]
 ref|XP_010459622.1| PREDICTED: protein RADIALIS-like 5 [Camelina sativa]
Length=100

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = +2

Query  137  KQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPLPNY  313
            KQNK FE ALA+YDK+TPDRW  +A+ VG KS EEV+R Y+IL +D+M IE D VPLP Y
Sbjct  15   KQNKMFERALAVYDKDTPDRWQNVAKAVGSKSAEEVKRHYDILVEDLMNIEQDLVPLPKY  74

Query  314  RATE--SSSRGFASNEQRLLRNLKLR  385
            +  +  S SRG    + RL++N++++
Sbjct  75   KTVDVGSKSRGINDFDLRLMKNMRIQ  100



>ref|XP_008782489.1| PREDICTED: protein RADIALIS-like 3 isoform X1 [Phoenix dactylifera]
Length=96

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK FE ALA+YDK+TPDRW  +AR V GKS EEV+R YE+L +D+  IE+ +V
Sbjct  12   SSWTPKQNKLFERALAVYDKDTPDRWQNVARAVGGKSAEEVKRHYELLVEDLKHIESGQV  71

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKL  382
            P PNY    SS     S+E++ L  LKL
Sbjct  72   PFPNYYTITSS----GSDEEQRLSYLKL  95



>ref|XP_003612028.1| MYB transcription factor MYB164 [Medicago truncatula]
Length=80

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDEV  298
            MASWTA+QNK FEEALAIYD+ETPDRWH +A+ VGKS+E+V+R YEIL++DI +IE  EV
Sbjct  1    MASWTARQNKLFEEALAIYDRETPDRWHNVAKVVGKSVEDVKRHYEILKEDIKRIERGEV  60



>ref|XP_003629426.1| MYB transcription factor MYB164 [Medicago truncatula]
 gb|AET03902.1| MYB family transcription factor [Medicago truncatula]
Length=73

 Score = 95.5 bits (236),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDE  295
            +  SWTA+QNK FE+ALA+YD+ETP+RWH +A+ VGKS+E+V+  YEIL++D+ +IE+  
Sbjct  1    MATSWTARQNKLFEQALALYDRETPERWHNVAKVVGKSVEDVKSHYEILKEDVQRIEHGH  60

Query  296  VPLPNYRATESSS  334
            +P P Y+   ++S
Sbjct  61   IPFPRYKTNTNNS  73



>emb|CDY13797.1| BnaA09g42990D [Brassica napus]
Length=103

 Score = 96.7 bits (239),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
             SWT KQNK FE ALA YD++TPDRW+ +AR VG +  +E +RQY+IL +DI  IEN  V
Sbjct  12   GSWTVKQNKAFERALATYDEDTPDRWYNVARAVGGTTPDEAKRQYDILVRDIESIENGHV  71

Query  299  PLPNYRATESSSRGFASNEQR  361
            P PNY+ T  S++G   +E++
Sbjct  72   PFPNYKTTGGSTKGRLRDEEK  92



>emb|CDY59758.1| BnaC08g49320D [Brassica napus]
Length=103

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
             SWT KQNK FE ALA YD++TPDRW+ +AR VG +  +E +RQY+IL +DI  IEN  V
Sbjct  12   GSWTVKQNKAFERALATYDEDTPDRWYNVARAVGGTTPDEAKRQYDILVRDIESIENGHV  71

Query  299  PLPNYRATESSSRGFASNEQR  361
            P PNY+ T  S++G   +E++
Sbjct  72   PFPNYKTTGGSTKGKLRDEEK  92



>ref|XP_006434998.1| hypothetical protein CICLE_v10003726mg, partial [Citrus clementina]
 gb|ESR48238.1| hypothetical protein CICLE_v10003726mg, partial [Citrus clementina]
Length=90

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WTAKQNK FE ALAIYDK+TPDRWH +AR V GK++EEV+R YE+L +D+ +IE  E+
Sbjct  6    STWTAKQNKLFENALAIYDKDTPDRWHNLARAVGGKTVEEVKRHYEMLAEDVSRIEAGEI  65

Query  299  PLPNYRATESSSR  337
            PLP+Y+    +++
Sbjct  66   PLPDYKKIGGTNK  78



>ref|XP_011037522.1| PREDICTED: protein RADIALIS-like 2 [Populus euphratica]
Length=88

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTA+QNK FE ALA+YDK+TPDRWH +AR V GK+ EEV+R YE+L +D+  IE+  VP 
Sbjct  14   WTAQQNKAFERALAVYDKDTPDRWHNVARAVGGKTAEEVKRHYELLVEDVKHIESGRVPF  73

Query  305  PNYRATESSS  334
            PNYR T ++ 
Sbjct  74   PNYRTTGANG  83



>ref|XP_007136596.1| hypothetical protein PHAVU_009G058100g [Phaseolus vulgaris]
 gb|ESW08590.1| hypothetical protein PHAVU_009G058100g [Phaseolus vulgaris]
Length=97

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 4/78 (5%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVP  301
             WT KQNK+FE ALAI+DK+TPDRWH +AR V GK++E+V+R YE L +D+ QIE   VP
Sbjct  6    GWTPKQNKRFENALAIFDKDTPDRWHNLARAVGGKTVEDVKRHYEKLVEDVKQIEEGHVP  65

Query  302  LPNYR--ATESSS-RGFA  346
            LPNYR  AT + S RG++
Sbjct  66   LPNYRTVATMAGSIRGYS  83



>ref|XP_010089027.1| hypothetical protein L484_020313 [Morus notabilis]
 gb|EXB37254.1| hypothetical protein L484_020313 [Morus notabilis]
Length=97

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEVP  301
            +WTA+QNK FE ALAIYDKE PDRW KIA+ VG +  EE++RQYEIL++DI +IE+ ++P
Sbjct  16   TWTAEQNKLFENALAIYDKEEPDRWLKIAKVVGGATEEEIKRQYEILQEDINRIESGKIP  75

Query  302  LPNYRATESSSRG  340
            LP YR  + SS+G
Sbjct  76   LPKYRKDQGSSKG  88



>emb|CAB43640.1| putative protein [Arabidopsis thaliana]
 emb|CAB80588.1| putative protein [Arabidopsis thaliana]
 gb|AAS09997.1| MYB transcription factor [Arabidopsis thaliana]
 gb|ABD57475.1| At4g39250 [Arabidopsis thaliana]
Length=97

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA YD++TP+RW  +A+ V GK+ EEV+R YE+L +DI  IEN  VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLVQDINSIENGHVPF  73

Query  305  PNYRATESSSRGFASNEQR  361
            PNYR +   + G  S E++
Sbjct  74   PNYRTSGGCTNGRLSQEEK  92



>ref|XP_009380360.1| PREDICTED: protein RADIALIS-like 3 [Musa acuminata subsp. malaccensis]
Length=98

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTA+QNK FE ALA+YDK+TPDRW  +AR V GK+++EV+R YE+L +D+  IE++ VP 
Sbjct  14   WTAQQNKLFERALAVYDKDTPDRWQNVARAVGGKTVDEVKRHYELLVEDLKFIESNRVPY  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            P Y++  SSSR   ++E++ LR LKL+
Sbjct  74   PYYKS--SSSRAGGADEEQRLRCLKLQ  98



>ref|XP_007156943.1| hypothetical protein PHAVU_002G030400g [Phaseolus vulgaris]
 gb|ESW28937.1| hypothetical protein PHAVU_002G030400g [Phaseolus vulgaris]
Length=99

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDEVPLP  307
            WT ++NK FE ALAIYDK+TPDRW+ IA +VG++  EV+RQYE+L +DI  IE+ +VPLP
Sbjct  15   WTPQKNKLFENALAIYDKDTPDRWNNIAMFVGETEAEVKRQYEMLLEDIKNIESGKVPLP  74

Query  308  NYRATESSSRGFASNEQRLLRNLKL  382
             YR      +   +N ++ LR+LKL
Sbjct  75   AYRRNAGCDKVTINNAEQRLRDLKL  99



>gb|KHG17860.1| DnaJ subfamily C member 2 [Gossypium arboreum]
Length=94

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 3/90 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WT KQNK FE ALAIYDK+TPDRWHK+AR V GK++EEV+  Y+ L  DI QIE+  V
Sbjct  5    SNWTPKQNKLFENALAIYDKDTPDRWHKLARAVGGKTVEEVKLHYQNLVDDIKQIESGHV  64

Query  299  PLPNYR--ATESSSRGFASNEQRLLRNLKL  382
            PLP Y+          F  +E+  +RNL+L
Sbjct  65   PLPPYKKAGGNKGYNNFMDDEEPRMRNLRL  94



>ref|XP_003629427.1| RAD [Medicago truncatula]
 ref|XP_003629428.1| RAD [Medicago truncatula]
 gb|AET03903.1| MYB family transcription factor [Medicago truncatula]
 gb|AET03904.1| MYB family transcription factor [Medicago truncatula]
 gb|AFK46364.1| unknown [Medicago truncatula]
Length=72

 Score = 95.1 bits (235),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDE  295
            +  SWTA+QNK FE+ALA+YD+ETP+RWH +A+ VGKS+E+V+  YEIL++D+ +IE+  
Sbjct  1    MATSWTARQNKLFEQALALYDRETPERWHNVAKVVGKSVEDVKSHYEILKEDVQRIEHGH  60

Query  296  VPLPNYRATESS  331
            +P P Y+   +S
Sbjct  61   IPFPRYKTNTNS  72



>emb|CDP07510.1| unnamed protein product [Coffea canephora]
Length=94

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WTAKQNK FE ALA YDK+TPDR+H +A+ V GK++EEV+R YE+L +DI  IE+ +V
Sbjct  5    STWTAKQNKLFENALATYDKDTPDRFHNLAKAVGGKTVEEVKRHYEMLVQDINHIESGKV  64

Query  299  PLPNYRATESSSRGFA-SNEQRLLRNLKLR  385
            PLPNY +  +S++ +   +E++ ++ LKL+
Sbjct  65   PLPNYSSNGNSNKEYQYMHEEQRMKYLKLQ  94



>ref|XP_010060952.1| PREDICTED: protein RADIALIS-like 3 [Eucalyptus grandis]
 gb|KCW67848.1| hypothetical protein EUGRSUZ_F01569 [Eucalyptus grandis]
Length=97

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 70/93 (75%), Gaps = 5/93 (5%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG--KSIEEVRRQYEILEKDIMQIENDE  295
            ++WT KQNK FE ALAIYD++ PDRW  +AR VG  KS+E+V+R YE+L +D+ QIE  +
Sbjct  5    STWTPKQNKLFENALAIYDRDAPDRWQNLARAVGGNKSVEDVKRHYEMLVEDVNQIEAGQ  64

Query  296  VPLPNYRA-TESSSRGFAS--NEQRLLRNLKLR  385
            VPLPNYR     +S+G +S  +E++ L++L+++
Sbjct  65   VPLPNYRKLAGPNSKGCSSFMDEEQRLKSLRIQ  97



>gb|AGT17349.1| hypothetical protein SHCRBa_078_K12_R_140 [Saccharum hybrid cultivar 
R570]
Length=88

 Score = 95.5 bits (236),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIENDE  295
            A WT +QNK FE+ALA+YDK+TPDRWH IAR V  GKS E+VRR Y++LE+D+ +IE+ +
Sbjct  14   AQWTPRQNKLFEQALAVYDKDTPDRWHNIARAVGGGKSAEDVRRYYDLLEQDVGRIESGK  73

Query  296  VPLPNYRAT  322
            VP P YR +
Sbjct  74   VPFPAYRCS  82



>ref|XP_010029788.1| PREDICTED: protein RADIALIS-like 4 [Eucalyptus grandis]
Length=80

 Score = 95.1 bits (235),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +2

Query  113  LLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIEN  289
            L  +SWT KQNK FE+ALA YDK+TPDRW KIA+ V GKS +EV+R YEIL +D+  IE+
Sbjct  6    LTSSSWTPKQNKMFEKALAQYDKDTPDRWQKIAKAVGGKSADEVKRHYEILIEDVKHIES  65

Query  290  DEVPLPNYRATESSS  334
              VP PNYR++ +S 
Sbjct  66   GRVPFPNYRSSNNSG  80



>ref|XP_003537885.2| PREDICTED: protein RADIALIS-like 1-like [Glycine max]
 gb|KHN39786.1| DnaJ like subfamily C member 2 [Glycine soja]
Length=100

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK FE+ALA YDK+TP+RW  +A+ V GKS +EV+R YEIL +D+  IE+  V
Sbjct  14   SSWTPKQNKLFEKALAKYDKDTPERWQNVAKAVGGKSADEVKRHYEILLEDLRHIESGRV  73

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKL  382
            PLP Y++T SS+      E+RLL+ LKL
Sbjct  74   PLPKYKSTGSSTN--VDEEERLLKYLKL  99



>ref|XP_011083676.1| PREDICTED: protein RADIALIS-like 4 [Sesamum indicum]
Length=95

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WTAKQNK+FE+ALA+YDK+TPDRW  +AR V GK++EEV+  Y+ L +DI  IE+ +V
Sbjct  5    STWTAKQNKRFEDALAMYDKDTPDRWQNLARAVGGKTVEEVKSHYQKLVEDIDHIESGKV  64

Query  299  PLPNYR--ATESSSRGFASNEQRLLRNLKLR  385
            PLP+YR     +  +    ++++ LR+LKLR
Sbjct  65   PLPDYRPYGEAAKEKKIMDDQEQRLRSLKLR  95



>gb|AEV91165.1| MYB-related protein [Aegilops speltoides]
 gb|EMT01033.1| DnaJ homolog subfamily C member 2 [Aegilops tauschii]
Length=96

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIEN  289
            + A WT KQNK FE+ALA++D++TPDRWH IAR V  GKS ++VRR YE+L  DI +IE 
Sbjct  6    MSAGWTPKQNKLFEQALAVHDRDTPDRWHNIARAVGGGKSADDVRRYYELLVHDIARIEA  65

Query  290  DEVPLPNYRATESSSRGFASNEQRLLRNLKL  382
             +VP P YR         AS E   L++LK+
Sbjct  66   GKVPFPAYRPPCPGPGHNASYEADRLKHLKI  96



>gb|KHN08900.1| hypothetical protein glysoja_029477 [Glycine soja]
Length=97

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 4/88 (5%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SW+ K NK FE+ALA+YDK+TPDRW+ +A  V GK+ EEV+R YE+L +D+  IE+  V
Sbjct  10   GSWSVKDNKAFEKALAVYDKDTPDRWYNVAHAVGGKTPEEVKRHYELLVQDVKHIESGRV  69

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKL  382
            P PNY+ T S S      E++ LRNL L
Sbjct  70   PFPNYKKTTSES---TDQEEKRLRNLNL  94



>emb|CAN75513.1| hypothetical protein VITISV_020771 [Vitis vinifera]
Length=168

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FEEALA+YDK TPDRW  IA+ VG KS EEV+R YEILE+D+M IEN +VPL
Sbjct  16   WTQKQNKLFEEALALYDKNTPDRWANIAKAVGGKSAEEVKRHYEILEQDVMHIENGQVPL  75

Query  305  PNYR  316
            P YR
Sbjct  76   PIYR  79



>ref|XP_002441574.1| hypothetical protein SORBIDRAFT_09g029560 [Sorghum bicolor]
 gb|EES20004.1| hypothetical protein SORBIDRAFT_09g029560 [Sorghum bicolor]
Length=88

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIENDE  295
            A WT KQNK FE+ALA+YDK+TPDRWH IAR V  GKS E+VRR Y++LE+D+  IE+ +
Sbjct  14   AQWTPKQNKLFEQALAVYDKDTPDRWHNIARAVGGGKSAEDVRRYYDLLEEDVGHIESGK  73

Query  296  VPLPNYRAT  322
            VP P YR  
Sbjct  74   VPFPAYRCA  82



>ref|XP_008364991.1| PREDICTED: protein RADIALIS-like 3 [Malus domestica]
 ref|XP_009365559.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
Length=95

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SWTA+QNK FE ALA+YDK+TP+RW+ +AR V GKS+EEV+R Y++L +D+ +IE  EV
Sbjct  5    GSWTARQNKLFENALAVYDKDTPERWYNLARAVGGKSVEEVKRHYQMLVEDVNKIEAGEV  64

Query  299  PLPNYRATESSS  334
            PLPNYR +   +
Sbjct  65   PLPNYRKSGGGN  76



>gb|KHN00535.1| hypothetical protein glysoja_000203 [Glycine soja]
Length=73

 Score = 94.4 bits (233),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDE  295
            + +SWT +QNK FE+ALA+YD+ETPDRW  +A  VG+S+E+V+R YEIL++D+ +IE+ +
Sbjct  1    MASSWTPRQNKLFEQALALYDRETPDRWQNVANVVGRSVEDVKRHYEILKEDVKRIEHGQ  60

Query  296  VPLPNYRATESSS  334
            VP P Y+   S++
Sbjct  61   VPFPRYKTNTSNN  73



>emb|CDY59631.1| BnaC07g48440D [Brassica napus]
Length=98

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = +2

Query  137  KQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPLPNY  313
            KQNK FE ALA+YDK+TPDRW  +A+ VG KS EEV+R Y+IL +D+M IE D VPLP Y
Sbjct  13   KQNKMFERALAVYDKDTPDRWQNVAKAVGNKSAEEVKRHYDILVEDLMNIEQDLVPLPKY  72

Query  314  RATE--SSSRGFASNEQRLLRNLKLR  385
            +  +  + SRG    + RL++N++++
Sbjct  73   KTVDVGNKSRGINDYDLRLMKNMRIQ  98



>ref|XP_009340740.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
Length=76

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIEND  292
            L +SWT KQNK+FE+ALA+YDK+TPDRW K+AR V GKS EEV+R YE+L +D+  IE+ 
Sbjct  7    LSSSWTPKQNKQFEKALALYDKDTPDRWQKVARAVGGKSAEEVKRHYELLIEDVKHIESG  66

Query  293  EVPLPNYRA  319
             VP P+YR 
Sbjct  67   RVPFPDYRG  75



>ref|XP_008795931.1| PREDICTED: protein RADIALIS-like 3 [Phoenix dactylifera]
Length=95

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 63/92 (68%), Gaps = 6/92 (7%)
 Frame = +2

Query  110  RLLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIE  286
            R   +SWT KQNK FE ALA+YDK+TPDRW  +AR V GKS EEV+R YE+L +D+  IE
Sbjct  8    RSTGSSWTPKQNKLFERALAVYDKDTPDRWQNVARAVGGKSAEEVKRHYELLVEDLKHIE  67

Query  287  NDEVPLPNYRATESSSRGFASNEQRLLRNLKL  382
            + +VP PNY    S+      +E++ LR LKL
Sbjct  68   SGQVPFPNYNNNSST-----MDEEQRLRYLKL  94



>ref|XP_009340748.1| PREDICTED: protein RADIALIS-like 4 [Pyrus x bretschneideri]
Length=97

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 4/88 (5%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
            ++WTAKQNK FE ALA YD+ETPDRW  IAR VG    EEV+RQYEIL  DI +IE+ +V
Sbjct  13   STWTAKQNKLFENALATYDRETPDRWSNIARIVGGMTEEEVKRQYEILLADINRIESGKV  72

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKL  382
            PLP YR    S+    S+E+  L+ LKL
Sbjct  73   PLPKYRKVGESN---ISSEEERLKTLKL  97



>ref|XP_009140298.1| PREDICTED: protein RADIALIS-like 2 [Brassica rapa]
Length=100

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
             +WT KQ+K FE ALA YD+++PDRW+ +AR VG +  +E +RQYE+L +DI  IEN  V
Sbjct  12   GAWTVKQSKAFESALATYDQDSPDRWYNVARAVGGTTPDEAKRQYELLVRDIESIENGHV  71

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKLR  385
              PNY+    S++G   +E++ +R++KL+
Sbjct  72   AFPNYKTNGGSTKGRLRDEEKRMRSMKLQ  100



>ref|XP_011003722.1| PREDICTED: protein RADIALIS-like 3 [Populus euphratica]
Length=85

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 57/70 (81%), Gaps = 1/70 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE+ALA+YDK+TPDRWH +A+ V GKS EEV+R YEIL +D+ +IE+  VP 
Sbjct  16   WTPKQNKLFEKALALYDKDTPDRWHNVAKAVGGKSAEEVQRHYEILIRDVREIESGRVPF  75

Query  305  PNYRATESSS  334
            PNYR++ +S+
Sbjct  76   PNYRSSGNSN  85



>ref|XP_007042177.1| DnaJ subfamily C member 2 [Theobroma cacao]
 gb|EOX98008.1| DnaJ subfamily C member 2 [Theobroma cacao]
Length=139

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 6/80 (8%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVP  301
            SWTAKQNK FE+ALA YDK+TPDRWH +A+ V GK+ EEV+R YEIL +D+  IE+  VP
Sbjct  13   SWTAKQNKLFEKALAKYDKDTPDRWHNVAKAVGGKTAEEVKRHYEILVEDLKHIESGRVP  72

Query  302  LPNYRATESSSRGFASNEQR  361
            +PNYR+T     G A  E+R
Sbjct  73   IPNYRST-----GNADEEER  87



>ref|XP_006878579.1| hypothetical protein AMTR_s00011p00247840 [Amborella trichopoda]
 gb|ERM94724.1| hypothetical protein AMTR_s00011p00247840 [Amborella trichopoda]
Length=103

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = +2

Query  110  RLLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGK-SIEEVRRQYEILEKDIMQIE  286
            R    SWTAKQNK FE+ALAIYDK+TPDRWHK+AR VG  S EEV+R+YE L +D+  IE
Sbjct  8    RFSSPSWTAKQNKSFEKALAIYDKDTPDRWHKVAREVGGTSAEEVKREYERLIEDLKDIE  67

Query  287  NDEVPLPNYRATESSSRG---FASNEQRLLRNLKLR  385
            + + P P Y+++   S        +E+RLLR LKL+
Sbjct  68   SGKFPDPIYKSSGGGSSRGSKLTEDEERLLRRLKLQ  103



>ref|XP_011025788.1| PREDICTED: protein RADIALIS-like 3 [Populus euphratica]
Length=100

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%), Gaps = 3/90 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
            ++W+ ++NK FE ALAIYDK++PDRW  IA +VG++  EEVR+QYEIL  DI +IE+D+V
Sbjct  11   SNWSEQKNKLFENALAIYDKDSPDRWRNIATFVGETTEEEVRKQYEILLDDIKRIESDQV  70

Query  299  PLPNYRATESSSR--GFASNEQRLLRNLKL  382
            PLPNY+  E S +     SNE   L+ LKL
Sbjct  71   PLPNYKNHEESFKENSIMSNEGDRLQQLKL  100



>ref|XP_009779120.1| PREDICTED: protein RADIALIS-like 4 [Nicotiana sylvestris]
Length=96

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 64/89 (72%), Gaps = 5/89 (6%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIENDEV  298
            SWT +QNK FE ALA +DK+TPDRW  +AR V  GKS++EV+R YEIL +D+ +IE+  V
Sbjct  9    SWTPQQNKLFERALAQFDKDTPDRWQNVARAVGGGKSVDEVKRHYEILIEDLRRIESGLV  68

Query  299  PLPNYRATESSSRGFASN-EQRLLRNLKL  382
            PLP YR     + G A++ EQRLLR L L
Sbjct  69   PLPTYR--NGGTTGVAADEEQRLLRYLNL  95



>ref|XP_006573585.1| PREDICTED: protein RADIALIS-like 1-like [Glycine max]
Length=114

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 64/88 (73%), Gaps = 3/88 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIE-EVRRQYEILEKDIMQIENDEVPL  304
            WT ++NK FE ALAIYDK+TP+RW+ IA +VG + E EV+RQYEIL +DI  IE+ +VPL
Sbjct  28   WTTEKNKLFENALAIYDKDTPERWNNIAMFVGGTTEVEVKRQYEILLEDIKNIESGKVPL  87

Query  305  PNY-RATESSSRGFASNEQRLLRNLKLR  385
            P+Y R         +S EQR LR+LKLR
Sbjct  88   PDYTRNAGCGKLNISSAEQR-LRDLKLR  114



>ref|NP_001056421.1| Os05g0579600 [Oryza sativa Japonica Group]
 dbj|BAF18335.1| Os05g0579600 [Oryza sativa Japonica Group]
 gb|EAY99166.1| hypothetical protein OsI_21125 [Oryza sativa Indica Group]
 dbj|BAH01047.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64813.1| hypothetical protein OsJ_19669 [Oryza sativa Japonica Group]
Length=90

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIENDE  295
            A W  KQNK FE+ALA+YDKETPDRWH IAR V  GKS E+V+R YE+LE+DI  IE+ +
Sbjct  7    AQWPQKQNKLFEQALAVYDKETPDRWHNIARAVGGGKSAEDVKRYYEMLEEDIKHIESGK  66

Query  296  VPLPNYRATESSS  334
            VP P YR   ++ 
Sbjct  67   VPFPAYRCPAAAG  79



>ref|XP_010095252.1| hypothetical protein L484_014592 [Morus notabilis]
 gb|EXB59098.1| hypothetical protein L484_014592 [Morus notabilis]
Length=84

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT  QNK+FE ALA+YDK+TPDRW K+AR V GKS EEV+R YEILE+DI  IE+ +VP 
Sbjct  15   WTPTQNKQFERALALYDKDTPDRWQKVARAVGGKSAEEVKRHYEILEEDIRHIESGKVPF  74

Query  305  PNYRATESSS  334
            P YR+   SS
Sbjct  75   PIYRSAGKSS  84



>ref|XP_009103382.1| PREDICTED: protein RADIALIS-like 5 [Brassica rapa]
Length=98

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = +2

Query  137  KQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPLPNY  313
            KQNK FE ALA+YDK+TPDRW  +A+ VG KS EEV+R Y+IL +D+M IE D VPLP Y
Sbjct  13   KQNKIFERALAVYDKDTPDRWQNVAKAVGNKSAEEVKRHYDILVEDLMNIEQDLVPLPKY  72

Query  314  RATE--SSSRGFASNEQRLLRNLKLR  385
            +  +  + SRG    + RL++N++++
Sbjct  73   KTVDVGNKSRGINDYDLRLMKNMRIQ  98



>sp|Q58FS3.1|RAD_ANTMA RecName: Full=Transcription factor RADIALIS [Antirrhinum majus]
 pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription 
Factor From Antirrhinum Majus
 gb|AAX48042.1| RADIALIS [Antirrhinum majus]
Length=93

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 62/87 (71%), Gaps = 5/87 (6%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            W+AK+NK FE ALA+YDK+TPDRW  +AR V G++ EEV++ YEIL +DI  IE+ +VP 
Sbjct  11   WSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF  70

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNYR T     G    +++  RNLK+R
Sbjct  71   PNYRTTG----GNMKTDEKRFRNLKIR  93



>ref|XP_009347537.1| PREDICTED: protein RADIALIS-like 4 [Pyrus x bretschneideri]
Length=97

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 3/82 (4%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
            ++WTAKQNK FE ALA YD+ETPDRW  IAR VG    EEV+RQYEIL  DI +IE+ +V
Sbjct  13   STWTAKQNKLFENALATYDRETPDRWSNIARIVGGMTEEEVKRQYEILLADINRIESGKV  72

Query  299  PLPNYRATESSSRGFASNEQRL  364
            PLP YR    S+   +S E+RL
Sbjct  73   PLPKYRKVGESN--ISSGEERL  92



>emb|CDY42615.1| BnaC01g00270D [Brassica napus]
Length=95

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 64/87 (74%), Gaps = 6/87 (7%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA YD++TP+RWH +A+ V GK+ EEV+R YE+L +DI  IE   VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWHNVAQVVGGKTTEEVKRHYELLVQDINSIETGHVPF  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNY+   ++ R F   E++ +RN++L+
Sbjct  74   PNYK---TNGRQF--QEEKRMRNMRLQ  95



>ref|XP_006303004.1| hypothetical protein CARUB_v10021157mg, partial [Capsella rubella]
 gb|EOA35902.1| hypothetical protein CARUB_v10021157mg, partial [Capsella rubella]
Length=121

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +2

Query  140  QNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPLPNYR  316
            QNK FE ALAIYDK+TPDRWH +A+ V GKS+EEV+  Y+IL +D++ IE+  VPLP Y+
Sbjct  39   QNKMFERALAIYDKDTPDRWHNVAKAVEGKSVEEVKHHYDILVEDLINIESGRVPLPKYK  98

Query  317  ATESSSRGFASNEQRLL-RNLKL  382
              ES  RG +  + R++ +NLK+
Sbjct  99   TMESKPRGTSDFDTRVMKKNLKI  121



>ref|XP_010477169.1| PREDICTED: protein RADIALIS-like 5 [Camelina sativa]
Length=102

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = +2

Query  137  KQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPLPNY  313
            KQNK FE ALA+YDK+TPDRW  +A+ VG KS EEV+R Y+IL +D+M IE D VPLP Y
Sbjct  15   KQNKMFERALAVYDKDTPDRWQNVAKAVGSKSAEEVKRHYDILVEDLMNIEQDLVPLPKY  74

Query  314  RAT----ESSSRGFASNEQRLLRNLKLR  385
            + T      S RG    + RL++N++++
Sbjct  75   KTTVDAGSKSRRGINDFDLRLMKNMRIQ  102



>ref|XP_009107919.1| PREDICTED: protein RADIALIS-like 1 [Brassica rapa]
Length=95

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 63/87 (72%), Gaps = 6/87 (7%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA YD++TP+RWH +A+ V GK+ EEV+R YE+L +DI  IEN  VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWHNVAQVVGGKTTEEVKRHYELLVQDINSIENGLVPF  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNY     ++ G    E++ +RN++L+
Sbjct  74   PNY-----NTNGRLFQEEKRMRNMRLQ  95



>ref|XP_004500809.1| PREDICTED: protein RADIALIS-like 6-like [Cicer arietinum]
Length=81

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +2

Query  107  HRLLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQI  283
            H+L  ++WT KQNK FE+ALA YDK+TPDRW  +A+ VG KS+EEV+R YEIL +D+  I
Sbjct  9    HKLCDSTWTPKQNKLFEKALAKYDKDTPDRWINVAKAVGEKSVEEVKRHYEILLEDLKHI  68

Query  284  ENDEVPLPNYRAT  322
            E+  VP+PNY++T
Sbjct  69   ESGRVPIPNYKST  81



>ref|XP_006416498.1| hypothetical protein EUTSA_v10009748mg [Eutrema salsugineum]
 gb|ESQ34851.1| hypothetical protein EUTSA_v10009748mg [Eutrema salsugineum]
Length=100

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = +2

Query  137  KQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPLPNY  313
            KQNK FE ALA+YDK+TPDRW  +A+ VG KS EEV+  Y+IL +D+M IE D VPLP Y
Sbjct  15   KQNKMFERALAVYDKDTPDRWQNVAKAVGSKSAEEVKSHYDILLEDLMNIEQDLVPLPKY  74

Query  314  RATE--SSSRGFASNEQRLLRNLKLR  385
            +  +  S SRG    + RL++N++++
Sbjct  75   KTVDAGSKSRGINGFDLRLMKNMRIQ  100



>ref|XP_011037518.1| PREDICTED: protein RADIALIS-like 4 isoform X1 [Populus euphratica]
Length=97

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 67/90 (74%), Gaps = 7/90 (8%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG--KSIEEVRRQYEILEKDIMQIENDE  295
            +SWT ++NK FE+ALA++DK+TPDRW  IA+ VG  KS EEV+R YEIL +D+  IE+  
Sbjct  13   SSWTPRENKLFEKALALFDKDTPDRWQNIAKAVGGVKSAEEVKRHYEILIEDLKYIESGR  72

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            VP+PNYR+  S++      E+RLL+ +KL+
Sbjct  73   VPIPNYRSCSSTNE-----EERLLKYVKLQ  97



>ref|XP_009406294.1| PREDICTED: protein RADIALIS-like 3 [Musa acuminata subsp. malaccensis]
Length=79

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            + WTAKQNK FE+ALA+YDK+TPDRWH +AR V GKS EEV+R YE+L  DI+ IE  ++
Sbjct  8    SCWTAKQNKMFEKALAVYDKDTPDRWHNVARAVGGKSAEEVKRHYELLVADIILIEKGQM  67

Query  299  PLPNYRATESSSRG  340
            P  NYR+  S  RG
Sbjct  68   PRANYRS--SGHRG  79



>ref|XP_002310232.1| hypothetical protein POPTR_0007s12860g [Populus trichocarpa]
 gb|EEE90682.1| hypothetical protein POPTR_0007s12860g [Populus trichocarpa]
Length=92

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             +W+A+QNK FE ALAIYDK+TPDRW KIA+ V G + +EV++QYEIL  DI  IE+D+V
Sbjct  11   TNWSAEQNKLFENALAIYDKDTPDRWGKIAKIVKGTTEDEVKQQYEILLDDIKSIESDKV  70

Query  299  PLPNYRATESSSRGFASNEQ  358
            PLPNY+   SS      NE+
Sbjct  71   PLPNYKNEGSSKENIIGNEE  90



>ref|XP_010690880.1| PREDICTED: protein RADIALIS-like 2 [Beta vulgaris subsp. vulgaris]
Length=82

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +2

Query  110  RLLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIE  286
            R    +WT KQNK FE ALAIYD++TPDRWH IAR V GK+ EEV+R YE L +DI  IE
Sbjct  9    RGTGCTWTPKQNKAFERALAIYDRDTPDRWHNIARAVGGKTAEEVKRHYEDLLEDIKNIE  68

Query  287  NDEVPLPNYR  316
            + +VP PNYR
Sbjct  69   SGQVPFPNYR  78



>gb|KHN36130.1| DnaJ like subfamily C member 2 [Glycine soja]
Length=101

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 64/88 (73%), Gaps = 3/88 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIE-EVRRQYEILEKDIMQIENDEVPL  304
            WT ++NK FE ALAIYDK+TP+RW+ IA +VG + E EV+RQYEIL +DI  IE+ +VPL
Sbjct  15   WTTEKNKLFENALAIYDKDTPERWNNIAMFVGGTTEVEVKRQYEILLEDIKNIESGKVPL  74

Query  305  PNY-RATESSSRGFASNEQRLLRNLKLR  385
            P+Y R         +S EQR LR+LKLR
Sbjct  75   PDYTRNAGCGKLNISSAEQR-LRDLKLR  101



>emb|CDY41968.1| BnaA01g05400D [Brassica napus]
Length=95

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 63/87 (72%), Gaps = 6/87 (7%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTAKQNK FE+ALA YD++TP+RWH +A+ V GK+ EEV+R YE+L +DI  IEN  VP 
Sbjct  14   WTAKQNKAFEQALATYDQDTPNRWHNVAQVVGGKTTEEVKRHYELLLQDINSIENGLVPF  73

Query  305  PNYRATESSSRGFASNEQRLLRNLKLR  385
            PNY     ++ G    E++ +RN++L+
Sbjct  74   PNY-----NTNGRLFQEEKRMRNMRLQ  95



>ref|XP_002456020.1| hypothetical protein SORBIDRAFT_03g028960 [Sorghum bicolor]
 gb|EES01140.1| hypothetical protein SORBIDRAFT_03g028960 [Sorghum bicolor]
Length=98

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 2/68 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIENDE  295
            A WTAKQNK FE+ALA+YD++TPDRWH IAR V  GKS +EVRR YE+L KD+  IE  +
Sbjct  11   AQWTAKQNKLFEQALAVYDRDTPDRWHNIARAVGGGKSADEVRRYYELLVKDVEHIEAGK  70

Query  296  VPLPNYRA  319
            VP P YR 
Sbjct  71   VPFPAYRC  78



>ref|NP_001236080.1| MYB transcription factor MYB142 [Glycine max]
 gb|ABH02867.1| MYB transcription factor MYB142 [Glycine max]
Length=97

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 4/86 (5%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SW+ K NK FE+ALA+YDK+TPDRW+ +A  V GK+ EEV+R YE+L +D+  IE+  V
Sbjct  10   GSWSVKDNKAFEKALAVYDKDTPDRWYNVAHAVGGKTPEEVKRHYELLVQDVKHIESGRV  69

Query  299  PLPNYRATESSSRGFASNEQRLLRNL  376
            P PNY+ T S S      E++ LRNL
Sbjct  70   PFPNYKKTTSES---TDQEEKRLRNL  92



>ref|XP_008447023.1| PREDICTED: protein RADIALIS-like 3 [Cucumis melo]
Length=96

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 6/89 (7%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             +WT KQNK FE+ALA+YDK+TP+RW  IA  V GKS +EV+R YEIL +D+ QIE+  V
Sbjct  13   TTWTPKQNKLFEKALALYDKDTPERWQNIATAVGGKSADEVQRHYEILLEDLRQIESGRV  72

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKLR  385
            P+PNYR T  S+R     E RLL+ LKL+
Sbjct  73   PIPNYRGT--SNR---DEELRLLKYLKLQ  96



>ref|XP_007156054.1| hypothetical protein PHAVU_003G254400g [Phaseolus vulgaris]
 gb|ESW28048.1| hypothetical protein PHAVU_003G254400g [Phaseolus vulgaris]
Length=66

 Score = 92.4 bits (228),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDE  295
            + +SWT +QNK FE+ALA+YD+ETPDRW  +A  VGKS+E+V+R YEIL++DI +IE+ +
Sbjct  1    MASSWTQRQNKLFEQALALYDRETPDRWQNVANVVGKSVEDVKRHYEILKEDIKRIEHGQ  60

Query  296  VPLPNY  313
            VP P Y
Sbjct  61   VPFPRY  66



>ref|XP_009602671.1| PREDICTED: protein RADIALIS-like 4 [Nicotiana tomentosiformis]
Length=96

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 64/89 (72%), Gaps = 5/89 (6%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIENDEV  298
            SWT +QNK FE ALA +DK+TPDRW  +AR V  GKS++EV+R YEIL +D+ +IE+  V
Sbjct  9    SWTPQQNKLFERALAHFDKDTPDRWQNVARAVGGGKSVDEVKRHYEILIEDLRRIESGLV  68

Query  299  PLPNYRATESSSRGFASN-EQRLLRNLKL  382
            PLP YR     + G A++ EQRLLR L L
Sbjct  69   PLPTYR--NGGTIGVAADEEQRLLRYLNL  95



>ref|XP_009149439.1| PREDICTED: protein RADIALIS-like 5 [Brassica rapa]
 emb|CDY29424.1| BnaA06g13720D [Brassica napus]
Length=98

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = +2

Query  137  KQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPLPNY  313
            KQNK FE ALA+YDK+TPDRW  +A+ VG KS EEV+R Y+IL +DI  IE D VPLP Y
Sbjct  13   KQNKMFERALAVYDKDTPDRWQNVAKAVGSKSAEEVKRHYDILVEDIENIEQDLVPLPKY  72

Query  314  RATE--SSSRGFASNEQRLLRNLKLR  385
            +  +  S SRG    + RL++N++++
Sbjct  73   KTIDVGSKSRGINDFDLRLMKNMRIQ  98



>ref|XP_008800710.1| PREDICTED: protein RADIALIS-like 1 [Phoenix dactylifera]
Length=79

 Score = 92.8 bits (229),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 3/76 (4%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIEND  292
            L + WT KQNK FE ALA YDK+TPDRWH +AR V GKS EEV+R YE L +DI QIE+ 
Sbjct  6    LSSPWTPKQNKMFETALAKYDKDTPDRWHDVARAVGGKSAEEVKRHYERLVEDIRQIESG  65

Query  293  EVPLPNYRATESSSRG  340
             VP P+YR+  S  RG
Sbjct  66   HVPFPSYRS--SGGRG  79



>ref|XP_004292033.1| PREDICTED: protein RADIALIS-like 6-like [Fragaria vesca subsp. 
vesca]
Length=101

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYVG--KSIEEVRRQYEILEKDIMQIENDEVP  301
            WT KQNK FE ALA+YDK+TPDRW  +A+ VG  K+ EEV+R Y+IL +D+ QIE+ +VP
Sbjct  15   WTPKQNKVFERALALYDKDTPDRWQNVAKAVGGNKTPEEVKRHYDILLEDLRQIESGQVP  74

Query  302  LPNYRATESSSRGFASNEQRLLRNLKLR  385
            +PNY++   ++      E+RLL+ LKL+
Sbjct  75   IPNYKSLGITTTKV-DEEERLLKYLKLQ  101



>ref|XP_002306110.2| hypothetical protein POPTR_0004s16320g [Populus trichocarpa]
 gb|EEE86621.2| hypothetical protein POPTR_0004s16320g [Populus trichocarpa]
Length=100

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 68/90 (76%), Gaps = 4/90 (4%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG--KSIEEVRRQYEILEKDIMQIENDE  295
            +SWT ++NK FE+ALA++DK+TPDRW  IA+ VG  KS EE++R YEIL +D+  IE+  
Sbjct  13   SSWTPRENKLFEKALALFDKDTPDRWQNIAKAVGGVKSAEEMKRHYEILIEDLKHIESGR  72

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            VP+PNY+++ S S    + E+RLL+ +KL+
Sbjct  73   VPIPNYKSSRSYSN--TNEEERLLKYVKLQ  100



>gb|KHN11104.1| hypothetical protein glysoja_033658 [Glycine soja]
Length=68

 Score = 92.0 bits (227),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDEVP  301
            +SWT +QNK FE ALAIYD+ETPDRW  IA+ VGKSIEEV+  YEIL++DI +IE D+VP
Sbjct  3    SSWTPRQNKIFEHALAIYDRETPDRWQNIAKMVGKSIEEVKMHYEILKEDIKRIEQDQVP  62

Query  302  LP  307
             P
Sbjct  63   FP  64



>emb|CDY39383.1| BnaC05g15040D [Brassica napus]
Length=98

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = +2

Query  137  KQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIENDEVPLPNY  313
            KQNK FE ALA+YDK+TPDRW  +A+ VG KS EEV+R Y++L +DI  IE D VPLP Y
Sbjct  13   KQNKMFERALAVYDKDTPDRWQNVAKAVGSKSAEEVKRHYDVLVEDIENIEQDLVPLPKY  72

Query  314  RATE--SSSRGFASNEQRLLRNLKLR  385
            +  +  S SRG    + RL++N++++
Sbjct  73   KTIDVGSKSRGINDFDLRLMKNMRIQ  98



>ref|XP_009603278.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana tomentosiformis]
 ref|XP_009603279.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana tomentosiformis]
Length=79

 Score = 92.4 bits (228),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIEND  292
            +++WT K+NKKFE+ALA+YDK+TPDRW  IA+YV  GKS+E+V++ Y IL +D+  IE+ 
Sbjct  6    LSAWTPKENKKFEQALAVYDKDTPDRWQNIAKYVGGGKSVEDVKQHYAILIEDLKHIESG  65

Query  293  EVPLPNYRATESS  331
            +VP P YR+  +S
Sbjct  66   DVPFPKYRSGGNS  78



>ref|XP_004969265.1| PREDICTED: protein RADIALIS-like 3-like [Setaria italica]
Length=91

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQ+K FE+ALA+YDKETPDRWH IAR V GKS EEVRR YEIL +D+ +IE  +VP 
Sbjct  13   WTKKQDKLFEQALAVYDKETPDRWHNIARAVGGKSAEEVRRYYEILVEDVKRIEAGKVPF  72

Query  305  PNYRATESSS  334
            P YR     +
Sbjct  73   PAYRCPGGGA  82



>ref|XP_011048444.1| PREDICTED: protein RADIALIS-like 1 [Populus euphratica]
Length=87

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTA+QNK FE ALA+YD++TPDRW+ +AR V GK+ EEV+R YE+L +D+  IE+  VP 
Sbjct  14   WTAQQNKAFERALAVYDRDTPDRWYNVARAVGGKTAEEVKRHYELLVEDVKHIESGHVPF  73

Query  305  PNYRATESSS  334
            PNYR T ++ 
Sbjct  74   PNYRTTGANG  83



>ref|XP_008338442.1| PREDICTED: protein RADIALIS-like 1 [Malus domestica]
Length=91

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 4/88 (5%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
            +SWTAKQNK FE ALA YD+ET DRW  IAR VG +  EEV+RQYEIL  DI +IE+ +V
Sbjct  7    SSWTAKQNKLFENALATYDRETHDRWRNIARIVGGTTEEEVKRQYEILLADINRIESGKV  66

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKL  382
            PLP YR    S+    S+E+  L+ LKL
Sbjct  67   PLPKYRKVGESN---ISSEEERLKTLKL  91



>gb|ADE77540.1| unknown [Picea sitchensis]
Length=107

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVP  301
            +WT KQNK FE ALAIYDK+TPDRWH +A  V GKS EEV+R YEIL +D+  IE  +VP
Sbjct  20   NWTFKQNKLFENALAIYDKDTPDRWHNVASVVGGKSPEEVKRHYEILLEDLNSIEAGQVP  79

Query  302  LPNYRATESSSRGFASNEQRLLRN  373
             PNY ++  ++R      + +L N
Sbjct  80   FPNYISSRPNNREILGGGKPILGN  103



>gb|KDP26264.1| hypothetical protein JCGZ_22436 [Jatropha curcas]
Length=79

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +2

Query  107  HRLLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG--KSIEEVRRQYEILEKDIMQ  280
            + L  ++WT KQNK FE+ALA+YDK+TPDRW  +A+ VG  KS EEVRR YEIL KD+ +
Sbjct  4    NSLTSSAWTPKQNKLFEKALALYDKDTPDRWLNVAKAVGGNKSPEEVRRHYEILIKDVRE  63

Query  281  IENDEVPLPNYRAT  322
            IE+  VP PNY +T
Sbjct  64   IESGRVPFPNYTST  77



>gb|ABM97744.1| RAD [Oreocharis leiophylla]
 gb|ABN13125.1| transcription factor RAD [Oreocharis leiophylla]
Length=85

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +2

Query  125  SWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVP  301
            +WTAK+NK FE+ALA+YDK+TPDRW  +A+ V G+++EEV+R YEIL +D+  IE+ +VP
Sbjct  7    NWTAKENKAFEQALAVYDKDTPDRWVNVAKAVPGRTVEEVKRHYEILVEDVKSIESGKVP  66

Query  302  LPNYRATESSSRGFASNEQR  361
             PNYR    S     ++EQR
Sbjct  67   FPNYRTIRESG-SMKNDEQR  85



>gb|KDO84586.1| hypothetical protein CISIN_1g034673mg [Citrus sinensis]
Length=87

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +2

Query  140  QNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIENDEVPLPNY  313
            QNKKFE ALA+YDK+TPDRW  +AR V  GKS ++V+R Y+ L +D++ IE+ + PLPNY
Sbjct  5    QNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPNY  64

Query  314  RATESSSRGFASNEQRLLRNLKL  382
            + T ++  G  ++  RL++NLKL
Sbjct  65   KNTGNNCIGILADAPRLMKNLKL  87



>ref|XP_004961115.1| PREDICTED: protein RADIALIS-like 3-like [Setaria italica]
Length=93

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 2/69 (3%)
 Frame = +2

Query  113  LLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG--KSIEEVRRQYEILEKDIMQIE  286
            +    WT +QNK+FE ALA+YD+ETPDRWHKIARY+G  KS +EVRR +E L  D+ QIE
Sbjct  1    MASGGWTQRQNKQFECALAVYDRETPDRWHKIARYMGGAKSADEVRRHFEHLVADVAQIE  60

Query  287  NDEVPLPNY  313
               VP P Y
Sbjct  61   AGRVPFPRY  69



>ref|XP_011025809.1| PREDICTED: protein RADIALIS-like 3 [Populus euphratica]
 ref|XP_011016702.1| PREDICTED: protein RADIALIS-like 3 [Populus euphratica]
Length=78

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            + SWT KQNK FE+ALA+YDK+TPDRWH +A+ V GKS EEV+  YEIL KD+ +IE+  
Sbjct  6    LTSWTPKQNKLFEKALALYDKDTPDRWHNVAKAVGGKSAEEVKMHYEILIKDVREIESGR  65

Query  296  VPLPNYRATESSS  334
            VP PNY ++ + +
Sbjct  66   VPFPNYWSSGNGN  78



>gb|EMS68204.1| DnaJ homolog subfamily C member 2 [Triticum urartu]
Length=96

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 60/91 (66%), Gaps = 2/91 (2%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIEN  289
            + A WT  QNK FE+ALA++D++TPDRWH IAR V  GKS ++VRR YE+L  DI +IE 
Sbjct  6    MSAVWTPMQNKLFEQALAVHDRDTPDRWHNIARAVGGGKSADDVRRYYELLVHDIARIEA  65

Query  290  DEVPLPNYRATESSSRGFASNEQRLLRNLKL  382
             +VP P YR         AS E   L++LK+
Sbjct  66   GKVPFPAYRPPCPGPGHNASYEADRLKHLKI  96



>ref|XP_009786616.1| PREDICTED: protein RADIALIS-like 1 [Nicotiana sylvestris]
Length=79

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIEND  292
            +++WT K+NKKFE+ALA+YDK+TPDRW  IA+YV  GKS+++V++ Y IL +D+  IE+ 
Sbjct  6    LSAWTPKENKKFEQALAVYDKDTPDRWQNIAKYVGGGKSVDDVKQHYAILIEDLKHIESG  65

Query  293  EVPLPNYRATESS  331
            +VP P YR+  +S
Sbjct  66   DVPFPKYRSGGNS  78



>ref|XP_010497645.1| PREDICTED: protein RADIALIS-like 2, partial [Camelina sativa]
Length=95

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE ALA+YD++TPDRW+ +AR V GK+ EE +RQYE+L +DI  IEN  VP 
Sbjct  15   WTVKQNKAFERALAVYDQDTPDRWYNVARAVGGKTPEEAKRQYELLVRDIESIENGHVPF  74

Query  305  PNYRATESSSRG  340
             +Y+ T +++RG
Sbjct  75   SDYKTTGATNRG  86



>ref|XP_002509490.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF50877.1| DNA binding protein, putative [Ricinus communis]
Length=107

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTA+QNK FE ALA+YDK+TPDRW  +AR V GK+ EEV+R Y++L +D+  IE+ +VP 
Sbjct  14   WTAQQNKAFERALAVYDKDTPDRWANVARAVGGKTPEEVKRHYDLLVEDVKYIESGQVPF  73

Query  305  PNYRATESSSRGFASNEQR  361
            PNYR T   +RG   + +R
Sbjct  74   PNYRTT--GTRGNMDDHER  90



>gb|ABI14753.1| myb-like protein RL4 [Antirrhinum majus]
Length=83

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQN++FEEAL ++DK+TPDRW  IAR + GKS E+VRR YE L KDI +IEND+VP+
Sbjct  16   WTPKQNRQFEEALTMFDKDTPDRWQNIARRIDGKSAEQVRRYYEELLKDITRIENDQVPI  75

Query  305  PNYRA  319
            PNY+ 
Sbjct  76   PNYKT  80



>ref|XP_010940077.1| PREDICTED: protein RADIALIS-like 3 [Elaeis guineensis]
Length=96

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 6/86 (7%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE ALA+YDK+TPDRW  +AR V GKS EEV+R YE+L +D+  IE+ +VP 
Sbjct  15   WTPKQNKLFERALAVYDKDTPDRWQNVARAVGGKSAEEVKRHYELLVEDLKHIESGQVPF  74

Query  305  PNYRATESSSRGFASNEQRLLRNLKL  382
            PNY     + R    +E++ LR LKL
Sbjct  75   PNY-----NKRSSTMDEEQRLRYLKL  95



>ref|XP_010649137.1| PREDICTED: protein RADIALIS-like 3 [Vitis vinifera]
Length=79

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  110  RLLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIE  286
            R   +SWT KQNK FE+ALA YDK+TPDRW  IA+ V GKS EEV+R YEIL +D+  IE
Sbjct  10   RTSGSSWTPKQNKLFEKALAKYDKDTPDRWQNIAKAVGGKSAEEVKRHYEILIEDVKHIE  69

Query  287  NDEVPLPNYR  316
            + +VP PNYR
Sbjct  70   SGKVPFPNYR  79



>gb|KDP46257.1| hypothetical protein JCGZ_10097 [Jatropha curcas]
Length=84

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 3/73 (4%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WTA+QNK FE ALA+YDK+TPDRW  +AR V GK+ +EV+R YE+L +D+  IE+ +VP 
Sbjct  14   WTAQQNKAFERALAVYDKDTPDRWANVARAVGGKTADEVKRHYELLVRDVKYIESGQVPF  73

Query  305  PNYRATESSSRGF  343
            PNYR T   +RG 
Sbjct  74   PNYRTT--GTRGI  84



>ref|XP_009801639.1| PREDICTED: protein RADIALIS-like 3 [Nicotiana sylvestris]
Length=64

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +2

Query  119  MASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDE  295
            M S T +QNKKFEEALA++DKETPDRWH IA  V GKS EEVRR YE+L KDIMQIEN +
Sbjct  1    MGSSTTRQNKKFEEALALFDKETPDRWHNIAMCVGGKSAEEVRRHYELLVKDIMQIENGQ  60



>ref|XP_010088931.1| hypothetical protein L484_018558 [Morus notabilis]
 gb|EXB37135.1| hypothetical protein L484_018558 [Morus notabilis]
Length=112

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 8/93 (9%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK FE+ALA+YDK+TPDRW  +A+ V GK+ EEV+R YE+L +D+ QIE+  +P+
Sbjct  17   WTPKQNKSFEKALALYDKDTPDRWQNVAKAVGGKTPEEVKRHYEVLLEDLRQIESGRIPI  76

Query  305  PNYRAT-----ESSSRG--FASNEQRLLRNLKL  382
            PNY+++     ES  +G   AS   R L+ LK+
Sbjct  77   PNYKSSGHDEEESMGKGRLGASWPDRKLKELKV  109



>ref|XP_011048394.1| PREDICTED: protein RADIALIS-like 4 [Populus euphratica]
Length=100

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 67/90 (74%), Gaps = 4/90 (4%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG--KSIEEVRRQYEILEKDIMQIENDE  295
            ++WT ++NK FE+ALA++DK+TPDRW  IA+ VG  KS EEV++ YEIL +D+  IE+  
Sbjct  13   SAWTPRENKLFEKALALFDKDTPDRWQNIAKAVGGVKSAEEVKKHYEILIEDLHHIESGR  72

Query  296  VPLPNYRATESSSRGFASNEQRLLRNLKLR  385
            +P+P Y++  S SR   + E+RLL++L L+
Sbjct  73   IPIPKYKS--SGSRNNTNKEERLLKHLNLQ  100



>ref|XP_003547982.1| PREDICTED: protein RADIALIS-like 1-like [Glycine max]
 gb|KHN11105.1| hypothetical protein glysoja_033659 [Glycine soja]
Length=73

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSIEEVRRQYEILEKDIMQIENDE  295
            + +SWT +QNK+FE ALA YD+ETPDRW  +A  VGKS+EEV+R YEIL++DI +IE  +
Sbjct  1    MASSWTPRQNKQFERALAKYDRETPDRWQNVANEVGKSVEEVKRHYEILKEDIRRIERGQ  60

Query  296  VPLPNYRATESSS  334
            V  P YR   S+S
Sbjct  61   VAFP-YRTNNSNS  72



>ref|XP_011099630.1| PREDICTED: protein RADIALIS-like 3 [Sesamum indicum]
 ref|XP_011099631.1| PREDICTED: protein RADIALIS-like 3 [Sesamum indicum]
Length=86

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK+FE+ALA+YDK+TPDRW  IAR V GKS EEV+R YEIL +D+  IE+   P 
Sbjct  17   WTPKQNKQFEKALAVYDKDTPDRWQNIARAVGGKSAEEVKRHYEILVEDLKHIESGNYPF  76

Query  305  PNYRATESSSR  337
            PNYR T  +SR
Sbjct  77   PNYR-TNGNSR  86



>ref|XP_004501011.1| PREDICTED: protein RADIALIS-like 1-like [Cicer arietinum]
Length=95

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 63/91 (69%), Gaps = 3/91 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            ++WT KQNK+FE ALAI DK+ PDRW K+AR V GKS+EEV R YE L +D+  IE   V
Sbjct  5    SNWTPKQNKRFENALAILDKDIPDRWQKLARAVGGKSVEEVIRHYEKLVEDVKLIEEGLV  64

Query  299  PLPNYRATESSSRGFA--SNEQRLLRNLKLR  385
            PLPNYR    S++G+    +E + ++ L L+
Sbjct  65   PLPNYRNNVGSNKGYTYIMDEDKRMKALSLQ  95



>emb|CBI17505.3| unnamed protein product [Vitis vinifera]
Length=74

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  110  RLLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIE  286
            R   +SWT KQNK FE+ALA YDK+TPDRW  IA+ V GKS EEV+R YEIL +D+  IE
Sbjct  5    RTSGSSWTPKQNKLFEKALAKYDKDTPDRWQNIAKAVGGKSAEEVKRHYEILIEDVKHIE  64

Query  287  NDEVPLPNYR  316
            + +VP PNYR
Sbjct  65   SGKVPFPNYR  74



>ref|XP_008352458.1| PREDICTED: protein RADIALIS-like 4 [Malus domestica]
Length=82

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT KQNK+FE+ALA+YDK+TPDRW K+AR V GKS EEV+R YEIL +D+  IE+  VP 
Sbjct  17   WTPKQNKQFEKALALYDKDTPDRWQKVARAVGGKSAEEVKRHYEILIEDVKHIESGRVPF  76

Query  305  PNYRA  319
            P+YR 
Sbjct  77   PDYRG  81



>ref|XP_008241690.1| PREDICTED: protein RADIALIS-like 4 [Prunus mume]
Length=81

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK+FE+ALA+YDK+TPDRW K+AR V GKS EEV++ YEIL +D+  IE   V
Sbjct  14   SSWTPKQNKQFEKALALYDKDTPDRWQKVARAVGGKSAEEVKQHYEILLEDVNHIEAGRV  73

Query  299  PLPNYRA  319
            P P YR 
Sbjct  74   PFPRYRG  80



>ref|XP_009390189.1| PREDICTED: protein RADIALIS-like 3 [Musa acuminata subsp. malaccensis]
Length=92

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +2

Query  110  RLLMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQI  283
            R   +SWT +QNK FE ALA+YDK+TPDRW  +AR V  GK+ EEV++ YE+L +D+  I
Sbjct  8    RGSTSSWTPQQNKLFERALAVYDKDTPDRWQNVARAVGGGKTAEEVKKHYELLLEDLEHI  67

Query  284  ENDEVPLPNYRATESSSRGFASNEQR  361
            E+  VP PNY+++  S  G A  EQR
Sbjct  68   ESGRVPYPNYKSS-GSRDGGADEEQR  92



>ref|XP_008800711.1| PREDICTED: protein RADIALIS-like 3 [Phoenix dactylifera]
Length=78

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT ++NKKFEEALA YDKETPDRWHK+A+ V GKS++EVRR YE+L +DI  IE   V
Sbjct  14   SSWTLRENKKFEEALAKYDKETPDRWHKVAQAVGGKSVDEVRRHYELLIRDINYIETGRV  73

Query  299  PLPNY  313
             +PNY
Sbjct  74   SIPNY  78



>ref|NP_001151113.1| LOC100284746 [Zea mays]
 gb|ACG41660.1| DNA binding protein [Zea mays]
 tpg|DAA58424.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05900.1| MYB-related transcription factor, partial [Zea mays]
Length=93

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            A WTAKQNK FE+ALA+YD++TPDRWH IAR V GKS +EVRR YE+L KD+  IE  +V
Sbjct  11   AQWTAKQNKLFEQALAVYDRDTPDRWHNIARAVGGKSADEVRRYYELLVKDLEHIEAGKV  70

Query  299  PLPNYRA  319
              P YR 
Sbjct  71   AFPAYRC  77



>ref|XP_009134001.1| PREDICTED: protein RADIALIS-like 2 isoform X3 [Brassica rapa]
Length=106

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
             SWT KQNK FE ALA YD++TPDRW+ +AR VG +  +E +RQY++L +DI  I+N  V
Sbjct  12   GSWTVKQNKAFERALATYDQDTPDRWYNVARAVGGTTPDEAKRQYDLLVRDIEIIDNGHV  71

Query  299  PLPNYRATESSSRGFASNEQR  361
            P PNY  T   ++G   +E++
Sbjct  72   PFPNYTTTGGRTKGRLRDEEK  92



>ref|XP_006575120.1| PREDICTED: protein RADIALIS-like 1-like [Glycine max]
Length=93

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 62/89 (70%), Gaps = 6/89 (7%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SW+AK NK FE ALA+YDK+TPDRW  +AR V GK+ +EV+  YE+L +DI QIE+ +V
Sbjct  10   GSWSAKDNKAFERALAVYDKDTPDRWKDVARAVGGKTPDEVKSHYELLLRDISQIESGKV  69

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKLR  385
            P PNY+ +          E++ +RNLK++
Sbjct  70   PYPNYKKSAEH-----DEEEKRMRNLKIQ  93



>gb|KHN41108.1| hypothetical protein glysoja_013450 [Glycine soja]
Length=111

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 63/86 (73%), Gaps = 8/86 (9%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG-KSIEEVRRQYEILEKDIMQIEND  292
            + +SWT  QNK+FE ALA+YD++TPDRW  IA+ VG KS EEV+R YEIL +D+  IE+ 
Sbjct  12   IFSSWTRMQNKQFESALALYDQDTPDRWQNIAKVVGDKSAEEVKRHYEILLEDLRHIESG  71

Query  293  EVPLPNYRATESSSRGFASNEQRLLR  370
             VP+P+Y++T+       +N++RL R
Sbjct  72   RVPIPSYKSTD-------NNQERLAR  90



>ref|XP_007145477.1| hypothetical protein PHAVU_007G242300g [Phaseolus vulgaris]
 gb|ESW17471.1| hypothetical protein PHAVU_007G242300g [Phaseolus vulgaris]
Length=88

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 63/89 (71%), Gaps = 6/89 (7%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
             SW+AK NK FE ALA+YDK+TPDRW+ +A  V GK+ +EV+R YE+L +DI QIE+ +V
Sbjct  5    GSWSAKDNKAFERALAVYDKDTPDRWNNVALAVGGKTPDEVKRHYELLLQDITQIESGQV  64

Query  299  PLPNYRATESSSRGFASNEQRLLRNLKLR  385
            P P Y+ T  S       E++ L+NL+L+
Sbjct  65   PFPKYKKTVESEE-----EEKRLKNLELQ  88



>ref|XP_009378514.1| PREDICTED: protein RADIALIS-like 3 [Pyrus x bretschneideri]
Length=104

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 69/92 (75%), Gaps = 4/92 (4%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVG--KSIEEVRRQYEILEKDIMQIENDE  295
            +SWT KQNK FE+ALA+YDKETP+RW  +A+ VG  K+ EEV++ Y+IL +D+ QIE+  
Sbjct  13   SSWTPKQNKLFEKALALYDKETPERWQNVAKAVGGNKTAEEVKKHYDILLEDLRQIESGR  72

Query  296  VPLPNYRATESSSRGFAS--NEQRLLRNLKLR  385
            VP+PNY+++  SS    +   E+RLL+ LKL+
Sbjct  73   VPIPNYKSSIGSSTSSINVDEEERLLKYLKLQ  104



>ref|XP_002313794.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE87749.1| myb family transcription factor family protein [Populus trichocarpa]
Length=87

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  128  WTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEVPL  304
            WT +QNK FE ALA+YD++TPDRW+ +AR V GK+ EEV+R YE+L +D+  IE+  VP 
Sbjct  14   WTVQQNKAFERALAVYDRDTPDRWYNVARAVGGKTAEEVKRHYELLVEDVKHIESGHVPF  73

Query  305  PNYRATESSS  334
            PNYR T ++ 
Sbjct  74   PNYRTTGANG  83



>gb|KHN25378.1| hypothetical protein glysoja_010295 [Glycine soja]
Length=92

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT KQNK FE+ALA YDK+TPDRW  +A+ V GKS +EV+R YEIL +D+  IE+  V
Sbjct  14   SSWTPKQNKLFEKALAKYDKDTPDRWQNVAKAVGGKSADEVKRHYEILLEDLRHIESGHV  73

Query  299  PLPNYRATESSS  334
            PLP Y++T SS+
Sbjct  74   PLPKYKSTGSST  85



>ref|XP_009134000.1| PREDICTED: protein RADIALIS-like 2 isoform X2 [Brassica rapa]
Length=112

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
             SWT KQNK FE ALA YD++TPDRW+ +AR VG +  +E +RQY++L +DI  I+N  V
Sbjct  12   GSWTVKQNKAFERALATYDQDTPDRWYNVARAVGGTTPDEAKRQYDLLVRDIEIIDNGHV  71

Query  299  PLPNYRATESSSRGFASNEQR  361
            P PNY  T   ++G   +E++
Sbjct  72   PFPNYTTTGGRTKGRLRDEEK  92



>gb|AAD39593.1|AC007858_7 10A19I.8 [Oryza sativa Japonica Group]
 gb|AAU10697.1| hypothetical protein [Oryza sativa Japonica Group]
Length=236

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV--GKSIEEVRRQYEILEKDIMQIENDE  295
            A W  KQNK FE+ALA+YDKETPDRWH IAR V  GKS E+V+R YE+LE+DI  IE+ +
Sbjct  7    AQWPQKQNKLFEQALAVYDKETPDRWHNIARAVGGGKSAEDVKRYYEMLEEDIKHIESGK  66

Query  296  VPLPNYRATESSS  334
            VP P YR   ++ 
Sbjct  67   VPFPAYRCPAAAG  79



>ref|XP_009396486.1| PREDICTED: protein RADIALIS-like 3 [Musa acuminata subsp. malaccensis]
Length=79

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 61/76 (80%), Gaps = 3/76 (4%)
 Frame = +2

Query  116  LMASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIEND  292
            + +SWTAK+NK FE+ALA+YD++TPDRWHKIAR + GK+ +EV+R Y++L +D+ +IE  
Sbjct  6    MSSSWTAKENKMFEKALAVYDRDTPDRWHKIARAIGGKTADEVKRYYDLLVEDVRRIEAG  65

Query  293  EVPLPNYRATESSSRG  340
            ++P  NYR+  S+ RG
Sbjct  66   QMPYANYRS--SNGRG  79



>ref|XP_002521210.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF41162.1| DNA binding protein, putative [Ricinus communis]
Length=81

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYVGKSI-EEVRRQYEILEKDIMQIENDEV  298
            ++WTA+QNK FE+ALAIYDK+TPDRW  IA+ VG +  EEV++Q+EIL  DI  IE+D++
Sbjct  7    SNWTAEQNKLFEDALAIYDKDTPDRWRTIAKIVGGTTEEEVKKQFEILVNDINHIESDKI  66

Query  299  PLPNYR  316
            PLPNY+
Sbjct  67   PLPNYK  72



>ref|XP_010028603.1| PREDICTED: protein RADIALIS-like 3 [Eucalyptus grandis]
 gb|KCW55363.1| hypothetical protein EUGRSUZ_I01278 [Eucalyptus grandis]
Length=85

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  122  ASWTAKQNKKFEEALAIYDKETPDRWHKIARYV-GKSIEEVRRQYEILEKDIMQIENDEV  298
            +SWT  QNK+FE ALA+YDK+TPDRW  +AR V GKS +EV+R YE L +D+ QIE+  +
Sbjct  12   SSWTPIQNKQFERALALYDKDTPDRWQNVARAVEGKSADEVKRHYEALVEDLDQIESGRI  71

Query  299  PLPNYRATESSS  334
            P+PNY++  +SS
Sbjct  72   PVPNYKSGGNSS  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 619402163716