BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c43711_g1_i1 len=581 path=[559:0-580]

Length=581
                                                                      Score     E

ref|XP_009596758.1|  PREDICTED: probable glutathione S-transferase      159   1e-44   
ref|XP_009776230.1|  PREDICTED: probable glutathione S-transferase      155   2e-43   
ref|XP_006339006.1|  PREDICTED: probable glutathione S-transferas...    152   3e-42   
ref|XP_004249548.1|  PREDICTED: probable glutathione S-transferase      151   1e-41   
ref|XP_009767205.1|  PREDICTED: probable glutathione S-transferase      151   1e-41   
gb|KCW49513.1|  hypothetical protein EUGRSUZ_K03038                     147   6e-41   
ref|XP_010037778.1|  PREDICTED: glutathione S-transferase U8-like       149   9e-41   
ref|XP_008370017.1|  PREDICTED: probable glutathione S-transferase      147   3e-40   
ref|XP_009618409.1|  PREDICTED: probable glutathione S-transferase      146   6e-40   
ref|XP_009789711.1|  PREDICTED: probable glutathione S-transferase      145   1e-39   
ref|XP_010042776.1|  PREDICTED: glutathione S-transferase U8-like       144   4e-39   
ref|XP_009378879.1|  PREDICTED: probable glutathione S-transferase      143   1e-38   
ref|XP_009626799.1|  PREDICTED: probable glutathione S-transferas...    142   1e-38   
ref|XP_009626798.1|  PREDICTED: probable glutathione S-transferas...    142   2e-38   
ref|XP_009625219.1|  PREDICTED: probable glutathione S-transferase      142   2e-38   
ref|XP_010039178.1|  PREDICTED: probable glutathione S-transferase      142   2e-38   
ref|XP_009788521.1|  PREDICTED: probable glutathione S-transferase      142   4e-38   
ref|XP_010037768.1|  PREDICTED: probable glutathione S-transferase      140   1e-37   
ref|XP_010037777.1|  PREDICTED: probable glutathione S-transferase      138   1e-36   
ref|XP_009767206.1|  PREDICTED: probable glutathione S-transferase      138   1e-36   
ref|XP_010037773.1|  PREDICTED: glutathione S-transferase U8-like       137   1e-36   
ref|NP_001234086.1|  uncharacterized protein LOC543814                  137   2e-36   
ref|XP_010037776.1|  PREDICTED: probable glutathione S-transferase      137   3e-36   
ref|XP_011000057.1|  PREDICTED: probable glutathione S-transferase      136   4e-36   
emb|CBI30466.3|  unnamed protein product                                134   4e-36   
ref|XP_006367668.1|  PREDICTED: probable glutathione S-transferas...    136   7e-36   
ref|XP_009606317.1|  PREDICTED: probable glutathione S-transferase      135   8e-36   
gb|ADB11327.1|  tau class glutathione transferase GSTU45                135   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009768031.1|  PREDICTED: probable glutathione S-transferase      135   1e-35   
ref|XP_009378880.1|  PREDICTED: probable glutathione S-transferase      135   2e-35   
ref|XP_002275657.2|  PREDICTED: probable glutathione S-transferase      134   2e-35   Vitis vinifera
ref|XP_008370015.1|  PREDICTED: probable glutathione S-transferase      134   4e-35   
ref|XP_009802971.1|  PREDICTED: probable glutathione S-transferase      134   6e-35   
ref|XP_010037769.1|  PREDICTED: probable glutathione S-transferase      133   9e-35   
ref|XP_009606316.1|  PREDICTED: probable glutathione S-transferase      132   2e-34   
ref|XP_010037779.1|  PREDICTED: probable glutathione S-transferase      132   3e-34   
ref|XP_008370016.1|  PREDICTED: glutathione S-transferase U8-like       131   3e-34   
gb|AFW90580.1|  glutathione S-transferase-like protein                  131   5e-34   
ref|XP_010325822.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    130   8e-34   
ref|XP_006367667.1|  PREDICTED: probable glutathione S-transferas...    130   9e-34   
ref|XP_004246388.1|  PREDICTED: probable glutathione S-transferase      130   1e-33   
ref|XP_006367665.1|  PREDICTED: probable glutathione S-transferas...    130   1e-33   
gb|KCW49506.1|  hypothetical protein EUGRSUZ_K03027                     127   1e-33   
ref|XP_007026866.1|  Tau class glutathione transferase GSTU45           129   2e-33   
ref|NP_001234778.1|  glutathione S-transferase-like protein             129   3e-33   
ref|XP_007026865.1|  Tau class glutathione transferase GSTU45           128   6e-33   
ref|XP_010039179.1|  PREDICTED: glutathione S-transferase U8-like       128   7e-33   
ref|XP_008781207.1|  PREDICTED: probable glutathione S-transferase      128   7e-33   
ref|XP_006367676.1|  PREDICTED: probable glutathione S-transferas...    128   8e-33   
emb|CDP06553.1|  unnamed protein product                                128   8e-33   
ref|XP_007026863.1|  Tau class glutathione transferase GSTU45           128   9e-33   
ref|XP_006360613.1|  PREDICTED: probable glutathione S-transferas...    128   9e-33   
gb|AAX20044.1|  probable glutathione-S-transferase                      127   1e-32   Capsicum annuum
ref|XP_010684665.1|  PREDICTED: glutathione S-transferase U8-like       127   1e-32   
ref|XP_006367670.1|  PREDICTED: probable glutathione S-transferas...    127   1e-32   
ref|XP_004246385.1|  PREDICTED: probable glutathione S-transferase      126   4e-32   
gb|AFK47124.1|  unknown                                                 125   5e-32   
gb|AEB77869.1|  glutathione S-transferase protein                       125   6e-32   
ref|XP_006367673.1|  PREDICTED: probable glutathione S-transferas...    124   2e-31   
gb|KCW61134.1|  hypothetical protein EUGRSUZ_H03907                     123   3e-31   
gb|KFK38292.1|  hypothetical protein AALP_AA3G095200                    123   3e-31   
ref|XP_010486488.1|  PREDICTED: glutathione S-transferase U8-like       124   4e-31   
ref|XP_010464567.1|  PREDICTED: glutathione S-transferase U8            123   4e-31   
ref|XP_009798686.1|  PREDICTED: probable glutathione S-transferase      120   5e-31   
ref|XP_004246379.1|  PREDICTED: probable glutathione S-transferase      123   6e-31   
ref|XP_010027076.1|  PREDICTED: probable glutathione S-transferase      123   6e-31   
ref|XP_006367677.1|  PREDICTED: probable glutathione S-transferas...    123   6e-31   
ref|XP_010325821.1|  PREDICTED: probable glutathione S-transferase      122   6e-31   
gb|AEB77872.1|  glutathione S-transferase protein                       122   8e-31   
ref|XP_006576598.1|  PREDICTED: probable glutathione S-transferas...    122   1e-30   
ref|XP_010101873.1|  putative glutathione S-transferase                 122   2e-30   
gb|ACN60408.1|  glutathione S-transferase                               121   2e-30   Capsicum annuum
ref|XP_004246384.1|  PREDICTED: probable glutathione S-transferase      121   2e-30   
ref|XP_010696150.1|  PREDICTED: glutathione S-transferase U8-like       121   3e-30   
ref|XP_010039180.1|  PREDICTED: glutathione S-transferase U8-like       122   3e-30   
ref|XP_009770038.1|  PREDICTED: probable glutathione S-transferase      121   3e-30   
ref|XP_009606318.1|  PREDICTED: probable glutathione S-transferase      121   3e-30   
ref|XP_011077664.1|  PREDICTED: probable glutathione S-transferase      122   4e-30   
gb|KHN47446.1|  Putative glutathione S-transferase                      121   4e-30   
ref|XP_006367664.1|  PREDICTED: probable glutathione S-transferas...    120   5e-30   
ref|XP_009802972.1|  PREDICTED: probable glutathione S-transferase      120   5e-30   
ref|XP_004302691.1|  PREDICTED: glutathione S-transferase U8-like       120   6e-30   
ref|XP_006346688.1|  PREDICTED: probable glutathione S-transferas...    122   6e-30   
ref|XP_010279542.1|  PREDICTED: probable glutathione S-transferas...    120   7e-30   
ref|XP_009606319.1|  PREDICTED: probable glutathione S-transferase      120   7e-30   
ref|NP_001238721.1|  glutathione S-transferase GST 13                   120   7e-30   
ref|XP_010101874.1|  putative glutathione S-transferase                 120   7e-30   
ref|XP_010039176.1|  PREDICTED: probable glutathione S-transferase      120   8e-30   
ref|XP_004246380.1|  PREDICTED: probable glutathione S-transferase      120   8e-30   
ref|XP_009629346.1|  PREDICTED: probable glutathione S-transferase      120   8e-30   
ref|NP_187538.1|  glutathione S-transferase TAU 8                       120   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234082.1|  uncharacterized protein LOC543813                  119   1e-29   
ref|XP_010279540.1|  PREDICTED: probable glutathione S-transferas...    119   2e-29   
ref|XP_006572808.1|  PREDICTED: uncharacterized protein LOC100306...    119   2e-29   
ref|XP_010279541.1|  PREDICTED: probable glutathione S-transferas...    119   2e-29   
ref|XP_009629347.1|  PREDICTED: probable glutathione S-transferase      119   2e-29   
ref|XP_006367671.1|  PREDICTED: probable glutathione S-transferas...    119   2e-29   
ref|XP_004246383.1|  PREDICTED: probable glutathione S-transferase      118   3e-29   
ref|XP_009123411.1|  PREDICTED: glutathione S-transferase U8            118   4e-29   
gb|KEH28979.1|  glutathione S-transferase, amino-terminal domain ...    118   4e-29   
ref|XP_004507184.1|  PREDICTED: probable glutathione S-transferas...    118   4e-29   
gb|AFS51729.1|  tau class glutathione S-transferase                     118   5e-29   
ref|NP_001235279.1|  uncharacterized protein LOC100527381               118   5e-29   
gb|ADD71974.1|  glutathione S-transferase                               118   5e-29   
ref|XP_007134772.1|  hypothetical protein PHAVU_010G074600g             118   5e-29   
ref|XP_008240102.1|  PREDICTED: glutathione S-transferase U8-like       118   5e-29   
ref|XP_002884725.1|  predicted protein                                  117   6e-29   
ref|XP_004302690.1|  PREDICTED: probable glutathione S-transferas...    117   7e-29   
ref|XP_010039177.1|  PREDICTED: glutathione S-transferase U8-like       117   8e-29   
ref|XP_009770673.1|  PREDICTED: probable glutathione S-transferase      117   8e-29   
gb|EYU26622.1|  hypothetical protein MIMGU_mgv1a013365mg                117   8e-29   
ref|XP_010470684.1|  PREDICTED: glutathione S-transferase U8-like       117   8e-29   
ref|XP_006367663.1|  PREDICTED: probable glutathione S-transferas...    117   9e-29   
sp|Q03663.1|GSTX2_TOBAC  RecName: Full=Probable glutathione S-tra...    117   1e-28   Nicotiana tabacum [American tobacco]
ref|XP_004246386.1|  PREDICTED: probable glutathione S-transferase      117   1e-28   
ref|XP_006407694.1|  hypothetical protein EUTSA_v10021472mg             117   1e-28   
emb|CDY22184.1|  BnaC01g39170D                                          117   1e-28   
ref|XP_008240089.1|  PREDICTED: glutathione S-transferase U8-like       117   2e-28   
gb|AFK49084.1|  unknown                                                 116   2e-28   
gb|KDO57979.1|  hypothetical protein CISIN_1g027827mg                   116   2e-28   
ref|XP_006429234.1|  hypothetical protein CICLE_v10012717mg             116   2e-28   
ref|XP_009626800.1|  PREDICTED: probable glutathione S-transferase      116   2e-28   
emb|CAN73675.1|  hypothetical protein VITISV_001110                     116   2e-28   Vitis vinifera
gb|KHG09979.1|  Glutathione S-transferase U8 -like protein              116   2e-28   
ref|XP_004246387.1|  PREDICTED: probable glutathione S-transferase      116   3e-28   
gb|KCW61132.1|  hypothetical protein EUGRSUZ_H03905                     116   3e-28   
ref|XP_002281843.2|  PREDICTED: glutathione S-transferase U7            116   3e-28   Vitis vinifera
gb|ABW69659.2|  glutathione S-transferase                               116   3e-28   Gossypium hirsutum [American cotton]
ref|XP_010024690.1|  PREDICTED: probable glutathione S-transferase      116   4e-28   
ref|NP_001238659.1|  glutathione S-transferase GST 7                    115   4e-28   
gb|KHN05113.1|  Putative glutathione S-transferase                      115   4e-28   
emb|CAB61885.1|  Glutation-S-transferase                                112   5e-28   Solanum lycopersicum
ref|XP_010101872.1|  putative glutathione S-transferase                 115   5e-28   
ref|XP_004147912.1|  PREDICTED: probable glutathione S-transferas...    115   5e-28   
gb|AAA87183.1|  auxin-induced protein                                   115   6e-28   Vigna radiata [mung bean]
ref|XP_006366496.1|  PREDICTED: probable glutathione S-transferas...    115   6e-28   
gb|AFK43265.1|  unknown                                                 115   7e-28   
gb|AFK45620.1|  unknown                                                 114   8e-28   
ref|XP_006480912.1|  PREDICTED: glutathione S-transferase U8-like       114   9e-28   
emb|CDP06552.1|  unnamed protein product                                115   9e-28   
ref|XP_010938161.1|  PREDICTED: glutathione S-transferase U8-like       114   1e-27   
ref|XP_006429233.1|  hypothetical protein CICLE_v10012710mg             114   1e-27   
ref|XP_002532525.1|  glutathione s-transferase, putative                114   1e-27   Ricinus communis
gb|AFK40836.1|  unknown                                                 114   2e-27   
gb|AGV54744.1|  glutathione transferase                                 114   2e-27   
ref|XP_006298410.1|  hypothetical protein CARUB_v10014479mg             114   2e-27   
emb|CAN73676.1|  hypothetical protein VITISV_001111                     114   2e-27   Vitis vinifera
ref|XP_003529119.1|  PREDICTED: probable glutathione S-transferas...    114   2e-27   
ref|XP_010693951.1|  PREDICTED: glutathione S-transferase U7-like       114   2e-27   
ref|XP_006367675.1|  PREDICTED: probable glutathione S-transferas...    114   2e-27   
gb|ACU14373.1|  unknown                                                 112   2e-27   Glycine max [soybeans]
ref|XP_007140454.1|  hypothetical protein PHAVU_008G113600g             114   3e-27   
gb|KHN05121.1|  Putative glutathione S-transferase                      114   3e-27   
ref|NP_001237841.1|  uncharacterized protein LOC100306119               114   3e-27   
ref|XP_008448606.1|  PREDICTED: probable glutathione S-transferase      113   3e-27   
ref|XP_004166786.1|  PREDICTED: probable glutathione S-transferas...    113   3e-27   
gb|KHG28543.1|  Glutathione S-transferase U8 -like protein              113   3e-27   
ref|XP_008240078.1|  PREDICTED: probable glutathione S-transferase      113   4e-27   
ref|XP_009613724.1|  PREDICTED: probable glutathione S-transferase      113   4e-27   
gb|AIS71913.1|  hypothetical protein                                    113   4e-27   
ref|NP_001238675.1|  glutathione S-transferase GST 8                    113   4e-27   
gb|AAA33943.1|  auxin-regulated protein                                 110   4e-27   Glycine max [soybeans]
ref|XP_007140455.1|  hypothetical protein PHAVU_008G113700g             113   5e-27   
ref|NP_001236169.1|  uncharacterized protein LOC100500052               113   5e-27   
ref|XP_002280676.1|  PREDICTED: probable glutathione S-transferase      112   5e-27   Vitis vinifera
ref|XP_002281694.2|  PREDICTED: uncharacterized protein LOC100246830    115   6e-27   Vitis vinifera
gb|KHN05118.1|  Putative glutathione S-transferase                      112   6e-27   
gb|AAO69664.1|  glutathione S-transferase                               112   6e-27   Phaseolus acutifolius
ref|XP_010685658.1|  PREDICTED: glutathione S-transferase U7-like       112   7e-27   
emb|CBI16040.3|  unnamed protein product                                114   7e-27   
gb|KEH26957.1|  glutathione S-transferase                               112   7e-27   
gb|EAY77227.1|  hypothetical protein OsI_05199                          112   9e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_003529124.1|  PREDICTED: probable glutathione S-transferas...    112   1e-26   
gb|KHN25840.1|  Putative glutathione S-transferase                      112   1e-26   
ref|XP_002280532.1|  PREDICTED: probable glutathione S-transferase      112   1e-26   Vitis vinifera
ref|XP_006367674.1|  PREDICTED: probable glutathione S-transferas...    112   1e-26   
ref|XP_010279423.1|  PREDICTED: probable glutathione S-transferase      111   1e-26   
ref|XP_007207190.1|  hypothetical protein PRUPE_ppa017086mg             111   1e-26   
gb|KGN54330.1|  hypothetical protein Csa_4G304760                       111   2e-26   
ref|XP_004147931.1|  PREDICTED: probable glutathione S-transferas...    111   2e-26   
ref|XP_008448631.1|  PREDICTED: glutathione S-transferase U8-like       111   2e-26   
ref|NP_001238439.1|  probable glutathione S-transferase                 111   2e-26   
ref|XP_002520472.1|  glutathione s-transferase, putative                111   2e-26   Ricinus communis
emb|CAN62219.1|  hypothetical protein VITISV_042912                     111   2e-26   Vitis vinifera
gb|KDO66687.1|  hypothetical protein CISIN_1g041211mg                   111   2e-26   
gb|EYU26623.1|  hypothetical protein MIMGU_mgv1a013321mg                110   3e-26   
gb|KHN06986.1|  Putative glutathione S-transferase                      110   3e-26   
ref|XP_002283736.1|  PREDICTED: probable glutathione S-transferase      110   3e-26   Vitis vinifera
ref|XP_004147913.1|  PREDICTED: glutathione S-transferase U8-like       110   3e-26   
gb|EYU26621.1|  hypothetical protein MIMGU_mgv1a013264mg                110   3e-26   
dbj|BAA78580.1|  Dcarg-1                                                110   4e-26   Daucus carota [carrots]
ref|XP_003529121.1|  PREDICTED: probable glutathione S-transferas...    110   5e-26   
ref|XP_008453455.1|  PREDICTED: probable glutathione S-transferase      110   6e-26   
ref|NP_001238643.1|  glutathione S-transferase GST 6                    110   6e-26   
ref|NP_001045401.1|  Os01g0949700                                       110   7e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006488416.1|  PREDICTED: glutathione S-transferase U7-like       109   1e-25   
ref|XP_006424949.1|  hypothetical protein CICLE_v10029241mg             109   1e-25   
ref|XP_004972343.1|  PREDICTED: probable glutathione S-transferas...    109   1e-25   
ref|XP_003529123.1|  PREDICTED: probable glutathione S-transferas...    109   1e-25   
ref|XP_010693980.1|  PREDICTED: probable glutathione S-transferase      109   1e-25   
gb|KDO66686.1|  hypothetical protein CISIN_1g041800mg                   108   2e-25   
gb|ACU15816.1|  unknown                                                 108   3e-25   Glycine max [soybeans]
ref|XP_004137330.1|  PREDICTED: probable glutathione S-transferas...    108   4e-25   
gb|KDO66688.1|  hypothetical protein CISIN_1g038634mg                   108   4e-25   
emb|CBI30467.3|  unnamed protein product                                105   4e-25   
gb|KHN05112.1|  Putative glutathione S-transferase                      107   4e-25   
gb|KCW49502.1|  hypothetical protein EUGRSUZ_K030212                    104   4e-25   
ref|XP_004157054.1|  PREDICTED: probable glutathione S-transferas...    107   4e-25   
emb|CBI30468.3|  unnamed protein product                                105   4e-25   
ref|XP_008240197.1|  PREDICTED: probable glutathione S-transferase      107   4e-25   
gb|AFY26875.1|  glutathione-S-transferase                               107   4e-25   
ref|XP_002318530.2|  hypothetical protein POPTR_0012s04770g             107   5e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009399930.1|  PREDICTED: probable glutathione S-transferase      107   5e-25   
ref|XP_006849226.1|  hypothetical protein AMTR_s00027p00230760          107   6e-25   
gb|KHN05114.1|  Putative glutathione S-transferase                      107   6e-25   
gb|ACJ86006.1|  unknown                                                 107   7e-25   Medicago truncatula
gb|AFK47387.1|  unknown                                                 107   1e-24   
ref|XP_004492380.1|  PREDICTED: probable glutathione S-transferas...    107   1e-24   
ref|XP_004246382.1|  PREDICTED: probable glutathione S-transferase      106   1e-24   
ref|XP_004299558.1|  PREDICTED: probable glutathione S-transferas...    106   1e-24   
ref|XP_004160429.1|  PREDICTED: probable glutathione S-transferas...    106   1e-24   
ref|XP_003623196.1|  Glutathione S-transferase                          106   1e-24   
ref|XP_002275435.3|  PREDICTED: glutathione S-transferase U8            106   1e-24   Vitis vinifera
ref|XP_004971273.1|  PREDICTED: probable glutathione S-transferas...    106   2e-24   
ref|XP_002275539.1|  PREDICTED: glutathione S-transferase U8            106   2e-24   Vitis vinifera
ref|XP_010060069.1|  PREDICTED: glutathione transferase GST 23-like     106   2e-24   
ref|XP_010674216.1|  PREDICTED: glutathione S-transferase U8-like       106   2e-24   
ref|XP_008793317.1|  PREDICTED: probable glutathione S-transferase      106   2e-24   
ref|XP_009347672.1|  PREDICTED: glutathione S-transferase U8-like       106   2e-24   
gb|AGH14251.1|  glutathione S-transferase                               106   2e-24   
ref|XP_008448766.1|  PREDICTED: probable glutathione S-transferase      105   3e-24   
gb|AEJ33772.1|  glutathione S-transferase-like protein                  105   3e-24   
gb|ADB11358.1|  tau class glutathione transferase GSTU26                105   3e-24   Populus trichocarpa [western balsam poplar]
ref|NP_001237856.1|  uncharacterized protein LOC100500680               105   3e-24   
gb|ABD83308.1|  Fgenesh protein 133                                     105   3e-24   Beta vulgaris [beet]
ref|XP_006645389.1|  PREDICTED: probable glutathione S-transferas...    105   4e-24   
ref|XP_004507183.1|  PREDICTED: probable glutathione S-transferas...    105   5e-24   
gb|EYU40236.1|  hypothetical protein MIMGU_mgv1a020023mg                105   5e-24   
ref|XP_006488417.1|  PREDICTED: glutathione S-transferase U7-like       104   5e-24   
ref|XP_004492381.1|  PREDICTED: glutathione S-transferase L2, chl...    107   6e-24   
gb|ACU24385.1|  unknown                                                 104   6e-24   Glycine max [soybeans]
ref|XP_002520480.1|  glutathione s-transferase, putative                104   7e-24   Ricinus communis
ref|XP_006424951.1|  hypothetical protein CICLE_v10030408mg             104   7e-24   
ref|XP_002520478.1|  glutathione s-transferase, putative                104   7e-24   Ricinus communis
gb|EAY79123.1|  hypothetical protein OsI_34229                          104   8e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_010064229.1|  PREDICTED: glutathione transferase GST 23-like     103   9e-24   
ref|NP_001045406.1|  Os01g0950300                                       104   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006376726.1|  hypothetical protein POPTR_0012s04780g             103   2e-23   
ref|XP_002520473.1|  glutathione s-transferase, putative                103   2e-23   Ricinus communis
ref|XP_003623210.1|  Glutathione S-transferase GST                      103   2e-23   
ref|XP_011039096.1|  PREDICTED: probable glutathione S-transferase      103   2e-23   
ref|XP_002881042.1|  glutathione-s-transferase                          103   2e-23   
ref|XP_010938160.1|  PREDICTED: glutathione transferase GST 23-like     103   3e-23   
ref|XP_010036377.1|  PREDICTED: glutathione transferase GST 23-like     103   3e-23   
ref|NP_001063423.1|  Os09g0467200                                       102   3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007016280.1|  Glutathione S-transferase tau 7, putative          102   3e-23   
ref|XP_007016281.1|  Glutathione S-transferase tau 7, putative          103   3e-23   
ref|XP_002532523.1|  glutathione s-transferase, putative                102   4e-23   Ricinus communis
ref|XP_007036677.1|  Tau class glutathione transferase GSTU26           102   4e-23   
ref|XP_002277724.2|  PREDICTED: glutathione transferase GST 23          102   4e-23   Vitis vinifera
gb|ACU15611.1|  unknown                                                 102   4e-23   Glycine max [soybeans]
ref|XP_008793318.1|  PREDICTED: glutathione transferase GST 23-like     102   4e-23   
ref|XP_006409999.1|  hypothetical protein EUTSA_v10017210mg             102   5e-23   
gb|ABW81037.1|  glutathione-s-transferase 7                             102   5e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_006367672.1|  PREDICTED: probable glutathione S-transferas...    102   5e-23   
gb|EMT29674.1|  hypothetical protein F775_18354                         102   5e-23   
ref|XP_002862399.1|  glutathione-s-transferase                          102   6e-23   
gb|ABW81189.1|  glutathione-S-transferase                               102   6e-23   Arabidopsis cebennensis
ref|NP_180503.1|  glutathione S-transferase tau 7                       102   8e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003578262.1|  PREDICTED: glutathione transferase GST 23-li...    101   8e-23   
ref|XP_010040697.1|  PREDICTED: glutathione transferase GST 23-like     102   9e-23   
ref|XP_004133937.1|  PREDICTED: probable glutathione S-transferas...    101   9e-23   
ref|XP_006849223.1|  hypothetical protein AMTR_s00027p00230090          101   1e-22   
gb|AES79420.2|  glutathione S-transferase, amino-terminal domain ...    101   1e-22   
ref|XP_003623202.1|  Glutathione S-transferase GST                      101   1e-22   
ref|XP_003623174.1|  hypothetical protein MTR_7g065290                  101   1e-22   
emb|CAN73674.1|  hypothetical protein VITISV_001109                     102   1e-22   Vitis vinifera
ref|XP_003623208.1|  Glutathione S-transferase GST                      100   2e-22   
ref|XP_008374802.1|  PREDICTED: glutathione S-transferase U8-like       100   2e-22   
ref|XP_008438211.1|  PREDICTED: probable glutathione S-transferase      100   2e-22   
gb|AFK36747.1|  unknown                                                 100   2e-22   
ref|XP_002520474.1|  glutathione s-transferase, putative                100   2e-22   
ref|XP_004246381.1|  PREDICTED: probable glutathione S-transferase      100   2e-22   
gb|AAR85966.1|  ert1                                                  97.1    2e-22   
ref|XP_010036925.1|  PREDICTED: glutathione transferase GST 23-like     100   2e-22   
ref|XP_004971259.1|  PREDICTED: glutathione transferase GST 23-like     100   2e-22   
ref|XP_010923032.1|  PREDICTED: probable glutathione S-transferase      100   2e-22   
ref|XP_004492376.1|  PREDICTED: probable glutathione S-transferas...    100   3e-22   
ref|NP_001234091.1|  uncharacterized protein LOC543816                  100   3e-22   
ref|XP_010278876.1|  PREDICTED: probable glutathione S-transferase      100   3e-22   
gb|EMT28293.1|  hypothetical protein F775_28363                         100   3e-22   
ref|XP_010097693.1|  putative glutathione S-transferase                 100   3e-22   
ref|XP_003567468.1|  PREDICTED: glutathione S-transferase U8-like       100   4e-22   
emb|CDM86451.1|  unnamed protein product                                100   4e-22   
ref|XP_004168417.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...  99.8    4e-22   
ref|XP_010521903.1|  PREDICTED: glutathione S-transferase U1-like     99.8    4e-22   
ref|XP_004166785.1|  PREDICTED: probable glutathione S-transferas...  99.8    4e-22   
emb|CDM86457.1|  unnamed protein product                              99.8    4e-22   
gb|ABW81093.1|  GST17                                                 99.4    5e-22   
gb|KGN54321.1|  hypothetical protein Csa_4G303690                     99.8    5e-22   
ref|XP_010036375.1|  PREDICTED: glutathione transferase GST 23-like   99.8    5e-22   
ref|XP_008781341.1|  PREDICTED: glutathione transferase GST 23-like   99.8    5e-22   
ref|XP_010036379.1|  PREDICTED: glutathione transferase GST 23-like   99.8    5e-22   
ref|NP_001234986.1|  glutathione S-transferase GST 19                 99.4    6e-22   
ref|XP_006484732.1|  PREDICTED: probable glutathione S-transferas...  99.4    6e-22   
ref|XP_008448643.1|  PREDICTED: probable glutathione S-transferas...  99.4    7e-22   
ref|XP_006829148.1|  hypothetical protein AMTR_s00001p00269490        99.4    7e-22   
ref|XP_010521899.1|  PREDICTED: glutathione S-transferase U7-like     99.4    7e-22   
ref|XP_009778650.1|  PREDICTED: glutathione transferase GST 23-like   99.4    7e-22   
ref|XP_003623173.1|  hypothetical protein MTR_7g065270                99.0    8e-22   
ref|XP_006294944.1|  hypothetical protein CARUB_v10023998mg           99.0    9e-22   
ref|XP_008219369.1|  PREDICTED: glutathione transferase GST 23-like   99.0    9e-22   
ref|XP_002459102.1|  hypothetical protein SORBIDRAFT_03g045850        99.0    1e-21   
ref|XP_004492379.1|  PREDICTED: probable glutathione S-transferas...  98.6    1e-21   
ref|XP_006354565.1|  PREDICTED: glutathione transferase GST 23-li...  98.6    1e-21   
ref|XP_006365401.1|  PREDICTED: probable glutathione S-transferas...  98.6    1e-21   
dbj|BAK07331.1|  predicted protein                                    98.6    1e-21   
ref|XP_006660720.1|  PREDICTED: glutathione transferase GST 23-like   98.2    1e-21   
ref|XP_007134780.1|  hypothetical protein PHAVU_010G075400g           98.2    1e-21   
ref|XP_010939722.1|  PREDICTED: glutathione transferase GST 23-like   98.6    1e-21   
ref|XP_004147908.1|  PREDICTED: probable glutathione S-transferas...  98.2    2e-21   
ref|XP_007208182.1|  hypothetical protein PRUPE_ppa018112mg           97.8    2e-21   
ref|XP_009593034.1|  PREDICTED: glutathione transferase GST 23-like   98.2    2e-21   
ref|XP_010414386.1|  PREDICTED: glutathione S-transferase U7          98.2    2e-21   
ref|XP_010650966.1|  PREDICTED: glutathione S-transferase U8          97.8    2e-21   
dbj|BAJ97078.1|  predicted protein                                    98.2    2e-21   
ref|XP_010663654.1|  PREDICTED: probable glutathione S-transferase    97.8    2e-21   
ref|XP_008448618.1|  PREDICTED: glutathione S-transferase U8-like     98.2    2e-21   
ref|XP_006367666.1|  PREDICTED: probable glutathione S-transferas...  98.2    2e-21   
ref|NP_001104988.1|  glutathione transferase24                        98.2    2e-21   
ref|XP_010264127.1|  PREDICTED: uncharacterized protein LOC104602212    100   2e-21   
ref|XP_004157055.1|  PREDICTED: glutathione S-transferase U8-like     97.8    2e-21   
ref|XP_006367669.1|  PREDICTED: probable glutathione S-transferas...  97.8    2e-21   
emb|CDM86421.1|  unnamed protein product                              98.2    2e-21   
dbj|BAC23036.1|  glutathion S-transferase                             97.8    2e-21   
ref|XP_010921338.1|  PREDICTED: glutathione transferase GST 23-like   97.8    2e-21   
ref|XP_002277759.2|  PREDICTED: probable glutathione S-transferase    97.8    2e-21   
ref|XP_007029718.1|  Glutathione S-transferase tau 7                  97.8    3e-21   
emb|CDM86453.1|  unnamed protein product                              97.8    3e-21   
emb|CDM84998.1|  unnamed protein product                              97.4    3e-21   
gb|ABW74586.1|  glutathione-S-transferase                             97.4    3e-21   
gb|KDP38795.1|  hypothetical protein JCGZ_05131                       97.4    3e-21   
tpg|DAA55821.1|  TPA: glutathione S-transferase                       97.4    3e-21   
ref|XP_007223941.1|  hypothetical protein PRUPE_ppa011108mg           97.4    3e-21   
gb|EMT19525.1|  hypothetical protein F775_31981                       97.4    3e-21   
ref|XP_010939723.1|  PREDICTED: glutathione transferase GST 23-like   97.1    4e-21   
ref|NP_001147759.1|  glutathione S-transferase                        97.4    4e-21   
ref|XP_002523994.1|  glutathione s-transferase, putative              96.3    4e-21   
ref|XP_004299557.1|  PREDICTED: probable glutathione S-transferas...  97.1    4e-21   
ref|XP_007145574.1|  hypothetical protein PHAVU_007G250000g           97.1    4e-21   
emb|CDM86455.1|  unnamed protein product                              97.1    4e-21   
gb|ABF97436.1|  Glutathione S-transferase, N-terminal domain cont...  97.1    5e-21   
ref|XP_004966104.1|  PREDICTED: glutathione transferase GST 23-like   97.1    5e-21   
ref|XP_002456930.1|  hypothetical protein SORBIDRAFT_03g045790        97.1    5e-21   
gb|KDP40336.1|  hypothetical protein JCGZ_02334                       96.7    6e-21   
ref|XP_009591433.1|  PREDICTED: glutathione S-transferase U8-like     96.7    6e-21   
emb|CDP11459.1|  unnamed protein product                              96.7    6e-21   
gb|AAF64450.1|AF239928_1  glutathione S-transferase                   96.3    7e-21   
ref|XP_008448743.1|  PREDICTED: probable glutathione S-transferase    96.3    8e-21   
ref|XP_004157056.1|  PREDICTED: glutathione S-transferase U8-like     96.3    8e-21   
emb|CBI16039.3|  unnamed protein product                              97.4    8e-21   
ref|XP_010271919.1|  PREDICTED: glutathione transferase GST 23-like   96.3    9e-21   
ref|XP_002523997.1|  glutathione s-transferase, putative              95.9    9e-21   
ref|NP_001045403.2|  Os01g0949900                                     96.3    9e-21   
ref|NP_001105593.1|  glutathione transferase7                         96.3    9e-21   
gb|AFP20277.1|  glutathione transferase 23                            95.9    1e-20   
ref|XP_002523996.1|  glutathione s-transferase, putative              95.9    1e-20   
emb|CDM86425.1|  unnamed protein product                              96.3    1e-20   
ref|XP_006849222.1|  hypothetical protein AMTR_s00027p00229840        95.9    1e-20   
gb|EMS46977.1|  putative glutathione S-transferase                    95.9    1e-20   
gb|KDO46806.1|  hypothetical protein CISIN_1g027333mg                 95.9    1e-20   
sp|P32111.1|GSTX1_SOLTU  RecName: Full=Probable glutathione S-tra...  95.9    1e-20   
ref|XP_006437359.1|  hypothetical protein CICLE_v10032702mg           95.9    1e-20   
gb|ACG47313.1|  glutathione S-transferase                             96.3    1e-20   
ref|XP_008448653.1|  PREDICTED: glutathione S-transferase U8-like...  95.5    1e-20   
gb|AFK37419.1|  unknown                                               95.5    1e-20   
ref|XP_010510492.1|  PREDICTED: glutathione S-transferase U7-like     96.3    1e-20   
ref|XP_003623211.1|  Glutathione S-transferase GST                    95.5    2e-20   
ref|XP_008344765.1|  PREDICTED: glutathione S-transferase U8-like     95.5    2e-20   
ref|XP_004971265.1|  PREDICTED: probable glutathione S-transferas...  95.5    2e-20   
ref|XP_004309296.1|  PREDICTED: glutathione transferase GST 23-like   95.5    2e-20   
ref|XP_006484731.1|  PREDICTED: probable glutathione S-transferas...  95.5    2e-20   
ref|XP_006437360.1|  hypothetical protein CICLE_v10032686mg           95.5    2e-20   
gb|ACG39974.1|  glutathione S-transferase                             95.5    2e-20   
gb|EMT10870.1|  hypothetical protein F775_07317                       95.5    2e-20   
ref|XP_010036378.1|  PREDICTED: glutathione transferase GST 23-like   95.1    2e-20   
ref|XP_004147907.1|  PREDICTED: probable glutathione S-transferas...  95.1    2e-20   
ref|XP_004307164.1|  PREDICTED: glutathione transferase GST 23-like   95.1    2e-20   
gb|KDP42181.1|  hypothetical protein JCGZ_02911                       95.1    2e-20   
ref|XP_008363401.1|  PREDICTED: glutathione S-transferase U8-like     95.1    2e-20   
gb|KEH23050.1|  glutathione S-transferase, amino-terminal domain ...  95.1    3e-20   
ref|XP_006489728.1|  PREDICTED: glutathione S-transferase U8-like     95.1    3e-20   
ref|XP_006849232.1|  hypothetical protein AMTR_s00027p00233060        95.1    3e-20   
gb|KDO57583.1|  hypothetical protein CISIN_1g046710mg                 94.7    3e-20   
gb|KDP34500.1|  hypothetical protein JCGZ_11050                       94.7    3e-20   
gb|KGN54328.1|  hypothetical protein Csa_4G304250                     94.7    3e-20   
ref|XP_010238250.1|  PREDICTED: glutathione transferase GST 23-li...  94.7    3e-20   
ref|XP_004299207.1|  PREDICTED: glutathione transferase GST 23-like   94.7    3e-20   
ref|XP_010036376.1|  PREDICTED: glutathione transferase GST 23-like   94.7    3e-20   
gb|KDO57582.1|  hypothetical protein CISIN_1g043218mg                 94.7    3e-20   
ref|XP_008224070.1|  PREDICTED: probable glutathione S-transferase    94.4    4e-20   
gb|ACN27865.1|  unknown                                               94.4    4e-20   
gb|KEH35720.1|  glutathione S-transferase, amino-terminal domain ...  94.4    4e-20   
dbj|BAK02670.1|  predicted protein                                    94.4    4e-20   
ref|XP_002520477.1|  glutathione s-transferase, putative              94.4    4e-20   
ref|NP_001045404.1|  Os01g0950000                                     94.4    4e-20   
ref|NP_001234088.1|  uncharacterized protein LOC543815                94.4    5e-20   
emb|CDP19810.1|  unnamed protein product                              94.4    5e-20   
ref|XP_011010098.1|  PREDICTED: probable glutathione S-transferase    94.4    5e-20   
gb|AFK37185.1|  unknown                                               94.4    5e-20   
ref|XP_011092669.1|  PREDICTED: glutathione S-transferase U7-like     94.4    5e-20   
ref|XP_004297032.1|  PREDICTED: probable glutathione S-transferas...  94.0    5e-20   
ref|XP_003623195.1|  Glutathione S-transferase GST                    94.0    5e-20   
ref|XP_011000484.1|  PREDICTED: probable glutathione S-transferase    94.0    5e-20   
ref|XP_008448664.1|  PREDICTED: probable glutathione S-transferase    94.0    5e-20   
ref|XP_010469955.1|  PREDICTED: glutathione S-transferase U7-like     94.0    6e-20   
ref|XP_004957087.1|  PREDICTED: glutathione transferase GST 23-like   94.0    7e-20   
gb|AFK41941.1|  unknown                                               94.0    7e-20   
ref|XP_009335024.1|  PREDICTED: probable glutathione S-transferas...  93.6    7e-20   
ref|XP_003591644.1|  hypothetical protein MTR_1g090150                94.0    7e-20   
ref|XP_004307163.1|  PREDICTED: probable glutathione S-transferas...  93.6    8e-20   
ref|XP_004147934.1|  PREDICTED: uncharacterized protein LOC101220464  97.1    8e-20   
ref|XP_009335025.1|  PREDICTED: probable glutathione S-transferas...  93.6    8e-20   
ref|NP_001172744.1|  Os01g0949850                                     93.6    8e-20   
ref|XP_006433894.1|  hypothetical protein CICLE_v10002406mg           93.6    9e-20   
gb|AFK44026.1|  unknown                                               93.6    9e-20   
gb|ACG44016.1|  glutathione S-transferase                             93.6    9e-20   
gb|AAG34836.1|AF244693_1  glutathione S-transferase GST 28            93.6    9e-20   
gb|KDO81087.1|  hypothetical protein CISIN_1g027498mg                 93.2    9e-20   
emb|CDX97887.1|  BnaC04g40520D                                        93.6    9e-20   
ref|XP_010521898.1|  PREDICTED: glutathione S-transferase U7-like     93.2    1e-19   
dbj|BAJ93446.1|  predicted protein                                    93.6    1e-19   
gb|KHN06423.1|  Putative glutathione S-transferase                    93.2    1e-19   
ref|XP_009787286.1|  PREDICTED: glutathione S-transferase U8-like     93.2    1e-19   
ref|XP_002322571.1|  hypothetical protein POPTR_0016s02370g           93.2    1e-19   
ref|XP_010067033.1|  PREDICTED: probable glutathione S-transferase    93.2    1e-19   
ref|XP_002459100.1|  hypothetical protein SORBIDRAFT_03g045810        93.2    1e-19   
emb|CDP21862.1|  unnamed protein product                              93.2    1e-19   
ref|XP_006849236.1|  hypothetical protein AMTR_s00027p00235060        93.2    1e-19   
ref|XP_006354571.1|  PREDICTED: glutathione transferase GST 23-li...  92.8    1e-19   
gb|EMT15872.1|  hypothetical protein F775_31887                       93.2    1e-19   
ref|XP_009360111.1|  PREDICTED: glutathione S-transferase U8-like     92.8    1e-19   
gb|KCW44243.1|  hypothetical protein EUGRSUZ_L02330                   90.5    2e-19   
gb|EEC72161.1|  hypothetical protein OsI_05201                        92.8    2e-19   
ref|XP_008224066.1|  PREDICTED: probable glutathione S-transferase    92.8    2e-19   
ref|XP_008235548.1|  PREDICTED: probable glutathione S-transferase    92.8    2e-19   
ref|NP_001045402.1|  Os01g0949800                                     92.8    2e-19   
gb|ABW81132.1|  GST40                                                 92.8    2e-19   
ref|XP_004971266.1|  PREDICTED: probable glutathione S-transferas...  92.8    2e-19   
ref|XP_011086578.1|  PREDICTED: glutathione transferase GST 23-like   92.4    2e-19   
ref|XP_006294917.1|  hypothetical protein CARUB_v10023969mg           92.4    2e-19   
ref|XP_006373657.1|  hypothetical protein POPTR_0016s02350g           92.4    2e-19   
ref|XP_006354574.1|  PREDICTED: glutathione transferase GST 23-like   92.4    2e-19   
ref|XP_004971267.1|  PREDICTED: probable glutathione S-transferas...  92.4    2e-19   
ref|XP_004172902.1|  PREDICTED: probable glutathione S-transferas...  89.7    2e-19   
ref|XP_007200430.1|  hypothetical protein PRUPE_ppa011142mg           92.0    3e-19   
emb|CDP09302.1|  unnamed protein product                              92.0    3e-19   
ref|XP_002520475.1|  glutathione s-transferase, putative              92.0    3e-19   
emb|CAN78656.1|  hypothetical protein VITISV_006850                   92.0    3e-19   
ref|XP_006354570.1|  PREDICTED: glutathione transferase GST 23-li...  92.0    3e-19   
ref|XP_002264054.1|  PREDICTED: glutathione transferase GST 23        92.0    4e-19   
ref|XP_010269443.1|  PREDICTED: probable glutathione S-transferase    91.7    4e-19   
ref|XP_007218360.1|  hypothetical protein PRUPE_ppa011115mg           91.7    4e-19   
ref|XP_002460369.1|  hypothetical protein SORBIDRAFT_02g027080        91.7    4e-19   
ref|XP_006472526.1|  PREDICTED: glutathione transferase GST 23-like   91.7    5e-19   
gb|KDP42500.1|  hypothetical protein JCGZ_00297                       91.3    5e-19   
ref|XP_006645390.1|  PREDICTED: probable glutathione S-transferas...  91.3    5e-19   
ref|XP_009372270.1|  PREDICTED: probable glutathione S-transferase    91.3    6e-19   
ref|XP_008448754.1|  PREDICTED: glutathione S-transferase U8-like     91.3    6e-19   
ref|XP_006437357.1|  hypothetical protein CICLE_v10032696mg           91.3    6e-19   
ref|XP_008812228.1|  PREDICTED: glutathione transferase GST 23-like   91.3    6e-19   
ref|XP_008359780.1|  PREDICTED: probable glutathione S-transferase    90.9    7e-19   
ref|XP_008812235.1|  PREDICTED: glutathione transferase GST 23-like   91.7    7e-19   
ref|XP_010414381.1|  PREDICTED: glutathione S-transferase U1-like     90.9    7e-19   
gb|EMS45226.1|  putative glutathione S-transferase                    91.7    7e-19   
ref|XP_007226235.1|  hypothetical protein PRUPE_ppa017218mg           90.9    7e-19   
ref|XP_004299656.1|  PREDICTED: probable glutathione S-transferas...  90.9    7e-19   
ref|XP_002456932.1|  hypothetical protein SORBIDRAFT_03g045840        91.3    8e-19   
ref|XP_011030495.1|  PREDICTED: probable glutathione S-transferase    90.9    8e-19   
ref|XP_003623172.1|  Glutathione S-transferase GST                    91.7    9e-19   
ref|NP_001050597.1|  Os03g0595600                                     90.9    1e-18   
gb|KDP39591.1|  hypothetical protein JCGZ_02611                       90.5    1e-18   
emb|CDY51366.1|  BnaA04g28600D                                        90.5    1e-18   
ref|XP_008674526.1|  PREDICTED: probable glutathione S-transferase    90.5    1e-18   
ref|XP_009343223.1|  PREDICTED: probable glutathione S-transferas...  90.1    1e-18   
ref|XP_007050084.1|  Glutathione S-transferase tau 7                  90.1    1e-18   
gb|KHN08290.1|  Glutathione transferase GST 23                        88.6    1e-18   
dbj|BAK01646.1|  predicted protein                                    90.5    1e-18   
ref|XP_006379925.1|  hypothetical protein POPTR_0008s17520g           89.7    1e-18   
gb|EMT16282.1|  hypothetical protein F775_43057                       90.5    1e-18   
ref|XP_002524046.1|  glutathione s-transferase, putative              90.1    1e-18   
ref|XP_008346196.1|  PREDICTED: probable glutathione S-transferase    90.1    1e-18   
ref|XP_002881053.1|  glutathione S-transferase 19                     90.1    1e-18   
emb|CBI39960.3|  unnamed protein product                              89.0    2e-18   
emb|CDP11462.1|  unnamed protein product                              90.5    2e-18   
ref|XP_010248269.1|  PREDICTED: probable glutathione S-transferase    88.2    2e-18   
ref|XP_002264055.2|  PREDICTED: probable glutathione S-transferas...  90.1    2e-18   
ref|XP_008240195.1|  PREDICTED: probable glutathione S-transferase    89.7    2e-18   
ref|XP_006829147.1|  hypothetical protein AMTR_s00001p00269450        90.1    2e-18   
ref|XP_008793319.1|  PREDICTED: probable glutathione S-transferase    89.7    2e-18   



>ref|XP_009596758.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=223

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 97/120 (81%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKCLPA+ KAL++KGEEQ+K KEE  E+LK+LD EL+ KKF GGE +GF D
Sbjct  93   ARFWAKFLDEKCLPAAWKALWSKGEEQEKDKEETYEVLKVLDNELKDKKFFGGEKIGFVD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NFV FWVG++EEA GV LVT EKFP+LC W++++ + C ++KE +P RD L+ +FK 
Sbjct  153  IAANFVGFWVGIVEEATGVVLVTSEKFPHLCVWRDEY-LNCSQVKENMPNRDMLLGYFKG  211



>ref|XP_009776230.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=221

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 95/120 (79%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKCLPA  KAL++KGEEQ+K KEE  E+LK+LD EL+ KK+ GGE +GF D
Sbjct  94   ARFWAKFLDEKCLPAVWKALWSKGEEQEKDKEEAYEVLKVLDNELKDKKYFGGEKIGFVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NFV FWVG++EEA GV LVT EKFP+ C W+E++ + C ++KE +P R+ L+ +FK 
Sbjct  154  IAANFVGFWVGIVEEATGVVLVTSEKFPHFCTWREEY-LNCSQVKENMPNREMLLGYFKG  212



>ref|XP_006339006.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=221

 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 95/120 (79%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+KCLPA  KAL+++GEEQ+K KEE  E+LK+LD EL+ KKF GG+ +GF D
Sbjct  93   ARFWAKFLDDKCLPAVWKALWSQGEEQEKDKEEAYEVLKVLDNELKDKKFFGGDNIGFVD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  NFV FW+ ++EEA GV LVT EKFPN C W++++ + CD++KE +P R+ L+ FFKS
Sbjct  153  IVANFVGFWIEIVEEATGVVLVTSEKFPNFCVWRDEY-LNCDKVKENMPSREMLLGFFKS  211



>ref|XP_004249548.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=221

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW KF+DEKCLPA  KAL+++G+EQ+K KEE  E+LK++D EL+ KKF GG+ +GF D
Sbjct  93   ARFWVKFLDEKCLPAVWKALWSQGDEQEKDKEEAYEVLKVIDNELKDKKFFGGDNIGFVD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +  NFV FW+G++EEA GV LVT E FPN C W++++ + CD +KE +P R+ L+ +FKS
Sbjct  153  VVANFVGFWIGIVEEATGVVLVTSENFPNFCAWRDEY-LNCDRVKENMPSREMLLGYFKS  211



>ref|XP_009767205.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
 sp|Q03662.1|GSTX1_TOBAC RecName: Full=Probable glutathione S-transferase; AltName: Full=Auxin-induced 
protein PGNT1/PCNT110 [Nicotiana tabacum]
 emb|CAA39709.1| auxin-induced protein [Nicotiana tabacum]
 emb|CAA39705.1| auxin-induced protein [Nicotiana tabacum]
Length=223

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 93/120 (78%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K +PA  K    KGEEQ+K KEEVCE+LK+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFLDDK-VPAVVKTFLRKGEEQEKDKEEVCEMLKVLDNELKDKKFFVGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA N VAFW+GV EEA GV LVT EKFPN C+W+ ++ I C +IKE LPPRD+L+ F++S
Sbjct  152  IAANLVAFWLGVFEEASGVVLVTSEKFPNFCKWRGEY-INCSQIKESLPPRDELLAFYRS  210



>gb|KCW49513.1| hypothetical protein EUGRSUZ_K03038 [Eucalyptus grandis]
Length=155

 Score =   147 bits (371),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKC+PA  K+  + G E++K +EE CELL  L+ EL+ KKF GGE +GF D
Sbjct  26   ARFWAKFVDEKCVPALWKSCMSVGPEREKAQEEACELLSTLEGELKGKKFFGGENIGFVD  85

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I G+ +A+WVGVL+EA+GV+++T++KFP LCRW EDF   C  +KE LPPRDKL+ FFK+
Sbjct  86   IVGDVLAYWVGVLQEAVGVDVLTEDKFPVLCRWAEDF-RNCPVVKENLPPRDKLLAFFKT  144



>ref|XP_010037778.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=224

 Score =   149 bits (375),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKC+PA  K+  + G E++K +EE CELL  L+ EL+ KKF GGE +GF D
Sbjct  95   ARFWAKFVDEKCVPALWKSCMSVGPEREKAQEEACELLSTLEGELKGKKFFGGENIGFVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I G+ +A+WVGVL+EA+GV+++T++KFP LCRW EDF   C  +KE LPPRDKL+ FFK+
Sbjct  155  IVGDVLAYWVGVLQEAVGVDVLTEDKFPVLCRWAEDF-RNCPVVKENLPPRDKLLAFFKT  213



>ref|XP_008370017.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=221

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 90/122 (74%), Gaps = 4/122 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FIDEKCLPA+ KAL+   EE +K  EE CELLKIL+ EL+ KKF GGETVG  D
Sbjct  95   ARFWARFIDEKCLPAAWKALWG-SEEPEKAVEEACELLKILENELKDKKFFGGETVGLVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  NF+A+W+G ++E +GVEL+TKEK P+L  W ++F   C    E LPPRDKLV FF+ 
Sbjct  154  IVANFIAYWLGAIQEVVGVELLTKEKLPDLYDWSDEF---CSAFHESLPPRDKLVTFFRR  210

Query  361  GF  366
             F
Sbjct  211  RF  212



>ref|XP_009618409.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=220

 Score =   146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA F+D KC+    KALF KGEE DK KEE  ELLKILD EL+ KKF  G+  GFAD
Sbjct  93   ARFWANFLDVKCITTIGKALFGKGEESDKAKEESSELLKILDNELKDKKFFVGDNFGFAD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA N +AFW+G+LEEA GV LVT EKFPN C WK+++ I C ++K+ LP RD L+  F++
Sbjct  153  IAANLMAFWLGILEEASGVILVTSEKFPNFCAWKDEY-INCSQVKKYLPSRDVLLAHFQT  211

Query  361  GF  366
             F
Sbjct  212  RF  213



>ref|XP_009789711.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA F+D KC+    KALF KGEE DK KEE  ELLKILD EL+ KKF  G+  G+AD
Sbjct  93   ARFWANFLDVKCITTIGKALFGKGEESDKAKEECGELLKILDNELKDKKFFVGDNFGYAD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA N +AFW+G+LEEA GV LVT EKFPN C WK+++ I C ++KE LP RD L+  F+ 
Sbjct  153  IAANLMAFWLGILEEASGVILVTNEKFPNFCAWKDEY-INCSQVKEYLPSRDALLAHFQP  211

Query  361  GF  366
             F
Sbjct  212  RF  213



>ref|XP_010042776.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=224

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKC PA  K+  + G E++K  EE  ELL  L+ ELE KKF GGETVGF D
Sbjct  95   ARFWAKFLDEKCRPALWKSYTSVGPEREKAHEEAQELLSTLEGELEGKKFFGGETVGFLD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  NFV +W GVL+EA+GV+++T+EKFP LC+W E F   C  I+E LPPRD+LV FFK+
Sbjct  155  IVANFVGYWAGVLQEAVGVDVLTEEKFPALCKWAEGF-QNCPVIRENLPPRDRLVAFFKT  213



>ref|XP_009378879.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=221

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FIDEKCLPA+ KAL+   EE +K  EE CELLKIL+ EL+ KKF GGETVG  D
Sbjct  95   ARFWARFIDEKCLPAAWKALWG-SEEPEKAVEEACELLKILENELKDKKFFGGETVGLVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  NF+A+W+G ++E +GV+L+TKEK P+L  W ++F   C    E LPPRDKLV FF+
Sbjct  154  IVANFIAYWLGAIQEVVGVKLLTKEKLPDLYDWSDEF---CSVFHESLPPRDKLVAFFR  209



>ref|XP_009626799.1| PREDICTED: probable glutathione S-transferase isoform X2 [Nicotiana 
tomentosiformis]
Length=212

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K + A       KGEEQ+K KEEVCE+ K+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFLDDK-VTAVPNIFLRKGEEQEKAKEEVCEMFKVLDNELKDKKFFVGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            IA N VAFW+GV EEA GV LVT EKFPN C+W+ ++ I C +IKE LPPRD+L+ F++
Sbjct  152  IAANLVAFWLGVFEEASGVVLVTNEKFPNFCKWRGEY-INCSQIKESLPPRDELLAFYR  209



>ref|XP_009626798.1| PREDICTED: probable glutathione S-transferase isoform X1 [Nicotiana 
tomentosiformis]
Length=216

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 89/122 (73%), Gaps = 4/122 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCL---PASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVG  171
            ARFWAKF+D+K +    A       KGEEQ+K KEEVCE+ K+LD EL+ KKF  G+  G
Sbjct  93   ARFWAKFLDDKSVLQVTAVPNIFLRKGEEQEKAKEEVCEMFKVLDNELKDKKFFVGDKFG  152

Query  172  FADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDF  351
            FADIA N VAFW+GV EEA GV LVT EKFPN C+W+ ++ I C +IKE LPPRD+L+ F
Sbjct  153  FADIAANLVAFWLGVFEEASGVVLVTNEKFPNFCKWRGEY-INCSQIKESLPPRDELLAF  211

Query  352  FK  357
            ++
Sbjct  212  YR  213



>ref|XP_009625219.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=222

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA F+D KCL  + KA F KGEE DK KEE  ELLKILD EL+ KKF  G++ GFAD
Sbjct  93   ARFWANFLDVKCLTTTGKAYFGKGEESDKAKEECGELLKILDNELKDKKFFVGDSFGFAD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLV  345
            IA N +AFW+G++EEA GV LVT+EKFPN C WK+++ I C ++KE  P RD L+
Sbjct  153  IAANLIAFWLGIVEEASGVILVTREKFPNFCAWKDEY-INCSQVKEYFPSRDALL  206



>ref|XP_010039178.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49505.1| hypothetical protein EUGRSUZ_K03024 [Eucalyptus grandis]
Length=226

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            A FWAKF+DEKC PA  K+  + G E++K  EE  ELL  L+ EL+ KKF GGETVGF D
Sbjct  95   AHFWAKFLDEKCRPALWKSYTSVGPEREKAHEEAQELLSTLEGELKGKKFFGGETVGFVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  NFV +W GVL+EA+GV+++T+EKFP LC+W E F   C  I+E LPPRD+LVDFFK+
Sbjct  155  IVANFVWYWAGVLQEAVGVDVLTEEKFPVLCKWAEGF-QNCPVIRENLPPRDRLVDFFKA  213



>ref|XP_009788521.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=220

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKCLPA  K  F  GEE DK KEE  ELLKILD EL+ KKF  G+ +GFAD
Sbjct  93   ARFWAKFLDEKCLPAMGKVYFGTGEESDKAKEECNELLKILDNELKNKKFFVGDKIGFAD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKL  342
            IA N +AFW+G++EEA GV LVT EKF N C W+E++ + C ++K+ LP +D L
Sbjct  153  IAANLMAFWMGIIEEASGVVLVTSEKFSNYCVWREEY-LNCSQVKDNLPSKDAL  205



>ref|XP_010037768.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49501.1| hypothetical protein EUGRSUZ_K03019 [Eucalyptus grandis]
Length=224

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKC PA  K+  + G E++K  EE  ELL  L+ EL+ KKF GGETVGF D
Sbjct  95   ARFWAKFLDEKCRPALWKSYTSVGPEREKAHEEAQELLSTLEGELKGKKFFGGETVGFLD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  NFV +W GVL+EA+GV+++T+EKFP LC+W E F   C  I E LPPRD+LV FFK+
Sbjct  155  IVANFVGYWAGVLQEAVGVDVLTEEKFPVLCKWAEGF-QNCPVIWENLPPRDRLVGFFKT  213



>ref|XP_010037777.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49512.1| hypothetical protein EUGRSUZ_K03036 [Eucalyptus grandis]
Length=226

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEKC+P   K+  + G E++K  EE CELL  L+ EL+ KKF GGETVGF D
Sbjct  95   ARFWAKFIDEKCVPTIWKSFMSGGPEREKAHEEACELLSTLEGELKGKKFFGGETVGFVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  +F++ WVG ++EA GV+++T++KFP L +W E+F   C  IKE LPPRDK++ FFK+
Sbjct  155  IVASFISHWVGPVQEAAGVDVLTEDKFPMLYKWAEEF-KNCPVIKENLPPRDKILAFFKA  213



>ref|XP_009767206.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=223

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K           KGEEQ+K KEEVCE+LK+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFLDDKVT-VIVNTFLRKGEEQEKAKEEVCEMLKVLDNELKDKKFFVGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            IA NFVAFW+GV EEA GV LVT EKFPN  +W++++   C ++KE LP RD+L+ FF+
Sbjct  152  IAANFVAFWLGVFEEASGVVLVTSEKFPNFSKWRDEY-TNCSQVKESLPLRDELLPFFR  209



>ref|XP_010037773.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
 gb|KCW49510.1| hypothetical protein EUGRSUZ_K03031 [Eucalyptus grandis]
Length=213

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            A FWAKFIDEKC+PA  K+  + G E++K  +E CELL+ L+ EL+ KKF GGETVGF D
Sbjct  95   AHFWAKFIDEKCVPALWKSYMSVGPEREKAHDEACELLRTLEGELKGKKFFGGETVGFVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  +F+  WVG L+EA G +++T++KFP L +W EDF   C  IKE LPPRDK++ FFK+
Sbjct  155  IVASFIGHWVGALQEAAGFDVLTEDKFPMLYKWAEDF-KNCPVIKENLPPRDKILAFFKA  213



>ref|NP_001234086.1| uncharacterized protein LOC543814 [Solanum lycopersicum]
 gb|AAG16757.1| putative glutathione S-transferase T2 [Solanum lycopersicum]
Length=218

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF D+KC+P   KA+F  GEE +K KEE+ +L+KIL+ EL+ K F  G+  GFAD
Sbjct  93   ARFWAKFFDDKCMPVMGKAIFGSGEESNKAKEELGDLIKILENELKDKNFFVGDKFGFAD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +AGN +A+W+G++EEA G   VT EKFP  C W+ ++ + C  IKE LPPRD+++  FK+
Sbjct  153  MAGNLMAYWMGIVEEASGNIFVTSEKFPIFCNWRNEY-VNCSTIKEYLPPRDEILAHFKA  211

Query  361  GF  366
             F
Sbjct  212  RF  213



>ref|XP_010037776.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49511.1| hypothetical protein EUGRSUZ_K03034 [Eucalyptus grandis]
Length=226

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEKC+PA  K+L + G E++K  EE CELL  L+ EL+ KKF GGETVGF D
Sbjct  95   ARFWAKFIDEKCVPAIWKSLTSVGPEKEKANEEACELLSTLEGELKGKKFFGGETVGFVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  +F+  WVG ++EA G + +T++KFP L +W E+F   C  IKE LPPRDK++ FFK+
Sbjct  155  IVASFIGHWVGAVQEAAGFDFLTEDKFPVLYKWAEEF-KNCPVIKENLPPRDKILAFFKA  213



>ref|XP_011000057.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
 ref|XP_011000058.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 87/122 (71%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEKC+PA  + +++K  E++K  EE  + LK L+ EL+ KKF GGET+G  D
Sbjct  93   ARFWAKFIDEKCMPAIWQIMWSKENEREKAIEEAIQHLKTLENELKDKKFFGGETIGLVD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  NF+ FW+G   EA G+ELV KE+FP LC+W +++ + C  +KE +PPRDKL+ F + 
Sbjct  153  IVANFIGFWLGAAAEATGMELVNKERFPILCKWIDEY-VNCSVVKENIPPRDKLIAFLRP  211

Query  361  GF  366
             F
Sbjct  212  RF  213



>emb|CBI30466.3| unnamed protein product [Vitis vinifera]
Length=126

 Score =   134 bits (336),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK+IDEKC+PA  KA + + +E++K  EE C  LK L+ EL+ KKF GGE+VGF D
Sbjct  2    ARFWAKYIDEKCVPALWKACWCEEKEREKAVEEACVCLKTLENELKDKKFFGGESVGFVD  61

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  NF+ FWVG + EA+GVEL+T++KFP LC+W ++  + C  IKE LP +DK+V F+++
Sbjct  62   IVANFIGFWVGAIGEAVGVELLTRDKFPILCKWSDEH-VGCRVIKENLPSKDKVVAFYRT  120



>ref|XP_006367668.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=222

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 90/121 (74%), Gaps = 2/121 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKR-KEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWAKF+D KCL A  KAL+ KGEEQ+K  +EE  E+LKI+D EL+ KKF  G+ +GF 
Sbjct  94   ARFWAKFLDGKCLEAVGKALWCKGEEQEKNIQEEAYEMLKIVDNELKDKKFFSGDKIGFV  153

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            D+A N++ FWV ++EEA G  L+T EKFPNLC W +++ + C E++E LP RD ++ FFK
Sbjct  154  DVAANYIPFWVEIVEEATGNVLITSEKFPNLCAWIDEY-LKCSEVQENLPDRDMMLSFFK  212

Query  358  S  360
            +
Sbjct  213  A  213



>ref|XP_009606317.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=221

 Score =   135 bits (341),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKR-KEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWA+F+D KCL A  KAL++KG+EQ+K  ++E  ELLKI+D EL+ KKF GG+ +GF 
Sbjct  93   ARFWARFLDGKCLEAVGKALWSKGKEQEKSIQQEAYELLKIVDNELKDKKFFGGDKIGFV  152

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
            D+A N++ FW+ ++EEA GV LVT +KFP+LC W++++ + C E+KE LP RD ++ FF
Sbjct  153  DLAANYIPFWLEIVEEATGVVLVTSQKFPHLCAWRDEY-LSCSEVKENLPDRDMMLVFF  210



>gb|ADB11327.1| tau class glutathione transferase GSTU45 [Populus trichocarpa]
Length=220

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 85/119 (71%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEKC+PA  + + +K  E++K  EE  + LK L+ EL+ KKF GGET+G  D
Sbjct  93   ARFWAKFIDEKCMPAIWQIMLSKENEREKAIEEAIQHLKTLENELKDKKFFGGETIGLVD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  NF+ FW+G  +EA G+ELV KE+FP LC+W +++   C  +KE LPPRDKL+ F +
Sbjct  153  IVANFIGFWLGAAQEATGMELVNKERFPVLCKWIDEY-ANCSVVKENLPPRDKLIAFLR  210



>ref|XP_009768031.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=223

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K   A       KGEEQ+K KEEV E+ K+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFLDDKVT-AVPNIFRRKGEEQEKAKEEVREMFKVLDNELKDKKFFVGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            IA N VAFW+GV +E  GV LVT EKFPN C+W+ ++ I C +IKE LPPRD+L+ F++
Sbjct  152  IAANLVAFWLGVFQETSGVVLVTSEKFPNFCKWRGEY-INCSQIKESLPPRDELLAFYR  209



>ref|XP_009378880.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=222

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 4/119 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FIDEKCLPA+ K L+   EE +K  EE CELLKIL+ EL+ KKF  GETVG  D
Sbjct  95   ARFWARFIDEKCLPATYKVLWG-SEEHEKAVEEACELLKILENELKDKKFFAGETVGLVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  NF+ +W+  ++E +GVEL+TKEK P L  W ++F   C   +E LPPRDKLV   +
Sbjct  154  IVANFIGYWLRAIQEVVGVELLTKEKLPKLYNWSDEF---CSVFQESLPPRDKLVAHIR  209



>ref|XP_002275657.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=218

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK+IDEKC+PA  KA + + +E++K  EE C  LK L+ EL+ KKF GGE+VGF D
Sbjct  94   ARFWAKYIDEKCVPALWKACWCEEKEREKAVEEACVCLKTLENELKDKKFFGGESVGFVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  NF+ FWVG + EA+GVEL+T++KFP LC+W ++  + C  IKE LP +DK+V F+++
Sbjct  154  IVANFIGFWVGAIGEAVGVELLTRDKFPILCKWSDEH-VGCRVIKENLPSKDKVVAFYRT  212



>ref|XP_008370015.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=221

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 86/119 (72%), Gaps = 4/119 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FIDEKCLPA+ KAL+   EE +K  EE CELLKIL+ EL+ KKF  GETVG  D
Sbjct  94   ARFWARFIDEKCLPATWKALWG-SEEPEKAVEEACELLKILENELKDKKFFAGETVGLVD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  NF+AFW+  ++E +GVEL++KEK P L  W ++F   C   +E LPP+D+LV  F+
Sbjct  153  IVANFIAFWLRAIQELVGVELLSKEKLPKLYNWSDEF---CSVFQENLPPKDRLVAHFR  208



>ref|XP_009802971.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=226

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 91/121 (75%), Gaps = 2/121 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWAKF+D KCL    KAL++KG+ E+   ++E  E+LKI+D EL+ KKF GG+ +GF 
Sbjct  93   ARFWAKFLDGKCLEVVGKALWSKGKKEKQSIQQEAYEMLKIVDNELKDKKFFGGDKIGFV  152

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            D+A N++ FW+ ++EEA GV LVT EKFP+LC W++++ + C E+KE LP RD ++ FFK
Sbjct  153  DVAANYIPFWLEIVEEATGVVLVTSEKFPHLCAWRDEY-LSCSEVKENLPDRDMMLGFFK  211

Query  358  S  360
            +
Sbjct  212  A  212



>ref|XP_010037769.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49508.1| hypothetical protein EUGRSUZ_K03029 [Eucalyptus grandis]
Length=226

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEKC+PA  K+L + G E++K  EE CELL  L+ EL+ KKF GGETVGF D
Sbjct  95   ARFWAKFIDEKCVPAIWKSLTSVGPEKEKANEEACELLSTLEGELKGKKFFGGETVGFVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  +F+  WVG ++EA G + +T++KFP L +W E+F   C  IKE LPPRDK++  FK+
Sbjct  155  IVASFIGHWVGAVQEAAGFDFLTEDKFPVLYKWAEEF-KNCPVIKENLPPRDKILADFKA  213



>ref|XP_009606316.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=212

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +1

Query  7    FWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFADIA  186
            FWAKF+D+K + A       KGEEQ+K KE+VCE+ K+LD EL+ KKF  G+  GFADIA
Sbjct  95   FWAKFLDDK-VTAVPNIFLRKGEEQEKAKEKVCEMFKVLDNELKDKKFFVGDKFGFADIA  153

Query  187  GNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKSG  363
             N VAFW+GV EEA GV LVT+EKF   C+W+ ++ I C +IKE LPPRD+L+ F+++ 
Sbjct  154  ANLVAFWLGVFEEASGVVLVTREKFSIFCKWRGEY-INCSQIKESLPPRDELLAFYRAS  211



>ref|XP_010037779.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49514.1| hypothetical protein EUGRSUZ_K03039 [Eucalyptus grandis]
Length=230

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKC+PA  K  ++ GEEQ+   EE C +LKIL+ ELE KKF GG  +GF D
Sbjct  95   ARFWAKFLDEKCVPALWKYCWSLGEEQENAYEEACGVLKILEGELEDKKFFGGNNLGFVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  N V  W+ V++EA G  ++T +KFP LC+W E+F   C  +KE LPPRD+L   FK+
Sbjct  155  ITANSVGLWIVVIQEAGGFNILTPDKFPRLCKWAEEF-RSCPVVKENLPPRDRLYALFKA  213

Query  361  GF  366
             F
Sbjct  214  RF  215



>ref|XP_008370016.1| PREDICTED: glutathione S-transferase U8-like [Malus domestica]
Length=222

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 83/119 (70%), Gaps = 4/119 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FIDEKCLPA+ K L+   EE +K  EE CELLKIL+ EL+ KKF  GETVG  D
Sbjct  95   ARFWARFIDEKCLPATYKVLWG-CEEHEKAVEEACELLKILENELKDKKFFAGETVGLVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  NF+ +W+  ++E +GVEL+TKEK P L  W ++F   C   +E LPP+DKLV   +
Sbjct  154  IVANFIGYWLRAIQEVVGVELLTKEKLPKLYNWSDEF---CSVFQESLPPKDKLVAHIR  209



>gb|AFW90580.1| glutathione S-transferase-like protein [Solanum tuberosum]
Length=226

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 82/119 (69%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K +     A   KGEEQ+K KEEVCE+LKILD EL+ K F      G+AD
Sbjct  93   ARFWAKFLDDKVVTV-VNAFLGKGEEQEKAKEEVCEMLKILDNELKDKTFFVANKFGYAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  N V  W+GV +E  G+ELVT EKFPN C W++++ + C ++KE LP R+ L+ FF+
Sbjct  152  IVANLVGLWLGVFQEGFGIELVTSEKFPNFCGWRDEY-VKCSQVKEYLPSRNDLLAFFQ  209



>ref|XP_010325822.1| PREDICTED: LOW QUALITY PROTEIN: probable glutathione S-transferase 
[Solanum lycopersicum]
Length=224

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K +     A   KGEE +K KEEV E+LKILD EL+ KKF  G+  G AD
Sbjct  93   ARFWAKFLDDKVVTV-VNAFLGKGEENEKAKEEVYEMLKILDNELKNKKFFVGDKFGIAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  N V  W+GV +E  GVELVT EKFPN C W++++ + C ++KE LP RD L+ FF++
Sbjct  152  IVANLVGLWLGVFQEGSGVELVTSEKFPNFCSWRDEY-VNCSQVKEYLPRRDDLLAFFQA  210



>ref|XP_006367667.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=226

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 82/119 (69%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K +     A   KGEEQ+K KEEVCE+LKILD EL+ K F      G+AD
Sbjct  93   ARFWAKFLDDKVVTV-VNAFLGKGEEQEKAKEEVCEMLKILDNELKDKTFFVANKFGYAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  N V  W+GV +E  G+ELVT EKFPN C W++++ + C ++KE LP R+ L+ FF+
Sbjct  152  IVANLVGLWLGVFQEGSGIELVTSEKFPNFCGWRDEY-VNCSQVKEYLPSRNDLLAFFQ  209



>ref|XP_004246388.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=219

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 87/120 (73%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K + A       KGEEQ+K K+EVCE+L +LD EL+ KKF  G+  G+AD
Sbjct  93   ARFWAKFLDDK-VGAMVNTFLLKGEEQEKGKKEVCEMLNVLDNELKGKKFFVGDKFGYAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +A NFV +W+GV +EA GV LVT EKF N C W++++ + C ++KE LPPR+ L+ F ++
Sbjct  152  MAANFVGYWLGVFQEASGVVLVTSEKFSNFCVWRDEY-VNCSQVKEYLPPRNDLLAFVEA  210



>ref|XP_006367665.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=226

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 82/119 (69%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K +     A   KGEEQ+K KEEVCE+LKILD EL+ K F      G+AD
Sbjct  93   ARFWAKFLDDKVVTV-VNAFLGKGEEQEKAKEEVCEMLKILDNELKDKTFFVANKFGYAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  N V  W+GV +E  G+ELVT EKFPN C W++++ + C ++KE LP R+ L+ FF+
Sbjct  152  IVANLVGLWLGVFQEGSGIELVTSEKFPNFCGWRDEY-VNCSQVKEYLPSRNDLLAFFQ  209



>gb|KCW49506.1| hypothetical protein EUGRSUZ_K03027 [Eucalyptus grandis]
Length=124

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKC+    K+  + G E++K  EE  +LL  L+ EL+ KKF GGETVGF D
Sbjct  2    ARFWAKFLDEKCMQTLWKSFTSIGAEREKMHEEARQLLSTLEGELKGKKFFGGETVGFID  61

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  NFV +WVGV++EA+G +++T+ +FP LC+W E+F   C  IKE LP +DKL+ FFK
Sbjct  62   IMANFVGYWVGVIQEAVGADVLTEGEFPLLCKWAEEF-QNCPVIKENLPLKDKLLAFFK  119



>ref|XP_007026866.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
 gb|EOY07368.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
Length=224

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FIDEKC+P   KAL   GEE++K  EEV E LK L+  L  K+F GGET+G  D
Sbjct  97   ARFWARFIDEKCMPPVWKALLGTGEEREKALEEVRECLKTLEGVLNGKRFFGGETIGLLD  156

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+AFW+ V++E  G+E +T +K P L +W ++F + C+ +KE LPPRDKL+ F K+
Sbjct  157  IAANFIAFWLRVIQEVSGLEFLTADKCPVLIKWCDEF-VSCNPVKEHLPPRDKLIAFMKN  215



>ref|NP_001234778.1| glutathione S-transferase-like protein [Solanum lycopersicum]
 gb|ABM06179.1| glutathione S-transferase-like protein [Solanum lycopersicum]
Length=217

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 86/119 (72%), Gaps = 4/119 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF D+K L A  K++F KGEEQ+K KEEV ++LK+LD EL+ KK   GE  GF D
Sbjct  93   ARFWAKFFDDKGL-AIRKSIFFKGEEQEKAKEEVYDMLKVLDNELKNKKIFVGEKFGFVD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  N  A W+GVLEEA GV LVT+EK+PN C W++++   C + K+ LPPRD+L+  ++
Sbjct  152  IVANAAALWLGVLEEASGVVLVTREKYPNFCDWRDEY---CTQNKKYLPPRDELLAHYQ  207



>ref|XP_007026865.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
 gb|EOY07367.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
Length=220

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 85/120 (71%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEKCLPA  KA ++   E++K  EE CE LK L+  L  K+F GG+ VG  D
Sbjct  95   ARFWAKFIDEKCLPAIWKAGWSPESEREKPVEEACECLKTLESALGGKRFFGGDKVGMVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ +W+ +++E  G+EL++ EKFP L +W ++F + C  +K  LPPRDKL+ FFK+
Sbjct  155  IAANFIGYWLRLIQEVTGMELLSAEKFPELFKWTDEF-VSCSVVKGSLPPRDKLLAFFKA  213



>ref|XP_010039179.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=216

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKC+    K+  + G E++K  EE  +LL  L+ EL+ KKF GGETVGF D
Sbjct  85   ARFWAKFLDEKCMQTLWKSFTSIGAEREKMHEEARQLLSTLEGELKGKKFFGGETVGFID  144

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  NFV +WVGV++EA+G +++T+ +FP LC+W E+F   C  IKE LP +DKL+ FFK
Sbjct  145  IMANFVGYWVGVIQEAVGADVLTEGEFPLLCKWAEEF-QNCPVIKENLPLKDKLLAFFK  202



>ref|XP_008781207.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
 ref|XP_008781208.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=225

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 84/120 (70%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW KF+DEKC+P   K+L+++GE Q K  EE  E L IL++EL+ KKF GG ++G  D
Sbjct  94   ARFWTKFVDEKCMPIMWKSLWSEGEMQQKLMEETNENLSILERELDGKKFFGGNSIGLVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+++W  VL+E  G+ L  +EK P L +W  +F +  D +KECLPP+D+L+  F++
Sbjct  154  IAANFLSYWTEVLQEVAGISLFNEEKHPILFKWANEF-MSSDAVKECLPPKDELLSHFQA  212



>ref|XP_006367676.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=225

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 83/121 (69%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF D K + A   A   KG EQ+K KEEVCE+LK+L+KEL+ KK   G+  GF D
Sbjct  93   ARFWAKFFDNKVV-AVVNAFLGKGNEQEKGKEEVCEMLKVLEKELKDKKLFVGDKFGFVD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPR-DKLVDFFK  357
            IA N V  W+GV +EA GV L T E FPN C W++ + I C ++KE LPPR D+L+ F++
Sbjct  152  IAANLVGLWMGVFQEASGVVLATNENFPNFCAWRDAY-INCSQVKEYLPPRIDELLAFYQ  210

Query  358  S  360
            +
Sbjct  211  A  211



>emb|CDP06553.1| unnamed protein product [Coffea canephora]
Length=233

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 86/123 (70%), Gaps = 1/123 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA +++EKCLPA  K  ++ GE+ DK K E  E+LK L+ EL+ KKF GG+++G  D
Sbjct  93   ARFWANYVEEKCLPALFKTFWSVGEQYDKDKAEAGEVLKFLEDELQGKKFFGGDSIGLVD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  NF+AFW   ++EALG++++TK+ FP L  W E++ + C +I + LPP+DKL+  F  
Sbjct  153  IVANFMAFWFRTIQEALGLDVLTKDNFPKLWEWAENY-VNCSDINQFLPPKDKLIAIFPP  211

Query  361  GFI  369
             ++
Sbjct  212  PYM  214



>ref|XP_007026863.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
 gb|EOY07365.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
Length=228

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 85/120 (71%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA F+DEKCLP   KA +++  E++K  EE CE LK L+  L  K+F GG+TVG  D
Sbjct  95   ARFWANFVDEKCLPVLRKAGWSQESEREKVVEEACECLKTLESALRGKRFFGGDTVGMVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ +W+ V++EA G+E+++ EKFP L +W ++F + C  +K  LPPRDKL+ F K+
Sbjct  155  IAANFIGYWLRVIQEATGMEVLSAEKFPELFKWTDEF-VSCSIVKGSLPPRDKLLAFVKA  213



>ref|XP_006360613.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=227

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K + A     F KG+EQ+K KEEV E+LK+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFLDDK-VTAVVNTFFRKGDEQEKGKEEVYEMLKVLDNELKDKKFFVGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPP-RDKLVDFFK  357
            I  N VA W+GV EEA GV LVT +KFP  C W++++ I C ++KE LP  RD+L+ FF 
Sbjct  152  IVANMVALWLGVYEEASGVVLVTSQKFPKFCAWRDEY-INCSQVKEYLPSRRDELLTFFH  210

Query  358  S  360
            +
Sbjct  211  A  211



>gb|AAX20044.1| probable glutathione-S-transferase [Capsicum annuum]
Length=220

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 83/115 (72%), Gaps = 2/115 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K L A  K  F KGEEQ+K K E  E LK+LD E++ KKF   +  GFAD
Sbjct  93   ARFWAKFLDDK-LQAIGKTFFFKGEEQEKAKGEAYETLKVLDNEVKDKKFFVADKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLV  345
            IA NFV  W+GV EEA G+ LVT+EKFPN C W++++ I C + KE LPPRD+L+
Sbjct  152  IAANFVGLWLGVFEEATGIVLVTREKFPNFCAWRDEY-INCTQNKEYLPPRDELL  205



>ref|XP_010684665.1| PREDICTED: glutathione S-transferase U8-like [Beta vulgaris subsp. 
vulgaris]
Length=223

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEKC+ +    L+A  +E +K  +E  E L++L+KE+E KKF GGE +GF D
Sbjct  96   ARFWAKFIDEKCITSLWNTLWATEDEYEKLLKEAKENLQVLEKEIEGKKFFGGENIGFVD  155

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  NF+ FW+G ++EA+G  + TK+ +P L +W E++ + C+ IKE LPPRD+LV +FK
Sbjct  156  IVANFIGFWLGCVQEAVGRTIFTKQSYPFLSKWAEEY-VSCNIIKENLPPRDRLVTYFK  213



>ref|XP_006367670.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=217

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 83/120 (69%), Gaps = 4/120 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
             RFW KF ++K  P+  K+LF KGEEQ+K KEEV E+LKILD EL+ KKF  G+  GF D
Sbjct  93   VRFWDKFFEDKG-PSMMKSLFLKGEEQEKAKEEVYEMLKILDNELKDKKFFVGDKFGFVD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  N VA W GV EE  GV LVTKEKFPN C W++++ I   + KE LPPRD+L   +++
Sbjct  152  IVANAVALWFGVFEEVTGVVLVTKEKFPNFCVWRDEYYI---QNKEYLPPRDELFAHYQA  208



>ref|XP_004246385.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=222

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 86/121 (71%), Gaps = 2/121 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKR-KEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWA F+D  CL A  K L++K EE++K  +EE  E+LKI+D EL+ KKF  G+ +GF 
Sbjct  94   ARFWATFLDGMCLDAVRKGLWSKREEKEKNIQEEAYEMLKIVDNELKDKKFFSGDKIGFV  153

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            D+A N++ FWV ++EEA G  L+T EKFPNLC W + + + C E++E LP RD ++ FFK
Sbjct  154  DVAANYIPFWVEIVEEATGNVLITSEKFPNLCAWIDKY-LKCSEVQENLPDRDMMLSFFK  212

Query  358  S  360
            +
Sbjct  213  A  213



>gb|AFK47124.1| unknown [Lotus japonicus]
Length=221

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 88/123 (72%), Gaps = 3/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALF-AKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW++FID+K LPA ++A + A  EE++K  +E  E L+ L+KEL+  KF GGET+G  
Sbjct  93   ARFWSRFIDDKILPAISRAAWTANQEEREKGIQESVEALQFLEKELK-HKFFGGETIGLV  151

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIAG F+AFW+ V+EE+ G  L+T EKFP L +W +DF I    +KE LPPRDKL+ FFK
Sbjct  152  DIAGAFLAFWLPVIEESTGFSLLTSEKFPKLYKWSQDF-INHPVVKENLPPRDKLLGFFK  210

Query  358  SGF  366
              +
Sbjct  211  GRY  213



>gb|AEB77869.1| glutathione S-transferase protein [Bruguiera gymnorhiza]
Length=222

 Score =   125 bits (315),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETK--KFLGGETVGF  174
            ARFWAKFID+KCLPA  +AL++K  E++K KEE C  LK L+ EL  K  KF GGET+G 
Sbjct  93   ARFWAKFIDDKCLPAFWQALWSKENEREKAKEEACHHLKTLENELNAKGTKFFGGETIGL  152

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
             DIA NF  +W+ +L+EA  ++ VTKE+FP    W ++F   C  IKE LP +DK++  F
Sbjct  153  VDIAANFFGYWLAILQEAAEMDFVTKEEFPVFFDWIDEF-SSCSAIKESLPAKDKMLAVF  211

Query  355  KSGF  366
            +S F
Sbjct  212  QSRF  215



>ref|XP_006367673.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=217

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K  P   K+ F KGEEQ+K KEE  E+LKILD EL+ KK   G+  GFAD
Sbjct  93   ARFWAKFLDDKMAPVG-KSFFLKGEEQEKAKEEAYEILKILDNELKDKKLFVGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NFV  WVGV EEA G  LVTKE FPNLC W++++ I C E KE LPPR++LV  F++
Sbjct  152  IAANFVGIWVGVFEEASGEVLVTKENFPNLCAWRDEY-INCSENKEYLPPRNELVAHFQA  210

Query  361  GF  366
             F
Sbjct  211  RF  212



>gb|KCW61134.1| hypothetical protein EUGRSUZ_H03907 [Eucalyptus grandis]
Length=207

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 89/127 (70%), Gaps = 9/127 (7%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELE--TKKFLGGETVGF  174
            ARFWAKF+D+KC PA  ++   +G E++   EE C LL +L+ EL+   K+F GG+T+GF
Sbjct  74   ARFWAKFMDDKCAPALWRSCRREGIERENAFEEACALLNVLEAELKDKQKRFFGGDTIGF  133

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRW---KEDFIIICDEIKECLPPRDKLV  345
             DIAGNF+ +W+GV++E  GV L+T EKFP LC+W    ++F I    IKE LPPR++L 
Sbjct  134  VDIAGNFIGYWIGVIQEVAGVRLLTPEKFPLLCKWCCEFQNFPI----IKENLPPREQLF  189

Query  346  DFFKSGF  366
             FFK+ F
Sbjct  190  AFFKARF  196



>gb|KFK38292.1| hypothetical protein AALP_AA3G095200 [Arabis alpina]
Length=204

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 85/122 (70%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA ++D+K + A  KA +    E++K  EE  E LK L+KEL  K F GGET+GF D
Sbjct  78   ARFWANYVDDKVMLALWKACWGPETEREKLVEEASEGLKFLEKELGDKLFFGGETIGFVD  137

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA +F+ +W+G+++EA GV ++T EKFP L RW EDF +  + IKE LPP+ KL+ FFK+
Sbjct  138  IAADFIGYWLGIVQEASGVTIMTAEKFPKLQRWSEDF-VGNNFIKEVLPPKQKLLAFFKA  196

Query  361  GF  366
             F
Sbjct  197  QF  198



>ref|XP_010486488.1| PREDICTED: glutathione S-transferase U8-like [Camelina sativa]
 ref|XP_010486489.1| PREDICTED: glutathione S-transferase U8-like [Camelina sativa]
 ref|XP_010486490.1| PREDICTED: glutathione S-transferase U8-like [Camelina sativa]
Length=223

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++DEK + A  KA +    E++K  +E  E LK L+KEL  K F GGET+GF D
Sbjct  97   ARFWAKYVDEKVMVAMWKACWGPKSEREKETKEAYEGLKYLEKELGDKHFFGGETIGFVD  156

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA +F+ +W+G+++EA GV ++T E+FPNL RW ++F I  + IKE LPP+ KL    K+
Sbjct  157  IAADFIGYWLGIVQEASGVTIMTAEEFPNLQRWSKEF-ISNNFIKEVLPPKQKLATLLKA  215

Query  361  GF  366
             F
Sbjct  216  QF  217



>ref|XP_010464567.1| PREDICTED: glutathione S-transferase U8 [Camelina sativa]
Length=224

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (70%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++DEK + A  KA +    E++K  +E  E LK L+KEL  K F GGET+GF D
Sbjct  98   ARFWAKYVDEKVMVAIWKACWGPRSEREKETKEAYEGLKYLEKELGDKHFFGGETIGFVD  157

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA +F+ +W+G+++EA GV ++T E+FPNL RW +DF I  + +KE LPP+ +L   FK+
Sbjct  158  IAADFIGYWLGIVQEASGVTIMTAEEFPNLQRWSKDF-IDNNFVKEVLPPKHELAALFKA  216

Query  361  GF  366
             F
Sbjct  217  QF  218



>ref|XP_009798686.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=126

 Score =   120 bits (301),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = +1

Query  31   KCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFADIAGNFVAFWV  210
            KCL    KAL+ KGEE DK +EE  E LKILD E + KKF  G+  G+ADIA N +AFW+
Sbjct  9    KCLTTIGKALYGKGEESDKAREEFGEPLKILDNEFKDKKFFVGDDFGYADIAANLMAFWL  68

Query  211  GVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKSGF  366
            G+ EEA GV LVT EK+PN C WK+++ I C ++KE LP RD L+  F+  F
Sbjct  69   GIGEEASGVVLVTSEKYPNFCAWKDEY-IHCSQVKEYLPLRDALLAHFQPRF  119



>ref|XP_004246379.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=220

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+KCLP   KAL    EE++K KEE  ELLKILD EL+ K+F  G+ +GF D
Sbjct  93   ARFWAKFLDDKCLPTMGKALLGNEEEKEKAKEECGELLKILDNELKDKEFFVGDKIGFVD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA N +AFW+G++EEA GV LV  EKFPN   W++++ I C ++K+ LP RD+L   F+S
Sbjct  153  IAANALAFWMGIIEEASGVILVKNEKFPNYYTWRDNY-INCSQVKKYLPSRDELFSHFQS  211

Query  361  GF  366
             F
Sbjct  212  RF  213



>ref|XP_010027076.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
Length=232

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 89/127 (70%), Gaps = 9/127 (7%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELE--TKKFLGGETVGF  174
            ARFWAKF+D+KC PA  ++   +G E++   EE C LL +L+ EL+   K+F GG+T+GF
Sbjct  99   ARFWAKFMDDKCAPALWRSCRREGIERENAFEEACALLNVLEAELKDKQKRFFGGDTIGF  158

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRW---KEDFIIICDEIKECLPPRDKLV  345
             DIAGNF+ +W+GV++E  GV L+T EKFP LC+W    ++F I    IKE LPPR++L 
Sbjct  159  VDIAGNFIGYWIGVIQEVAGVRLLTPEKFPLLCKWCCEFQNFPI----IKENLPPREQLF  214

Query  346  DFFKSGF  366
             FFK+ F
Sbjct  215  AFFKARF  221



>ref|XP_006367677.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=215

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 86/122 (70%), Gaps = 4/122 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW KF++++ + A  K +F KGEEQ+K K+E CE+LKIL+ EL+ KK+  G+  GFAD
Sbjct  93   ARFWVKFLEDQ-VAAVGKTIFLKGEEQEKAKKEACEMLKILENELKDKKYFVGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  N +A W+GV EEA GV LVT E +PNL  W+ ++   C++ KE LP RD+L+  F++
Sbjct  152  IGANVLAIWLGVFEEASGVPLVTSENYPNLYAWRNEY---CNQNKEYLPSRDELLAHFQA  208

Query  361  GF  366
             F
Sbjct  209  RF  210



>ref|XP_010325821.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=210

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 84/120 (70%), Gaps = 4/120 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW KF ++K  P+  K++  KGEEQ+K KEEV E+L+ILD EL+ KKF  G+  GF D
Sbjct  93   ARFWVKFFEDKG-PSMRKSILLKGEEQEKAKEEVFEMLRILDNELKGKKFFVGDKFGFVD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  N  A W+GVLEE  GV LVTKEKFPN C W++++   C + KE LP RD+L+  FK+
Sbjct  152  IVANAGALWLGVLEEVSGVVLVTKEKFPNFCVWRDEY---CTQNKEYLPSRDELLIRFKT  208



>gb|AEB77872.1| glutathione S-transferase protein [Bruguiera gymnorhiza]
Length=222

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 84/124 (68%), Gaps = 3/124 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETK--KFLGGETVGF  174
            ARFWAKFID+KCLPA  +AL++K  E++K KEE C  LK L+ EL  K  KF GG T+G 
Sbjct  93   ARFWAKFIDDKCLPAFWQALWSKENEREKAKEEACHHLKTLENELNAKGTKFFGGGTIGL  152

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
             DIA NF  +W+ +L+EA  ++ VTKE+FP    W ++F   C  IKE LP +DK++  F
Sbjct  153  VDIAANFFGYWLAILQEAAEMDFVTKEEFPVFFDWIDEF-SSCSAIKESLPAKDKMLAVF  211

Query  355  KSGF  366
            +S F
Sbjct  212  QSRF  215



>ref|XP_006576598.1| PREDICTED: probable glutathione S-transferase-like isoform X1 
[Glycine max]
Length=226

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 87/123 (71%), Gaps = 3/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFA-KGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+++ID+KCLPA +KA F    EE+DK  EE  E L+IL+ EL+  KF GGET+   
Sbjct  98   ARFWSRYIDDKCLPAISKAAFTVDKEERDKGTEESLESLQILENELK-HKFFGGETIDIV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+  +EEA+G++L+T EKFP L +W ED+      +K+ LP RD+LV FFK
Sbjct  157  DIAAGFIAFWLPAIEEAVGLKLLTNEKFPKLYKWGEDY-TNHPIVKKNLPQRDRLVGFFK  215

Query  358  SGF  366
            + +
Sbjct  216  ARY  218



>ref|XP_010101873.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB90010.1| putative glutathione S-transferase [Morus notabilis]
Length=217

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 83/119 (70%), Gaps = 3/119 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FID+KC PA  KA ++K +E++K  EE+ ELLK L+ EL+   F GGETVG  D
Sbjct  94   ARFWARFIDDKCFPAIWKAYWSK-DEREKAVEELIELLKFLENELDDN-FFGGETVGLVD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I GN +A W+  L E  GVE++T+EKFP LCRW  +F +    +KE LP R+KL+ F +
Sbjct  152  IVGNIIAHWLPALHEVAGVEILTEEKFPKLCRWSHEF-VNHSVVKEVLPSREKLIAFLR  209



>gb|ACN60408.1| glutathione S-transferase [Capsicum annuum]
Length=220

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 82/115 (71%), Gaps = 4/115 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF D+K   A TK+ F +GEEQ+K KE+  E+LK+LD EL+ KK+  G+  GFAD
Sbjct  93   ARFWAKFFDDKG-DALTKSFFVQGEEQEKAKEQAYEMLKVLDNELKDKKYFVGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLV  345
            IA   VA ++GVLEEA G+ L T+EKFP  C W++++   C E KE LPPRD L+
Sbjct  152  IAATGVALYLGVLEEATGIVLATREKFPIFCAWRDEY---CSENKEYLPPRDGLL  203



>ref|XP_004246384.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=217

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 85/122 (70%), Gaps = 7/122 (6%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW KF ++K     T + F K E   K KEEVCE+LKILD EL+ KKF  G+  GFAD
Sbjct  93   ARFWVKFFEDKGSAVGT-SFFHKSE---KAKEEVCEMLKILDNELKDKKFFVGDKFGFAD  148

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+A W+G+LEEA G+ LVTKEK+PN   W++++I   +  KE LP RD+L+ FFK+
Sbjct  149  IAANFLALWMGILEEATGIILVTKEKYPNFYAWRDEYI---NGNKEYLPSRDELLAFFKA  205

Query  361  GF  366
             F
Sbjct  206  RF  207



>ref|XP_010696150.1| PREDICTED: glutathione S-transferase U8-like [Beta vulgaris subsp. 
vulgaris]
Length=224

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FIDEKCLP+  +A +    EQ+   EE    LKIL+KEL+  KF GG ++G+ D
Sbjct  96   ARFWARFIDEKCLPSIWRAFWGPENEQESAGEEARNNLKILEKELKGNKFFGGTSIGYLD  155

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  NF+A+W+  +++A G E++TKE FP L +WK+DF + C  +K+ LPP ++LV +++
Sbjct  156  IVANFIAYWLDAIQKAAGKEILTKELFPLLSKWKDDF-VACKVVKQNLPPWERLVAYYQ  213



>ref|XP_010039180.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
 gb|KCW49509.1| hypothetical protein EUGRSUZ_K03030 [Eucalyptus grandis]
Length=278

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKC+    K+  + G E++K  EE   LL  L+ EL+ KKF GGETVGF D
Sbjct  95   ARFWAKFLDEKCMQTLWKSCTSIGAEREKAHEEARLLLSTLEGELKGKKFFGGETVGFVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  NFV +WVGV++EA+G +++T+ +FP LC+W E+F      IKE LPP+DK + FFK
Sbjct  155  IMANFVGYWVGVIQEAVGADVLTEGEFPLLCKWAEEF-QNRPVIKENLPPKDKFLAFFK  212



>ref|XP_009770038.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=228

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 93/122 (76%), Gaps = 2/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+++K +PA  K+ F KGEEQ+K KEE  E+LKILD E++ KKF  G+ +G AD
Sbjct  93   ARFWAKFLEDK-VPAVGKSFFLKGEEQEKGKEEAYEMLKILDNEVKDKKFFTGDKIGLAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NFV  W+GV EEA G+ LVT+EKFPN C W++++ I C++ K+ LPPRD+LV  FK+
Sbjct  152  IAANFVGLWLGVFEEASGLVLVTREKFPNFCAWRDEY-INCNQNKKYLPPRDELVAHFKA  210

Query  361  GF  366
             F
Sbjct  211  RF  212



>ref|XP_009606318.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=222

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 86/115 (75%), Gaps = 2/115 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF +EK   +  ++ F KGEEQ+K KE+VCE+LK+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFFEEKGT-SVGRSFFLKGEEQEKAKEQVCEMLKVLDNELKNKKFFVGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLV  345
            IA N  A W+GVLEEA GV LVT EKFPN C W++++ I C + KE LPPRD+L+
Sbjct  152  IAANAAALWLGVLEEASGVVLVTSEKFPNFCAWRDEY-IYCSQNKEYLPPRDELL  205



>ref|XP_011077664.1| PREDICTED: probable glutathione S-transferase [Sesamum indicum]
Length=253

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D++CLPA  KA ++ GEE++K KEE  ELLK LD E++ KK+ GG+ +G  D
Sbjct  120  ARFWAKFVDDECLPAMWKACWSSGEEREKAKEEAVELLKFLDSEIKGKKWFGGDNIGIVD  179

Query  181  IAGNFVAFWVGVLEEALGV--ELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
            IA NF+A+W G++ E +G+  E++T+EK PNLC+W E +   C  +KE +PP+DKL + F
Sbjct  180  IAANFIAYWFGIIAEVVGLVDEVITQEKHPNLCKWIEKY-NKCSFVKENVPPKDKLAEKF  238

Query  355  KSG  363
            K G
Sbjct  239  KDG  241



>gb|KHN47446.1| Putative glutathione S-transferase [Glycine soja]
Length=226

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFA-KGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+++ID+KCLPA +KA F    EE+DK  EE  E L+IL+ EL+   F GGET+   
Sbjct  98   ARFWSRYIDDKCLPAISKAAFTVDKEERDKGTEESLESLQILENELK-HNFFGGETIDIV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+  +EEA+G++L+T EKFP L +W ED+      +K+ LP RD+LV FFK
Sbjct  157  DIAAGFIAFWLPAIEEAVGLKLLTNEKFPKLYKWGEDY-TNHPIVKKNLPQRDRLVGFFK  215

Query  358  SGF  366
            + +
Sbjct  216  ARY  218



>ref|XP_006367664.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=226

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K + A   A   KGEE +K KEE+CE+LKILD EL+ K     +  G+AD
Sbjct  93   ARFWAKFLDDK-VAAVVNAFLRKGEEHEKAKEEICEMLKILDNELKDKMLFVADKFGYAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPR-DKLVDFFK  357
            +A N V  W+G  EEA GV L T EKFPN C W++ + I C ++KE LP R D+L+ F++
Sbjct  152  MAANLVGLWMGFFEEASGVVLATNEKFPNFCTWRDAY-INCSQVKEYLPSRFDELLAFYQ  210



>ref|XP_009802972.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=220

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 89/122 (73%), Gaps = 2/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF +EK   +  ++ F KGEEQ+K KEEV E+LK+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFFEEKG-ASVGRSFFLKGEEQEKAKEEVFEMLKVLDNELKDKKFFIGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA N  A W+GVLEEA GV L T+EKFPN C W++++ I C + KE LPPRD+L+  FK+
Sbjct  152  IAANAAALWLGVLEEASGVVLATREKFPNFCAWRDEY-ISCSQNKEYLPPRDELLAHFKA  210

Query  361  GF  366
             F
Sbjct  211  RF  212



>ref|XP_004302691.1| PREDICTED: glutathione S-transferase U8-like [Fragaria vesca 
subsp. vesca]
Length=223

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 89/123 (72%), Gaps = 3/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FIDEKC+PA  KA  +  EE++K  EE CELL++L+ EL+ KK+ GG+ +G  D
Sbjct  95   ARFWARFIDEKCIPALKKACASIAEEREKAVEEACELLQLLEDELKHKKYFGGDCIGLVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDE-IKECLPPRDKLVDFFK  357
            I  NF++ W+ V++E +GVEL+T +KFP LC W E F  +C   +K+CLPP++KL+  F 
Sbjct  155  IVANFISHWLKVVQEVVGVELLTIKKFPRLCEWSEHF--VCHHAVKDCLPPKEKLLAVFH  212

Query  358  SGF  366
            S +
Sbjct  213  SHY  215



>ref|XP_006346688.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=278

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K + A     F KG+EQ+K KEEV E+LK+LD EL+ KKF   +  GFAD
Sbjct  144  ARFWAKFLDDK-VTAVVNTFFRKGDEQEKGKEEVYEMLKVLDNELKDKKFFVCDKFGFAD  202

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPP-RDKLVDFFK  357
            I  N VA W+G+ EE  GV LVT +KFP  C W++++ I C ++KE LP  RD+L+ FF 
Sbjct  203  IVANMVALWLGIYEETSGVVLVTSQKFPKFCAWRDEY-INCSQVKEYLPSRRDELLTFFH  261

Query  358  S  360
            +
Sbjct  262  A  262



>ref|XP_010279542.1| PREDICTED: probable glutathione S-transferase isoform X3 [Nelumbo 
nucifera]
Length=227

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELET-KKFLGGETVGFA  177
             RFW KFIDEKC     +A +++  EQ+K  EE  E LKIL+ EL+  KKF GG+ +G  
Sbjct  94   TRFWVKFIDEKCNATLWRACWSEASEQEKAIEEARENLKILENELKKGKKFFGGDNIGSV  153

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  ++AFWVGVL+E +G+ L+ +EKFP L +W E+F I CD +KE LPPRDKL  +++
Sbjct  154  DIAAIYIAFWVGVLQEVVGISLMDEEKFPVLHKWIEEF-INCDVVKENLPPRDKLFAYYQ  212



>ref|XP_009606319.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=219

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+++K +P   K  F KGEEQ+K KEE  E+LKILD EL+ KKF  G+ +G AD
Sbjct  93   ARFWAKFLEDK-VPPVGKTFFLKGEEQEKGKEEAFEMLKILDNELKDKKFFTGDKIGLAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NFV  W+GV EEA G+ LVT+EKFPN C W++++ I C + KE LPPRD+L+  FK+
Sbjct  152  IAANFVGLWLGVFEEASGIVLVTREKFPNFCAWRDEY-INCSQNKEYLPPRDELLAHFKA  210

Query  361  GF  366
             F
Sbjct  211  RF  212



>ref|NP_001238721.1| glutathione S-transferase GST 13 [Glycine max]
 gb|AAG34803.1|AF243368_1 glutathione S-transferase GST 13 [Glycine max]
 gb|KHN47445.1| Putative glutathione S-transferase [Glycine soja]
Length=220

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW+K +D+K LPA   A ++    ++K  EE  E LKIL + L+ KKF GGE++G  D
Sbjct  98   ARFWSKTLDDKILPAIWNACWSDENGREKAVEEALEALKILQETLKDKKFFGGESIGLVD  157

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ +WV +L+E  G+EL+T EKFP L  W +DF I    IKE LPPRD+L  FFK+
Sbjct  158  IAANFIGYWVAILQEIAGLELLTIEKFPKLYNWSQDF-INHPVIKEGLPPRDELFAFFKA  216

Query  361  G  363
             
Sbjct  217  S  217



>ref|XP_010101874.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB90011.1| putative glutathione S-transferase [Morus notabilis]
Length=217

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 86/120 (72%), Gaps = 3/120 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FID+KC P   KA ++K +E++K  EE+ ELLK L+ EL    F GGETVG  D
Sbjct  94   ARFWARFIDDKCFPEIWKAYWSK-DEREKAVEELIELLKFLENEL-NDNFFGGETVGLVD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I G+ +A+W+ V++E  GVE++T+EKFP LCRW  +F +    +KE LP R+KL+ +F++
Sbjct  152  IVGSLIAYWLPVVQEVAGVEILTEEKFPKLCRWSHEF-VNHSVVKEVLPCREKLIAYFRA  210



>ref|XP_010039176.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
Length=213

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 14/120 (12%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEK              E++K  EE CELL  L+ EL+ KKF GGETVGF D
Sbjct  95   ARFWAKFIDEKP-------------EREKAHEEACELLSTLEGELKGKKFFGGETVGFVD  141

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  +F++ WVG ++EA+GV+++T++KFP L +W E+F   C  IKE LPPRDK++ FFK+
Sbjct  142  IVASFISHWVGPVQEAVGVDVLTEDKFPMLYKWAEEF-KKCPVIKENLPPRDKILAFFKA  200



>ref|XP_004246380.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=215

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (70%), Gaps = 4/122 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW KF++++ + A  K++F KGEEQ++ K+  CE+LKIL+ EL+ KKF  G+  G AD
Sbjct  93   ARFWVKFLEDQ-IAAVGKSIFLKGEEQEREKKAACEMLKILENELKDKKFFVGDKFGLAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA N +A W+GV EEA GV LVT E +PNL  W+ ++   C++ KE LP RD+L+  F+ 
Sbjct  152  IAANVLAIWLGVFEEASGVALVTSENYPNLYGWRNEY---CNQNKEYLPSRDELLIHFQP  208

Query  361  GF  366
             F
Sbjct  209  RF  210



>ref|XP_009629346.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=223

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K + A     F KGEEQ+K KEEV E+LK+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFLDDK-VAAVVNTFFRKGEEQEKGKEEVYEMLKVLDNELKDKKFFAGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA N V FW+GV EE  GV LV  EKFPN  +W++++ I C ++ E LPPRD+L+ FF++
Sbjct  152  IAANLVGFWLGVFEEGYGVVLVKSEKFPNFSKWRDEY-INCSQVNESLPPRDELLAFFRA  210

Query  361  GF  366
             F
Sbjct  211  RF  212



>ref|NP_187538.1| glutathione S-transferase TAU 8 [Arabidopsis thaliana]
 sp|Q9SR36.1|GSTU8_ARATH RecName: Full=Glutathione S-transferase U8; Short=AtGSTU8; AltName: 
Full=GST class-tau member 8 [Arabidopsis thaliana]
 gb|AAF14025.1|AC011436_9 putative glutathione transferase [Arabidopsis thaliana]
 gb|AAM63323.1| putative glutathione transferase [Arabidopsis thaliana]
 gb|ABD60727.1| At3g09270 [Arabidopsis thaliana]
 gb|AEE74745.1| glutathione S-transferase TAU 8 [Arabidopsis thaliana]
Length=224

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++DEK + A  KA +    E++K  +E  E LK L+KEL  K F GGET+GF D
Sbjct  98   ARFWAKYVDEKVMLAVKKACWGPESEREKEVKEAYEGLKCLEKELGDKLFFGGETIGFVD  157

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA +F+ +W+G+ +EA GV ++T E+FP L RW EDF +  + IKE LPP++KLV   K+
Sbjct  158  IAADFIGYWLGIFQEASGVTIMTAEEFPKLQRWSEDF-VGNNFIKEVLPPKEKLVAVLKA  216

Query  361  GF  366
             F
Sbjct  217  MF  218



>ref|NP_001234082.1| uncharacterized protein LOC543813 [Solanum lycopersicum]
 gb|AAG16756.1| putative glutathione S-transferase T1 [Solanum lycopersicum]
Length=224

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 86/122 (70%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARF AK IDEK + A  K  + KGEE++K  +E  E+LK LD EL+ KKF GG+++GF D
Sbjct  95   ARFLAKLIDEKLMGAMYKVCYGKGEEREKGCDETFEVLKYLDNELQNKKFFGGDSIGFVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  +++A W G ++EA+G+EL+T++KFP L +W ++F + C  +KE LP R+ LV  +K+
Sbjct  155  IVASYIALWFGAIQEAIGMELLTEQKFPKLSKWIDEF-LCCRIVKENLPNREVLVLLYKA  213

Query  361  GF  366
             F
Sbjct  214  QF  215



>ref|XP_010279540.1| PREDICTED: probable glutathione S-transferase isoform X1 [Nelumbo 
nucifera]
Length=227

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 84/121 (69%), Gaps = 2/121 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELET-KKFLGGETVGFA  177
             RFW KFIDEKC+ A  KA + +  +Q+K  EE  E LKIL+ EL+  +KF  G+ +GF 
Sbjct  94   TRFWVKFIDEKCIEAIWKACWIEERKQEKAIEEAKETLKILENELKKGRKFFAGDNIGFV  153

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFWVGVL+E +G+ L+ +EKFP L +W E+F I CD + E LPPRDKL  +++
Sbjct  154  DIAAIFIAFWVGVLQEVVGISLMDEEKFPVLHKWIEEF-INCDVVGENLPPRDKLFAYYQ  212

Query  358  S  360
             
Sbjct  213  G  213



>ref|XP_006572808.1| PREDICTED: uncharacterized protein LOC100306119 isoform X1 [Glycine 
max]
 gb|KHN06031.1| Putative glutathione S-transferase [Glycine soja]
Length=226

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 86/123 (70%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALF-AKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW++FID+KC+PA +KA F A  EE+DK  EE  E L+IL+  L+ K F G  T+G  
Sbjct  98   ARFWSRFIDDKCMPAISKAAFTADKEERDKGTEESLESLQILENVLKHKFFGGETTIGIV  157

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+  +EEA+G++L+T EKFP L +W ED+      +K+ LP RD++V FFK
Sbjct  158  DIAAGFIAFWLPAIEEAVGLKLLTNEKFPKLYKWGEDY-TNHPVVKKNLPQRDRVVGFFK  216

Query  358  SGF  366
            + +
Sbjct  217  ARY  219



>ref|XP_010279541.1| PREDICTED: probable glutathione S-transferase isoform X2 [Nelumbo 
nucifera]
Length=227

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 84/121 (69%), Gaps = 2/121 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELET-KKFLGGETVGFA  177
             RFW KFIDEKC+ A  KA + +  +Q+K  EE  E LKIL+ EL+  +KF  G+ +GF 
Sbjct  94   TRFWVKFIDEKCIEAIWKACWIEERKQEKAIEEAKETLKILENELKKGRKFFAGDNIGFV  153

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFWVGVL+E +G+ L+ +EKFP L +W E+F I CD + E LPPRDKL  +++
Sbjct  154  DIAAIFIAFWVGVLQEVVGISLMDEEKFPVLHKWIEEF-INCDVVGENLPPRDKLFAYYQ  212

Query  358  S  360
             
Sbjct  213  G  213



>ref|XP_009629347.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=214

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 87/120 (73%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K   A       KGEEQ+K KEEV E+LK+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFLDDKVT-AVVNTFLRKGEEQEKGKEEVYEMLKVLDNELKDKKFFAGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA N V FW+GV EE  GV LVT EKFPN  +W++++ I C ++KE LPPRD+L+ F+++
Sbjct  152  IAANLVGFWLGVFEEVSGVVLVTSEKFPNFSKWRDEY-INCSQVKESLPPRDELLAFYRA  210



>ref|XP_006367671.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=217

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 84/122 (69%), Gaps = 7/122 (6%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW KF ++K     T + F K E   K KEEVCE+LKILD EL+ KKF  G+  G AD
Sbjct  93   ARFWVKFFEDKGSAVGT-SFFHKSE---KAKEEVCEMLKILDNELKDKKFFVGDKFGLAD  148

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+A W+G+LEEA G+ LVTKEK+PN   W++++I   +  KE LP RD+L+ FFK+
Sbjct  149  IAANFLALWMGILEEATGIILVTKEKYPNFYAWRDEYI---NGNKEYLPSRDELLAFFKA  205

Query  361  GF  366
             F
Sbjct  206  RF  207



>ref|XP_004246383.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=219

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF DEK   +  ++ F KGEEQ+K KEE+ E+LK++D EL+ KK+   +  GF D
Sbjct  93   ARFWAKFFDEKG-SSVGRSFFLKGEEQEKAKEELHEMLKVVDNELKDKKYFVVDKFGFVD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  N VA W+GVLEEA GV LVT EK+PN   W++++ I C E K+ LP R++L+  FK+
Sbjct  152  IVANVVALWLGVLEEASGVVLVTNEKYPNFYAWRDEY-INCSENKKYLPSRNELLAKFKA  210



>ref|XP_009123411.1| PREDICTED: glutathione S-transferase U8 [Brassica rapa]
Length=226

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 85/122 (70%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++D+K +    KA +    E++K  EE  + LK L++EL  K+F GGET+GF D
Sbjct  98   ARFWAKYVDDKVMLTLWKACWGPESEREKMVEEAYDGLKYLEEELGDKQFFGGETIGFVD  157

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA +F+A+W G+ +EA GV ++T E+FP L RW ++F +  + IKE LPP++KL+  FK+
Sbjct  158  IAADFIAYWFGIAQEASGVMIMTAERFPKLQRWSQNF-VRNNIIKEVLPPKEKLMALFKA  216

Query  361  GF  366
             F
Sbjct  217  QF  218



>gb|KEH28979.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=220

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 84/121 (69%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW+K +D+K LPA   A ++  + ++K  EE  E LKIL+ E++ KKF GGET+G  D
Sbjct  98   ARFWSKTLDDKILPAIWNACWSDEKGREKAVEEALEALKILEDEIKDKKFFGGETLGLVD  157

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ +WV +L+E  G+EL+T EKFP + +W ++F I    IKE LPPRD+L  FFK+
Sbjct  158  IAANFIGYWVYILQEIAGLELLTLEKFPKVYKWSQEF-INHPVIKEGLPPRDELFAFFKA  216

Query  361  G  363
             
Sbjct  217  S  217



>ref|XP_004507184.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=218

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW+K +D+K LPA   A +   + ++K  EE  E LKIL+  L  KKF GGET+G  D
Sbjct  98   ARFWSKTLDDKILPAIWNACWIDEKGREKAVEEALEALKILEGALNDKKFFGGETIGLVD  157

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ +WV VL+E  G+EL+T EKFP L +W ++F I    IKE LPPRD+L  FFK+
Sbjct  158  IAANFIGYWVSVLQEIKGLELLTIEKFPKLFKWSQEF-INHPVIKEGLPPRDELFAFFKA  216



>gb|AFS51729.1| tau class glutathione S-transferase [Glycine soja]
Length=219

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW+K +D+K LPA   A ++    ++K  EE  E LKIL + L+ KKF GGE++G  D
Sbjct  97   ARFWSKTLDDKILPAIWNACWSDENGREKAVEEALEALKILQEALKDKKFFGGESIGLVD  156

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ +WV +L+E  G+EL+T EKFP L +W ++F I    IKE LPPRD+L  FF++
Sbjct  157  IAANFIGYWVAILQEIAGLELLTIEKFPKLYKWSQEF-INHPVIKEGLPPRDELFAFFQA  215

Query  361  G  363
             
Sbjct  216  S  216



>ref|NP_001235279.1| uncharacterized protein LOC100527381 [Glycine max]
 gb|ACU16470.1| unknown [Glycine max]
 gb|KHN06030.1| Putative glutathione S-transferase [Glycine soja]
Length=219

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW+K +D+K LPA   A ++    ++K  EE  E LKIL + L+ KKF GGE++G  D
Sbjct  97   ARFWSKTLDDKILPAIWNACWSDENGREKAVEEALEALKILQEALKDKKFFGGESIGLVD  156

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ +WV +L+E  G+EL+T EKFP L +W ++F I    IKE LPPRD+L  FF++
Sbjct  157  IAANFIGYWVAILQEIAGLELLTIEKFPKLYKWSQEF-INHPVIKEGLPPRDELFAFFQA  215

Query  361  G  363
             
Sbjct  216  S  216



>gb|ADD71974.1| glutathione S-transferase [Glycine soja]
Length=219

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW+K +D+K LPA   A ++    ++K  EE  E LKIL + L+ KKF GGE++G  D
Sbjct  97   ARFWSKTLDDKILPAIWNACWSDENGREKAVEEALEALKILQEALKDKKFFGGESIGLVD  156

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ +WV +L+E  G+EL+T EKFP L +W ++F I    IKE LPPRD+L  FF++
Sbjct  157  IAANFIGYWVAILQEIAGLELLTIEKFPKLYKWSQEF-INHPVIKEGLPPRDELFAFFQA  215

Query  361  G  363
             
Sbjct  216  S  216



>ref|XP_007134772.1| hypothetical protein PHAVU_010G074600g [Phaseolus vulgaris]
 gb|ESW06766.1| hypothetical protein PHAVU_010G074600g [Phaseolus vulgaris]
Length=224

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 87/123 (71%), Gaps = 3/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALF-AKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW++FID+KCLPA  KA F A  EE+ K  EE  + L+IL+ EL+ +KF GGE++G  
Sbjct  97   ARFWSRFIDDKCLPAILKAAFTANEEERQKGTEESLDALQILEDELK-QKFFGGESIGLV  155

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+  +EEA+G++L+  +KFP L +W E++      +KE LP R+++V FFK
Sbjct  156  DIAAGFIAFWLPAIEEAVGLKLLISQKFPKLSKWSEEY-TNHPVVKESLPQRERVVGFFK  214

Query  358  SGF  366
            + +
Sbjct  215  ARY  217



>ref|XP_008240102.1| PREDICTED: glutathione S-transferase U8-like [Prunus mume]
Length=220

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 4/122 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FIDEKCLPA   A +   EE +K  EE CELLK+L+ EL+  KF GGE VG  D
Sbjct  95   ARFWARFIDEKCLPAIWNACWG-SEEHEKAVEEACELLKLLEHELKGNKFFGGEKVGLVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I GNF+A+W+  ++E +GVE++TKEK P L  W ++F+ +   ++E LPPRDKLV FF+ 
Sbjct  154  IVGNFIAYWLRAIQEVVGVEILTKEKLPKLYDWSDEFVNV---LQESLPPRDKLVAFFRG  210

Query  361  GF  366
             F
Sbjct  211  RF  212



>ref|XP_002884725.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60984.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=224

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 83/122 (68%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++D+K + A  KA +    E++K  +E  E LK L+K L  K F GGET+GF D
Sbjct  98   ARFWAKYVDDKVMLAVKKACWGPESEREKEVKEAYECLKCLEKVLGDKLFFGGETIGFVD  157

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA +F+ +W+G+ +EA GV ++T E+FP L RW EDF +  D IKE LPP++KLV   K+
Sbjct  158  IAADFIGYWLGIFQEASGVTIMTAEEFPKLQRWSEDF-VGNDFIKEVLPPKEKLVAVLKA  216

Query  361  GF  366
             F
Sbjct  217  MF  218



>ref|XP_004302690.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=218

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 85/123 (69%), Gaps = 3/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+F++EKC+PA  K      E+++K  EE  E LK+L+ EL+ KKF GGE +GF D
Sbjct  94   ARFWARFVEEKCMPAMFKCSVGT-EDREKAVEEAYETLKLLENELKGKKFFGGEEIGFVD  152

Query  181  IAGNFV-AFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  +F+  +W+   +E +G+EL+TKEK P LC W ++F+     IKE LPPRDKL+ FF+
Sbjct  153  IVADFIGGYWLRDFQEVVGMELLTKEKLPKLCEWSDEFVNHA-VIKEVLPPRDKLIAFFR  211

Query  358  SGF  366
            + F
Sbjct  212  TRF  214



>ref|XP_010039177.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=230

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKC+    K   +   E++K  EE  +LL  L+ EL+ KKF  GETV F D
Sbjct  99   ARFWAKFLDEKCMQTLWKCCTSIRAEREKAHEEAHQLLSTLEGELKGKKFFRGETVEFVD  158

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  NFV +WVGV++EA+G +++T+ +FP LC+W E+F   C  I+E LPP+DK + FFK
Sbjct  159  IMTNFVGYWVGVIQEAVGADVLTEGEFPLLCKWAEEF-QNCSVIEENLPPKDKFLAFFK  216



>ref|XP_009770673.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
 sp|Q03664.1|GSTX3_TOBAC RecName: Full=Probable glutathione S-transferase; AltName: Full=Auxin-induced 
protein PCNT103 [Nicotiana tabacum]
 emb|CAA39704.1| auxin-induced protein [Nicotiana tabacum]
Length=223

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW+KF+ +K + A     F KGEEQ+K KEEV E+LK+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWSKFLGDK-VAAVVNTFFRKGEEQEKGKEEVYEMLKVLDNELKDKKFFVGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA N V FW+GV EE  GV LVT EKFPN  RW++++ I C ++KE LP RD+L+ FF++
Sbjct  152  IAANLVGFWLGVFEEGYGVVLVTSEKFPNFSRWRDEY-INCSQVKESLPSRDELLAFFRA  210

Query  361  GF  366
             F
Sbjct  211  RF  212



>gb|EYU26622.1| hypothetical protein MIMGU_mgv1a013365mg [Erythranthe guttata]
Length=222

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+KC+P   KA +++GEE++K  EE  + L+ L+ E++ KKF GG+ VG  D
Sbjct  95   ARFWAKFVDDKCMPQVWKACWSEGEEREKAMEEASKALEFLENEIKGKKFFGGDNVGLVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
             + NF+A+W G+L E  G++ +T+EK+PNL +W ++F   C  +KE LP + K+V  F  
Sbjct  155  FSANFLAYWCGILAELSGLQFLTEEKYPNLTKWADEF-CGCSFVKENLPDKGKMVHVFNG  213



>ref|XP_010470684.1| PREDICTED: glutathione S-transferase U8-like [Camelina sativa]
 ref|XP_010470778.1| PREDICTED: glutathione S-transferase U8-like [Camelina sativa]
 ref|XP_010470969.1| PREDICTED: glutathione S-transferase U8-like [Camelina sativa]
Length=230

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK +DEK + A  KA +    E++K  +E  E LK L+KEL  + F GGET+GF D
Sbjct  98   ARFWAKHVDEKVMVAMWKACWGPKSEREKETKEAYEGLKYLEKELGDRHFFGGETIGFVD  157

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA +F+ +W+G+++EA GV ++T E+FPNL R  +DF I  D IKE LPP+ K+    K+
Sbjct  158  IAADFIGYWLGIVQEASGVTIMTAEEFPNLQRRSKDF-IGNDFIKEVLPPKQKIAALLKA  216

Query  361  GF  366
             F
Sbjct  217  QF  218



>ref|XP_006367663.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=219

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 89/120 (74%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+++K + A+      KGEEQ+K KEEV E+LKILD EL+ KKF  G+  G+AD
Sbjct  93   ARFWAKFLNDK-VGAAVNTFLHKGEEQEKGKEEVFEMLKILDNELKDKKFFVGDKFGYAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NFV +W+GV +EA GVELVT E FPN C W++++ + C ++KE LPPR+ L+ F ++
Sbjct  152  IAANFVGYWLGVFQEASGVELVTSENFPNFCAWRDEY-VNCSQVKEYLPPRNDLLAFIQA  210



>sp|Q03663.1|GSTX2_TOBAC RecName: Full=Probable glutathione S-transferase; AltName: Full=Auxin-induced 
protein PGNT35/PCNT111 [Nicotiana tabacum]
 emb|CAA39706.1| auxin-induced protein [Nicotiana tabacum]
 emb|CAA39710.1| auxin-induced protein [Nicotiana tabacum]
Length=223

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 87/122 (71%), Gaps = 2/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K + A     F KGEEQ+K KEEV E+LK+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFLDDK-VAAVVNTFFRKGEEQEKGKEEVYEMLKVLDNELKDKKFFAGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA N V FW+GV EE  G  LV  EKFPN  +W++++ I C ++ E LPPRD+L+ FF++
Sbjct  152  IAANLVGFWLGVFEEGYGDVLVKSEKFPNFSKWRDEY-INCSQVNESLPPRDELLAFFRA  210

Query  361  GF  366
             F
Sbjct  211  RF  212



>ref|XP_004246386.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=225

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K + A       KGEEQ+K K+EVCE+LK+LD EL+ KK   G+ +GFAD
Sbjct  93   ARFWAKFLDDK-VGAVVNTFLRKGEEQEKGKKEVCEMLKVLDNELKDKKLFVGDKLGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPR-DKLVDFFK  357
            +  N V  W+ V EEA  V L T E FPN C W+  + I C+++KE LP R D+L+ F++
Sbjct  152  MVANLVGLWMSVFEEASEVVLATNENFPNFCAWRNTY-ISCNQVKEYLPLRIDELLAFYQ  210



>ref|XP_006407694.1| hypothetical protein EUTSA_v10021472mg [Eutrema salsugineum]
 gb|ESQ49147.1| hypothetical protein EUTSA_v10021472mg [Eutrema salsugineum]
Length=224

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++DEK + A  KA +    E++K  EE  E LK L+ EL  K+F GGET+GF D
Sbjct  98   ARFWAKYVDEKVMLALWKACWGPESEREKLVEEAYEGLKCLETELGEKRFFGGETIGFVD  157

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA +F+ +W+G+++EA GV ++T EKF  L RW EDF +  + IKE LPP+ KL    K+
Sbjct  158  IAADFIGYWLGIVQEASGVTIMTAEKFLKLQRWSEDF-VGNNVIKEVLPPKQKLAALLKA  216

Query  361  GF  366
             F
Sbjct  217  QF  218



>emb|CDY22184.1| BnaC01g39170D [Brassica napus]
Length=226

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 85/122 (70%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++D+K +    KA +    E++K  EE  + LK L+++L  K+F GGET+GF D
Sbjct  98   ARFWAKYVDDKVMLTLWKACWGPESEREKMVEEAYDGLKYLEEDLGDKQFFGGETIGFVD  157

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA +F+A+W G+ +EA GV ++T E+FP L RW ++F +  + IKE LPP++KL+  FK+
Sbjct  158  IAADFIAYWFGIAQEASGVMIMTAERFPKLQRWSQNF-VRNNIIKEVLPPKEKLMALFKA  216

Query  361  GF  366
             F
Sbjct  217  QF  218



>ref|XP_008240089.1| PREDICTED: glutathione S-transferase U8-like [Prunus mume]
Length=224

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 86/122 (70%), Gaps = 4/122 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FIDEKCLPA   A +   EE +K  EE CELLK+L+ EL+  KF GGE VG  D
Sbjct  95   ARFWARFIDEKCLPAMWNACWG-SEEHEKAVEEACELLKLLEHELKGNKFFGGEKVGLVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I GNF+A+W+  ++E +GVE++TKEK P L  W ++F+ +   ++E LPPRDKLV F + 
Sbjct  154  IVGNFIAYWLRAIQEVVGVEILTKEKLPKLYDWSDEFVNV---LQESLPPRDKLVAFLRG  210

Query  361  GF  366
             F
Sbjct  211  HF  212



>gb|AFK49084.1| unknown [Medicago truncatula]
Length=220

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 83/121 (69%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW K +D+K LPA   A ++  + ++K  EE  E LKIL+ E++ KKF GGET+G  D
Sbjct  98   ARFWFKTLDDKILPAIWNACWSDEKGREKAVEEALEALKILEDEIKDKKFFGGETLGLVD  157

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ +WV +L+E  G+EL+T EKFP + +W ++F I    IKE LPPRD+L  FFK+
Sbjct  158  IAANFIGYWVYILQEIAGLELLTLEKFPKVYKWSQEF-INHPVIKEGLPPRDELFAFFKA  216

Query  361  G  363
             
Sbjct  217  S  217



>gb|KDO57979.1| hypothetical protein CISIN_1g027827mg [Citrus sinensis]
Length=218

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEV-CELLKILDKELETKKFLGGETVGFA  177
            ARFWA+FIDEKC  A   A   + +E+++      CELLK L+ EL+ ++F GG+ +G  
Sbjct  93   ARFWAQFIDEKCRVALRNAYGCQEKEREEEATREACELLKTLENELKNRRFFGGDKIGLV  152

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DI  NF+ FW+G ++EAL V+L T+++FP L RW E+F + C  IKE LPPRDKL+ F +
Sbjct  153  DIVANFIGFWLGAIQEALEVKLFTEDRFPKLYRWSEEF-VNCSIIKESLPPRDKLISFMR  211

Query  358  SGF  366
              +
Sbjct  212  RRY  214



>ref|XP_006429234.1| hypothetical protein CICLE_v10012717mg [Citrus clementina]
 ref|XP_006480913.1| PREDICTED: glutathione S-transferase U8-like [Citrus sinensis]
 gb|ESR42474.1| hypothetical protein CICLE_v10012717mg [Citrus clementina]
Length=218

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEV-CELLKILDKELETKKFLGGETVGFA  177
            ARFWA+FIDEKC  A   A   + +E+++      CELLK L+ EL+ ++F GG+ +G  
Sbjct  93   ARFWAQFIDEKCRVALRNAYGCQEKEREEEATREACELLKTLENELKDRRFFGGDRIGLV  152

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DI  NF+ FW+G ++EAL V+L T+E+FP L RW E+F + C  I+E LPPRDKL+ F +
Sbjct  153  DIVANFIGFWLGAIQEALEVKLFTEERFPKLYRWSEEF-VNCSIIRESLPPRDKLISFMR  211

Query  358  SGF  366
              +
Sbjct  212  RRY  214



>ref|XP_009626800.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=224

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 86/118 (73%), Gaps = 2/118 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K   A       +GEEQ+K KEEV E+LK+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFLDDKV-AAVVNTFLRRGEEQEKGKEEVYEMLKVLDNELKDKKFFVGDEFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
            IA NFVAFW+GV EEA GV LVT EKFPN  +W++++ I C ++K+ LP R KL+ FF
Sbjct  152  IAANFVAFWLGVFEEASGVVLVTSEKFPNFSKWRDEY-INCSQVKDSLPLRYKLLAFF  208



>emb|CAN73675.1| hypothetical protein VITISV_001110 [Vitis vinifera]
Length=221

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 89/124 (72%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++D+K  PA+TK + +KGEEQ    EE+ E LK L+ EL+ KKF GGE++GF D
Sbjct  94   ARFWAKYMDDKLWPAATKVVVSKGEEQKAVIEEIQEQLKTLESELKEKKFFGGESLGFVD  153

Query  181  IAGNFVAFWVGVLEEALG-VELVTKEKFPNLCRWKEDFIIICDEI-KECLPPRDKLVDFF  354
            IA N + F + V +EALG +E++T+EKFP L  W +   ++ D + KEC+PPR++ + FF
Sbjct  154  IAANIIVFLL-VAQEALGLMEILTEEKFPVLHEWYZR--LVDDAVFKECVPPRERHLGFF  210

Query  355  KSGF  366
            K+ F
Sbjct  211  KARF  214



>gb|KHG09979.1| Glutathione S-transferase U8 -like protein [Gossypium arboreum]
Length=225

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW KFIDEKC P    A ++   E++K   E CE +K L+  L  KKF GGET+G  D
Sbjct  95   ARFWIKFIDEKCFPTLWLAAWSSENEREKVTNEACEYMKTLESALNGKKFFGGETIGMVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  + V +++ V +E +G+ L++ +KFP L +W EDF   C  +KE LPPRDKL+ F K
Sbjct  155  IVASSVGYFIRVTQEIMGLNLLSADKFPQLFQWSEDF-ANCSIVKESLPPRDKLLPFVK  212



>ref|XP_004246387.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=222

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 89/120 (74%), Gaps = 3/120 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K + A       KGEE++K KEE CE+LK+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFLDDK-VGAVVSTFIRKGEEREKGKEEACEMLKVLDNELKDKKFFVGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPR-DKLVDFFK  357
            IA N V +W+G+ +EA GVELVT EK+PN C W++++ + C ++KE LPPR D+L+ FF+
Sbjct  152  IAANLVGYWLGIFQEASGVELVTSEKYPNFCAWRDEY-MNCSQVKEYLPPRNDELLAFFQ  210



>gb|KCW61132.1| hypothetical protein EUGRSUZ_H03905, partial [Eucalyptus grandis]
Length=233

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 86/127 (68%), Gaps = 9/127 (7%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKEL--ETKKFLGGETVGF  174
            ARFWAKF+D+ C+PA  ++   +G E++   EE   LL +L+ EL  + K+F GG+T+GF
Sbjct  96   ARFWAKFMDDNCVPALWRSCRREGIERENAFEEAYALLNVLEAELRDKQKRFFGGDTIGF  155

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRW---KEDFIIICDEIKECLPPRDKLV  345
             DI GNF+ +W+GV++E  GV L+T EKFP LC+W    ++F I     KE LPPR++L 
Sbjct  156  VDITGNFIGYWIGVIQEVAGVRLLTPEKFPLLCKWCCEFQNFPI----FKENLPPREQLF  211

Query  346  DFFKSGF  366
             FFK+ F
Sbjct  212  AFFKARF  218



>ref|XP_002281843.2| PREDICTED: glutathione S-transferase U7 [Vitis vinifera]
Length=230

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 86/123 (70%), Gaps = 4/123 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++D+K LPA+ K   +KGEEQ    EE+ + LK L+ EL+ KKF GGE++GF D
Sbjct  104  ARFWAKYMDDKLLPAAIKVAMSKGEEQKGVIEEIQKQLKTLESELKEKKFFGGESLGFVD  163

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEI-KECLPPRDKLVDFFK  357
            IA N +  W+ V +EALG+E++T+EKFP L  W +   ++ D + KEC+PPR++ + F K
Sbjct  164  IAANTIV-WLVVAQEALGMEILTEEKFPVLHGWYQR--LVDDAVFKECMPPREQHLSFVK  220

Query  358  SGF  366
              F
Sbjct  221  VRF  223



>gb|ABW69659.2| glutathione S-transferase [Gossypium hirsutum]
Length=225

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW KFIDEKC P    A ++   E++K   E CE +K L+  L  KKF GGET+G  D
Sbjct  95   ARFWIKFIDEKCFPTLWLAAWSPENEREKVTNEACEYMKTLESALNGKKFFGGETIGMVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I  + V +++ V +E +G+ L++ +KFP L +W EDF   C  +KE LPPRDKL+ F K
Sbjct  155  IVASSVGYFIRVTQEIMGLNLLSADKFPQLFQWSEDF-ANCSIVKESLPPRDKLLPFVK  212



>ref|XP_010024690.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
Length=236

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 86/127 (68%), Gaps = 9/127 (7%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKEL--ETKKFLGGETVGF  174
            ARFWAKF+D+ C+PA  ++   +G E++   EE   LL +L+ EL  + K+F GG+T+GF
Sbjct  99   ARFWAKFMDDNCVPALWRSCRREGIERENAFEEAYALLNVLEAELRDKQKRFFGGDTIGF  158

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRW---KEDFIIICDEIKECLPPRDKLV  345
             DI GNF+ +W+GV++E  GV L+T EKFP LC+W    ++F I     KE LPPR++L 
Sbjct  159  VDITGNFIGYWIGVIQEVAGVRLLTPEKFPLLCKWCCEFQNFPI----FKENLPPREQLF  214

Query  346  DFFKSGF  366
             FFK+ F
Sbjct  215  AFFKARF  221



>ref|NP_001238659.1| glutathione S-transferase GST 7 [Glycine max]
 gb|AAG34797.1|AF243362_1 glutathione S-transferase GST 7 [Glycine max]
Length=225

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 84/121 (69%), Gaps = 2/121 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A+ K ++   E E++K  EE  E L+ L+ EL+ KKF GGE +G  
Sbjct  97   ARFWSKFIDDKVVGAAWKYIYTVDEKEREKNVEESYEALQFLENELKDKKFFGGEEIGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+ +++E LG++L T EKFP L +W ++F I    +K+ LPPRD+L  F+K
Sbjct  157  DIAAVFIAFWIPIIQEVLGLKLFTSEKFPKLYKWSQEF-INHPVVKQVLPPRDQLFAFYK  215

Query  358  S  360
            +
Sbjct  216  A  216



>gb|KHN05113.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 84/121 (69%), Gaps = 2/121 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A+ K ++   E E++K  EE  E L+ L+ EL+ KKF GGE +G  
Sbjct  97   ARFWSKFIDDKVVGAAWKYIYTVDEKEREKNVEESYEALQFLENELKDKKFFGGEEIGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+ +++E LG++L T EKFP L +W ++F I    +K+ LPPRD+L  F+K
Sbjct  157  DIAAVFIAFWIPIIQEVLGLKLFTSEKFPKLYKWSQEF-INHPVVKQVLPPRDQLFAFYK  215

Query  358  S  360
            +
Sbjct  216  A  216



>emb|CAB61885.1| Glutation-S-transferase [Solanum lycopersicum]
Length=111

 Score =   112 bits (280),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +1

Query  52   KALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFADIAGNFVAFWVGVLEEAL  231
            KA+F  GEE +K KEE+ +L+KIL+ EL+ K F  G+  GFAD+AGN +A+W+G++EEA 
Sbjct  3    KAIFGSGEESNKAKEELGDLIKILENELKDKNFFVGDKFGFADMAGNLMAYWMGIVEEAS  62

Query  232  GVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKSGF  366
            G   VT EKFP  C W+ ++ + C  IKE LPPRD+++  FK+ F
Sbjct  63   GNIFVTSEKFPIFCNWRNEY-VNCSTIKEYLPPRDEILAHFKARF  106



>ref|XP_010101872.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB90009.1| putative glutathione S-transferase [Morus notabilis]
Length=217

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARF A+FID+KC PA  KA ++K +E++K  EE+ ELLK L+ EL    F GGETVG  D
Sbjct  94   ARFGARFIDDKCFPAIWKAYWSK-DEREKAVEELIELLKFLENEL-NDNFFGGETVGLVD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I G+ +A W+  L+E  GVE++T+EKFP LCRW  +F +    +KE LP R+KL+  F++
Sbjct  152  IVGSLIAHWLPALQEVAGVEILTEEKFPKLCRWTHEF-VNHSVVKEVLPSREKLIALFRA  210



>ref|XP_004147912.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
Length=224

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 80/119 (67%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKAL-FAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWA +ID+K L A+ KA   +K EE++K  EE  E LK L+KEL+ KKF GG  +G  
Sbjct  98   ARFWANYIDDKVLAATLKAAKSSKREEREKGLEETEETLKPLEKELQNKKFFGGNKIGIV  157

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
            DI G  +A+W+  +EEA G EL+T +KFP L +W E+ I+    +K+ LPP+ KLV +F
Sbjct  158  DIVGTVIAYWIPAIEEAFGFELLTTKKFPKLTKWSEE-IVNNSVVKQVLPPKSKLVAYF  215



>gb|AAA87183.1| auxin-induced protein [Vigna radiata]
Length=230

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 84/123 (68%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + AS K++F   E E++K   E  E L+ L+ E++ KKF GGE +G  
Sbjct  102  ARFWSKFIDDKIVGASWKSVFTVDEKEREKNIAETYESLQFLENEIKEKKFFGGEELGLV  161

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  +VAFW+ +++E  G+EL+T EKFPNL RW ++F +    +KE LPPRD +  FFK
Sbjct  162  DIAAVYVAFWIPLIQEIAGLELLTSEKFPNLYRWSQEF-LNHPIVKESLPPRDPVFAFFK  220

Query  358  SGF  366
              +
Sbjct  221  GRY  223



>ref|XP_006366496.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=224

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 83/122 (68%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARF AK IDEK + A  K  + KGEE++K  +E  E+LK  D EL+ KKF GG+ +GF D
Sbjct  95   ARFLAKLIDEKLMGAMYKVCYGKGEEKEKGCDETLEVLKYFDNELQNKKFFGGDNLGFID  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  +++A W G ++EA+G+EL+T++KFP L +W ++F +    +KE LP R+ LV  +K+
Sbjct  155  IVASYIALWFGAIQEAIGMELLTEQKFPKLSKWIDEF-LSSRIVKENLPTREVLVPLYKA  213

Query  361  GF  366
             F
Sbjct  214  QF  215



>gb|AFK43265.1| unknown [Medicago truncatula]
Length=220

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 83/121 (69%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW+K +D+K L A   A ++  + ++K  EE  E LKIL+ E++ KKF GGET+G  D
Sbjct  98   ARFWSKTLDDKILSAIWNACWSDEKGREKAVEEALEALKILEDEIKDKKFFGGETLGLVD  157

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ +WV +L+E  G+EL+T EKFP + +W ++F I    IKE LPPRD+L  FFK+
Sbjct  158  IAANFIGYWVYILQEIAGLELLTLEKFPKVYKWSQEF-INHPVIKEGLPPRDELFAFFKA  216

Query  361  G  363
             
Sbjct  217  S  217



>gb|AFK45620.1| unknown [Lotus japonicus]
Length=219

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW+K +D+K LP    A ++  + ++K  EE  E LK+L  +L+  +F GGET+G  D
Sbjct  97   ARFWSKTLDDKILPPIWNACWSDEKGREKAVEEALEALKLLQDQLKDNRFFGGETIGLVD  156

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ +WV +L+E  G+EL+T EKFP L +W ++F +    IKE LPPRD+L  FFK+
Sbjct  157  IAANFIGYWVSILQEIAGLELLTVEKFPKLFKWSQEF-VNHPVIKEGLPPRDELFAFFKA  215

Query  361  G  363
             
Sbjct  216  S  216



>ref|XP_006480912.1| PREDICTED: glutathione S-transferase U8-like [Citrus sinensis]
Length=220

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEKC+ A  KA +++ +E+++   E CE L+ L+  L+ K+F GG+ +G  D
Sbjct  94   ARFWAKFIDEKCIFALWKACWSEEKEREEAAREACEHLQTLEDVLKDKRFFGGDMIGLVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  NF+ FW+G++EEA GV+L+T+EK+P L +W E+F + C  IKE LPPRDKL+ + ++
Sbjct  154  IVANFMGFWLGIIEEATGVKLLTEEKYPKLYKWSEEF-VNCSAIKENLPPRDKLLAYMRA  212

Query  361  GF  366
             +
Sbjct  213  RY  214



>emb|CDP06552.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA F+D+KC PA  K +++  E+ ++ K E  E LK+L+ EL  K+F GG+++G  D
Sbjct  93   ARFWANFVDQKCFPALWKTIWSTSEQYEQNKAEALERLKVLENELGGKRFFGGDSIGMVD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  NF+ F    ++EAL +++ T++ FP L  W E+F   C  +K+CLPP+DKL+  F  
Sbjct  153  IVANFIGFSFRTIQEALKLDVFTEDNFPKLWEWAENF-ANCSPVKKCLPPQDKLIANFPP  211

Query  361  GFI  369
             ++
Sbjct  212  AYM  214



>ref|XP_010938161.1| PREDICTED: glutathione S-transferase U8-like [Elaeis guineensis]
Length=226

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+F+D+KC+PA   + + +G+ Q    +E  E L IL+ EL+ KKF GG  +G  D
Sbjct  95   ARFWARFLDDKCMPAMWMSCWTEGDAQQNFMKESKENLSILEGELKGKKFFGGNAIGLVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA  F+A W GVL+E  G+ LV +EK P L +W E+F I  D + ECLP R++L+ FF++
Sbjct  155  IAALFIAHWAGVLQEVAGISLVNEEKHPILFKWIEEF-ISSDIVVECLPARERLLAFFQA  213



>ref|XP_006429233.1| hypothetical protein CICLE_v10012710mg [Citrus clementina]
 gb|ESR42473.1| hypothetical protein CICLE_v10012710mg [Citrus clementina]
Length=220

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEKC+ A  KA +++ +E+++   E  E L+ L+  L+ K+F GG+ +G  D
Sbjct  94   ARFWAKFIDEKCIFALWKACWSEEKEREEAAREASEHLQTLEDVLKDKRFFGGDMIGLVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  NF+ FW+G++EEA GV+L+T+EK+P L +W E+F + C  IKE LPPRDKL+ + ++
Sbjct  154  IVANFIGFWLGIIEEATGVKLLTEEKYPKLYKWSEEF-VNCSAIKENLPPRDKLLAYMRA  212

Query  361  GF  366
             +
Sbjct  213  RY  214



>ref|XP_002532525.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29859.1| glutathione s-transferase, putative [Ricinus communis]
Length=224

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 82/118 (69%), Gaps = 1/118 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF D+KCL  +  A + +GEE++K  E   E   +L+++++ KKF  GE +G+ D
Sbjct  93   ARFWAKFADDKCLYGAFHACWKEGEEKEKAIESAMESFAMLEEQIKGKKFFNGEQIGYLD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
            +A  ++ +W+ V+EE  G++LV  EKFP+L  W + FI I   IKECLPPRD+LV++F
Sbjct  153  LALGWIPYWLNVMEEVGGMKLVDAEKFPSLHEWTQSFIEI-PLIKECLPPRDQLVNYF  209



>gb|AFK40836.1| unknown [Lotus japonicus]
Length=225

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A+ K++F   E E++K  +E  E L+ L+ EL+ KKF GGE  GF 
Sbjct  97   ARFWSKFIDDKVVTAAWKSVFTADEKEREKNIQESFEALQFLENELKDKKFFGGEEFGFV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DI   F+AFW+ +++E  G++L T EKFP L +W ++F +    +KECLPPRD +  FFK
Sbjct  157  DITAVFIAFWIPMIQEIAGLQLFTAEKFPKLYKWSQEF-LNHPVVKECLPPRDPVFAFFK  215

Query  358  SGF  366
              +
Sbjct  216  GLY  218



>gb|AGV54744.1| glutathione transferase [Phaseolus vulgaris]
Length=225

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A+ K++F   E E++K   E  E L+ L+ E+  KKF GGE +G  
Sbjct  97   ARFWSKFIDDKIVGATWKSVFTADEKEREKNVAEASESLQFLENEIADKKFFGGEELGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  +VAFW+ +++E  G+EL+T EKFPNL +W ++F +    +KE LPPRD +  FFK
Sbjct  157  DIAAVYVAFWIPLVQEIGGLELLTSEKFPNLYKWSQEF-VSHPIVKESLPPRDPVFGFFK  215

Query  358  SGF  366
              +
Sbjct  216  GRY  218



>ref|XP_006298410.1| hypothetical protein CARUB_v10014479mg, partial [Capsella rubella]
 gb|EOA31308.1| hypothetical protein CARUB_v10014479mg, partial [Capsella rubella]
Length=247

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++DEK + A  KA +    E++K ++E  E L  L+KE+  K+F GGET+G  D
Sbjct  120  ARFWAKYVDEKVMVAMGKAFWGPESEREKERKEAYEGLISLEKEIGDKRFFGGETIGIVD  179

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA +F+ +W+G+++E  GV ++T E+FPNL RW EDF +  + IKE LPP+ KL   FK+
Sbjct  180  IAADFIGYWLGIVQEVSGVTIMTAEEFPNLKRWSEDF-VGNNIIKEVLPPKQKLAALFKT  238

Query  361  GF  366
             F
Sbjct  239  PF  240



>emb|CAN73676.1| hypothetical protein VITISV_001111 [Vitis vinifera]
Length=220

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 85/123 (69%), Gaps = 4/123 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++D+K LPA+     +KGEEQ    EE+ + LK L+ EL+ KKF GGE++GF D
Sbjct  94   ARFWAKYMDDKLLPAAIXVAMSKGEEQXGVIEEIQKQLKTLESELKEKKFFGGESLGFVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEI-KECLPPRDKLVDFFK  357
            IA N +  W+ V +EALG+E++T+EKFP L  W +   ++ D + KEC+PPR++ + F K
Sbjct  154  IAANTIV-WLVVAQEALGMEILTEEKFPVLHGWYQR--LVDDAVFKECMPPREQHLSFVK  210

Query  358  SGF  366
              F
Sbjct  211  VRF  213



>ref|XP_003529119.1| PREDICTED: probable glutathione S-transferase isoform 1 [Glycine 
max]
Length=225

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K   AS KA+F   E E++K  EE  + L+ L+ E++ KKF GGE +G  
Sbjct  97   ARFWSKFIDDKVFGASWKAVFTADEKEREKNVEEAIDALQFLENEIKDKKFFGGEEIGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  ++AFWV +++E  G+EL T EKFP L  W ++F +    +KE LPPRD +  FFK
Sbjct  157  DIAAVYIAFWVPMVQEIAGLELFTSEKFPKLHNWSQEF-LNHPIVKESLPPRDPVFAFFK  215

Query  358  SGF  366
              +
Sbjct  216  GRY  218



>ref|XP_010693951.1| PREDICTED: glutathione S-transferase U7-like [Beta vulgaris subsp. 
vulgaris]
Length=221

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 85/122 (70%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K  P    AL ++GEE +K   ++ E+L+IL+ E++ K+F GG+++G+ D
Sbjct  92   ARFWAKFVDDKVTPLVRSALMSEGEESEKAIPQLDEVLQILESEIKGKQFFGGKSIGYLD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  + V FW+  L+E +G E++TKEKFP++  W  D ++ C  +K+ +P  D+L +F+++
Sbjct  152  IVASMVPFWITCLQEVVGKEVITKEKFPSISSWA-DELLGCSVMKQNVPHHDRLKEFYQA  210

Query  361  GF  366
             F
Sbjct  211  RF  212



>ref|XP_006367675.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=231

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA F+  K +     A   KG+ Q+K   EVCE+LKIL  +LE K F      GFAD
Sbjct  93   ARFWANFLHNK-METVRNAFLGKGKVQEKSIVEVCEMLKILGDKLEGKTFFVANEFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  N V FW+GV +E  GVELVT++KFP  C W++ + + C ++K+ LP RDKL+ F+++
Sbjct  152  IVANMVGFWLGVYQEVSGVELVTEKKFPIFCVWRDKY-VNCSQVKKYLPSRDKLIAFYQA  210

Query  361  GFIP  372
               P
Sbjct  211  SARP  214



>gb|ACU14373.1| unknown [Glycine max]
Length=182

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 80/120 (67%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K   A+ K++F   E E++K  EE  E L+ L+ E++ KKF GGE +G  
Sbjct  54   ARFWSKFIDDKVFGAAWKSVFTADEKEREKNVEEAIEALQFLENEIKDKKFFGGEEIGLV  113

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  ++AFWV +++E  G+EL T EKFP L  W ++F +    +KE LPPRD +  FFK
Sbjct  114  DIAAVYIAFWVPMVQEIAGLELFTSEKFPKLHNWSQEF-LNHPIVKESLPPRDPVFSFFK  172



>ref|XP_007140454.1| hypothetical protein PHAVU_008G113600g [Phaseolus vulgaris]
 gb|AEX38001.1| glutathione transferase [Phaseolus vulgaris]
 gb|ESW12448.1| hypothetical protein PHAVU_008G113600g [Phaseolus vulgaris]
Length=225

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A+ K++F   E E++K   E  E L+ L+ E+  KKF GGE +G  
Sbjct  97   ARFWSKFIDDKIVGATWKSVFTADEKEREKNVAEASESLQFLENEIGDKKFFGGEELGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  +VAFW+ +++E  G+EL+T EKFPNL +W ++F +    +KE LPPRD +  FFK
Sbjct  157  DIAAVYVAFWIPLVQEIGGLELLTSEKFPNLYKWSQEF-VSHPIVKESLPPRDPVFGFFK  215

Query  358  SGF  366
              +
Sbjct  216  GRY  218



>gb|KHN05121.1| Putative glutathione S-transferase [Glycine soja]
Length=232

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K   AS KA+F   E E++K  EE  + L+ L+ E++ KKF GGE +G  
Sbjct  97   ARFWSKFIDDKVFGASWKAVFTADEKEREKNVEEAIDALQFLENEIKDKKFFGGEEIGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  ++AFWV +++E  G+EL T EKFP L  W ++F +    +KE LPPRD +  FFK
Sbjct  157  DIAAVYIAFWVPMVQEIAGLELFTSEKFPKLHNWSQEF-LNHPIVKESLPPRDPVFAFFK  215

Query  358  SGF  366
              +
Sbjct  216  GRY  218



>ref|NP_001237841.1| uncharacterized protein LOC100306119 [Glycine max]
 gb|ACU14149.1| unknown [Glycine max]
Length=232

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 83/122 (68%), Gaps = 2/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALF-AKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW++FID+KC+PA +KA F A  EE+DK  EE  E L+IL+  L+ K F G  T+G  
Sbjct  98   ARFWSRFIDDKCMPAISKAAFTADKEERDKGTEESLESLQILENVLKHKFFGGETTIGIV  157

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+  +EEA+G++L+T EKFP L +W ED+      +K+ LP RD++V   +
Sbjct  158  DIAAGFIAFWLPAIEEAVGLKLLTNEKFPKLYKWGEDY-TNHPVVKKNLPQRDRVVGVLQ  216

Query  358  SG  363
            S 
Sbjct  217  SS  218



>ref|XP_008448606.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=218

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA +ID K +    K   +KGEE +K  EEV E L+ L+KEL++ KF GGE +GF D
Sbjct  95   ARFWAAYIDGKVVSTLGKIRGSKGEEMEKAVEEVKEALEPLEKELKSNKFFGGEKIGFLD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I G  +AFW+   EEALG+EL+T  KFPNL  W E+ +   + +KE +P +D LV  FK+
Sbjct  155  IVGILIAFWIPASEEALGIELLTSHKFPNLIHWIEE-LANNNVVKELIPKKDDLVAHFKT  213



>ref|XP_004166786.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN54320.1| hypothetical protein Csa_4G303680 [Cucumis sativus]
Length=222

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 80/121 (66%), Gaps = 2/121 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKAL-FAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWA +ID+K L A+ KA   +K EE++K  EE  E LK L+KEL+ KKF GG  +G  
Sbjct  98   ARFWANYIDDKVLAATLKAAKSSKREEREKGLEETEETLKPLEKELQNKKFFGGNKIGIV  157

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DI G  +A+W+  +EEA G EL+T +KFP L +W E+ I+    +K+ LPP+  LV + +
Sbjct  158  DIVGTVIAYWIPAIEEAFGFELLTTKKFPKLTKWSEE-IVNNSVVKQVLPPKSNLVAYLQ  216

Query  358  S  360
            +
Sbjct  217  T  217



>gb|KHG28543.1| Glutathione S-transferase U8 -like protein [Gossypium arboreum]
Length=216

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW  FID KC  A  K  F+  EE++K  EE CE LK L+  L  KKF GG+T+G  D
Sbjct  94   ARFWINFIDGKCSSAIRKVAFSPEEEREKAVEEACECLKTLESALNGKKFFGGDTIGMVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I   F+AFW+   +E +G+EL++ EKFPNL +W +DF + C  +KE LPPRDKLV   K+
Sbjct  154  IVALFIAFWLRPFQEIMGLELLSSEKFPNLFKWTDDF-VSCSIVKELLPPRDKLVAHIKA  212



>ref|XP_008240078.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=226

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 83/119 (70%), Gaps = 3/119 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA FIDEKC PA  KA + + E  +K  EE CELLK L+ EL+  KF GGET+GF D
Sbjct  98   ARFWASFIDEKCSPAICKA-YWEIEGHEKAMEEACELLKFLENELKDNKFFGGETIGFVD  156

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPP-RDKLVDFF  354
            +A +F+ +W+  ++EA+GVE++TKEK P L  W ++F +    +KE LPP ++ L+ FF
Sbjct  157  MAASFIGYWLRPIQEAVGVEVLTKEKCPKLYDWCDEF-VSHSVVKEVLPPNKETLIAFF  214



>ref|XP_009613724.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=218

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEK L A  K + +KGEE++K  EE  ELLK L+ EL+ KKF GG+ +GF D
Sbjct  94   ARFWAKFIDEKLLTAVYKLVSSKGEEKEKGWEETTELLKFLENELQNKKFFGGDNIGFLD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  +++  W G ++E+LG+EL+TKE+FP LC+W ++F + C  I E LPPR+ LV  +K+
Sbjct  154  IVASYI-HWFGAIQESLGLELLTKEQFPKLCKWIDEF-LSCRIIMENLPPRELLVPLYKA  211

Query  361  GF  366
             F
Sbjct  212  QF  213



>gb|AIS71913.1| hypothetical protein [Nicotiana tabacum]
Length=218

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEK L A  K + +KGEE++K  EE  ELLK L+ EL+ KKF GG+ +GF D
Sbjct  94   ARFWAKFIDEKLLAAVYKLVSSKGEEKEKGWEETTELLKFLENELQNKKFFGGDNIGFLD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  +++  W G ++E+LG+EL+TKE+FP LC+W ++F + C  I E LPPR+ LV  +K+
Sbjct  154  IVASYI-HWFGAIQESLGLELLTKEQFPKLCKWIDEF-LSCRIIMENLPPRELLVPLYKA  211

Query  361  GF  366
             F
Sbjct  212  QF  213



>ref|NP_001238675.1| glutathione S-transferase GST 8 [Glycine max]
 gb|AAG34798.1|AF243363_1 glutathione S-transferase GST 8 [Glycine max]
Length=225

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 80/120 (67%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K   A+ K++F   E E++K  EE  E L+ L+ E++ KKF GGE +G  
Sbjct  97   ARFWSKFIDDKVFGAAWKSVFTADEKEREKNVEEAIEALQFLENEIKDKKFFGGEEIGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  ++AFWV +++E  G+EL T EKFP L  W ++F +    +KE LPPRD +  FFK
Sbjct  157  DIAAVYIAFWVPMVQEIAGLELFTSEKFPKLHNWSQEF-LNHPIVKESLPPRDPVFSFFK  215



>gb|AAA33943.1| auxin-regulated protein, partial [Glycine max]
Length=140

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 80/123 (65%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A +K++F   E E++K  EE  E L+ L+ EL+ KKF GGE  G  
Sbjct  12   ARFWSKFIDDKIVGAVSKSVFTVDEKEREKNVEETYEALQFLENELKDKKFFGGEEFGLV  71

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+ + +E  G++L T EKFP L +W ++F +    + E LPPRD L  +FK
Sbjct  72   DIAAVFIAFWIPIFQEIAGLQLFTSEKFPILYKWSQEF-LNHPFVHEVLPPRDPLFAYFK  130

Query  358  SGF  366
              +
Sbjct  131  ERY  133



>ref|XP_007140455.1| hypothetical protein PHAVU_008G113700g [Phaseolus vulgaris]
 gb|ESW12449.1| hypothetical protein PHAVU_008G113700g [Phaseolus vulgaris]
Length=225

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 85/123 (69%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A+ K+ F   E E++K  +E  E L+ L+ E++ KKF GGE +G  
Sbjct  97   ARFWSKFIDDKVVGAAWKSAFTVDEKEREKNLQEALEGLQFLEDEIKEKKFFGGEEIGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIAG F+AFW+ +++E  G++L++ EKFPNL +W ++ +I    +KE LPPR+ L  FFK
Sbjct  157  DIAGVFIAFWMPIVQEIAGLQLLSSEKFPNLYKWSQE-LINHSVVKEVLPPREPLFAFFK  215

Query  358  SGF  366
              +
Sbjct  216  GRY  218



>ref|NP_001236169.1| uncharacterized protein LOC100500052 [Glycine max]
 gb|ACU14762.1| unknown [Glycine max]
Length=225

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A+  A+F   E E++K   E  E L+ L+ E++ KKF GGE VG  
Sbjct  97   ARFWSKFIDDKIVGAAWNAVFTVDEKEREKNVVETYEALQFLENEIKDKKFFGGEEVGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIAG ++AFWV +++E  G+EL++ EKFP L +W ++F +    +KE LPPRD +  FFK
Sbjct  157  DIAGVYIAFWVPLIQEIAGLELLSSEKFPKLYKWSQEF-VNHPIVKESLPPRDPVFAFFK  215

Query  358  SGF  366
              +
Sbjct  216  GRY  218



>ref|XP_002280676.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK+ DEKC+  + +A  A+GEE++K  E   E    L+K ++ KKF GGE +GF D
Sbjct  94   ARFWAKYADEKCMFGAWEAFKAEGEEKEKAMESALESFAFLEKAIKGKKFFGGEKMGFLD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +   ++  W+ VLEE  G++++  EKFP+L  W E+FI I   IKEC+PPRD LV+ F +
Sbjct  154  LVVGWIPHWLSVLEEVGGMKMLDAEKFPSLHEWAENFIQI-PLIKECIPPRDVLVNHFHA  212

Query  361  GF  366
             F
Sbjct  213  TF  214



>ref|XP_002281694.2| PREDICTED: uncharacterized protein LOC100246830 [Vitis vinifera]
Length=446

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 89/124 (72%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++D+K  PA+TK + +KGEEQ    EE+ E LK L+ EL+ KKF GGE++GF D
Sbjct  94   ARFWAKYMDDKLWPAATKVVVSKGEEQKAVIEEIQEQLKTLESELKEKKFFGGESLGFVD  153

Query  181  IAGNFVAFWVGVLEEALG-VELVTKEKFPNLCRWKEDFIIICDEI-KECLPPRDKLVDFF  354
            IA N + F + V +EALG +E++T+EKFP L  W +   ++ D + KEC+PPR++ + FF
Sbjct  154  IAANIIVFLL-VAQEALGLMEILTEEKFPVLHEWYQR--LVDDAVFKECVPPRERHLGFF  210

Query  355  KSGF  366
            K+ F
Sbjct  211  KARF  214


 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 83/123 (67%), Gaps = 5/123 (4%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEK  PA+ K   +KGEE +   EE+ E LK L+ EL+ KKF GGE++GF D
Sbjct  321  ARFWAKFLDEKLWPAAKKVALSKGEEHNGLIEEIQEHLKTLESELKEKKFFGGESLGFVD  380

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEI-KECLPPRDKLVDFFK  357
            IA + + FW+ V++E LG++++T++KFP L  W     ++ D + KEC+   ++L+  FK
Sbjct  381  IAADII-FWLLVVQETLGLDILTEDKFPGLHEWYHR--LLDDAVFKECV-SMERLLASFK  436

Query  358  SGF  366
              F
Sbjct  437  VRF  439



>gb|KHN05118.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K   A+ K++F   E E++K  EE  E L+ L+ E++ KKF GGE +G  
Sbjct  97   ARFWSKFIDDKVFGAAWKSVFTADEKEREKNVEEAIEALQFLENEIKDKKFFGGEEIGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  ++AFWV +++E  G+EL T EKFP L  W ++F +    +KE LPPRD +  FFK
Sbjct  157  DIAAVYIAFWVPMVQEIAGLELFTSEKFPKLHNWSQEF-LNHPIVKESLPPRDPVFAFFK  215

Query  358  SGF  366
              +
Sbjct  216  GRY  218



>gb|AAO69664.1| glutathione S-transferase [Phaseolus acutifolius]
Length=225

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 82/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+  + ++ K++F   E E++K   E  E L+ L+ E+  KKF GGE +G  
Sbjct  97   ARFWSKFIDDNIVGSTWKSVFTADEKEREKNVAEASESLQFLENEIADKKFFGGEELGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  +VAFW+ +++E  G+EL+T EKFPNL +W ++F +    +KE LPPRD +  FFK
Sbjct  157  DIAAVYVAFWIPLVQEIAGLELLTSEKFPNLYKWSQEF-VSHPIVKESLPPRDPVFGFFK  215

Query  358  SGF  366
              +
Sbjct  216  GRY  218



>ref|XP_010685658.1| PREDICTED: glutathione S-transferase U7-like [Beta vulgaris subsp. 
vulgaris]
Length=232

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 82/124 (66%), Gaps = 4/124 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAK-GEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWA+FID+K LP+  +   +K  EE+ K KEE   LL+IL+ +L  KKF GG+ +G+ 
Sbjct  97   ARFWARFIDDKLLPSVWRYFLSKDNEERMKTKEEAIMLLRILESQLNMKKFFGGDILGYV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEI-KECLPPRDKLVDFF  354
            DI  N VAFW+  ++E +G+EL+ KEKFP L RW E +    D I K CLP +DK + + 
Sbjct  157  DIVANVVAFWIERVQEVVGIELLNKEKFPILYRWIEKY--YDDSITKGCLPRKDKHMVYI  214

Query  355  KSGF  366
            K+ +
Sbjct  215  KARY  218



>emb|CBI16040.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 85/120 (71%), Gaps = 4/120 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++D+K LPA+ K   +KGEEQ    EE+ + LK L+ EL+ KKF GGE++GF D
Sbjct  2    ARFWAKYMDDKLLPAAIKVAMSKGEEQKGVIEEIQKQLKTLESELKEKKFFGGESLGFVD  61

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEI-KECLPPRDKLVDFFK  357
            IA N +  W+ V +EALG+E++T+EKFP L  W +   ++ D + KEC+PPR++ + F K
Sbjct  62   IAANTIV-WLVVAQEALGMEILTEEKFPVLHGWYQR--LVDDAVFKECMPPREQHLSFVK  118


 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 88/122 (72%), Gaps = 5/122 (4%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK++D+K  PA+TK + +KGEEQ    EE+ E LK L+ EL+ KKF GGE++GF D
Sbjct  225  ARFWAKYMDDKLWPAATKVVVSKGEEQKAVIEEIQEQLKTLESELKEKKFFGGESLGFVD  284

Query  181  IAGNFVAFWVGVLEEALG-VELVTKEKFPNLCRWKEDFIIICDEI-KECLPPRDKLVDFF  354
            IA N + F + V +EALG +E++T+EKFP L  W +   ++ D + KEC+PPR++ + FF
Sbjct  285  IAANIIVFLL-VAQEALGLMEILTEEKFPVLHEWYQR--LVDDAVFKECVPPRERHLGFF  341

Query  355  KS  360
            K+
Sbjct  342  KA  343



>gb|KEH26957.1| glutathione S-transferase [Medicago truncatula]
Length=223

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEKC+     A  A+GEE+ K  +   E L  L+K+++ KKF GGE +G+ D
Sbjct  93   ARFWAKFIDEKCIFGVWGACVAQGEEKAKAVDAAIESLAFLEKQIQGKKFFGGEKIGYLD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I   ++++W+ VLEE   +EL+  EKFP+L  W  +F I    IK+C+PP++ +V++F  
Sbjct  153  IVAGWISYWLNVLEELGEMELINAEKFPSLHEWGHNF-IQTSPIKDCIPPKEMVVEYFSF  211

Query  361  GF  366
            G 
Sbjct  212  GI  213



>gb|EAY77227.1| hypothetical protein OsI_05199 [Oryza sativa Indica Group]
Length=239

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%), Gaps = 4/121 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA F+DE CL     ALF +GEEQ K  EE  E L + + EL  K+F GG ++G AD
Sbjct  98   ARFWAHFLDENCLKPLRPALFGEGEEQKKSMEETREGLTVAEAELRGKRFFGGSSIGLAD  157

Query  181  IAGNFV-AFWVGVLEEALGVELVT--KEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDF  351
            IAG  V A WVGVL+E  GV +++    ++P L RW +D+ +  + + ECLP RD+L+ +
Sbjct  158  IAGGGVLAHWVGVLQEVAGVSVLSDGDGEYPALRRWAKDY-VANESVMECLPDRDRLLSY  216

Query  352  F  354
            F
Sbjct  217  F  217



>ref|XP_003529124.1| PREDICTED: probable glutathione S-transferase-like [Glycine max]
Length=225

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A  K++F   E E++K  EE  E L+ L+ EL+ KKF GGE  G  
Sbjct  97   ARFWSKFIDDKIVGAVLKSVFTVDEKEREKNVEETYEALQFLENELKDKKFFGGEEFGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+ + +E  G++L T EKFP L +W ++F +    ++E LPPRD L  FFK
Sbjct  157  DIAAVFIAFWIPIFQEIAGLQLFTSEKFPILYKWSQEF-LNHPLVQEVLPPRDPLFTFFK  215

Query  358  SGF  366
            + +
Sbjct  216  ARY  218



>gb|KHN25840.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A+  A+F   E E++K   E  E L+ L+ E++ KKF GGE VG  
Sbjct  97   ARFWSKFIDDKIVGAAWNAVFTVDEKEREKNVVETYEALQFLENEIKDKKFFGGEEVGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIAG ++AFWV +++E  G+EL++ EKFP L +W ++F +    +KE LPPRD +  FFK
Sbjct  157  DIAGVYIAFWVPLIQEIAGLELLSSEKFPKLYKWSQEF-VNHPIVKEGLPPRDPVFAFFK  215

Query  358  SGF  366
              +
Sbjct  216  GRY  218



>ref|XP_002280532.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK+ DEKCL  + +A  A+GEE++K  E   E    L+K ++ KKF GGE +GF D
Sbjct  94   ARFWAKYADEKCLFGAWEAFKAEGEEKEKAMESALESFAFLEKAIKGKKFFGGEKMGFLD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +   ++  W+ VLEE  G++++  E+FP+L  W E+FI I   IKEC+PPRD LV+ F +
Sbjct  154  LVVGWIPHWLSVLEEVGGMKMLDAERFPSLHEWAENFIQI-PLIKECIPPRDDLVNHFHA  212

Query  361  GF  366
              
Sbjct  213  SL  214



>ref|XP_006367674.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=225

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 87/120 (73%), Gaps = 3/120 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K + A       KGEEQ+K KEE CE+LK+LD EL+ KKF  G+  GFAD
Sbjct  93   ARFWAKFLDDK-VGAVVSTFIRKGEEQEKGKEEACEMLKVLDNELKDKKFFVGDKFGFAD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPR-DKLVDFFK  357
            IA N V +W+G+ +EA GV+LVT E F N C W++++ I C ++KE LPPR D+L+ FF+
Sbjct  152  IAANLVGYWLGIFQEASGVKLVTSENFSNFCAWRDEY-INCSQVKEYLPPRNDELLAFFQ  210



>ref|XP_010279423.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=223

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF DEKCL  +  AL A+G E++K  E   E L  L+K++E KKF GG+T+GF D
Sbjct  93   ARFWAKFGDEKCLMGAWAALCAEGPEKEKAVETAMETLNYLEKQIEGKKFFGGKTIGFLD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +   ++  W+ VL+E  G++L   E+FP L  W ++FI I   IK+C PPRD++V +F+S
Sbjct  153  LVIGWIPHWLDVLDEVGGMKLFDAERFPCLHEWAQNFIQI-PIIKDCHPPRDEMVAYFQS  211

Query  361  G  363
             
Sbjct  212  S  212



>ref|XP_007207190.1| hypothetical protein PRUPE_ppa017086mg [Prunus persica]
 gb|EMJ08389.1| hypothetical protein PRUPE_ppa017086mg [Prunus persica]
Length=226

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 83/119 (70%), Gaps = 3/119 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA FIDEKC PA  KA + + E  +K  EE CELL+ L+ EL+  KF GGET+GF D
Sbjct  98   ARFWASFIDEKCSPAICKA-YWEIEGHEKAMEEACELLQSLENELKDNKFFGGETIGFVD  156

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPP-RDKLVDFF  354
            +A +F+ +W+  ++EA+GVE++TKEK P L  W ++F +    +KE LPP ++ L+ FF
Sbjct  157  MAASFIGYWLRPIQEAVGVEVLTKEKCPKLYDWCDEF-VSHSVVKEVLPPNKETLIAFF  214



>gb|KGN54330.1| hypothetical protein Csa_4G304760 [Cucumis sativus]
Length=220

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 79/120 (66%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKAL-FAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWAK+ID+K L A+ KA   +K EE++K  EE  E LK L+KEL+ KKF GG  +G  
Sbjct  96   ARFWAKYIDDKVLAATLKAAKSSKREEKEKGLEETEETLKPLEKELQNKKFFGGNKIGIV  155

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DI G  +A+W+  +EE  G EL+T +KFP L +W E+ I+    +K+ LPP+  LV + +
Sbjct  156  DIVGTVIAYWIPAIEEGFGSELLTSKKFPKLTKWSEE-IVKNSVVKQVLPPKSVLVAYLQ  214



>ref|XP_004147931.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
Length=220

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 79/120 (66%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKAL-FAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWAK+ID+K L A+ KA   +K EE++K  EE  E LK L+KEL+ KKF GG  +G  
Sbjct  96   ARFWAKYIDDKVLAATLKAAKSSKREEREKGLEETEETLKPLEKELQNKKFFGGNKIGIV  155

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DI G  +A+W+  +EE  G EL+T +KFP L +W E+ I+    +K+ LPP+  LV + +
Sbjct  156  DIVGTVIAYWIPAIEEGFGSELLTSKKFPKLTKWSEE-IVKNSVVKQVLPPKSVLVAYLQ  214



>ref|XP_008448631.1| PREDICTED: glutathione S-transferase U8-like [Cucumis melo]
Length=224

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK+IDEK +PA  K   ++ +E++K  E+    L+ L++EL+ K F GG+T+GF D
Sbjct  99   ARFWAKYIDEKVVPAVQKVARSQEDEREKSIEDAQAALEPLEEELKNKLFFGGDTIGFVD  158

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IAG  +A W+   EEA+G EL++  KFPNL +W +DF +     KE LP +D LV F K+
Sbjct  159  IAGLVLARWIPATEEAVGFELLSAHKFPNLTKWSQDF-VNHSVAKEVLPEKDVLVAFLKN  217



>ref|NP_001238439.1| probable glutathione S-transferase [Glycine max]
 sp|P32110.1|GSTX6_SOYBN RecName: Full=Probable glutathione S-transferase; AltName: Full=G2-4; 
AltName: Full=Heat shock protein 26A [Glycine max]
 gb|AAA33973.1| Gmhsp26-A [Glycine max]
 gb|ACU17044.1| unknown [Glycine max]
Length=225

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A +K++F   E E++K  EE  E L+ L+ EL+ KKF GGE  G  
Sbjct  97   ARFWSKFIDDKIVGAVSKSVFTVDEKEREKNVEETYEALQFLENELKDKKFFGGEEFGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+ + +E  G++L T EKFP L +W ++F +    + E LPPRD L  +FK
Sbjct  157  DIAAVFIAFWIPIFQEIAGLQLFTSEKFPILYKWSQEF-LNHPFVHEVLPPRDPLFAYFK  215

Query  358  SGF  366
            + +
Sbjct  216  ARY  218



>ref|XP_002520472.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41885.1| glutathione s-transferase, putative [Ricinus communis]
Length=222

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF++EK L  ++K   AK EE+ +  EE+ + LK+L+ EL  ++F GGE++GF D
Sbjct  94   ARFWAKFVEEKILQTASKFRVAKEEEKKQIYEELDQQLKVLENELREREFSGGESIGFVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I   F+ +W  V +E L + L++KEKFP LC++ +  + I D +KECLPP++K + + ++
Sbjct  154  IVAFFILYWFQVRQEVLQLSLISKEKFPVLCKYVDKLLEI-DMVKECLPPKEKHLAYVRA  212

Query  361  GF  366
             F
Sbjct  213  HF  214



>emb|CAN62219.1| hypothetical protein VITISV_042912 [Vitis vinifera]
Length=221

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 86/125 (69%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKE--EVCELLKILDKELETKKFLGGETVGF  174
            ARFWAKFIDEK  P   KAL +K EE+++R+   E  E L+ L+ EL+ KKF GGE+ G+
Sbjct  94   ARFWAKFIDEKLWPVVRKALGSK-EEKEQREAIGETHEHLETLESELKEKKFFGGESRGY  152

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEI-KECLPPRDKLVDF  351
             DIA   V  W+G+ +EALGVE + KEKFP L  W++   ++ D + KEC+PPR+KL  F
Sbjct  153  LDIAA-MVIIWLGIAQEALGVEFIPKEKFPRLHEWQQR--LVEDAVFKECVPPREKLGAF  209

Query  352  FKSGF  366
            FK+ F
Sbjct  210  FKARF  214



>gb|KDO66687.1| hypothetical protein CISIN_1g041211mg [Citrus sinensis]
Length=222

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +1

Query  4    RFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFADI  183
            RFWAKFIDEK L    KA F +G+E++   EE  E +K L+ EL  K F  GET+GF DI
Sbjct  95   RFWAKFIDEKILATGWKANFGEGKEREVAIEEFAEQMKFLENELNGKDFFEGETIGFLDI  154

Query  184  AGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
              N +AFW  V ++ALG+E  T+EKFP L +W  + I   D + EC PPR+K + F K+
Sbjct  155  VANLIAFWFPVRQDALGIEAFTQEKFPVLFKWIAN-ITKIDLVNECRPPREKHLAFVKA  212



>gb|EYU26623.1| hypothetical protein MIMGU_mgv1a013321mg [Erythranthe guttata]
Length=223

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D+K  P   KA + +GEE++K  EE  E LK+L+ E++ KK  GG+ +G  D
Sbjct  96   ARFWAKFLDDKFAPQIWKACWGEGEEREKGIEEATESLKLLENEIKGKKLFGGDNLGLVD  155

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I  +F+A+W  +L++ LG++  T+EK+PNL  W ++F   C  +KE LPP+ +LV  FK 
Sbjct  156  IVAHFMAYWSEILQQLLGLDFFTREKYPNLFNWGDEF-CNCSFVKENLPPKHELVLIFKG  214



>gb|KHN06986.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 80/123 (65%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K   A+ K++F   E E++K  EE  E L+ L+ EL+  KF GGE  G  
Sbjct  97   ARFWSKFIDDKVFGAAWKSVFTLDEKEREKNVEESLEALQFLENELKDNKFFGGEEFGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+ + +E  G+++ T EKFP L +W ++F +    +KE LPPRD L  FFK
Sbjct  157  DIAAIFIAFWIPIFQEIAGLQIFTSEKFPKLYKWSQEF-MSHPVVKEVLPPRDPLFAFFK  215

Query  358  SGF  366
            + +
Sbjct  216  ARY  218



>ref|XP_002283736.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=226

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 84/124 (68%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWAKFIDEK  P   KAL +K E EQ +   E  E L+ L+ EL+ KKF GGE+ G+ 
Sbjct  99   ARFWAKFIDEKLWPVVRKALGSKEEKEQREAIGETHEHLETLESELKEKKFFGGESWGYL  158

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEI-KECLPPRDKLVDFF  354
            DIA   V  W+G+ +EALGVE + KEKFP L +W++   ++ D + KEC+PPR+KL  FF
Sbjct  159  DIAA-MVIIWLGIAQEALGVEFIPKEKFPRLHKWQQR--LVEDAVFKECVPPREKLGAFF  215

Query  355  KSGF  366
            K+ F
Sbjct  216  KARF  219



>ref|XP_004147913.1| PREDICTED: glutathione S-transferase U8-like [Cucumis sativus]
 gb|KGN54318.1| hypothetical protein Csa_4G303170 [Cucumis sativus]
Length=224

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK+ID+K +PA+ K   ++ +E++K  E+    L+ L+KELE K F GG+ +GF D
Sbjct  99   ARFWAKYIDDKVVPAAQKVARSQEDEREKSIEDAQATLEPLEKELENKSFFGGDKIGFVD  158

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I G  +A WV   EEA+G EL++  KFPNL +W ++F +     KE LP +D LV F K+
Sbjct  159  IVGLVLARWVPATEEAVGFELLSAHKFPNLTKWSQNF-VNHSVAKEVLPKKDVLVAFLKN  217



>gb|EYU26621.1| hypothetical protein MIMGU_mgv1a013264mg [Erythranthe guttata]
Length=225

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGG-ETVGFA  177
            ARFWAKF+D+KC+PA  KA + KGEE +K  EE  + L+ L+ E++ K+F GG +++G  
Sbjct  94   ARFWAKFVDDKCIPAMWKACWQKGEEGEKAMEEANDALEFLENEIKGKRFFGGDDSIGLV  153

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA + +A   G++ E +GV+ + K+KFPNLC+W +++   C  +KE  PP  KL+  +K
Sbjct  154  DIAADVIACRNGIIAELMGVQFLRKDKFPNLCKWADEY-CNCSFVKENQPPNQKLIHHYK  212

Query  358  S  360
            +
Sbjct  213  A  213



>dbj|BAA78580.1| Dcarg-1 [Daucus carota]
Length=218

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFID+K +PA       +GEEQ K  +EV EL K+L+ +L  KKF GG+T+G  D
Sbjct  96   ARFWAKFIDDKLMPAIMNIRRCQGEEQVKAIDEVVELFKLLENQLNGKKFFGGDTIGLVD  155

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKL  342
            I  NF+A W+ + +E +G+++VT+EK P  C+W +++ +    IK+ LP +++L
Sbjct  156  ITANFLALWLIIHQEIMGLQIVTEEKLPVFCKWIDEY-LNSSVIKQSLPSKEEL  208



>ref|XP_003529121.1| PREDICTED: probable glutathione S-transferase-like isoformX1 
[Glycine max]
 gb|KHN05111.1| Putative glutathione S-transferase [Glycine soja]
Length=226

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 80/123 (65%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K   A  K++F   E E++K  EE  E L+ L+ E++ KKF GGE  G  
Sbjct  97   ARFWSKFIDDKIGGAVWKSVFTVDEKEREKNVEESLEALQFLESEIKGKKFFGGEEFGMV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFWV +++E  G+EL T EKFP L  W ++F +    +KE LPPRD L  FFK
Sbjct  157  DIAAIFIAFWVPMVQEIAGLELFTSEKFPKLYNWSQEF-MSHPVVKEVLPPRDPLFAFFK  215

Query  358  SGF  366
            + +
Sbjct  216  ARY  218



>ref|XP_008453455.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=224

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 82/122 (67%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEK L  + +A  A+GEE++K  E   + L +LDKE++ KKF GGE +G+ D
Sbjct  93   ARFWAKFLDEKGLLGAWEACQAEGEEKEKAVEAAVQHLALLDKEIQGKKFFGGEKIGYLD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +A  ++  W+ VL+E   + +  +E+FP+L  W ++FI +   IKE LPPR+ LV++FK 
Sbjct  153  LAAGWICHWLSVLDEVGEMNVFDRERFPSLHEWAQNFIHV-PVIKESLPPREILVNYFKG  211

Query  361  GF  366
              
Sbjct  212  SL  213



>ref|NP_001238643.1| glutathione S-transferase GST 6 [Glycine max]
 gb|AAG34796.1|AF243361_1 glutathione S-transferase GST 6 [Glycine max]
Length=225

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + AS K++F   E E++K  EE  E L+ L+ EL+ K+F GG+  GF 
Sbjct  97   ARFWSKFIDDKIVGASWKSVFTVDEKEREKNVEESLEALQFLENELQDKRFFGGDEFGFV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIAG F+AF + + +E  G++L T EKFP L +W ++ +I    +K+ LPPR+ L  FFK
Sbjct  157  DIAGVFIAFSIPIFQEVAGLQLFTSEKFPKLFKWSQE-LINHPVVKDVLPPREPLFAFFK  215

Query  358  SGF  366
            S +
Sbjct  216  SLY  218



>ref|NP_001045401.1| Os01g0949700 [Oryza sativa Japonica Group]
 dbj|BAD87877.1| putative glutathione S-transferase [Oryza sativa Japonica Group]
 dbj|BAF07315.1| Os01g0949700 [Oryza sativa Japonica Group]
 gb|EAZ14835.1| hypothetical protein OsJ_04762 [Oryza sativa Japonica Group]
 dbj|BAG91227.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00448.1| unnamed protein product [Oryza sativa Japonica Group]
Length=239

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (64%), Gaps = 4/121 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW  F+DE CL     ALF +GEEQ K  EE  E L + + EL  K+F GG ++G AD
Sbjct  98   ARFWVHFLDENCLKPLRPALFGEGEEQKKSMEETREGLTVAEAELRGKRFSGGSSIGLAD  157

Query  181  IAGNFV-AFWVGVLEEALGVELVT--KEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDF  351
            IAG  V A WVGVL+E  GV +++    ++P L RW +D+ +  + + ECLP RD+L+ +
Sbjct  158  IAGGGVLAHWVGVLQEVAGVSVLSDGDGEYPALRRWAKDY-VANESVMECLPDRDRLLSY  216

Query  352  F  354
            F
Sbjct  217  F  217



>ref|XP_006488416.1| PREDICTED: glutathione S-transferase U7-like [Citrus sinensis]
Length=223

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEK L    KA  A+G+E++   EE+ E +K+L+ EL  K F GGE +G  D
Sbjct  95   ARFWAKFIDEKLLATGMKASLAEGKEKELLNEEILEQMKLLENELNGKDFFGGEAIGLVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I    VAFW  V  E LGVE++T+EKFP L +W      I D + +  PPR+K V   ++
Sbjct  155  IVATVVAFWFPVSHEVLGVEVITQEKFPVLLKWIGKLQEI-DVVSQSRPPREKHVAHVRA  213



>ref|XP_006424949.1| hypothetical protein CICLE_v10029241mg [Citrus clementina]
 gb|ESR38189.1| hypothetical protein CICLE_v10029241mg [Citrus clementina]
Length=222

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEK L    KA  A+G+E++   EE+ E +K+L+ EL  K F GGE +G  D
Sbjct  94   ARFWAKFIDEKLLATGMKASLAEGKEKELLNEEILEQMKLLENELNGKDFFGGEAIGLVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I    VAFW  V  E LGVE++T+EKFP L +W      I D + +  PPR+K V   ++
Sbjct  154  IVATVVAFWFPVSHEVLGVEVITQEKFPVLLKWIGKLQEI-DVVSQSRPPREKHVAHVRA  212



>ref|XP_004972343.1| PREDICTED: probable glutathione S-transferase-like [Setaria italica]
Length=228

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 82/123 (67%), Gaps = 5/123 (4%)
 Frame = +1

Query  4    RFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFADI  183
            RFWA F++EKCL     ALFA GE Q    +E  E L +++++L  K+F+GGE +G ADI
Sbjct  96   RFWAHFLEEKCLQPLRAALFADGEVQQVAMKEARESLAVVEEQLRGKRFMGGEAIGLADI  155

Query  184  AGNFVAFWVGVLEEALGV-ELVTKEKFPNLCRWKEDFIIICDE-IKECLPPRDKLVDFFK  357
            A + VA W+GV+EE  GV  L+T E++P LC+W + +    DE +K+CLP RD+L   + 
Sbjct  156  AASNVAHWLGVMEEVGGVTPLLTDEEYPALCQWAKRY--AGDETVKQCLPKRDELFAMY-  212

Query  358  SGF  366
            SGF
Sbjct  213  SGF  215



>ref|XP_003529123.1| PREDICTED: probable glutathione S-transferase-like [Glycine max]
Length=225

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 80/123 (65%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A  K++F   E E++K  EE  E L+ L+ EL+ KKF GGE  G  
Sbjct  97   ARFWSKFIDDKIVGAVWKSVFTVDEKEREKNVEETYEALQFLENELKDKKFFGGEEFGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+ + +E  G++L T EKFP L +W E+  +    ++E LPPRD L  FFK
Sbjct  157  DIAAVFIAFWIPIFQEIAGLQLFTSEKFPILYKWSEE-SLNHPLVQEVLPPRDPLFTFFK  215

Query  358  SGF  366
            + +
Sbjct  216  ARY  218



>ref|XP_010693980.1| PREDICTED: probable glutathione S-transferase [Beta vulgaris 
subsp. vulgaris]
Length=234

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 74/122 (61%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+D K  P    AL  KG   +K   E+ ELL+IL+ E++  +F GG  +GF D
Sbjct  93   ARFWAKFVDNKLTPVMRSALLHKGVRSEKATLELKELLQILENEIKGMQFFGGNNIGFLD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I    V FW+  L+ A G E+ T+EK+P +C W  D ++ C  IK+ LP  DKL +F++ 
Sbjct  153  IVAAIVPFWITCLQAASGKEVFTREKYPRICTW-ADQMLGCKIIKQNLPDHDKLNEFYRG  211

Query  361  GF  366
             F
Sbjct  212  HF  213



>gb|KDO66686.1| hypothetical protein CISIN_1g041800mg [Citrus sinensis]
Length=223

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFIDEK L    KA  A+G+E++   EE+ E +K+L+ EL  K F GGE +G  D
Sbjct  95   ARFWAKFIDEKLLATGMKASLAEGKEKELLNEEILEQMKLLENELNGKDFFGGEAIGLVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I    VAFW  +  E LGVE++T+EKFP L +W      I D + +  PPR+K V   ++
Sbjct  155  IVATVVAFWFPISHEVLGVEVITQEKFPVLLKWIGKLQEI-DVVNQSRPPREKHVAHVRA  213



>gb|ACU15816.1| unknown [Glycine max]
Length=228

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 80/123 (65%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A  K++F   E E++K  EE  E L+ L+ EL+ KKF GGE  G  
Sbjct  97   ARFWSKFIDDKIVGAVWKSVFTVDEKEREKNVEETYEALQFLENELKDKKFFGGEEFGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+ + +E  G++L T EKFP L +W ++  +    ++E LPPRD L  FFK
Sbjct  157  DIAAVFIAFWIPIFQEIAGLQLFTSEKFPILYKWSQE-SLNHPFVQEVLPPRDPLFTFFK  215

Query  358  SGF  366
            + +
Sbjct  216  ARY  218



>ref|XP_004137330.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN63854.1| hypothetical protein Csa_1G024860 [Cucumis sativus]
Length=224

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEK L  + +A  A+GEE++K  E   + L +LDKE++ KKF GGE +G+ D
Sbjct  93   ARFWAKFLDEKGLIGAWEACQAEGEEKEKAVEAAIQNLALLDKEIQGKKFFGGEQIGYLD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +A  ++  W+ VL+E   + +  +E+ P+L  W ++FI +   IKE LPPR+ LV++FK 
Sbjct  153  LAAGWICHWLNVLDEVGEMNVFDRERVPSLHEWAQNFIHV-PVIKESLPPRETLVNYFKG  211

Query  361  GF  366
              
Sbjct  212  SL  213



>gb|KDO66688.1| hypothetical protein CISIN_1g038634mg [Citrus sinensis]
Length=222

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW KFIDEK L    KA FA+G+E++   EE  + +K L+ EL  K F GGET+GF D
Sbjct  94   ARFWGKFIDEKALATRMKANFAEGKERELVTEEFFQQMKFLENELNGKDFFGGETIGFVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I    VA W  + +E LGVE  T+EKFP L +W    I   D + EC PPR+K + + K+
Sbjct  154  IVAIVVAIWFPLTQEVLGVETFTEEKFPVLFKWIRK-ITEIDVVNECRPPREKHLAYVKA  212



>emb|CBI30467.3| unnamed protein product [Vitis vinifera]
Length=129

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK+IDEKCLPA   A + + ++++K  EE    LK L+ EL+ KKF GGE++GF D
Sbjct  2    ARFWAKYIDEKCLPALWNACWCEKKDREKAVEEANVCLKTLENELKDKKFFGGESIGFVD  61

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ FWVGVL E +GVEL+T +KFP LC+W++++ + C  IKE LP ++KL  + ++
Sbjct  62   IAANFIGFWVGVLGEVVGVELLTIDKFPILCKWRDEY-VGCSVIKENLPSKEKLGAYLRT  120



>gb|KHN05112.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 80/123 (65%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + A  K++F   E E++K  EE  E L+ L+ EL+ KKF GGE  G  
Sbjct  97   ARFWSKFIDDKIVGAVWKSVFTVDEKEREKNVEETYEALQFLENELKDKKFFGGEEFGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW+ + +E  G++L T EKFP L +W ++  +    ++E LPPRD L  FFK
Sbjct  157  DIAAVFIAFWIPIFQEIAGLQLFTSEKFPILYKWSQE-SLNHPFVQEVLPPRDPLFTFFK  215

Query  358  SGF  366
            + +
Sbjct  216  ARY  218



>gb|KCW49502.1| hypothetical protein EUGRSUZ_K030212, partial [Eucalyptus grandis]
Length=105

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +1

Query  82   DKRKEEVCELLKILDKELETKKFLGGETVGFADIAGNFVAFWVGVLEEALGVELVTKEKF  261
            +K  EE CELL  L+ EL+ KKF GGETVGF DI  +F++ WVG ++EA+GV+++T++KF
Sbjct  1    EKAHEEACELLSTLEGELKGKKFFGGETVGFVDIVASFISHWVGPVQEAVGVDVLTEDKF  60

Query  262  PNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            P L +W E+F   C  IKE LPPRDK++ FFK+
Sbjct  61   PMLYKWAEEF-KKCPVIKENLPPRDKILAFFKA  92



>ref|XP_004157054.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
Length=220

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 79/120 (66%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTK-ALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWAK+ID+K + A  K A  +K EE++K  EE  + L+ L+KEL+ KKF GG  +GF 
Sbjct  96   ARFWAKYIDDKVVAAIRKVAKSSKTEEREKDLEETEKTLEPLEKELQNKKFFGGNQIGFV  155

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DI G  +A+W+  +EE  G EL+T +KFP L +W E+ I+    +K+ LPP+  LV + +
Sbjct  156  DIVGTVIAYWIPAIEEGFGFELLTSKKFPKLTKWSEE-IVKNSVVKQVLPPKSVLVAYLQ  214



>emb|CBI30468.3| unnamed protein product [Vitis vinifera]
Length=129

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK+IDEKCLPA   A + + ++++K  EE    L+ L+ EL+ KKF GGE++GF D
Sbjct  2    ARFWAKYIDEKCLPALWNACWCEKKDREKAVEEANVGLETLENELKDKKFFGGESIGFVD  61

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ FWVGVLEE +GVEL+T +KFP LC+W++++ + C  IKE LP ++KL  +F++
Sbjct  62   IAANFIGFWVGVLEEVVGVELLTIDKFPILCKWRDEY-VGCSGIKENLPSKEKLGAYFRT  120



>ref|XP_008240197.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=225

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKA-LFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWAKF DEK +  + +A   A+GEE++   E   E L  L+K++E KKF GGE +G+ 
Sbjct  93   ARFWAKFADEKVVFGAWRACTAAEGEEKETAIESALESLAYLEKQIEGKKFFGGEEIGYL  152

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            D+A  ++  W+  +EEA G++L+  E+FP+L  W  +FI I   IKECLPPR+KLV++  
Sbjct  153  DLALGWIPHWLNTMEEAGGMKLLEAERFPSLHEWGHNFIQI-PLIKECLPPREKLVNYLN  211

Query  358  SGF  366
            +  
Sbjct  212  ASL  214



>gb|AFY26875.1| glutathione-S-transferase [Ipomoea batatas]
Length=224

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF D+KCL  +  A  A+GEE+ +  E V E    ++K++E KKF GGE +GF D
Sbjct  93   ARFWAKFADDKCLMGTWTACMAEGEEKVRAIESVQESFAFIEKQIEGKKFFGGEEIGFLD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +   ++  W+ V+EE  G++L+  EKFP L  W ++FI I   I + LPPRD L+++FK+
Sbjct  153  LGIGWICLWLNVMEEVGGMKLLDPEKFPCLHNWAQNFIKI-PVIHQFLPPRDDLLNYFKA  211

Query  361  GF  366
              
Sbjct  212  SL  213



>ref|XP_002318530.2| hypothetical protein POPTR_0012s04770g [Populus trichocarpa]
 gb|EEE96750.2| hypothetical protein POPTR_0012s04770g [Populus trichocarpa]
Length=225

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 79/120 (66%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGG-ETVGFA  177
            ARFWAKF DEKCL  +  A + +GEE++K  E   E    L+K+++ KKF  G + +G+ 
Sbjct  93   ARFWAKFADEKCLMGAFAAFWKEGEEKEKAIESALESFTFLEKQIQGKKFFSGDDNIGYL  152

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            D+   ++  W+ V+EEA G++L+  +KFP+L  W ++FI I   IKEC PPRD LV++F 
Sbjct  153  DLVMGWIPLWLNVMEEAGGMKLMDAQKFPSLHEWTQNFIEI-PLIKECFPPRDALVNYFN  211



>ref|XP_009399930.1| PREDICTED: probable glutathione S-transferase [Musa acuminata 
subsp. malaccensis]
Length=224

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 84/120 (70%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW++F+D+KC  A   + + +GE Q    E+  E L +L++EL+ KKF GG+++G  D
Sbjct  94   ARFWSRFLDDKCSLALWMSCWTEGETQQNFMEQAKECLHLLEEELKGKKFFGGDSIGMVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA +F+A W+GVLEE  G+ L+ +EK+PNLC+W E+F +  D + ECLP R  L+ FF++
Sbjct  154  IAASFIAHWLGVLEEVAGISLLDEEKYPNLCKWTEEF-LKSDAVMECLPKRANLLAFFQA  212



>ref|XP_006849226.1| hypothetical protein AMTR_s00027p00230760 [Amborella trichopoda]
 gb|ERN10807.1| hypothetical protein AMTR_s00027p00230760 [Amborella trichopoda]
Length=224

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKFID+KCLP S  A   +G +Q+K  +E  E +K L+  L+ K F GGET+ + D
Sbjct  95   ARFWAKFIDDKCLPVSWIAFTTQGGQQEKALKEAQECIKTLEAALKAK-FFGGETIDYVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            + GNF+ +W+ +L EA G++    EK P    W E+F  + D +KE LP  DKL+ +FK
Sbjct  154  VVGNFLGYWMRILGEAAGIQYYDAEKAPVFHSWIEEFTSV-DVVKESLPTHDKLLAYFK  211



>gb|KHN05114.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 82/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            AR W+KFID+K + AS K++F   E E++K  EE  E L+ L+ EL+ K+F GG+  GF 
Sbjct  97   ARVWSKFIDDKIVGASWKSVFTVDEKEREKNVEESLEALQFLENELQDKRFFGGDEFGFV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIAG F+AF + + +E  G++L T EKFP L +W ++ +I    +K+ LPPR+ L  FFK
Sbjct  157  DIAGVFIAFSIPIFQEVAGLQLFTSEKFPKLFKWSQE-LINHPVVKDVLPPREPLFAFFK  215

Query  358  SGF  366
            S +
Sbjct  216  SLY  218



>gb|ACJ86006.1| unknown [Medicago truncatula]
 gb|AFK37765.1| unknown [Medicago truncatula]
 gb|AFK44018.1| unknown [Medicago truncatula]
 gb|KEH28980.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=225

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 85/123 (69%), Gaps = 3/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFA-KGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW++FID+K LPA +KA +    EE++K  EE  + L+ L+ EL+  KF GGE +   
Sbjct  97   ARFWSRFIDDKILPAISKAAWTVNKEEREKGIEESLQALQFLENELK-HKFFGGENISIV  155

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA +++AFW+  +EEA+G+++++ +KFP L +W ++F      +KE LPP+D L+ FFK
Sbjct  156  DIAASYLAFWLPAIEEAVGLKVLSSDKFPKLYKWSQEF-NNHPIVKENLPPKDGLLGFFK  214

Query  358  SGF  366
            S +
Sbjct  215  SRY  217



>gb|AFK47387.1| unknown [Medicago truncatula]
Length=225

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 81/123 (66%), Gaps = 3/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K + AS+K++F   E E++K  EE  E L+ L  EL+ K F GGE   F 
Sbjct  97   ARFWSKFIDDKIVSASSKSVFTLDEKEREKNVEETTEALQFLQNELKGKYF-GGEEFNFV  155

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  FVAFW+ ++++ +G++L T EKFP L  W ++F +    +KE +PPR+ L  FFK
Sbjct  156  DIAAVFVAFWIPLVQDIIGLQLFTAEKFPKLYNWSQEF-LDHPVVKETIPPREPLFAFFK  214

Query  358  SGF  366
              +
Sbjct  215  GRY  217



>ref|XP_004492380.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=225

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 82/124 (66%), Gaps = 4/124 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRK--EEVCELLKILDKELETKKFLGGETVGF  174
            ARFW+KFID+K +  S KA+    +E+++ K  EE  E L+IL+ EL+ K F GGE +GF
Sbjct  97   ARFWSKFIDDKIIATSIKAVHTVDDEKEREKNVEESSEALQILENELKDK-FFGGENIGF  155

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
             DIA  ++AFW+ ++++  G++L   EK PNL +W  +F +    +KE +PPRD +  +F
Sbjct  156  VDIAAVYIAFWIPLIQDITGLQLFNAEKCPNLYKWSHEF-LNHPIVKENMPPRDPIFAYF  214

Query  355  KSGF  366
            K+ +
Sbjct  215  KAHY  218



>ref|XP_004246382.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=217

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 83/120 (69%), Gaps = 4/120 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF ++K  P+  K+LF KGEEQ+K KEEV E+LKILD EL+ KKF  G   GF D
Sbjct  93   ARFWAKFFEDKW-PSMMKSLFFKGEEQEKGKEEVNEMLKILDNELKDKKFFVGNNFGFVD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +  N VA W GVLEE +GV  VT EKFPN C W++++ I   + KE LP RD+L   +++
Sbjct  152  VVANAVALWFGVLEEVIGVVSVTSEKFPNFCDWRDEYYI---QNKEYLPSRDELFAHYQA  208



>ref|XP_004299558.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=224

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF DEK L A   A  A+GEE++K  +   E L  L++++E KKF GGE +G+ D
Sbjct  93   ARFWAKFADEKVLIAVWGAFTAEGEEKEKAIKSALEPLAYLEQQIEGKKFFGGEKIGYFD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            +   +++ W+ V+EE  G++L+  E+FP L  W ++F I    I+EC+PPR+KLV++F 
Sbjct  153  LVVGWLSQWLNVMEEVGGMKLLEAERFPLLHEWGQNF-IQAPAIRECIPPREKLVEYFH  210



>ref|XP_004160429.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
Length=224

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEK L  + +A  A+GEE++K  E   + L +LDKE++ KKF GGE +G+ D
Sbjct  93   ARFWAKFLDEKGLIGAWEACQAEGEEKEKAVEAAIQNLALLDKEIQGKKFFGGEQIGYLD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +A  ++  W+ VL+E   + +  +E+ P+L  W ++FI +   I+E LPPR+ LV++FK 
Sbjct  153  LAAGWICHWLNVLDEVGEMNVFDRERVPSLHEWAQNFIHV-PVIEESLPPRETLVNYFKG  211

Query  361  GF  366
              
Sbjct  212  SL  213



>ref|XP_003623196.1| Glutathione S-transferase [Medicago truncatula]
 gb|AES79414.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=224

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 80/123 (65%), Gaps = 3/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW KFID+KCL A+ KA F   E E++K  EE  E  ++L+ EL+ + F GGE +G  
Sbjct  97   ARFWTKFIDDKCLSAARKAAFTIDEKEREKAIEETEEAFQVLENELK-ETFFGGEEIGIV  155

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA  F+AFW  +++EA  + L T EKFP L +W +DF      +K+ LPPR+ L+ +FK
Sbjct  156  DIAAVFIAFWFPIVQEATNLNLFTSEKFPKLYKWSQDF-TNHPIVKDKLPPREGLLTYFK  214

Query  358  SGF  366
            + +
Sbjct  215  ARY  217



>ref|XP_002275435.3| PREDICTED: glutathione S-transferase U8 [Vitis vinifera]
 emb|CAN63896.1| hypothetical protein VITISV_041660 [Vitis vinifera]
Length=221

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK+IDEKCLPA   A + + ++++K  EE    L+ L+ EL+ KKF GGE++GF D
Sbjct  94   ARFWAKYIDEKCLPALWNACWCEKKDREKAVEEANVGLETLENELKDKKFFGGESIGFVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ FWVGVLEE +GVEL+T +KFP LC+W++++ + C  IKE LP ++KL  +F++
Sbjct  154  IAANFIGFWVGVLEEVVGVELLTIDKFPILCKWRDEY-VGCSGIKENLPSKEKLGAYFRT  212



>ref|XP_004971273.1| PREDICTED: probable glutathione S-transferase-like [Setaria italica]
Length=228

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+F+D+KC      +L+ +GE Q+   +E+ E LK+L+ +++ K+F GG+ VG+ D
Sbjct  95   ARFWARFLDDKCSTPFWLSLWTEGEVQEGFVKEIKENLKLLEGQVKGKRFFGGDAVGYLD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA +  A W+ VLEE  GV LVT E+FP+LCRW +++    + +K+CLP R+KL+  F +
Sbjct  155  IAASGFAHWLPVLEEVAGVSLVTDEEFPDLCRWGQEY-ASHEVVKQCLPDREKLLARFTA  213



>ref|XP_002275539.1| PREDICTED: glutathione S-transferase U8 [Vitis vinifera]
Length=221

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAK+IDEKCLPA   A + + ++++K  EE    LK L+ EL+ KKF GGE++GF D
Sbjct  94   ARFWAKYIDEKCLPALWNACWCEKKDREKAVEEANVCLKTLENELKDKKFFGGESIGFVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA NF+ FWVGVL E +GVEL+T +KFP LC+W++++ + C  IKE LP ++KL  + ++
Sbjct  154  IAANFIGFWVGVLGEVVGVELLTIDKFPILCKWRDEY-VGCSVIKENLPSKEKLGAYLRT  212



>ref|XP_010060069.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW66601.1| hypothetical protein EUGRSUZ_F00396 [Eucalyptus grandis]
Length=225

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 74/122 (61%), Gaps = 2/122 (2%)
 Frame = +1

Query  4    RFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFADI  183
            RFWAKF DEKC+PA       +GEEQ K   E  E LK L+  LE K F GGET+ FAD+
Sbjct  98   RFWAKFADEKCMPAMKAVFCTEGEEQQKAVLEARETLKTLESGLEGKLFFGGETINFADV  157

Query  184  AGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKSG  363
            A  ++  W  ++EE  G  L+  E  P+L  W + F+ +   IKEC+PP DKL++   SG
Sbjct  158  ATGYIGCWARIVEEITGTTLIDAESMPSLDAWSKRFLEL-PVIKECVPPWDKLIE-LNSG  215

Query  364  FI  369
            F+
Sbjct  216  FL  217



>ref|XP_010674216.1| PREDICTED: glutathione S-transferase U8-like [Beta vulgaris subsp. 
vulgaris]
Length=222

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 76/122 (62%), Gaps = 3/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKK--FLGGETVGF  174
            A FWA FIDEK   A   AL+   +E  +  EE  E L+ L+ EL+ KK  F GGE +GF
Sbjct  100  ALFWAIFIDEKLFRARKMALWGDEKESKEAMEETFECLRWLENELKVKKSKFFGGECIGF  159

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
             DI  N + FWVGV EE     ++ +E+FP L  W +DF + CD +KECLPPR+KL+  +
Sbjct  160  VDIVANGIGFWVGVQEEVTNKRMLVQERFPLLWDWAQDF-VSCDAVKECLPPREKLLALY  218

Query  355  KS  360
            ++
Sbjct  219  QA  220



>ref|XP_008793317.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=226

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW+ F+DEKC+PA   + + +G+ Q     +  E L IL+ EL+ KKF GG+ +G  D
Sbjct  95   ARFWSTFVDEKCIPAFWMSCWTEGDMQQNFMIQSKENLSILEGELKGKKFFGGDAIGMVD  154

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            IA  F+A W GVL+E  G+ L+ +EK P L +W E+F +    + ECLP R+ L+ +F++
Sbjct  155  IAAFFIAHWAGVLQEVAGISLINEEKHPILFKWIEEF-MSSSIVMECLPAREGLLAYFQA  213



>ref|XP_009347672.1| PREDICTED: glutathione S-transferase U8-like [Pyrus x bretschneideri]
Length=224

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF DEK +P    A   +GE Q+K KE V E L +L+K++E KKF GGE +G+ D
Sbjct  93   ARFWAKFNDEKLVPPVWTACTGEGEAQEKAKESVLESLALLEKQIEGKKFFGGEQIGYLD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +   ++++W+  +EEA G +++  E FP+L +W ++F I    I+EC+P R+  V + + 
Sbjct  153  LVLGWISYWISAVEEAGGNKVLEAEMFPSLHQWGQNF-IHTTLIEECIPAREAFVAYVQY  211

Query  361  GFI  369
              I
Sbjct  212  AII  214



>gb|AGH14251.1| glutathione S-transferase [Musa acuminata AAA Group]
Length=224

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = +1

Query  4    RFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFADI  183
            RFW++F+D+KC  A   + + +GE Q    E+  E L +L++EL+ KKF GG+++G  DI
Sbjct  95   RFWSRFLDDKCSLALWMSCWTEGETQQNFMEQAKECLHLLEEELKGKKFFGGDSIGMVDI  154

Query  184  AGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            A +F+A W+GVLEE  G+ L+ +EK+PNLC+W E+F +  D + ECLP R  L+ FF++
Sbjct  155  AASFIAHWLGVLEEVAGISLLDEEKYPNLCKWTEEF-LKSDAVMECLPKRANLLAFFQA  212



>ref|XP_008448766.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=222

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 82/120 (68%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKAL-FAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFWAK+ID+K + A  KA   +K EE++K  EE  E L+ L+KEL+ KKF GG  +GF 
Sbjct  98   ARFWAKYIDDKVVAAILKAAKSSKREEREKGLEETEETLEPLEKELQNKKFFGGNKIGFV  157

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DI G  +A+W+  +EEA G E++T +KFPNL +W E+ I+    +K+ LPP+  LV +F+
Sbjct  158  DIVGTVIAYWIPAIEEAFGFEVLTTKKFPNLTKWSEE-IVNQSVVKQVLPPKSNLVAYFQ  216



>gb|AEJ33772.1| glutathione S-transferase-like protein [Solanum habrochaites]
Length=217

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 82/120 (68%), Gaps = 4/120 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF ++K  P+  K+LF KGEEQ+K KEEV E+LKILD EL+ KKF  G   GF D
Sbjct  93   ARFWAKFFEDKW-PSMMKSLFFKGEEQEKGKEEVNEMLKILDNELKDKKFFVGNNFGFVD  151

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +  N VA W GVLEE +GV  VT EKFPN C W++ + I   + KE LP RD+L   +++
Sbjct  152  VVANAVALWFGVLEEVIGVVSVTSEKFPNFCDWRDGYYI---QNKEYLPSRDELFAHYQA  208



>gb|ADB11358.1| tau class glutathione transferase GSTU26 [Populus trichocarpa]
Length=225

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGG-ETVGFA  177
            ARFWAKF +EKCL  +  A + +GEE++K  E   E    L+K+++ KKF  G + +G+ 
Sbjct  93   ARFWAKFAEEKCLMGAFAAFWKEGEEKEKAIESALESFTFLEKQIQGKKFFSGDDNIGYL  152

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
            D+   ++  W+ V+EEA G++L+  +KFP L  W ++FI I   IKECLPPRD LV++F
Sbjct  153  DLVMGWIPLWLNVMEEAGGMKLMDAQKFPFLHEWTQNFIEI-PLIKECLPPRDALVNYF  210



>ref|NP_001237856.1| uncharacterized protein LOC100500680 [Glycine max]
 gb|ACU15822.1| unknown [Glycine max]
Length=225

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K   A+ K++F   E E++K  EE  E L+ L+ EL+  KF GGE  G  
Sbjct  97   ARFWSKFIDDKVFGAAWKSVFTLDEKEREKNVEESLEALQFLENELKDNKFFGGEEFGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKL  342
            DIA  F+AFW+ + +E  G+++ T EKFP L +W ++F +    +KE LPPRD L
Sbjct  157  DIAAIFIAFWIPIFQEIAGLQIFTSEKFPKLYKWSQEF-MSHPVVKEVLPPRDPL  210



>gb|ABD83308.1| Fgenesh protein 133 [Beta vulgaris]
Length=223

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 76/124 (61%), Gaps = 0/124 (0%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
             RFWAKFI EK  PA   A+   GE+ +K+ EE+ ELL IL+KE++ KKF+GG    + D
Sbjct  93   TRFWAKFIAEKITPAVRDAMLIPGEDAEKKTEELIELLHILEKEIKEKKFVGGNRNKYMD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I   +V  W+ +L+E     ++T+EKFP +  W +  ++ C +I E LP ++K+ D  + 
Sbjct  153  IVSLYVIHWIPILQEYSSKHVLTREKFPGIYDWIDQVLLDCGDIMENLPDKNKMFDVLRV  212

Query  361  GFIP  372
             F P
Sbjct  213  IFGP  216



>ref|XP_006645389.1| PREDICTED: probable glutathione S-transferase-like [Oryza brachyantha]
Length=232

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA+FID+KC      AL+ +GE Q+  K E+ E L +++ +L  K+F GG+ +G+ D
Sbjct  99   ARFWARFIDDKCTKPFWLALWTEGEAQEGFKREIKENLALMEGQLRGKRFFGGDAIGYLD  158

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            +A +  A+W+ V EE  GV LVT +++P+LCRW +++      +K CLP R KL+  F +
Sbjct  159  VAASGYAYWLEVFEEVAGVSLVTADEYPDLCRWAKEYASD-GRVKGCLPDRAKLLAHFTA  217



>ref|XP_004507183.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=225

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 84/123 (68%), Gaps = 3/123 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFA-KGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+KCLPA +KA +    EE++K  EE  + L+ L+ EL+  KF GG  +   
Sbjct  97   ARFWSKFIDDKCLPAISKAAWTVNKEEREKGIEESLQALQFLENELK-HKFFGGVNINIV  155

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            DIA +++AFW+ ++EEA+G++ ++  KFP L +W ++F I    +K  LPP++ ++ FFK
Sbjct  156  DIAASYLAFWLPLVEEAIGLKFLSSGKFPKLYKWSQEF-INHPIVKANLPPKEGILGFFK  214

Query  358  SGF  366
            S +
Sbjct  215  SRY  217



>gb|EYU40236.1| hypothetical protein MIMGU_mgv1a020023mg [Erythranthe guttata]
Length=226

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 82/122 (67%), Gaps = 1/122 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWAKF+DEKC+P+  +A   +G++++       + L++++K++E K+F GGE +G+ D
Sbjct  93   ARFWAKFVDEKCVPSVWEAARLEGDKKEAAIVSAKQTLQLVEKQIEGKRFFGGEQLGYLD  152

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I   ++  W+G +EEA G++L+  E+FP+LC W  +F ++   I E LPP+  +V +F+ 
Sbjct  153  IVMGWMCLWLGAMEEAGGMKLLDSEEFPSLCEWILNFTMV-PTIHESLPPKQNVVKYFQF  211

Query  361  GF  366
            G 
Sbjct  212  GL  213



>ref|XP_006488417.1| PREDICTED: glutathione S-transferase U7-like [Citrus sinensis]
Length=222

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW KFIDEK L    KA FA+G+E++   EE  + ++ L+ EL  K F GGET+GF D
Sbjct  94   ARFWGKFIDEKVLATRMKANFAEGKERELVTEEFFQQMEFLENELNGKDFFGGETIGFVD  153

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I    VA W  + +E LGV+  T+EKFP L +W    I   D + EC PPR+K + + K+
Sbjct  154  IVAIVVAIWFPLTQEVLGVDTFTEEKFPVLFKWIRK-ITEIDVVNECRPPREKHLAYVKA  212



>ref|XP_004492381.1| PREDICTED: glutathione S-transferase L2, chloroplastic-like [Cicer 
arietinum]
Length=460

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 82/124 (66%), Gaps = 4/124 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRK--EEVCELLKILDKELETKKFLGGETVGF  174
             RFW+KFID+K + +S KA+F   +E+++ K  EE  E LKIL+ EL+ K F GGE  GF
Sbjct  330  TRFWSKFIDDKIVSSSFKAVFTVDDEKEREKNVEESSEALKILENELKDK-FFGGEEFGF  388

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
             DIA  F+AFW+ ++++  G++L T EK+P L  W ++F +    +KE LPPR+ L  FF
Sbjct  389  VDIAAVFIAFWIPLVQDITGLQLFTAEKYPKLHNWSQEF-LNHPVVKENLPPREPLFAFF  447

Query  355  KSGF  366
            K  +
Sbjct  448  KGRY  451


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 72/117 (62%), Gaps = 7/117 (6%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQ-DKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+KC+ A+ K++F   E+Q +K +EE+ E L+ L+ EL+  KF GGE +GF 
Sbjct  115  ARFWSKFIDDKCVAAAWKSVFMVDEKQREKAREELLEALQFLENELKD-KFFGGEDIGFV  173

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVD  348
            DIA  F+  +  V E     +L T + FP L +W  +F      + E +P +D+ ++
Sbjct  174  DIAALFIPLFQQVAE----FQLFTSDNFPKLYKWSLEF-YNHPVVNEIMPSKDQHLN  225



>gb|ACU24385.1| unknown [Glycine max]
Length=206

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 74/111 (67%), Gaps = 2/111 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGE-EQDKRKEEVCELLKILDKELETKKFLGGETVGFA  177
            ARFW+KFID+K   AS KA+F   E E++K  EE  + L+ L+ E++ KKF GGE +G  
Sbjct  97   ARFWSKFIDDKVFGASWKAVFTADEKEREKNVEEAIDALQFLENEIKDKKFFGGEEIGLV  156

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPP  330
            DIA  ++AFWV +++E  G+EL T EKFP L  W ++F +    +KE LPP
Sbjct  157  DIAAVYIAFWVPMVQEIAGLELFTSEKFPKLHNWSQEF-LNHPIVKESLPP  206



>ref|XP_002520480.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41893.1| glutathione s-transferase, putative [Ricinus communis]
Length=225

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 79/124 (64%), Gaps = 3/124 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETK--KFLGGETVGF  174
            ARFWA+F+DEK LP + K   A  EE+DK   EV E LK+L+ EL+ K  +F GG  +G+
Sbjct  95   ARFWARFVDEKLLPTTFKIECAIKEEKDKIIHEVHEHLKLLEHELKHKEHEFFGGLELGY  154

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
             DI   F+  WV V +E + ++L+T+EK+P  C+W      I D +  CLPP++K + FF
Sbjct  155  LDIVTFFIGHWVQVHQEVMEIDLITEEKYPFFCKWMVKLHKI-DIVHGCLPPKEKHIAFF  213

Query  355  KSGF  366
            K+ F
Sbjct  214  KAHF  217



>ref|XP_006424951.1| hypothetical protein CICLE_v10030408mg, partial [Citrus clementina]
 gb|ESR38191.1| hypothetical protein CICLE_v10030408mg, partial [Citrus clementina]
Length=228

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW KFIDEK L    KA FA+G+E++   EE  + ++ L+ EL  K F GGET+GF D
Sbjct  100  ARFWGKFIDEKVLATRMKANFAEGKERELVTEEFFQQMEFLENELNGKDFFGGETIGFVD  159

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFKS  360
            I    VA W  + +E LGV+  T+EKFP L +W    I   D + EC PPR+K + + K+
Sbjct  160  IVAIVVAIWFPLTQEVLGVDTFTEEKFPVLFKWIRK-ITEIDVVNECRPPREKHLAYVKA  218



>ref|XP_002520478.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41891.1| glutathione s-transferase, putative [Ricinus communis]
Length=223

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 76/124 (61%), Gaps = 2/124 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFW  F+DEK L  + K   AK EE ++  +E+ + +K+L+ ELE K+F GGE +G  D
Sbjct  94   ARFWTNFVDEKILQTAKKTRTAKAEELEQLHQEIYQDMKLLESELEGKEFFGGEKIGQVD  153

Query  181  IAGNFVAFWVGVLEEA-LGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I    + +W  V+ +  L  E +++EKFP L +W      I D IKECLPPRDK V + K
Sbjct  154  IVAFVILYWFHVMSQGVLQTEFISEEKFPVLHKWMAKLCEI-DAIKECLPPRDKHVAYMK  212

Query  358  SGFI  369
            + F+
Sbjct  213  ARFV  216



>gb|EAY79123.1| hypothetical protein OsI_34229 [Oryza sativa Indica Group]
Length=238

 Score =   104 bits (260),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 82/122 (67%), Gaps = 3/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAK--GEEQDKRKEEVCELLKILDKELETKKFLGGETVGF  174
            ARFWA+FID+KC      AL++   GE ++    E+ E LK+L+ +L+ ++F GG+ +G+
Sbjct  103  ARFWARFIDDKCTKPFWLALWSTNDGEVREGFAAEIKENLKLLEAQLKGRRFFGGDAIGY  162

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
             D+A +  A+W+ VLEE  GV LVT ++FP+LCRW +++    D IK CLP R KL++ F
Sbjct  163  LDLAASGYAYWLEVLEEVAGVSLVTGDEFPDLCRWAKEY-AADDRIKACLPDRAKLLEHF  221

Query  355  KS  360
             +
Sbjct  222  TA  223



>ref|XP_010064229.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
Length=205

 Score =   103 bits (258),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 71/117 (61%), Gaps = 1/117 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            A FWAKF+D KC+PA      +KGEEQ K   +  E LK L+  LE K F GGET+ FAD
Sbjct  77   AHFWAKFVDAKCMPAVMAMFSSKGEEQQKAVLQARESLKTLESGLEGKPFFGGETINFAD  136

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDF  351
            +A  ++  W  ++EE     L+  EK P+L  W + F+ +   IKEC+PP DKL++ 
Sbjct  137  VATGWIGCWARIVEEITSTSLIDAEKMPSLDAWFKRFLDV-PVIKECMPPWDKLIEL  192



>ref|NP_001045406.1| Os01g0950300 [Oryza sativa Japonica Group]
 dbj|BAB86200.1| putative glutathione S-transferase [Oryza sativa Japonica Group]
 dbj|BAF07320.1| Os01g0950300 [Oryza sativa Japonica Group]
 gb|EAZ14840.1| hypothetical protein OsJ_04767 [Oryza sativa Japonica Group]
Length=238

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 82/122 (67%), Gaps = 3/122 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAK--GEEQDKRKEEVCELLKILDKELETKKFLGGETVGF  174
            ARFWA+FID+KC      AL++   GE ++    E+ E LK+L+ +L+ ++F GG+ +G+
Sbjct  103  ARFWARFIDDKCTKPFWLALWSTDDGEVREGFAAEIKENLKLLEAQLKGRRFFGGDAIGY  162

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
             D+A +  A+W+ VLEE  GV LVT ++FP+LCRW +++    D IK CLP R KL++ F
Sbjct  163  LDLAASGYAYWLEVLEEVAGVSLVTGDEFPDLCRWAKEY-AADDRIKACLPDRAKLLEHF  221

Query  355  KS  360
             +
Sbjct  222  TA  223



>ref|XP_006376726.1| hypothetical protein POPTR_0012s04780g [Populus trichocarpa]
 gb|ERP54523.1| hypothetical protein POPTR_0012s04780g [Populus trichocarpa]
Length=225

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGG-ETVGFA  177
            ARFWAKF DEKC+  +  A   +GEE++K  E   E    L+K+++ KKF  G + +G+ 
Sbjct  93   ARFWAKFADEKCVMGAFVAFLKEGEEKEKAIESALESFTFLEKQIQGKKFFSGDDNIGYL  152

Query  178  DIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            D+   ++  W+  +EEA G++L+  +KFP+L  W ++FI I   IKEC PPRD LV++F 
Sbjct  153  DLVMGWIPHWLNAIEEAGGMKLMDAQKFPSLHEWTQNFIEI-PLIKECFPPRDALVNYFN  211



>ref|XP_002520473.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41886.1| glutathione s-transferase, putative [Ricinus communis]
Length=242

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 73/119 (61%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRKEEVCELLKILDKELETKKFLGGETVGFAD  180
            ARFWA F DE  L  + K+  AKGEE++K  +EVC+ LK+L+ EL  K+F GG+ +G+ D
Sbjct  117  ARFWANFADENILQTAIKSSKAKGEEREKLWDEVCQNLKLLENELNGKQFFGGKNIGYLD  176

Query  181  IAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFFK  357
            I    +  W  V  E   +EL+T+E FP L +W E    I D +KE LPPRDK +   +
Sbjct  177  IVAFSLVHWFQVANEVTQMELITEENFPGLLKWTEKMGDI-DVVKETLPPRDKHLALIR  234



>ref|XP_003623210.1| Glutathione S-transferase GST [Medicago truncatula]
 gb|AES79428.1| glutathione S-transferase [Medicago truncatula]
Length=226

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 84/124 (68%), Gaps = 4/124 (3%)
 Frame = +1

Query  1    ARFWAKFIDEKCLPASTKALFAKGEEQDKRK--EEVCELLKILDKELETKKFLGGETVGF  174
            ARFW+KFID+K + +S KA++A  +E++++K  EE  E L+IL+ EL+ K F GGE + F
Sbjct  97   ARFWSKFIDDKIVTSSFKAVYAVNDEKERQKNVEESTEALQILENELKNKYF-GGEEINF  155

Query  175  ADIAGNFVAFWVGVLEEALGVELVTKEKFPNLCRWKEDFIIICDEIKECLPPRDKLVDFF  354
             DIA  F+AFW+ ++++   ++L   EK+P L +W ++F +    +KE +P RD L  FF
Sbjct  156  VDIAAVFIAFWIPLIQDIAELKLFNAEKYPKLYKWSQEF-LNHPAVKEHVPARDPLFAFF  214

Query  355  KSGF  366
            K+ +
Sbjct  215  KAKY  218



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669965605652