BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c43667_g1_i1 len=454 path=[432:0-453]

Length=454
                                                                      Score     E

ref|XP_009340879.1|  PREDICTED: secoisolariciresinol dehydrogenas...    189   1e-56   
ref|XP_008229660.1|  PREDICTED: secoisolariciresinol dehydrogenas...    188   5e-56   
ref|XP_009374964.1|  PREDICTED: secoisolariciresinol dehydrogenas...    187   1e-55   
ref|XP_006383023.1|  hypothetical protein POPTR_0005s10820g             183   3e-55   
ref|XP_011022234.1|  PREDICTED: secoisolariciresinol dehydrogenas...    184   8e-55   
ref|XP_009340877.1|  PREDICTED: secoisolariciresinol dehydrogenas...    184   1e-54   
ref|XP_011006635.1|  PREDICTED: secoisolariciresinol dehydrogenas...    184   1e-54   
ref|XP_004506207.1|  PREDICTED: momilactone A synthase-like             183   2e-54   
ref|XP_008230130.1|  PREDICTED: secoisolariciresinol dehydrogenas...    184   2e-54   
ref|XP_007207105.1|  hypothetical protein PRUPE_ppa020955mg             183   2e-54   
ref|XP_009773000.1|  PREDICTED: secoisolariciresinol dehydrogenas...    183   3e-54   
ref|XP_002272206.1|  PREDICTED: secoisolariciresinol dehydrogenas...    183   4e-54   Vitis vinifera
ref|XP_007207752.1|  hypothetical protein PRUPE_ppa027184mg             185   4e-54   
ref|XP_006384778.1|  hypothetical protein POPTR_0004s21020g             184   5e-54   
ref|XP_008229671.1|  PREDICTED: secoisolariciresinol dehydrogenas...    182   5e-54   
ref|XP_006388114.1|  alcohol dehydroge family protein                   182   1e-53   
ref|XP_007206815.1|  hypothetical protein PRUPE_ppa025923mg             181   2e-53   
ref|XP_003540812.1|  PREDICTED: secoisolariciresinol dehydrogenase      181   3e-53   
ref|XP_009340878.1|  PREDICTED: secoisolariciresinol dehydrogenas...    181   4e-53   
ref|XP_002523859.1|  short chain alcohol dehydrogenase, putative        180   4e-53   Ricinus communis
ref|XP_007206370.1|  hypothetical protein PRUPE_ppa017863mg             179   9e-53   
ref|XP_011006647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    179   1e-52   
ref|XP_004506206.1|  PREDICTED: momilactone A synthase-like             179   2e-52   
gb|KDP34634.1|  hypothetical protein JCGZ_11952                         178   3e-52   
ref|XP_009605456.1|  PREDICTED: secoisolariciresinol dehydrogenas...    177   4e-52   
ref|XP_010651861.1|  PREDICTED: secoisolariciresinol dehydrogenas...    177   8e-52   
ref|XP_010651860.1|  PREDICTED: secoisolariciresinol dehydrogenas...    177   8e-52   
ref|XP_008246119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    176   1e-51   
ref|XP_006368128.1|  PREDICTED: secoisolariciresinol dehydrogenas...    173   1e-51   
emb|CDP06869.1|  unnamed protein product                                176   1e-51   
gb|AFK37606.1|  unknown                                                 176   2e-51   
gb|AEC10992.1|  alcohol dehydrogenase                                   176   3e-51   
gb|KEH29814.1|  short-chain dehydrogenase/reductase                     175   4e-51   
gb|KEH29817.1|  short-chain dehydrogenase/reductase                     175   4e-51   
gb|KEH29815.1|  short-chain dehydrogenase/reductase                     174   7e-51   
gb|AFK35915.1|  unknown                                                 174   7e-51   
emb|CDP06868.1|  unnamed protein product                                174   1e-50   
emb|CDP06870.1|  unnamed protein product                                174   1e-50   
emb|CBI28275.3|  unnamed protein product                                182   1e-50   
ref|XP_006362152.1|  PREDICTED: secoisolariciresinol dehydrogenas...    173   1e-50   
ref|XP_009605454.1|  PREDICTED: secoisolariciresinol dehydrogenas...    173   2e-50   
gb|AFK46966.1|  unknown                                                 173   3e-50   
ref|XP_003539841.1|  PREDICTED: secoisolariciresinol dehydrogenase      173   4e-50   
gb|ACU18308.1|  unknown                                                 172   4e-50   Glycine max [soybeans]
ref|XP_010324818.1|  PREDICTED: secoisolariciresinol dehydrogenas...    172   5e-50   
ref|XP_010262932.1|  PREDICTED: secoisolariciresinol dehydrogenas...    172   5e-50   
ref|XP_007132473.1|  hypothetical protein PHAVU_011G097000g             172   6e-50   
gb|KDP26161.1|  hypothetical protein JCGZ_22863                         172   6e-50   
ref|XP_004244887.1|  PREDICTED: secoisolariciresinol dehydrogenas...    172   7e-50   
ref|XP_009605455.1|  PREDICTED: secoisolariciresinol dehydrogenas...    171   8e-50   
ref|XP_006367118.1|  PREDICTED: secoisolariciresinol dehydrogenas...    171   2e-49   
emb|CDP06872.1|  unnamed protein product                                172   3e-49   
ref|XP_003540813.1|  PREDICTED: secoisolariciresinol dehydrogenas...    170   3e-49   
ref|NP_001239862.1|  uncharacterized protein LOC100794412               169   7e-49   
gb|KHN21176.1|  Momilactone A synthase                                  169   8e-49   
ref|XP_006384780.1|  alcohol dehydroge family protein                   169   9e-49   
ref|XP_007132471.1|  hypothetical protein PHAVU_011G096800g             169   1e-48   
dbj|BAA13541.1|  CPRD12 protein                                         169   1e-48   Vigna unguiculata
ref|XP_010246244.1|  PREDICTED: secoisolariciresinol dehydrogenas...    169   2e-48   
gb|KHN21175.1|  Momilactone A synthase                                  169   2e-48   
gb|KHN21177.1|  Momilactone A synthase                                  169   3e-48   
ref|XP_007132475.1|  hypothetical protein PHAVU_011G097200g             167   4e-48   
ref|XP_011006659.1|  PREDICTED: momilactone A synthase-like             167   7e-48   
ref|XP_003538100.1|  PREDICTED: secoisolariciresinol dehydrogenase      167   7e-48   
ref|XP_006367119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    166   8e-48   
gb|ACU18273.1|  unknown                                                 167   8e-48   Glycine max [soybeans]
ref|XP_010246807.1|  PREDICTED: secoisolariciresinol dehydrogenas...    166   2e-47   
gb|KHN11533.1|  Momilactone A synthase                                  165   2e-47   
ref|XP_006481515.1|  PREDICTED: secoisolariciresinol dehydrogenas...    165   5e-47   
ref|XP_006424145.1|  hypothetical protein CICLE_v10029347mg             162   5e-47   
ref|XP_006481514.1|  PREDICTED: secoisolariciresinol dehydrogenas...    165   5e-47   
gb|KDO58270.1|  hypothetical protein CISIN_1g044923mg                   163   5e-47   
emb|CAN68176.1|  hypothetical protein VITISV_014635                     164   7e-47   Vitis vinifera
ref|XP_010049792.1|  PREDICTED: secoisolariciresinol dehydrogenas...    164   9e-47   
ref|XP_003546632.1|  PREDICTED: secoisolariciresinol dehydrogenas...    164   1e-46   
ref|XP_010070261.1|  PREDICTED: secoisolariciresinol dehydrogenas...    163   2e-46   
ref|XP_006424148.1|  hypothetical protein CICLE_v10029025mg             163   2e-46   
gb|KCW83009.1|  hypothetical protein EUGRSUZ_C04391                     163   3e-46   
ref|XP_006424147.1|  hypothetical protein CICLE_v10029025mg             163   3e-46   
ref|XP_010051779.1|  PREDICTED: secoisolariciresinol dehydrogenas...    163   5e-46   
ref|XP_009388139.1|  PREDICTED: momilactone A synthase-like             161   5e-46   
gb|KCW45306.1|  hypothetical protein EUGRSUZ_L01036                     160   5e-46   
dbj|BAC53872.1|  alcohol dehydroge                                      162   6e-46   Phaseolus lunatus
ref|XP_006481516.1|  PREDICTED: secoisolariciresinol dehydrogenas...    162   7e-46   
ref|XP_010691689.1|  PREDICTED: secoisolariciresinol dehydrogenas...    161   7e-46   
ref|XP_002272549.1|  PREDICTED: secoisolariciresinol dehydrogenas...    161   1e-45   Vitis vinifera
ref|XP_007152489.1|  hypothetical protein PHAVU_004G135000g             161   1e-45   
ref|XP_007152499.1|  hypothetical protein PHAVU_004G135300g             161   1e-45   
ref|XP_002275746.2|  PREDICTED: secoisolariciresinol dehydrogenas...    161   1e-45   Vitis vinifera
ref|XP_002272838.1|  PREDICTED: secoisolariciresinol dehydrogenas...    161   1e-45   Vitis vinifera
ref|XP_010040330.1|  PREDICTED: secoisolariciresinol dehydrogenas...    160   1e-45   
ref|XP_010050120.1|  PREDICTED: secoisolariciresinol dehydrogenas...    160   2e-45   
gb|KCW83006.1|  hypothetical protein EUGRSUZ_C04389                     160   2e-45   
ref|XP_007132474.1|  hypothetical protein PHAVU_011G097100g             160   2e-45   
gb|ACU19531.1|  unknown                                                 160   2e-45   Glycine max [soybeans]
ref|XP_006481517.1|  PREDICTED: secoisolariciresinol dehydrogenas...    160   2e-45   
ref|XP_010040326.1|  PREDICTED: secoisolariciresinol dehydrogenas...    160   3e-45   
emb|CBI28276.3|  unnamed protein product                                161   4e-45   
ref|XP_010691680.1|  PREDICTED: secoisolariciresinol dehydrogenas...    159   4e-45   
gb|EYU18087.1|  hypothetical protein MIMGU_mgv1a0119322mg               156   6e-45   
gb|AFV30207.1|  borneol dehydrogenase                                   159   8e-45   
ref|XP_010917564.1|  PREDICTED: momilactone A synthase-like             158   1e-44   
gb|KDP36160.1|  hypothetical protein JCGZ_08804                         159   1e-44   
ref|XP_002323404.1|  alcohol dehydroge family protein                   158   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_010917565.1|  PREDICTED: momilactone A synthase-like isofo...    157   3e-44   
ref|XP_010049793.1|  PREDICTED: secoisolariciresinol dehydrogenas...    157   4e-44   
ref|XP_009411944.1|  PREDICTED: momilactone A synthase-like             156   1e-43   
ref|XP_002308448.2|  alcohol dehydroge family protein                   156   1e-43   Populus trichocarpa [western balsam poplar]
gb|KDP36168.1|  hypothetical protein JCGZ_08812                         156   1e-43   
gb|KDP34947.1|  hypothetical protein JCGZ_09235                         154   1e-43   
ref|XP_011043648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    155   2e-43   
gb|KDP34949.1|  hypothetical protein JCGZ_09237                         155   3e-43   
gb|KDP34951.1|  hypothetical protein JCGZ_09239                         154   3e-43   
ref|XP_009399160.1|  PREDICTED: momilactone A synthase-like             155   3e-43   
gb|KDP36156.1|  hypothetical protein JCGZ_08800                         154   4e-43   
ref|XP_008462605.1|  PREDICTED: secoisolariciresinol dehydrogenas...    154   7e-43   
ref|XP_010246229.1|  PREDICTED: secoisolariciresinol dehydrogenas...    154   7e-43   
ref|XP_010262933.1|  PREDICTED: secoisolariciresinol dehydrogenas...    154   9e-43   
gb|ADK56099.1|  alcohol dehydrogenase                                   153   1e-42   
gb|KDP36159.1|  hypothetical protein JCGZ_08803                         153   1e-42   
gb|KCW58914.1|  hypothetical protein EUGRSUZ_H01537                     152   2e-42   
gb|KDP36157.1|  hypothetical protein JCGZ_08801                         152   2e-42   
ref|XP_009420509.1|  PREDICTED: momilactone A synthase-like             152   2e-42   
gb|KCW90500.1|  hypothetical protein EUGRSUZ_A02619                     153   2e-42   
emb|CBI30355.3|  unnamed protein product                                150   2e-42   
ref|XP_003553613.1|  PREDICTED: secoisolariciresinol dehydrogenase      152   3e-42   
gb|KDP36165.1|  hypothetical protein JCGZ_08809                         154   3e-42   
ref|XP_010059374.1|  PREDICTED: secoisolariciresinol dehydrogenas...    154   3e-42   
ref|XP_007043248.1|  Short chain alcohol dehydrogenase                  152   4e-42   
gb|KDP36095.1|  hypothetical protein JCGZ_08739                         152   4e-42   
ref|XP_004139501.1|  PREDICTED: zerumbone synthase-like                 152   5e-42   
ref|XP_010246256.1|  PREDICTED: secoisolariciresinol dehydrogenas...    152   5e-42   
ref|XP_010246261.1|  PREDICTED: secoisolariciresinol dehydrogenas...    152   5e-42   
ref|XP_011094346.1|  PREDICTED: secoisolariciresinol dehydrogenas...    151   7e-42   
gb|EYU26737.1|  hypothetical protein MIMGU_mgv1a011831mg                151   9e-42   
gb|KEH24184.1|  short-chain dehydrogenase/reductase                     149   9e-42   
gb|AFK45740.1|  unknown                                                 151   1e-41   
ref|XP_011094266.1|  PREDICTED: secoisolariciresinol dehydrogenas...    151   1e-41   
ref|XP_011046902.1|  PREDICTED: secoisolariciresinol dehydrogenas...    150   1e-41   
ref|XP_002275723.3|  PREDICTED: secoisolariciresinol dehydrogenas...    150   1e-41   Vitis vinifera
dbj|BAE72096.1|  Lactuca sativa short-chain dehydrogenase/reducta...    150   1e-41   Lactuca sativa [cultivated lettuce]
ref|XP_011046907.1|  PREDICTED: secoisolariciresinol dehydrogenas...    150   1e-41   
ref|XP_011094267.1|  PREDICTED: secoisolariciresinol dehydrogenas...    150   1e-41   
ref|XP_002523206.1|  short chain alcohol dehydrogenase, putative        150   1e-41   Ricinus communis
ref|XP_011046906.1|  PREDICTED: secoisolariciresinol dehydrogenas...    150   2e-41   
gb|KDP36171.1|  hypothetical protein JCGZ_08815                         150   2e-41   
ref|XP_002530513.1|  short chain alcohol dehydrogenase, putative        149   2e-41   Ricinus communis
ref|XP_004305639.1|  PREDICTED: momilactone A synthase-like             150   2e-41   
ref|XP_002530176.1|  short chain alcohol dehydrogenase, putative        152   2e-41   Ricinus communis
gb|AAK83036.1|AF286651_1  TASSELSEED2-like protein                      150   2e-41   Cucumis sativus [cucumbers]
ref|XP_011043647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    150   2e-41   
ref|XP_010654129.1|  PREDICTED: secoisolariciresinol dehydrogenas...    150   2e-41   
gb|KDP36152.1|  hypothetical protein JCGZ_08796                         150   3e-41   
gb|KEH30870.1|  short-chain dehydrogenase/reductase                     146   3e-41   
ref|XP_006653365.1|  PREDICTED: momilactone A synthase-like             150   3e-41   
ref|XP_002526911.1|  short chain alcohol dehydrogenase, putative        150   3e-41   Ricinus communis
gb|KGN48288.1|  hypothetical protein Csa_6G454360                       150   3e-41   
ref|XP_002281352.1|  PREDICTED: secoisolariciresinol dehydrogenas...    150   3e-41   Vitis vinifera
emb|CBI30358.3|  unnamed protein product                                147   3e-41   
gb|KDP36172.1|  hypothetical protein JCGZ_08816                         150   3e-41   
gb|KDP36166.1|  hypothetical protein JCGZ_08810                         150   3e-41   
ref|XP_002309406.1|  putative short-chain alcohol dehydrogenase f...    149   3e-41   Populus trichocarpa [western balsam poplar]
gb|AAF98270.1|AF188188_1  sex determination protein                     145   4e-41   Cucumis sativus [cucumbers]
emb|CDP02837.1|  unnamed protein product                                151   4e-41   
ref|XP_004143392.1|  PREDICTED: zerumbone synthase-like                 149   4e-41   
ref|XP_004170965.1|  PREDICTED: zerumbone synthase-like                 149   4e-41   
gb|KDP34955.1|  hypothetical protein JCGZ_09243                         149   4e-41   
ref|XP_010059357.1|  PREDICTED: secoisolariciresinol dehydrogenas...    149   5e-41   
ref|XP_010104812.1|  Momilactone A synthase                             149   6e-41   
ref|XP_002530171.1|  short chain alcohol dehydrogenase, putative        149   8e-41   Ricinus communis
ref|XP_011094268.1|  PREDICTED: secoisolariciresinol dehydrogenas...    149   8e-41   
gb|KDP36096.1|  hypothetical protein JCGZ_08740                         148   8e-41   
ref|XP_002309402.2|  hypothetical protein POPTR_0006s22270g             148   1e-40   Populus trichocarpa [western balsam poplar]
emb|CBI30357.3|  unnamed protein product                                147   1e-40   
ref|XP_006338927.1|  PREDICTED: secoisolariciresinol dehydrogenas...    148   1e-40   
ref|XP_011046903.1|  PREDICTED: secoisolariciresinol dehydrogenas...    148   1e-40   
ref|XP_011043649.1|  PREDICTED: secoisolariciresinol dehydrogenas...    148   1e-40   
ref|XP_002309405.1|  alcohol dehydroge family protein                   148   2e-40   Populus trichocarpa [western balsam poplar]
gb|EPS74091.1|  hypothetical protein M569_00663                         149   2e-40   
ref|XP_011094269.1|  PREDICTED: secoisolariciresinol dehydrogenas...    147   2e-40   
ref|XP_010104809.1|  Momilactone A synthase                             147   2e-40   
ref|XP_002323403.1|  alcohol dehydroge family protein                   147   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010654128.1|  PREDICTED: secoisolariciresinol dehydrogenas...    147   2e-40   
ref|XP_002281290.1|  PREDICTED: secoisolariciresinol dehydrogenas...    147   2e-40   Vitis vinifera
dbj|BAE72097.1|  Lactuca sativa short-chain dehydrogenase/reducta...    147   3e-40   Lactuca sativa [cultivated lettuce]
ref|XP_009789920.1|  PREDICTED: xanthoxin dehydrogenase-like            147   3e-40   
gb|AAK83035.1|AF286650_1  CTA                                           147   3e-40   Cucumis sativus [cucumbers]
ref|XP_010654127.1|  PREDICTED: secoisolariciresinol dehydrogenas...    147   3e-40   
ref|XP_010104808.1|  Momilactone A synthase                             148   3e-40   
ref|XP_007162946.1|  hypothetical protein PHAVU_001G193500g             147   3e-40   
ref|XP_007027903.1|  Short chain alcohol dehydrogenase, putative        147   4e-40   
ref|XP_008798880.1|  PREDICTED: secoisolariciresinol dehydrogenas...    147   4e-40   
ref|XP_004975524.1|  PREDICTED: momilactone A synthase-like             147   4e-40   
ref|XP_007027908.1|  Short chain alcohol dehydrogenase, putative        147   4e-40   
ref|XP_006359043.1|  PREDICTED: xanthoxin dehydrogenase-like            147   5e-40   
gb|KHG10215.1|  hypothetical protein F383_13541                         146   7e-40   
ref|XP_004169912.1|  PREDICTED: short-chain dehydrogenase reducta...    146   8e-40   
emb|CDP20435.1|  unnamed protein product                                146   9e-40   
ref|XP_007202842.1|  hypothetical protein PRUPE_ppa014608mg             145   1e-39   
ref|XP_004136701.1|  PREDICTED: momilactone A synthase-like             145   1e-39   
ref|XP_002323405.1|  putative short-chain alcohol dehydrogenase f...    145   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_002524074.1|  short chain alcohol dehydrogenase, putative        144   1e-39   Ricinus communis
ref|XP_007043243.1|  Short chain alcohol dehydrogenase                  145   1e-39   
ref|XP_006430117.1|  hypothetical protein CICLE_v10012261mg             145   2e-39   
gb|KDO35956.1|  hypothetical protein CISIN_1g046809mg                   145   2e-39   
ref|XP_006481701.1|  PREDICTED: secoisolariciresinol dehydrogenas...    145   2e-39   
ref|XP_009626741.1|  PREDICTED: secoisolariciresinol dehydrogenas...    145   2e-39   
ref|XP_008243483.1|  PREDICTED: secoisolariciresinol dehydrogenas...    145   2e-39   
ref|XP_009387285.1|  PREDICTED: momilactone A synthase-like             144   3e-39   
sp|Q94KL7.1|SILD_FORIN  RecName: Full=Secoisolariciresinol dehydr...    144   3e-39   Forsythia x intermedia [cultivated forsythia]
gb|KDP37624.1|  hypothetical protein JCGZ_06967                         144   3e-39   
ref|XP_011089208.1|  PREDICTED: secoisolariciresinol dehydrogenas...    144   4e-39   
ref|XP_008243484.1|  PREDICTED: secoisolariciresinol dehydrogenas...    144   4e-39   
ref|XP_010104810.1|  Momilactone A synthase                             144   4e-39   
gb|ABS87381.1|  short-chain dehydrogenase/reductase protein             144   4e-39   Lactuca sativa [cultivated lettuce]
ref|XP_006430116.1|  hypothetical protein CICLE_v10012261mg             145   4e-39   
ref|XP_009631424.1|  PREDICTED: xanthoxin dehydrogenase-like            144   5e-39   
ref|XP_009349369.1|  PREDICTED: secoisolariciresinol dehydrogenas...    144   5e-39   
ref|XP_010059365.1|  PREDICTED: secoisolariciresinol dehydrogenas...    144   5e-39   
ref|XP_002513344.1|  short chain alcohol dehydrogenase, putative        144   5e-39   Ricinus communis
ref|XP_007027886.1|  NAD(P)-binding Rossmann-fold superfamily pro...    144   5e-39   
ref|XP_009618318.1|  PREDICTED: secoisolariciresinol dehydrogenas...    144   6e-39   
ref|XP_008392031.1|  PREDICTED: secoisolariciresinol dehydrogenas...    143   7e-39   
ref|XP_008360614.1|  PREDICTED: secoisolariciresinol dehydrogenas...    144   7e-39   
ref|XP_010061228.1|  PREDICTED: secoisolariciresinol dehydrogenas...    143   8e-39   
ref|XP_010061227.1|  PREDICTED: secoisolariciresinol dehydrogenas...    144   9e-39   
ref|XP_007027905.1|  Short chain alcohol dehydrogenase, putative        143   1e-38   
gb|ABD65462.1|  short chain alcohol dehydrogenase                       143   1e-38   Gossypium hirsutum [American cotton]
ref|XP_007162945.1|  hypothetical protein PHAVU_001G193400g             143   1e-38   
gb|KDP36155.1|  hypothetical protein JCGZ_08799                         143   1e-38   
ref|XP_002513332.1|  short chain alcohol dehydrogenase, putative        143   1e-38   Ricinus communis
ref|XP_007204705.1|  hypothetical protein PRUPE_ppa009636mg             143   1e-38   
ref|XP_009350131.1|  PREDICTED: secoisolariciresinol dehydrogenas...    143   1e-38   
gb|AHH81852.1|  short-chain alcohol dehydrogenase                       143   1e-38   
ref|XP_008351500.1|  PREDICTED: secoisolariciresinol dehydrogenas...    143   2e-38   
emb|CBI30352.3|  unnamed protein product                                142   2e-38   
ref|XP_009763487.1|  PREDICTED: secoisolariciresinol dehydrogenas...    142   2e-38   
gb|KDP32262.1|  hypothetical protein JCGZ_14783                         142   2e-38   
gb|KDP42340.1|  hypothetical protein JCGZ_02813                         142   2e-38   
gb|EYU18090.1|  hypothetical protein MIMGU_mgv1a010990mg                143   2e-38   
ref|XP_004139590.1|  PREDICTED: short-chain dehydrogenase reducta...    142   2e-38   
ref|XP_006428245.1|  hypothetical protein CICLE_v10012415mg             142   2e-38   
gb|ACJ84780.1|  unknown                                                 137   2e-38   Medicago truncatula
gb|KDP36170.1|  hypothetical protein JCGZ_08814                         142   3e-38   
ref|XP_002275768.1|  PREDICTED: tropinone reductase-like 1              142   3e-38   Vitis vinifera
gb|KDP25017.1|  hypothetical protein JCGZ_24000                         142   4e-38   
gb|KEH24173.1|  short-chain dehydrogenase/reductase                     141   4e-38   
ref|NP_001275796.1|  short chain alcohol dehydrogenase                  141   5e-38   
dbj|BAD93612.1|  hypothetical protein                                   139   5e-38   Cucumis melo [Oriental melon]
ref|XP_004237829.1|  PREDICTED: xanthoxin dehydrogenase-like            141   5e-38   
gb|KDO58269.1|  hypothetical protein CISIN_1g044485mg                   141   5e-38   
gb|AHH81851.1|  short-chain alcohol dehydrogenase                       141   5e-38   
ref|XP_009372539.1|  PREDICTED: secoisolariciresinol dehydrogenas...    141   5e-38   
ref|XP_006424146.1|  hypothetical protein CICLE_v10030340mg             141   6e-38   
ref|XP_006577090.1|  PREDICTED: secoisolariciresinol dehydrogenas...    141   7e-38   
gb|KDP22808.1|  hypothetical protein JCGZ_00395                         142   7e-38   
ref|XP_002530170.1|  short chain alcohol dehydrogenase, putative        141   7e-38   Ricinus communis
gb|KDP36167.1|  hypothetical protein JCGZ_08811                         140   8e-38   
ref|XP_004494228.1|  PREDICTED: momilactone A synthase-like             140   9e-38   
ref|NP_001150890.1|  sex determination protein tasselseed-2             142   1e-37   Zea mays [maize]
gb|ADB82907.1|  secoisolariciresinol dehydrogenase                      140   1e-37   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_010683811.1|  PREDICTED: tropinone reductase-like 1              141   1e-37   
ref|XP_002281462.1|  PREDICTED: secoisolariciresinol dehydrogenas...    140   1e-37   Vitis vinifera
ref|XP_003632648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    140   1e-37   
ref|NP_001052709.1|  Os04g0405300                                       140   1e-37   Oryza sativa Japonica Group [Japonica rice]
gb|AHH81853.1|  short-chain alcohol dehydrogenase                       140   1e-37   
ref|XP_003579668.1|  PREDICTED: momilactone A synthase-like             140   1e-37   
ref|XP_010101928.1|  Momilactone A synthase                             140   1e-37   
ref|XP_008669542.1|  PREDICTED: momilactone A synthase-like             140   1e-37   
ref|XP_009768564.1|  PREDICTED: secoisolariciresinol dehydrogenas...    140   1e-37   
ref|XP_011088939.1|  PREDICTED: secoisolariciresinol dehydrogenas...    140   2e-37   
ref|XP_009631422.1|  PREDICTED: xanthoxin dehydrogenase-like            140   2e-37   
ref|XP_004249781.1|  PREDICTED: secoisolariciresinol dehydrogenas...    140   2e-37   
gb|KHN33174.1|  Momilactone A synthase                                  140   2e-37   
ref|XP_008437356.1|  PREDICTED: zerumbone synthase-like                 140   2e-37   
ref|XP_002446247.1|  hypothetical protein SORBIDRAFT_06g009610          139   3e-37   Sorghum bicolor [broomcorn]
ref|XP_011046905.1|  PREDICTED: secoisolariciresinol dehydrogenas...    139   3e-37   
gb|KDP36151.1|  hypothetical protein JCGZ_08795                         139   3e-37   
ref|XP_009618308.1|  PREDICTED: secoisolariciresinol dehydrogenas...    139   3e-37   
ref|XP_007205611.1|  hypothetical protein PRUPE_ppa009084mg             140   3e-37   
emb|CBI18081.3|  unnamed protein product                                139   3e-37   
ref|XP_003554452.1|  PREDICTED: secoisolariciresinol dehydrogenase      139   3e-37   
ref|XP_009387234.1|  PREDICTED: momilactone A synthase-like             139   3e-37   
ref|XP_002533854.1|  short chain alcohol dehydrogenase, putative        139   4e-37   
ref|XP_006854737.1|  hypothetical protein AMTR_s00030p00244080          139   4e-37   
ref|XP_003554453.1|  PREDICTED: secoisolariciresinol dehydrogenas...    139   5e-37   
ref|XP_010104807.1|  Momilactone A synthase                             139   5e-37   
ref|XP_006854740.1|  hypothetical protein AMTR_s00030p00244570          139   5e-37   
gb|ACU23500.1|  unknown                                                 139   6e-37   
ref|XP_004228706.1|  PREDICTED: secoisolariciresinol dehydrogenas...    139   6e-37   
ref|XP_002265892.1|  PREDICTED: short-chain dehydrogenase reducta...    139   6e-37   
ref|XP_009611083.1|  PREDICTED: secoisolariciresinol dehydrogenas...    139   7e-37   
gb|ACJ83290.1|  unknown                                                 135   9e-37   
ref|XP_002309404.1|  alcohol dehydroge family protein                   138   9e-37   
ref|XP_002447766.1|  hypothetical protein SORBIDRAFT_06g015240          138   9e-37   
ref|XP_009605329.1|  PREDICTED: secoisolariciresinol dehydrogenas...    138   1e-36   
emb|CAA11153.1|  short chain alcohol dehydrogenase                      138   1e-36   
emb|CAN78993.1|  hypothetical protein VITISV_001799                     140   1e-36   
gb|EAZ30638.1|  hypothetical protein OsJ_14688                          138   1e-36   
ref|XP_008244807.1|  PREDICTED: short-chain dehydrogenase reducta...    138   1e-36   
ref|XP_007027881.1|  Short chain alcohol dehydrogenase                  137   1e-36   
ref|XP_009776711.1|  PREDICTED: secoisolariciresinol dehydrogenas...    138   1e-36   
ref|XP_002526345.1|  short chain alcohol dehydrogenase, putative        137   2e-36   
gb|AGY49282.1|  short chain alcohol dehydrogenase/reductase             137   2e-36   
ref|XP_006854739.1|  hypothetical protein AMTR_s00030p00244330          137   2e-36   
ref|XP_010024677.1|  PREDICTED: secoisolariciresinol dehydrogenas...    137   2e-36   
gb|KCW90498.1|  hypothetical protein EUGRSUZ_A02616                     137   2e-36   
ref|XP_004136700.1|  PREDICTED: momilactone A synthase-like             137   3e-36   
ref|XP_010999596.1|  PREDICTED: xanthoxin dehydrogenase isoform X2      137   3e-36   
ref|XP_003538228.1|  PREDICTED: xanthoxin dehydrogenase-like            137   3e-36   
gb|ACU19262.1|  unknown                                                 137   3e-36   
emb|CDP16984.1|  unnamed protein product                                137   3e-36   
ref|XP_009592996.1|  PREDICTED: secoisolariciresinol dehydrogenas...    136   3e-36   
ref|XP_004152436.1|  PREDICTED: zerumbone synthase-like                 137   3e-36   
ref|XP_006430114.1|  hypothetical protein CICLE_v10012444mg             136   3e-36   
gb|AFK39722.1|  unknown                                                 134   4e-36   
ref|XP_010999595.1|  PREDICTED: xanthoxin dehydrogenase isoform X1      137   4e-36   
ref|XP_009787721.1|  PREDICTED: xanthoxin dehydrogenase-like            136   4e-36   
dbj|BAB86915.1|  S-locus linked stigma protein 1                        133   5e-36   
ref|XP_004305640.1|  PREDICTED: momilactone A synthase-like             136   6e-36   
gb|KDP36169.1|  hypothetical protein JCGZ_08813                         136   6e-36   
ref|XP_009590019.1|  PREDICTED: secoisolariciresinol dehydrogenas...    136   6e-36   
gb|KGN59171.1|  hypothetical protein Csa_3G778270                       136   6e-36   
ref|XP_006354114.1|  PREDICTED: secoisolariciresinol dehydrogenas...    135   8e-36   
ref|XP_010905491.1|  PREDICTED: secoisolariciresinol dehydrogenas...    135   1e-35   
ref|XP_006429516.1|  hypothetical protein CICLE_v10012298mg             136   1e-35   
gb|ABK26187.1|  unknown                                                 135   1e-35   
gb|ABK21151.1|  unknown                                                 135   1e-35   
ref|XP_010551306.1|  PREDICTED: xanthoxin dehydrogenase                 135   2e-35   
ref|XP_010312221.1|  PREDICTED: secoisolariciresinol dehydrogenas...    135   2e-35   
ref|XP_010312220.1|  PREDICTED: secoisolariciresinol dehydrogenas...    135   2e-35   
ref|XP_006303255.1|  hypothetical protein CARUB_v10009938mg             135   2e-35   
gb|KGN59172.1|  hypothetical protein Csa_3G778280                       135   2e-35   
ref|XP_003624486.1|  Sex determination protein tasselseed-2             135   2e-35   
ref|XP_010038162.1|  PREDICTED: secoisolariciresinol dehydrogenas...    135   2e-35   
ref|XP_007026536.1|  NAD(P)-binding Rossmann-fold superfamily pro...    135   2e-35   
ref|XP_010038161.1|  PREDICTED: secoisolariciresinol dehydrogenas...    135   2e-35   
ref|XP_010038160.1|  PREDICTED: secoisolariciresinol dehydrogenas...    135   2e-35   
gb|ABR18410.1|  unknown                                                 135   2e-35   
ref|XP_004137687.1|  PREDICTED: short-chain dehydrogenase reducta...    135   2e-35   
ref|XP_009802753.1|  PREDICTED: secoisolariciresinol dehydrogenas...    134   2e-35   
ref|XP_010038159.1|  PREDICTED: secoisolariciresinol dehydrogenas...    135   2e-35   
ref|XP_009776783.1|  PREDICTED: short-chain dehydrogenase reducta...    135   2e-35   
ref|XP_011032578.1|  PREDICTED: short-chain dehydrogenase reducta...    135   3e-35   
ref|NP_001275184.1|  short-chain dehydrogenase/reductase                134   3e-35   
ref|XP_006360738.1|  PREDICTED: secoisolariciresinol dehydrogenas...    134   3e-35   
ref|XP_010038156.1|  PREDICTED: secoisolariciresinol dehydrogenas...    135   3e-35   
ref|XP_010038158.1|  PREDICTED: secoisolariciresinol dehydrogenas...    135   3e-35   
gb|KDP21551.1|  hypothetical protein JCGZ_22022                         134   3e-35   
ref|XP_007008811.1|  NAD(P)-binding Rossmann-fold superfamily pro...    134   3e-35   
gb|KDO70558.1|  hypothetical protein CISIN_1g024145mg                   134   3e-35   
ref|XP_003554454.1|  PREDICTED: secoisolariciresinol dehydrogenas...    134   3e-35   
ref|XP_006430112.1|  hypothetical protein CICLE_v10012455mg             134   3e-35   
ref|XP_008442883.1|  PREDICTED: secoisolariciresinol dehydrogenas...    134   3e-35   
ref|XP_006354115.1|  PREDICTED: secoisolariciresinol dehydrogenas...    134   4e-35   
ref|XP_006481699.1|  PREDICTED: tropinone reductase-like 1-like         134   4e-35   
ref|XP_010479742.1|  PREDICTED: xanthoxin dehydrogenase                 134   4e-35   
ref|XP_010104811.1|  Momilactone A synthase                             134   4e-35   
ref|XP_002533789.1|  short chain alcohol dehydrogenase, putative        134   4e-35   
gb|EYU18091.1|  hypothetical protein MIMGU_mgv1a011664mg                134   5e-35   
ref|XP_006339150.1|  PREDICTED: secoisolariciresinol dehydrogenas...    134   5e-35   
ref|XP_002463346.1|  hypothetical protein SORBIDRAFT_02g042140          134   5e-35   
ref|XP_010039348.1|  PREDICTED: short-chain dehydrogenase reducta...    134   5e-35   
ref|XP_006361625.1|  PREDICTED: secoisolariciresinol dehydrogenas...    133   6e-35   
ref|XP_011091814.1|  PREDICTED: xanthoxin dehydrogenase                 133   6e-35   
ref|XP_006339148.1|  PREDICTED: secoisolariciresinol dehydrogenas...    134   6e-35   
ref|XP_004493066.1|  PREDICTED: short-chain dehydrogenase reducta...    134   7e-35   
ref|XP_004493067.1|  PREDICTED: short-chain dehydrogenase reducta...    134   7e-35   
ref|XP_009147691.1|  PREDICTED: xanthoxin dehydrogenase                 133   8e-35   
ref|XP_007148993.1|  hypothetical protein PHAVU_005G031500g             133   9e-35   
gb|AAC35340.1|  short-chain alcohol dehydrogenase                       133   9e-35   
gb|EYU42960.1|  hypothetical protein MIMGU_mgv1a011480mg                132   1e-34   
gb|KHN02192.1|  Momilactone A synthase                                  139   1e-34   
ref|XP_009618506.1|  PREDICTED: secoisolariciresinol dehydrogenas...    133   1e-34   
ref|XP_009771386.1|  PREDICTED: short-chain dehydrogenase reducta...    133   1e-34   
gb|AAC35342.1|  short-chain alcohol dehydrogenase                       132   1e-34   
ref|XP_002297758.1|  GLUCOSE INSENSITIVE 1 family protein               132   1e-34   
ref|XP_002323034.2|  short-chain dehydrogenase/reductase family p...    133   1e-34   
ref|XP_010422493.1|  PREDICTED: zerumbone synthase-like                 133   1e-34   
gb|KHG08861.1|  Xanthoxin dehydrogenase -like protein                   132   1e-34   
ref|XP_002530177.1|  short chain alcohol dehydrogenase, putative        131   1e-34   
emb|CDY52974.1|  BnaA06g01590D                                          132   1e-34   
ref|XP_009771385.1|  PREDICTED: short-chain dehydrogenase reducta...    133   1e-34   
ref|XP_008367851.1|  PREDICTED: xanthoxin dehydrogenase-like            132   1e-34   
ref|XP_004237828.1|  PREDICTED: xanthoxin dehydrogenase-like            132   2e-34   
ref|XP_006396543.1|  hypothetical protein EUTSA_v10028841mg             133   2e-34   
ref|XP_009354435.1|  PREDICTED: xanthoxin dehydrogenase                 132   2e-34   
ref|XP_010455976.1|  PREDICTED: zerumbone synthase-like                 132   2e-34   
ref|XP_002308240.1|  short-chain dehydrogenase/reductase family p...    132   2e-34   
ref|XP_010430745.1|  PREDICTED: zerumbone synthase-like                 132   2e-34   
ref|XP_009782884.1|  PREDICTED: short-chain dehydrogenase reducta...    132   2e-34   
gb|AAD14442.1|  putative alcohol dehydrogenase                          132   2e-34   
ref|XP_009122095.1|  PREDICTED: zerumbone synthase isoform X2           132   2e-34   
ref|XP_006361611.1|  PREDICTED: secoisolariciresinol dehydrogenas...    132   3e-34   
emb|CDP06416.1|  unnamed protein product                                132   3e-34   
emb|CDY21945.1|  BnaC09g00510D                                          132   3e-34   
ref|XP_006339318.1|  PREDICTED: secoisolariciresinol dehydrogenas...    132   3e-34   
ref|XP_002894375.1|  hypothetical protein ARALYDRAFT_474354             132   3e-34   
ref|XP_004499827.1|  PREDICTED: xanthoxin dehydrogenase-like            131   3e-34   
ref|XP_008442351.1|  PREDICTED: short-chain dehydrogenase reducta...    132   3e-34   
ref|XP_007027880.1|  Short chain alcohol dehydrogenase                  131   3e-34   
ref|XP_006354216.1|  PREDICTED: secoisolariciresinol dehydrogenas...    131   3e-34   
ref|XP_004302582.1|  PREDICTED: short-chain dehydrogenase reducta...    132   4e-34   
ref|XP_009587781.1|  PREDICTED: short-chain dehydrogenase reducta...    131   4e-34   
ref|XP_010244665.1|  PREDICTED: secoisolariciresinol dehydrogenas...    131   5e-34   
ref|NP_001052173.1|  Os04g0179100                                       131   5e-34   
ref|XP_002520695.1|  short chain alcohol dehydrogenase, putative        131   5e-34   
ref|XP_010314459.1|  PREDICTED: uncharacterized protein LOC100750...    131   5e-34   
emb|CDY61086.1|  BnaC06g41140D                                          131   6e-34   
sp|H9BFQ0.1|TPRL1_ERYCB  RecName: Full=Tropinone reductase-like 1       130   6e-34   
emb|CDY22106.1|  BnaA09g01350D                                          131   6e-34   
ref|XP_006481700.1|  PREDICTED: tropinone reductase-like 2-like         130   6e-34   
ref|NP_567251.2|  NAD(P)-binding Rossmann-fold superfamily protein      132   7e-34   
ref|XP_002530512.1|  short chain alcohol dehydrogenase, putative        131   7e-34   
emb|CAH66125.1|  OSIGBa0109M01.3                                        130   7e-34   
gb|ABK26167.1|  unknown                                                 131   7e-34   
ref|XP_006288323.1|  hypothetical protein CARUB_v10001569mg             131   8e-34   
ref|XP_011019045.1|  PREDICTED: short-chain dehydrogenase reducta...    131   8e-34   
ref|XP_010244663.1|  PREDICTED: secoisolariciresinol dehydrogenas...    130   9e-34   
ref|XP_010244664.1|  PREDICTED: secoisolariciresinol dehydrogenas...    130   9e-34   
ref|XP_008383844.1|  PREDICTED: xanthoxin dehydrogenase isoform X2      130   9e-34   
gb|KHN13691.1|  Xanthoxin dehydrogenase                                 130   9e-34   
ref|XP_006591160.1|  PREDICTED: xanthoxin dehydrogenase-like            130   9e-34   
ref|XP_010244661.1|  PREDICTED: secoisolariciresinol dehydrogenas...    131   1e-33   
ref|XP_003598766.1|  Short-chain dehydrogenase/reductase                130   1e-33   
ref|XP_010244662.1|  PREDICTED: secoisolariciresinol dehydrogenas...    131   1e-33   
gb|ABK24336.1|  unknown                                                 130   1e-33   
ref|XP_010036428.1|  PREDICTED: tropinone reductase-like 1              130   1e-33   
ref|NP_001052174.1|  Os04g0179200                                       130   1e-33   
gb|KDP36097.1|  hypothetical protein JCGZ_08741                         130   1e-33   
ref|XP_010500833.1|  PREDICTED: xanthoxin dehydrogenase-like            129   2e-33   
emb|CAH66124.1|  OSIGBa0109M01.2                                        129   2e-33   
ref|XP_004252563.1|  PREDICTED: secoisolariciresinol dehydrogenas...    129   2e-33   
gb|KFK30916.1|  hypothetical protein AALP_AA6G042300                    130   2e-33   
gb|ABK24197.1|  unknown                                                 129   3e-33   
gb|ABK23507.1|  unknown                                                 129   3e-33   
gb|AFL56690.1|  ADH1                                                    129   3e-33   
sp|H9BFQ1.1|TPRL2_ERYCB  RecName: Full=Tropinone reductase-like 2       129   3e-33   
ref|XP_010684754.1|  PREDICTED: zerumbone synthase                      129   3e-33   
ref|XP_010312311.1|  PREDICTED: short-chain dehydrogenase reducta...    129   3e-33   
ref|XP_011079747.1|  PREDICTED: zerumbone synthase isoform X2           129   3e-33   
dbj|BAA89230.1|  wts2L                                                  129   4e-33   
ref|XP_004249651.1|  PREDICTED: short-chain dehydrogenase reducta...    129   4e-33   
ref|XP_004303064.1|  PREDICTED: xanthoxin dehydrogenase-like            129   4e-33   
ref|XP_004136499.1|  PREDICTED: zerumbone synthase-like                 128   4e-33   
dbj|BAA06241.1|  TFHP-1 protein                                         127   4e-33   
ref|XP_002277487.2|  PREDICTED: short-chain dehydrogenase reducta...    129   4e-33   
ref|XP_010264499.1|  PREDICTED: short-chain dehydrogenase reducta...    129   4e-33   
ref|XP_010264500.1|  PREDICTED: short-chain dehydrogenase reducta...    128   4e-33   
ref|XP_009115857.1|  PREDICTED: short-chain dehydrogenase reducta...    129   4e-33   
ref|XP_011033624.1|  PREDICTED: zerumbone synthase isoform X2           129   4e-33   
ref|XP_011033623.1|  PREDICTED: zerumbone synthase isoform X1           129   4e-33   
ref|XP_006392929.1|  hypothetical protein EUTSA_v10011636mg             129   5e-33   
ref|XP_009782046.1|  PREDICTED: short-chain dehydrogenase reducta...    128   5e-33   
gb|AAC35341.1|  short-chain alcohol dehydrogenase                       128   5e-33   
ref|XP_011079746.1|  PREDICTED: zerumbone synthase isoform X1           129   6e-33   
ref|XP_010264496.1|  PREDICTED: short-chain dehydrogenase reducta...    129   6e-33   
ref|XP_010264497.1|  PREDICTED: short-chain dehydrogenase reducta...    128   6e-33   
gb|AAC35343.1|  short-chain alcohol dehydrogenase                       128   6e-33   
ref|XP_009615997.1|  PREDICTED: short-chain dehydrogenase reducta...    129   7e-33   
emb|CDX78027.1|  BnaA09g32220D                                          128   8e-33   
ref|XP_008370219.1|  PREDICTED: short-chain dehydrogenase reducta...    128   8e-33   
ref|XP_004290718.1|  PREDICTED: zerumbone synthase-like                 128   9e-33   
gb|EYU18089.1|  hypothetical protein MIMGU_mgv1a010226mg                128   9e-33   
gb|KHN33244.1|  Sex determination protein tasselseed-2                  128   9e-33   
gb|AER92598.1|  putative short-chain alcohol dehydrogenase              128   9e-33   
ref|XP_003522142.1|  PREDICTED: short-chain dehydrogenase reducta...    128   9e-33   
ref|XP_006361612.1|  PREDICTED: secoisolariciresinol dehydrogenas...    127   9e-33   
ref|XP_004494319.1|  PREDICTED: zerumbone synthase-like                 128   9e-33   
ref|XP_002308449.1|  hypothetical protein POPTR_0006s22330g             127   1e-32   
ref|XP_008443590.1|  PREDICTED: tropinone reductase-like 1              127   1e-32   
ref|XP_008368953.1|  PREDICTED: secoisolariciresinol dehydrogenase      128   1e-32   
ref|XP_008350108.1|  PREDICTED: secoisolariciresinol dehydrogenas...    127   1e-32   
ref|XP_006855389.1|  hypothetical protein AMTR_s00057p00137740          127   1e-32   
ref|XP_006361624.1|  PREDICTED: secoisolariciresinol dehydrogenas...    128   1e-32   
gb|EYU41979.1|  hypothetical protein MIMGU_mgv1a011548mg                127   1e-32   
gb|EAZ29934.1|  hypothetical protein OsJ_13988                          127   1e-32   
ref|XP_002874879.1|  predicted protein                                  127   1e-32   
gb|KDP41845.1|  hypothetical protein JCGZ_26863                         127   1e-32   
ref|XP_010256990.1|  PREDICTED: short-chain dehydrogenase reducta...    127   2e-32   
ref|XP_002321038.2|  hypothetical protein POPTR_0014s13030g             127   2e-32   
ref|XP_003623493.1|  Sex determination protein tasselseed-2             127   2e-32   
ref|XP_002321039.2|  hypothetical protein POPTR_0014s13030g             127   2e-32   
gb|ABK94192.1|  unknown                                                 127   2e-32   
gb|KDP32981.1|  hypothetical protein JCGZ_13012                         126   2e-32   
ref|XP_008245281.1|  PREDICTED: xanthoxin dehydrogenase                 127   2e-32   
ref|XP_009136629.1|  PREDICTED: short-chain dehydrogenase reducta...    127   2e-32   
ref|XP_010067756.1|  PREDICTED: xanthoxin dehydrogenase                 127   2e-32   
emb|CDX90636.1|  BnaA03g41450D                                          127   2e-32   
ref|XP_010685947.1|  PREDICTED: sex determination protein tassels...    127   2e-32   
ref|XP_008386750.1|  PREDICTED: secoisolariciresinol dehydrogenas...    127   2e-32   
emb|CDY29039.1|  BnaC07g32450D                                          127   2e-32   
ref|XP_004252598.1|  PREDICTED: secoisolariciresinol dehydrogenas...    126   3e-32   
ref|XP_002463347.1|  hypothetical protein SORBIDRAFT_02g042150          127   3e-32   
ref|XP_010094675.1|  Sex determination protein tasselseed-2             126   3e-32   
ref|XP_003579803.1|  PREDICTED: momilactone A synthase-like             126   3e-32   
ref|XP_007218800.1|  hypothetical protein PRUPE_ppa009814mg             126   3e-32   
ref|XP_004252564.1|  PREDICTED: secoisolariciresinol dehydrogenas...    127   3e-32   
ref|XP_010683629.1|  PREDICTED: secoisolariciresinol dehydrogenas...    126   3e-32   
emb|CBI30353.3|  unnamed protein product                                125   3e-32   



>ref|XP_009340879.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=273

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T ++FS+HGAKVVIADVQDDLG  VC +L S S +FVHCDVTKE D+ENA
Sbjct  25   TGGASGIGESTARVFSKHGAKVVIADVQDDLGESVCTDLNSSSVSFVHCDVTKEEDIENA  84

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V TA SK+GKLD+M+NNAGIGG  KP+ILD+D +EFEQV+  NLVG+FLGTKHAARVMIP
Sbjct  85   VKTATSKYGKLDIMFNNAGIGGTPKPNILDNDKAEFEQVLSVNLVGSFLGTKHAARVMIP  144



>ref|XP_008229660.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=270

 Score =   188 bits (477),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T +LFS+HGA+VVIADVQDDL   VC +L S S +FVHCDVTKE DVENA
Sbjct  22   TGGASGIGESTARLFSKHGARVVIADVQDDLAESVCRDLSSSSTSFVHCDVTKEEDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V TA  K+GKLD+M+NNAG GG+ KP+ILD+D +EFEQV+R NLVGAFLG KHAARVMIP
Sbjct  82   VKTATRKYGKLDIMFNNAGTGGIAKPNILDNDKAEFEQVIRVNLVGAFLGIKHAARVMIP  141



>ref|XP_009374964.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=270

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T ++FS+HGAKVVIADVQDDLG  VC +L S SA+FVHCDVTKE D+ENA
Sbjct  22   TGGASGIGESTARVFSKHGAKVVIADVQDDLGESVCRDLNSSSASFVHCDVTKEEDIENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V TA SK+GKLD+M+NNAGI G  KP+ILD+  +EFEQV+R NLVGAFLG KHAARVMIP
Sbjct  82   VKTATSKYGKLDIMFNNAGIIGTPKPNILDNGKAEFEQVIRVNLVGAFLGIKHAARVMIP  141



>ref|XP_006383023.1| hypothetical protein POPTR_0005s10820g, partial [Populus trichocarpa]
 gb|ERP60820.1| hypothetical protein POPTR_0005s10820g, partial [Populus trichocarpa]
Length=189

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG +SGIG++T +LF +HGAKVVIAD+QD+LG  VC ELE   A+F+HCDVT+E DVENA
Sbjct  22   TGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKELEPEPASFIHCDVTQEKDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+M+NNAG GG  K +IL++D +EFE+++  NLVGAFLGTKHAARVMIP
Sbjct  82   VNTAVSKYGKLDIMFNNAGTGGTPKTNILENDKAEFEKIICANLVGAFLGTKHAARVMIP  141

Query  93   KTR  85
              R
Sbjct  142  ARR  144



>ref|XP_011022234.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=268

 Score =   184 bits (468),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG +SGIG++T +LF +HGAKVVIAD+QD+LG  VC ELE   A+F+HCDVT+E DVENA
Sbjct  22   TGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKELEPEPASFIHCDVTQEKDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+M+NNAGIGG  K +IL++D +EFE+++  NLVGAFLGTKHAARVMIP
Sbjct  82   VNTAVSKYGKLDIMFNNAGIGGTPKTNILENDKAEFEKIICVNLVGAFLGTKHAARVMIP  141

Query  93   KTR  85
              R
Sbjct  142  ARR  144



>ref|XP_009340877.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=263

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T ++FS+HGAKVVIADVQDDLG  V  +L S SA+FVHCDVTKE D+ENA
Sbjct  15   TGGASGIGESTARVFSKHGAKVVIADVQDDLGESVFRDLNSSSASFVHCDVTKEEDIENA  74

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V TA SK+GKLD+M+NNAGIGG  KP+ILD+D +EFEQV+  NLVG+FLG KHAARVMIP
Sbjct  75   VKTATSKYGKLDIMFNNAGIGGTPKPNILDNDKAEFEQVLSVNLVGSFLGIKHAARVMIP  134



>ref|XP_011006635.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG +SGIG++  +LF++HGAKVVIADVQD+LG  VC EL++ SA+FVHCDVT+E DVENA
Sbjct  22   TGGSSGIGESAARLFAKHGAKVVIADVQDELGHSVCEELKNESASFVHCDVTQEKDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK GKLD+M+NNAG+ G  KP+ILD+D +EFE+V+  N+VGAFLGTKHAARVMIP
Sbjct  82   VNTAVSKHGKLDIMFNNAGVVGSPKPNILDNDKAEFEKVISVNIVGAFLGTKHAARVMIP  141

Query  93   KTR  85
              R
Sbjct  142  ARR  144



>ref|XP_004506207.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=271

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS+HGA+VVIAD+QD++G  +C +L + SA+FVHCD TKE DVENA
Sbjct  22   TGGASGIGEATVRLFSKHGAQVVIADIQDEMGHSICKDLNNSSASFVHCDTTKETDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT VSK+GKLD+M+NNAGI G+NK +IL++  SEFE+V++ NL+G FLGTKHA+RVMIP
Sbjct  82   VNTTVSKYGKLDIMFNNAGISGVNKTNILENKLSEFEEVIKVNLIGVFLGTKHASRVMIP  141

Query  93   KTR  85
              R
Sbjct  142  ARR  144



>ref|XP_008230130.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=272

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T +LFS+HGAKVVIADVQDD    VC +L   S +FVHCDVTKE DVENA
Sbjct  24   TGGASGIGESTARLFSKHGAKVVIADVQDDFAESVCRDLSPSSTSFVHCDVTKEEDVENA  83

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V TA +K+G+LD+M+NNAGI G NKP+ILD+D  EFEQV+R NLVGAFLG KHAARVMIP
Sbjct  84   VQTATNKYGELDIMFNNAGIIGTNKPNILDNDRVEFEQVIRVNLVGAFLGIKHAARVMIP  143



>ref|XP_007207105.1| hypothetical protein PRUPE_ppa020955mg [Prunus persica]
 gb|EMJ08304.1| hypothetical protein PRUPE_ppa020955mg [Prunus persica]
Length=270

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T +LFS+HGA+VVIADVQD L   VC +L S S +FVHCDVTKE DVENA
Sbjct  22   TGGASGIGESTARLFSKHGARVVIADVQDGLAESVCRDLSSSSISFVHCDVTKEEDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V TA  K+GKLD+M+NNAG GG+ KP+ILD+D +EFEQV+R NL+GAFLG KHAARVMIP
Sbjct  82   VKTATRKYGKLDIMFNNAGTGGVAKPNILDNDKAEFEQVIRVNLIGAFLGIKHAARVMIP  141



>ref|XP_009773000.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=263

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+A  +LFSRHGAKVVIAD+QDDL +KVC EL++ S  FVHC+VTKE D+ENA
Sbjct  17   TGAASGIGEAAARLFSRHGAKVVIADIQDDLAQKVCKELDTSSTTFVHCNVTKEEDLENA  76

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN AVSK+GKLD+MYNNAGI G  K +ILD++ SEFE+V+  NLVG FLG K AARVMIP
Sbjct  77   VNIAVSKYGKLDIMYNNAGIMGAIKSNILDNEKSEFEKVISVNLVGTFLGIKQAARVMIP  136

Query  93   KTR  85
            + +
Sbjct  137  RRQ  139



>ref|XP_002272206.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=268

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG++T +LFSRHGAKVVIAD+QD+LG+ VC EL S  SA+FVHCDVT E DVEN
Sbjct  22   TGGASGIGESTARLFSRHGAKVVIADIQDNLGQSVCKELSSPTSASFVHCDVTSEKDVEN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            A+N AV+K+GKLD+M+NNAGI G +KP+ILD+D +EFE+++  N+VGAFLGTKHAARVMI
Sbjct  82   AINVAVAKYGKLDIMFNNAGIVGESKPNILDNDKTEFEKILNVNVVGAFLGTKHAARVMI  141

Query  96   P  94
            P
Sbjct  142  P  142



>ref|XP_007207752.1| hypothetical protein PRUPE_ppa027184mg [Prunus persica]
 gb|EMJ08951.1| hypothetical protein PRUPE_ppa027184mg [Prunus persica]
Length=343

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T +LFS+HGAKVVIADVQDDL   VC +L   S +FVHCDVTKE DVEN 
Sbjct  24   TGGASGIGESTARLFSKHGAKVVIADVQDDLAESVCRDLSPSSTSFVHCDVTKEEDVENV  83

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V TA +K+GKLD+M+NNAGI G+ KP+ILD+D  EFEQV+R NLVGAFLG KHAARVMIP
Sbjct  84   VQTATNKYGKLDIMFNNAGIAGMVKPNILDNDKIEFEQVIRVNLVGAFLGIKHAARVMIP  143



>ref|XP_006384778.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
 gb|ERP62575.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
Length=305

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG +SGIG++  +LF++HGAKVVIADVQD+LG  VC EL++ SA+FVHCDVT+E DVENA
Sbjct  56   TGGSSGIGESAARLFAKHGAKVVIADVQDELGHSVCEELKTESASFVHCDVTQEKDVENA  115

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK GKLD+M+NNAGI G  KP+ILD+D +EFE+V+  N+VGAFLGTKHAARVMIP
Sbjct  116  VNTAVSKHGKLDIMFNNAGIVGTPKPNILDNDKAEFEKVISVNVVGAFLGTKHAARVMIP  175

Query  93   KTR  85
              R
Sbjct  176  VRR  178



>ref|XP_008229671.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=272

 Score =   182 bits (463),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++  +LFS+HGAKVVIADVQDDL   VC +L   S +FVHCDVTKE DVENA
Sbjct  24   TGGASGIGESAARLFSKHGAKVVIADVQDDLAESVCRDLSPSSTSFVHCDVTKEEDVENA  83

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V TA +K+GKLD+M+NNAG+ G+ KP+ILD+D  EFEQV+R NLVGAFLG KHAARVMIP
Sbjct  84   VKTATNKYGKLDIMFNNAGVVGMTKPNILDNDKVEFEQVIRVNLVGAFLGIKHAARVMIP  143



>ref|XP_006388114.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP47028.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=271

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG +SGIG++T +LF +HGAKVVIAD+QD+LG  VC ELE   A+F+HCDVT+E DVENA
Sbjct  22   TGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKELEPEPASFIHCDVTQEKDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+M+NNAG GG  K +I+++D +EFE+++  NLVGAFLGTKHAARVMIP
Sbjct  82   VNTAVSKYGKLDIMFNNAGTGGTPKTNIIENDKAEFEKIICANLVGAFLGTKHAARVMIP  141

Query  93   KTR  85
              R
Sbjct  142  ARR  144



>ref|XP_007206815.1| hypothetical protein PRUPE_ppa025923mg [Prunus persica]
 gb|EMJ08014.1| hypothetical protein PRUPE_ppa025923mg [Prunus persica]
Length=272

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T +LFS+HGAKVVIADVQDDL   VC +L      FVHCDVTKE DVENA
Sbjct  24   TGGASGIGESTARLFSKHGAKVVIADVQDDLAESVCRDLSPSPTLFVHCDVTKEEDVENA  83

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V T  +K+G+LD+M+NNAGI G NKP+ILD+D  EFEQV+R NLVGAFLG KHAARVMIP
Sbjct  84   VQTTTNKYGELDIMFNNAGIIGTNKPNILDNDKVEFEQVIRVNLVGAFLGIKHAARVMIP  143



>ref|XP_003540812.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
Length=269

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 100/123 (81%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS+HGA VVIAD+QDDLG  +C  LES  A++VHCDVT E DVEN 
Sbjct  22   TGGASGIGEATARLFSKHGAHVVIADIQDDLGLSICKHLES--ASYVHCDVTNETDVENC  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT VSK GKLD+M+NNAGI G+NK SILD+  SEFE+V+  NLVG FLGTKHAARVMIP
Sbjct  80   VNTTVSKHGKLDIMFNNAGITGVNKTSILDNTKSEFEEVINVNLVGVFLGTKHAARVMIP  139

Query  93   KTR  85
              R
Sbjct  140  ARR  142



>ref|XP_009340878.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=274

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T ++FS+ GAKVVIADVQDDLG  VC +L S SA+FVHCDVTKE D+E+A
Sbjct  26   TGGASGIGESTARVFSKLGAKVVIADVQDDLGESVCRDLNSSSASFVHCDVTKEEDIEHA  85

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V TA SK+GKLD+M+NNAGI G  KP+ILD+  +EFEQV+R NLVGAFLG KHAARVMIP
Sbjct  86   VKTATSKYGKLDIMFNNAGIIGTPKPNILDNGKAEFEQVIRVNLVGAFLGIKHAARVMIP  145



>ref|XP_002523859.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF38585.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=272

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSA-AFVHCDVTKEADVEN  277
            TGAASGIG+   +LFS+HGA +VIADVQD+LG  VC EL+S S+ +++HC+VT+E DVEN
Sbjct  22   TGAASGIGECAARLFSKHGANLVIADVQDELGHSVCRELDSPSSVSYIHCNVTREEDVEN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AVNTAVSK+GKLD+M+NNAG+ G+ KP+ILD+D +EFE+++  NLVGAFLGTKHAARVMI
Sbjct  82   AVNTAVSKYGKLDIMFNNAGVVGIAKPNILDNDKAEFEKIISVNLVGAFLGTKHAARVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PNRK  145



>ref|XP_007206370.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
 gb|EMJ07569.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
Length=270

 Score =   179 bits (455),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T +LFS+HGAKVVIADVQD+L   +C +L S S +FVHCDVTKE DVENA
Sbjct  22   TGGASGIGESTARLFSKHGAKVVIADVQDNLAESICRDLSSSSTSFVHCDVTKEEDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V TA SK+GKLD+M+NNAGI G+ K +ILD+D +EFEQV+  NLVG FLG KHAARVMIP
Sbjct  82   VKTATSKYGKLDIMFNNAGIAGIAKTNILDNDKAEFEQVIGVNLVGVFLGIKHAARVMIP  141



>ref|XP_011006647.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG +SGIG++  +LF++HGAKVVIADVQD+LG  VC EL++ SA+FVHCDVT+E DVENA
Sbjct  22   TGGSSGIGESAARLFAKHGAKVVIADVQDELGHFVCEELKNESASFVHCDVTQEKDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK GKLD+M+NNAG     KP+ILD+D +EFE+V+  N+VGAFLGTKHAARVMIP
Sbjct  82   VNTAVSKHGKLDIMFNNAGAADTPKPNILDNDKAEFEKVLSVNIVGAFLGTKHAARVMIP  141

Query  93   KTR  85
              R
Sbjct  142  ARR  144



>ref|XP_004506206.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=271

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS+HGA+VVIAD+QD++G  +C +L   +A++VHCD TKE D+ENA
Sbjct  22   TGGASGIGEATARLFSKHGAQVVIADIQDEMGHSICKDLNKSTASYVHCDTTKEKDIENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT VSK+GKLD+M+NNAGI G+NK +IL++  SEFE+V++ NL+G FLGTKHA+RVMIP
Sbjct  82   VNTTVSKYGKLDIMFNNAGIVGVNKTNILENKLSEFEEVIKVNLIGVFLGTKHASRVMIP  141

Query  93   KTR  85
              R
Sbjct  142  ARR  144



>gb|KDP34634.1| hypothetical protein JCGZ_11952 [Jatropha curcas]
Length=270

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 106/125 (85%), Gaps = 2/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG--SAAFVHCDVTKEADVE  280
            TGAASGIG+ T +LFS+HGA+VVIAD+QD+LG  +C E++      +FVHCDVTKE DVE
Sbjct  19   TGAASGIGECTARLFSKHGAQVVIADIQDELGHSLCKEIDRDGKYCSFVHCDVTKEEDVE  78

Query  279  NAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            NA+N+AVSK+GKLD+M+NNAGI G+ KP+ILD++ +EFE+++  NLVGAFLGTKHAARVM
Sbjct  79   NALNSAVSKYGKLDIMFNNAGIIGVAKPNILDNEKAEFEKIISVNLVGAFLGTKHAARVM  138

Query  99   IPKTR  85
            IP  +
Sbjct  139  IPNRK  143



>ref|XP_009605456.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=263

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+A  +LFS+H AKVVIAD+QDDL +KVC EL+  S  FVHCDVTKE ++ENA
Sbjct  17   TGAASGIGEAAARLFSKHRAKVVIADIQDDLSQKVCKELDPSSTTFVHCDVTKEEELENA  76

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN AVSK+GKLD+MYNNAGI G  K +ILD++ SEFE+V+  NLVG FLG K AARVMIP
Sbjct  77   VNIAVSKYGKLDIMYNNAGIMGAVKSNILDNEKSEFEKVISINLVGTFLGIKQAARVMIP  136

Query  93   KTR  85
            + +
Sbjct  137  RRQ  139



>ref|XP_010651861.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=267

 Score =   177 bits (448),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T +LFSRHGAKVVIAD+QD+LG  VC +L   SA+FVHCDVT E +VENA
Sbjct  22   TGGASGIGESTARLFSRHGAKVVIADIQDNLGLSVCKDLSPTSASFVHCDVTNEKEVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN AV+  GKLD+M+NNAGI G  KP ILD+D +EFE+V+  N+VGAFLGTKHAARVMIP
Sbjct  82   VNLAVATHGKLDIMFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTKHAARVMIP  141



>ref|XP_010651860.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=288

 Score =   177 bits (450),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T +LFSRHGAKVVIAD+QD+LG  VC +L   SA+FVHCDVT E +VENA
Sbjct  43   TGGASGIGESTARLFSRHGAKVVIADIQDNLGLSVCKDLSPTSASFVHCDVTNEKEVENA  102

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN AV+  GKLD+M+NNAGI G  KP ILD+D +EFE+V+  N+VGAFLGTKHAARVMIP
Sbjct  103  VNLAVATHGKLDIMFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTKHAARVMIP  162



>ref|XP_008246119.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Prunus 
mume]
Length=257

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T +LFS+HGAKVVIADVQDDL   +C +L S S +FVHCDVTKE DVENA
Sbjct  9    TGGASGIGESTVRLFSKHGAKVVIADVQDDLAESICRDLSSSSTSFVHCDVTKEEDVENA  68

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V TA SK+GKLD+M+NNAGI G  K +ILD+D +EFEQV+  NLVG FLG KHAARVMI 
Sbjct  69   VKTATSKYGKLDIMFNNAGIAGTAKTNILDNDKAEFEQVIGVNLVGVFLGIKHAARVMIS  128



>ref|XP_006368128.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Solanum 
tuberosum]
Length=170

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+A  KLFSR+GAKVVIAD+QDDL  KVC +L+  S  FVHCDVTKE D+EN 
Sbjct  9    TGAASGIGEAAAKLFSRYGAKVVIADIQDDLAHKVCKDLDPSSTTFVHCDVTKEEDLENV  68

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN  V K+GKLD+MYNNAGI G  K +IL+++ S+FE+V+ TNLVG FLG K AARVMIP
Sbjct  69   VNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIKQAARVMIP  128

Query  93   K  91
            +
Sbjct  129  R  129



>emb|CDP06869.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG++  +LF +HGAKVV+AD+QDDL +KVC +L+  SA+ VHCDVT+E+D+ENA
Sbjct  22   TGAASGIGESAARLFVKHGAKVVVADIQDDLAQKVCQDLDPSSASHVHCDVTQESDIENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+M+NNAGIGG    +ILD   S+FE+V+  NLVG FLG KHAARVMIP
Sbjct  82   VNTAVSKYGKLDIMFNNAGIGGSRTSNILDDKKSDFERVISVNLVGIFLGAKHAARVMIP  141



>gb|AFK37606.1| unknown [Medicago truncatula]
 gb|KEH29818.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=271

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS HGA+VVIAD+QDD+G  +C EL   SA +VHCDVTKE D+ENA
Sbjct  22   TGGASGIGEATARLFSNHGAQVVIADIQDDIGHSICQELHKSSATYVHCDVTKEKDIENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT VSK GKLD+M+NNAGI G+NK +IL++  SEF++V+  NL G FLGTKHAARVM P
Sbjct  82   VNTTVSKHGKLDIMFNNAGITGINKTNILENKLSEFQEVIDINLTGVFLGTKHAARVMTP  141

Query  93   KTR  85
              R
Sbjct  142  VRR  144



>gb|AEC10992.1| alcohol dehydrogenase [Camellia sinensis]
Length=277

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T +LFS+HGAKV+IAD+QDDLG  VC +L+  S +FVHCDVT E  V NA
Sbjct  22   TGGASGIGECTARLFSKHGAKVMIADIQDDLGLSVCKDLDEKSVSFVHCDVTNETHVMNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV++FGKLD+MYNNAGI GL KP+ILD+D  EFE+++R NLVGAFLGTK AARVMI 
Sbjct  82   VDAAVAQFGKLDIMYNNAGIVGLAKPNILDNDKDEFEKIIRVNLVGAFLGTKQAARVMIL  141

Query  93   KTR  85
              R
Sbjct  142  NRR  144



>gb|KEH29814.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=265

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS HGA+VVIAD+QDD G  +C EL+  S+++V CDVTKE D+ENA
Sbjct  16   TGGASGIGEATARLFSEHGAQVVIADIQDDKGHSICKELQKSSSSYVRCDVTKEEDIENA  75

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT V K+GKLD+M+NNAGI G+NK  IL++  SEFE V++ NL G FLGTKHAARVMIP
Sbjct  76   VNTTVFKYGKLDIMFNNAGISGVNKTKILENKLSEFEDVIKVNLTGVFLGTKHAARVMIP  135

Query  93   KTR  85
              R
Sbjct  136  ARR  138



>gb|KEH29817.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=271

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LF+ HGA+V+IAD+QDD G  VC +L   SA++VHCDVTKE D+ENA
Sbjct  22   TGGASGIGEATARLFTEHGAQVIIADIQDDKGYSVCKDLHKSSASYVHCDVTKEKDIENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT +S +GKLD+M+NNAGI G NK +IL+   SEFE+V+  NLVG FLGTKHA+RVMIP
Sbjct  82   VNTTISMYGKLDIMFNNAGIVGANKTNILEYKLSEFEEVINVNLVGVFLGTKHASRVMIP  141

Query  93   KTR  85
              R
Sbjct  142  ARR  144



>gb|KEH29815.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=266

 Score =   174 bits (442),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS HGA+VVIAD+QDD G  +C EL+  S+++V CDVTKE D+ENA
Sbjct  16   TGGASGIGEATARLFSEHGAQVVIADIQDDKGHSICKELQKSSSSYVRCDVTKEEDIENA  75

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT V K+GKLD+M+NNAGI G+NK  IL++  SEFE V++ NL G FLGTKHA+RVMIP
Sbjct  76   VNTTVFKYGKLDIMFNNAGISGVNKTKILENKLSEFEDVIKVNLTGVFLGTKHASRVMIP  135

Query  93   KTR  85
              R
Sbjct  136  ARR  138



>gb|AFK35915.1| unknown [Medicago truncatula]
Length=272

 Score =   174 bits (442),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS HGA+VVIAD+QDD G  +C EL+  S+++V CDVTKE D+ENA
Sbjct  22   TGGASGIGEATARLFSEHGAQVVIADIQDDKGHSICKELQKSSSSYVRCDVTKEEDIENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT V K+GKLD+M+NNAGI G+NK  IL++  SEFE V++ NL G FLGTKHA+RVMIP
Sbjct  82   VNTTVFKYGKLDIMFNNAGISGVNKTKILENKLSEFEDVIKVNLTGVFLGTKHASRVMIP  141

Query  93   KTR  85
              R
Sbjct  142  ARR  144



>emb|CDP06868.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG++  +LF +HGAKVVIAD+QDDL +KVC +L+  SA+ VHCD T+E+D+ENA
Sbjct  22   TGAASGIGESAARLFVKHGAKVVIADIQDDLAKKVCQDLDPSSASHVHCDTTQESDIENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT VSK+GKLD+M+NNAGI G    +ILD   S+FE+V+  NLVG FLGTKHAARVMIP
Sbjct  82   VNTTVSKYGKLDIMFNNAGIAGSGTSNILDDKKSDFERVISVNLVGVFLGTKHAARVMIP  141



>emb|CDP06870.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG++T +LF ++GAKVVIAD+QDDL +KVC +L+  SA+ VHCD T+E+D+ENA
Sbjct  19   TGAASGIGESTARLFVKYGAKVVIADIQDDLAKKVCQDLDPSSASHVHCDTTQESDIENA  78

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT VSK+GKLD+M+NNAGI G    +ILD   S+FE+V+  NLVG FLGTKHAARVMIP
Sbjct  79   VNTTVSKYGKLDIMFNNAGIAGSGTSNILDDKKSDFERVISVNLVGVFLGTKHAARVMIP  138



>emb|CBI28275.3| unnamed protein product [Vitis vinifera]
Length=861

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG++T +LFSRHGAKVVIAD+QD+LG+ VC EL S  SA+FVHCDVT E DVEN
Sbjct  615  TGGASGIGESTARLFSRHGAKVVIADIQDNLGQSVCKELSSPTSASFVHCDVTSEKDVEN  674

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            A+N AV+K+GKLD+M+NNAGI G +KP+ILD+D +EFE+++  N+VGAFLGTKHAARVMI
Sbjct  675  AINVAVAKYGKLDIMFNNAGIVGESKPNILDNDKTEFEKILNVNVVGAFLGTKHAARVMI  734

Query  96   P  94
            P
Sbjct  735  P  735


 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T +LFSRHGAKVVIAD+QD+LG  VC +L   SA+FVHCDVT E +VENA
Sbjct  293  TGGASGIGESTARLFSRHGAKVVIADIQDNLGLSVCKDLSPTSASFVHCDVTNEKEVENA  352

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN AV+  GKLD+M+NNAGI G  KP ILD+D +EFE+V+  N+VGAFLGTKHAARVMIP
Sbjct  353  VNLAVATHGKLDIMFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTKHAARVMIP  412


 Score =   161 bits (407),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG  T KLF +HGAKV+IAD+Q + G  +C +L   SA+FVHCDVTKE DV NA
Sbjct  22   TGGAGGIGSCTAKLFCQHGAKVLIADIQYEKGHSICKDLGPTSASFVHCDVTKELDVGNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++ A+SK+GKLD+M+NNAGI G  +P+ILD+D  EFE  +R N++G FLGTKHAARVM P
Sbjct  82   IDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFLGTKHAARVMAP  141

Query  93   KTR  85
              R
Sbjct  142  AGR  144



>ref|XP_006362152.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+A  KLFSR+GAKVVIAD+QDDL  KVC +L+  S  FVHCDVTKE D+EN 
Sbjct  17   TGAASGIGEAAAKLFSRYGAKVVIADIQDDLAHKVCKDLDPSSTTFVHCDVTKEEDLENV  76

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN  V K+GKLD+MYNNAGI G  K +IL+++ S+FE+V+ TNLVG FLG K AARVMIP
Sbjct  77   VNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIKQAARVMIP  136

Query  93   K  91
            +
Sbjct  137  R  137



>ref|XP_009605454.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Nicotiana tomentosiformis]
Length=263

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+A  +LFS HGAKVVIAD+QD+L +KVC +L+  S  FVHCD+TKE D+ENA
Sbjct  17   TGAASGIGEAAARLFSIHGAKVVIADIQDELAQKVCKDLDPTSTTFVHCDITKEEDLENA  76

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
             NTAV K+GKLD+MYNNAGI G+ K +IL+ +  EFE+V   NLVG FLGTK AARVMIP
Sbjct  77   ANTAVDKYGKLDIMYNNAGIVGIIKSNILEDEKYEFEKVTSVNLVGTFLGTKQAARVMIP  136

Query  93   KTR  85
              R
Sbjct  137  NGR  139



>gb|AFK46966.1| unknown [Lotus japonicus]
Length=270

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 100/123 (81%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS+HGA+VVIAD+QDDLG  VC +LES  A+FVHC+VTKE +VE A
Sbjct  22   TGGASGIGEATARLFSKHGAQVVIADIQDDLGHSVCKDLES--ASFVHCNVTKEDEVETA  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN AVSK GKLD+M+NNAGI G N  SIL++  SEFEQV   N+ GAFLGTKHAARVMIP
Sbjct  80   VNMAVSKHGKLDIMFNNAGISGNNNTSILNNTKSEFEQVFSVNVSGAFLGTKHAARVMIP  139

Query  93   KTR  85
              R
Sbjct  140  ARR  142



>ref|XP_003539841.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN21178.1| Momilactone A synthase [Glycine soja]
Length=273

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T +LFS+HGAKVVIAD+QD+LG  +C +L+S SA ++HCDVTKE ++E+A
Sbjct  24   TGGASGIGECTARLFSKHGAKVVIADIQDELGHSICKDLDSSSATYIHCDVTKEENIEHA  83

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT VSK+GKLD+M+++AGI G   PSIL +  S FEQV+  NLVG FLG KHAARVMIP
Sbjct  84   VNTTVSKYGKLDIMHSSAGIVGAWNPSILHNKKSHFEQVISVNLVGTFLGIKHAARVMIP  143

Query  93   KTRTGVDA  70
              R  + A
Sbjct  144  SGRGSIVA  151



>gb|ACU18308.1| unknown [Glycine max]
Length=273

 Score =   172 bits (437),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T +LFS+HGAKVVIAD+QD+LG  +C +L+S SA ++HCDVTKE ++E+A
Sbjct  24   TGGASGIGECTARLFSKHGAKVVIADIQDELGHSICKDLDSSSATYIHCDVTKEENIEHA  83

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT VSK+GKLD+M+++AGI G   PSIL +  S FEQV+  NLVG FLG KHAARVMIP
Sbjct  84   VNTTVSKYGKLDIMHSSAGIVGAWNPSILHNKKSHFEQVISVNLVGTFLGIKHAARVMIP  143

Query  93   KTRTGVDA  70
              R  + A
Sbjct  144  SGRGSIVA  151



>ref|XP_010324818.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Solanum lycopersicum]
Length=256

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+A+ KLFSR+G+KVVIAD+QDDL + VC +L+  S  FVHCDVTKE D+EN 
Sbjct  10   TGAASGIGEASAKLFSRYGSKVVIADIQDDLAQNVCKDLDPSSTTFVHCDVTKEEDLENV  69

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN  V K+GKLD+MYNNAGI G  K +IL+++ S+FE+V+ TNLVG FLG K AARVMIP
Sbjct  70   VNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIKQAARVMIP  129

Query  93   K  91
            +
Sbjct  130  R  130



>ref|XP_010262932.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=268

 Score =   172 bits (436),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T +LF RHGAKVVIADVQDDLG  VC ++ S +A+FVHCDVT E+ +  A
Sbjct  23   TGGASGIGESTVRLFCRHGAKVVIADVQDDLGHSVCNDIGSKAASFVHCDVTNESHIRKA  82

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+T V+K+GKLD+M+NNAGI G   P+ILD+D  EFEQV+  N+ G FLGTKHAARVMIP
Sbjct  83   VDTTVAKYGKLDIMFNNAGIVGTPNPNILDNDKGEFEQVLAVNITGPFLGTKHAARVMIP  142

Query  93   KTR  85
              R
Sbjct  143  ARR  145



>ref|XP_007132473.1| hypothetical protein PHAVU_011G097000g [Phaseolus vulgaris]
 gb|ESW04467.1| hypothetical protein PHAVU_011G097000g [Phaseolus vulgaris]
Length=269

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS HGA VVIAD+QDDLG  +C ELES  A +VHCDVT+E DVEN 
Sbjct  22   TGGASGIGEATARLFSEHGAHVVIADIQDDLGLSLCNELES--AVYVHCDVTEEEDVENC  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN AVSK+GKLD+M+NNAG   L K SILD+  S+FE+V+  NLVG FLGTKHAARVMIP
Sbjct  80   VNIAVSKYGKLDIMFNNAGSSDLFKRSILDNTKSDFERVLSVNLVGPFLGTKHAARVMIP  139

Query  93   KTR  85
              R
Sbjct  140  AKR  142



>gb|KDP26161.1| hypothetical protein JCGZ_22863 [Jatropha curcas]
Length=270

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 104/125 (83%), Gaps = 2/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG--SAAFVHCDVTKEADVE  280
            TGAASGIG+ T +LFS+HGA+VVIAD+QD+LG  V  E++      +FVHCDVTKE DVE
Sbjct  19   TGAASGIGECTARLFSKHGAQVVIADIQDELGHSVRKEIDRDGKYCSFVHCDVTKEEDVE  78

Query  279  NAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            NAVN+AVSK+G+LD+M+NNAGI G  KP+ILD++ +EFE+++  NLVGAFLGTKHAARVM
Sbjct  79   NAVNSAVSKYGELDIMFNNAGIVGAVKPNILDNEKAEFEKIISVNLVGAFLGTKHAARVM  138

Query  99   IPKTR  85
            IP  +
Sbjct  139  IPNRK  143



>ref|XP_004244887.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Solanum lycopersicum]
Length=263

 Score =   172 bits (435),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+A+ KLFSR+G+KVVIAD+QDDL + VC +L+  S  FVHCDVTKE D+EN 
Sbjct  17   TGAASGIGEASAKLFSRYGSKVVIADIQDDLAQNVCKDLDPSSTTFVHCDVTKEEDLENV  76

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN  V K+GKLD+MYNNAGI G  K +IL+++ S+FE+V+ TNLVG FLG K AARVMIP
Sbjct  77   VNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIKQAARVMIP  136

Query  93   K  91
            +
Sbjct  137  R  137



>ref|XP_009605455.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Nicotiana tomentosiformis]
Length=250

 Score =   171 bits (434),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  450  GAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENAV  271
            GAASGIG+A  +LFS HGAKVVIAD+QD+L +KVC +L+  S  FVHCD+TKE D+ENA 
Sbjct  5    GAASGIGEAAARLFSIHGAKVVIADIQDELAQKVCKDLDPTSTTFVHCDITKEEDLENAA  64

Query  270  NTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIPK  91
            NTAV K+GKLD+MYNNAGI G+ K +IL+ +  EFE+V   NLVG FLGTK AARVMIP 
Sbjct  65   NTAVDKYGKLDIMYNNAGIVGIIKSNILEDEKYEFEKVTSVNLVGTFLGTKQAARVMIPN  124

Query  90   TR  85
             R
Sbjct  125  GR  126



>ref|XP_006367118.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+A  KLFSR+GAKVVIAD+QDDL  KVC +L+  S  FVHCDVTKE D+EN 
Sbjct  17   TGAASGIGEAAAKLFSRYGAKVVIADIQDDLAHKVCKDLDPSSTTFVHCDVTKEEDLENV  76

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN  V K+GKLD+MYNNAGI G  K +IL+++ S+FE+V+ TNLVG FLG K AAR MIP
Sbjct  77   VNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIKQAARDMIP  136

Query  93   K  91
            +
Sbjct  137  R  137



>emb|CDP06872.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T +LF +HGAKVVIAD+QDDL +KVC +L+  SA+ VHCD T+E+D+ENA
Sbjct  22   TGGASGIGESTARLFVKHGAKVVIADIQDDLAKKVCQDLDPSSASHVHCDTTQESDIENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+M+NNAGI G    +ILD   S FE+V+  NLVG FLG KHAARVMIP
Sbjct  82   VNTAVSKYGKLDIMFNNAGIAGSGTSNILDDKKSGFERVISVNLVGVFLGAKHAARVMIP  141



>ref|XP_003540813.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=271

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS+HGA VVIAD+QDDLG  +C  LES  A++VHCDVTKE DVEN 
Sbjct  22   TGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHLES--ASYVHCDVTKEEDVENC  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+M NNAGI    K SILD++ S+FE V+  NLVG FLGTKHAARVMI 
Sbjct  80   VNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVISVNLVGPFLGTKHAARVMIA  139

Query  93   KTR  85
              R
Sbjct  140  AKR  142



>ref|NP_001239862.1| uncharacterized protein LOC100794412 [Glycine max]
 gb|ACU19399.1| unknown [Glycine max]
 gb|KHN44551.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   169 bits (429),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASG+G AT +LFS+HGA VVIAD+QDDLG  V  ELES  A++VHCDVTKE DVEN 
Sbjct  22   TGGASGLGAATARLFSKHGAYVVIADIQDDLGLSVAKELES--ASYVHCDVTKEEDVENC  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT VSK+GKLD+M+NNAG+    K SILD++ S+FE+V+  NLVG FLGTKHAARVMIP
Sbjct  80   VNTTVSKYGKLDIMFNNAGVSDEIKTSILDNNKSDFERVISVNLVGPFLGTKHAARVMIP  139

Query  93   KTR  85
              +
Sbjct  140  AKK  142



>gb|KHN21176.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   169 bits (428),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS+HGA +VIAD+QDDLG  +C  LES  A++VHCDVTKE DVEN 
Sbjct  22   TGGASGIGEATARLFSKHGAHLVIADIQDDLGLSLCKHLES--ASYVHCDVTKEEDVENC  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+M NNAGI    K SILD++ S+FE V+  NLVG FLGTKHAARVMI 
Sbjct  80   VNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVISVNLVGPFLGTKHAARVMIA  139

Query  93   KTR  85
              R
Sbjct  140  AKR  142



>ref|XP_006384780.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP62577.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=275

 Score =   169 bits (428),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++T + F +HGAKVVIAD QD+L   VC +L S SA+F+HCDVTKE DVENA
Sbjct  22   TGGARGIGESTARHFFKHGAKVVIADTQDELAHSVCKDLNSESASFIHCDVTKETDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTA+S+ GKLDVM+NNAGI G+ K +++D   SEFE+V+R NLVGAFLGTKHAARVM P
Sbjct  82   VNTAISRHGKLDVMFNNAGIVGVVKTNMVDVSMSEFEEVIRVNLVGAFLGTKHAARVMKP  141



>ref|XP_007132471.1| hypothetical protein PHAVU_011G096800g [Phaseolus vulgaris]
 gb|ESW04465.1| hypothetical protein PHAVU_011G096800g [Phaseolus vulgaris]
Length=269

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 96/123 (78%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS+HGA VVIAD+QD LG  +  ELES  A+++HCDVT E  VENA
Sbjct  22   TGGASGIGEATARLFSKHGAHVVIADIQDHLGLSLSKELES--ASYIHCDVTNEDHVENA  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNT VSK GKLD M+NNAGI G NK SILD+  SEFE V+  NLVG FLGTKHAARVMIP
Sbjct  80   VNTVVSKHGKLDTMFNNAGITGANKTSILDNTKSEFEAVINVNLVGVFLGTKHAARVMIP  139

Query  93   KTR  85
              R
Sbjct  140  AGR  142



>dbj|BAA13541.1| CPRD12 protein [Vigna unguiculata]
Length=267

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS+HGA VV+AD+QDD+G  +C EL+S  A +VHCDVTKE D+E  
Sbjct  22   TGGASGIGEATARLFSQHGAHVVVADIQDDVGLSLCNELKS--AIYVHCDVTKEEDIEKC  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+TAVSKFGKLD+M+NNAG G   K SILD+  S+FE+V+  NLVG FLGTKHAARVMIP
Sbjct  80   VDTAVSKFGKLDIMFNNAGTGDEFKKSILDNTKSDFERVISVNLVGPFLGTKHAARVMIP  139

Query  93   KTR  85
              R
Sbjct  140  ARR  142



>ref|XP_010246244.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=282

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELES-GSAAFVHCDVTKEADVEN  277
            TG ASGIGK+T KLF RHGAKVV+ADVQD+LG  +C EL+S  +A FVHCDV+KEADV++
Sbjct  22   TGGASGIGKSTAKLFVRHGAKVVVADVQDELGHSLCRELDSEDTAFFVHCDVSKEADVQS  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             V++ VSK+GKLD+MYNNA I G   P +L++D  +FE+V+  NL+GAFLG KHAARVMI
Sbjct  82   LVDSVVSKYGKLDIMYNNAAIPGNLNPELLETDPKDFERVLSVNLIGAFLGAKHAARVMI  141

Query  96   PKTR  85
            P+ +
Sbjct  142  PQKK  145



>gb|KHN21175.1| Momilactone A synthase [Glycine soja]
Length=304

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -2

Query  441  SGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENAVNTA  262
            +G  +AT +LFS+HGA VVIAD+QDDLG  +C  LES  A++VHCDVT E DVEN VNT 
Sbjct  22   TGGAEATARLFSKHGAHVVIADIQDDLGLSICKHLES--ASYVHCDVTNETDVENCVNTT  79

Query  261  VSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIPKTR  85
            VSK GKLD+M+NNAGI G+NK SILD+  SEFE+V+  NLVG FLGTKHAARVMIP  R
Sbjct  80   VSKHGKLDIMFNNAGITGVNKTSILDNTKSEFEEVINVNLVGVFLGTKHAARVMIPARR  138



>gb|KHN21177.1| Momilactone A synthase [Glycine soja]
Length=340

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS+HGA +VIAD+QDDLG  +C  LES  A++VHCDVTKE DVEN 
Sbjct  91   TGGASGIGEATARLFSKHGAHLVIADIQDDLGLSLCKHLES--ASYVHCDVTKEEDVENC  148

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+M NNAGI    K SILD++ S+FE V+  NLVG FLGTKHAARVMI 
Sbjct  149  VNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVISVNLVGPFLGTKHAARVMIA  208

Query  93   KTR  85
              R
Sbjct  209  AKR  211



>ref|XP_007132475.1| hypothetical protein PHAVU_011G097200g [Phaseolus vulgaris]
 gb|ESW04469.1| hypothetical protein PHAVU_011G097200g [Phaseolus vulgaris]
Length=268

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 102/128 (80%), Gaps = 2/128 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T +LF++HGAKVVIAD+QD+LG  VC +++S  + +VHCDVTKE  VE A
Sbjct  23   TGGASGIGECTARLFAKHGAKVVIADIQDELGHSVCKDIDS--SFYVHCDVTKEEHVERA  80

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVS+FGKLD+M+NNAGI G+  P+I+ +  S+FE+V+RTNLVG FLG KHAARVM P
Sbjct  81   VNTAVSRFGKLDIMHNNAGIIGVWNPNIIHNKKSDFEEVIRTNLVGVFLGMKHAARVMAP  140

Query  93   KTRTGVDA  70
              R  + A
Sbjct  141  SRRGSIIA  148



>ref|XP_011006659.1| PREDICTED: momilactone A synthase-like [Populus euphratica]
Length=275

 Score =   167 bits (422),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++T + F +HGAKVVIAD QD+L   VC +L S SA+F+HCD+TKE DVENA
Sbjct  22   TGGARGIGESTARHFFKHGAKVVIADTQDELAHSVCKDLNSESASFIHCDITKETDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTA+S+ GKLDVM+NNAGI G+ K +++D   SEFE+V+R NLVG FLGTKHAARVM P
Sbjct  82   VNTAISRHGKLDVMFNNAGIVGVVKTNMVDVSMSEFEEVIRVNLVGPFLGTKHAARVMKP  141



>ref|XP_003538100.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN08820.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   167 bits (422),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            +G ASGIG+AT +LFS+HGA VVIAD+QDDLG  +C  LES  A++VHCDVT E DV+NA
Sbjct  22   SGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHLES--ASYVHCDVTNENDVQNA  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTA+SK+G LD+M+NNAGI    K SILD+   +FE+V+  NLVG FLGTKHAARVMIP
Sbjct  80   VNTAISKYGNLDIMFNNAGIIDEIKTSILDNSKFDFERVISVNLVGPFLGTKHAARVMIP  139

Query  93   KTR  85
              R
Sbjct  140  AKR  142



>ref|XP_006367119.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   166 bits (421),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+   +LF+RHGA VVIAD+QDDL +KVC  L+  S  +VHCDVTKE D++N 
Sbjct  17   TGAASGIGEVAARLFTRHGAVVVIADIQDDLAQKVCENLDPSSITYVHCDVTKEDDLKNV  76

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+MYNNAGI    K +ILD++ SEFE+V+  NL+G F+G K AARVMIP
Sbjct  77   VNTAVSKYGKLDIMYNNAGIVDEIKSNILDNEKSEFEKVININLIGTFVGIKEAARVMIP  136

Query  93   K  91
            +
Sbjct  137  R  137



>gb|ACU18273.1| unknown [Glycine max]
Length=269

 Score =   167 bits (422),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            +G ASGIG+AT +LFS+HGA VVIAD+QDDLG  +C  LES  A++VHCDVT E DV+NA
Sbjct  22   SGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHLES--ASYVHCDVTNENDVQNA  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTA+SK+G LD+M+NNAGI    K SILD+   +FE+V+  NLVG FLGTKHAARVMIP
Sbjct  80   VNTAISKYGNLDIMFNNAGIIDEIKTSILDNSKFDFERVISVNLVGPFLGTKHAARVMIP  139

Query  93   KTR  85
              R
Sbjct  140  AKR  142



>ref|XP_010246807.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=285

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 99/129 (77%), Gaps = 4/129 (3%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL----ESGSAAFVHCDVTKEAD  286
            TG ASGIGK T +LF  HGAKVVIADVQD+LG+ +C EL    E G+A F+HCD+T+EAD
Sbjct  22   TGGASGIGKCTARLFVHHGAKVVIADVQDELGQALCQELGSVDEGGNALFIHCDITREAD  81

Query  285  VENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAAR  106
            +EN V++ VSK+GKLD+M+NNAGI G   P+IL +D  E E+V+  NLVG+ LG KHA R
Sbjct  82   IENVVDSTVSKYGKLDIMFNNAGISGALLPTILGTDKKEVERVLSVNLVGSLLGAKHATR  141

Query  105  VMIPKTRTG  79
            VMIP+ + G
Sbjct  142  VMIPQKKGG  150



>gb|KHN11533.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASG+G AT +LFS+HGA VVIAD+QDDLG  V  ELES  A++VHCDVT E DVEN 
Sbjct  22   TGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKELES--ASYVHCDVTNENDVENC  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+M+NNAGI    K SI+D+  S+FE+V+  NLVG FLGTKHAARVMIP
Sbjct  80   VNTAVSKYGKLDIMFNNAGIIDEIKTSIVDNSKSDFERVIGVNLVGPFLGTKHAARVMIP  139

Query  93   KTR  85
              +
Sbjct  140  AKK  142



>ref|XP_006481515.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Citrus sinensis]
Length=273

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELE-----SGSAAFVHCDVTKEA  289
            TG A  IG+ T +LFS+HGAKV+IAD++DDLG  VC ++      +   ++VHCDVTKE 
Sbjct  19   TGGAGSIGECTARLFSKHGAKVLIADIKDDLGESVCEDISSSSSSANGCSYVHCDVTKEK  78

Query  288  DVENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAA  109
            D+ENAVNTAVS++GKLD+M+NNAGI    KP+ILD+D +EFE+++  NLVGAFLGTKHAA
Sbjct  79   DIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAA  138

Query  108  RVMIPKTR  85
            RVM P  R
Sbjct  139  RVMKPAGR  146



>ref|XP_006424145.1| hypothetical protein CICLE_v10029347mg [Citrus clementina]
 gb|ESR37385.1| hypothetical protein CICLE_v10029347mg [Citrus clementina]
Length=188

 Score =   162 bits (410),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL-----ESGSAAFVHCDVTKEA  289
            TG ASG G+ T +LFSRHGAKV+IAD++DDLG  VC ++      +   ++VHCDVTKE 
Sbjct  22   TGGASGFGECTARLFSRHGAKVLIADIKDDLGESVCKDIGSSSSSANGCSYVHCDVTKEK  81

Query  288  DVENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAA  109
            ++ENAVNTAVS++GKLD+M+NNAGI    K +ILD+D +EFE+V+  NLVG FLGTKHAA
Sbjct  82   EIENAVNTAVSQYGKLDIMFNNAGIVDEAKHNILDNDQAEFERVLSVNLVGVFLGTKHAA  141

Query  108  RVMIPKTR  85
            RVM P  R
Sbjct  142  RVMKPAGR  149



>ref|XP_006481514.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Citrus sinensis]
Length=276

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELE-----SGSAAFVHCDVTKEA  289
            TG A  IG+ T +LFS+HGAKV+IAD++DDLG  VC ++      +   ++VHCDVTKE 
Sbjct  22   TGGAGSIGECTARLFSKHGAKVLIADIKDDLGESVCEDISSSSSSANGCSYVHCDVTKEK  81

Query  288  DVENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAA  109
            D+ENAVNTAVS++GKLD+M+NNAGI    KP+ILD+D +EFE+++  NLVGAFLGTKHAA
Sbjct  82   DIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAA  141

Query  108  RVMIPKTR  85
            RVM P  R
Sbjct  142  RVMKPAGR  149



>gb|KDO58270.1| hypothetical protein CISIN_1g044923mg, partial [Citrus sinensis]
Length=214

 Score =   163 bits (412),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELE-----SGSAAFVHCDVTKEA  289
            TG A  IG+   +LFS+HGAKV+IAD++DDLG  VC ++      +   ++VHCDVTKE 
Sbjct  19   TGGAGSIGECAARLFSKHGAKVLIADIKDDLGESVCEDISSSSSSANGCSYVHCDVTKEK  78

Query  288  DVENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAA  109
            D+ENAVNTAVS++GKLD+M+NNAGI    KP+ILD+D +EFE+++  NLVGAFLGTKHAA
Sbjct  79   DIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAA  138

Query  108  RVMIPKTR  85
            RVM P  R
Sbjct  139  RVMKPAGR  146



>emb|CAN68176.1| hypothetical protein VITISV_014635 [Vitis vinifera]
Length=265

 Score =   164 bits (415),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG  T KLF +HGAKV+IAD+QD+ G  +C +L   SA+FVHCDVTKE DV NA
Sbjct  22   TGGAGGIGSCTAKLFCQHGAKVLIADIQDEKGHSICKDLGPTSASFVHCDVTKELDVGNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++ A+SK+GKLD+M+NNAGI G  +P+ILD+D  EFE  +R N++G FLGTKHAARVM P
Sbjct  82   IDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFLGTKHAARVMAP  141

Query  93   KTR  85
              R
Sbjct  142  AGR  144



>ref|XP_010049792.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   164 bits (414),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++T +LFS+HGA+V+IAD++DDLG+ VC +L   +A+FVHCDV+ E+D++NA
Sbjct  22   TGGAGGIGESTARLFSKHGARVIIADIRDDLGKSVCKDLGPETASFVHCDVSSESDIKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            + TAV K GKLD+M NNA IG  +K SILD+D ++FE+VV  NL G FLGTKHAAR MIP
Sbjct  82   IATAVDKHGKLDIMVNNAAIGDPSKASILDNDKADFEKVVSVNLTGVFLGTKHAARAMIP  141

Query  93   KTR  85
              R
Sbjct  142  SQR  144



>ref|XP_003546632.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=269

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 97/123 (79%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASG+G AT +LFS+HGA VVIAD+QDDLG  V  ELES  A++VHCD T E DVEN 
Sbjct  22   TGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKELES--ASYVHCDATNENDVENC  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+M+NNAGI    K SI+D+  S+FE+V+  NLVG FLGTKHAARVMIP
Sbjct  80   VNTAVSKYGKLDIMFNNAGIIDEIKTSIVDNSKSDFERVIGVNLVGPFLGTKHAARVMIP  139

Query  93   KTR  85
              +
Sbjct  140  AKK  142



>ref|XP_010070261.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++T +LFS+HGAKV+IAD+ DDLG+ VC  L   +A+FVHCDV+ E DVENA
Sbjct  22   TGGACGIGESTARLFSKHGAKVIIADINDDLGKSVCKNLGPETASFVHCDVSSEPDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V TAV K GKLD+M NNA IG   K +ILD+D ++FE+V+  NL G FLGTKHAAR MIP
Sbjct  82   VATAVDKHGKLDIMVNNAAIGDPTKLNILDNDKADFEKVISVNLTGVFLGTKHAARAMIP  141

Query  93   KTRTGV  76
              R  +
Sbjct  142  SQRGSI  147



>ref|XP_006424148.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
 gb|ESR37388.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
Length=276

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELE-----SGSAAFVHCDVTKEA  289
            TG A  IG+   +LFS+HGAKV+IAD++DDLG  VC ++      +   ++VHCDVTKE 
Sbjct  22   TGGAGSIGECAARLFSKHGAKVLIADIKDDLGESVCEDISSSSSSANGCSYVHCDVTKEK  81

Query  288  DVENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAA  109
            D+ENAVNTAVS++GKLD+M+NNAGI    KP+ILD+D +EFE+++  NLVGAFLGTKHAA
Sbjct  82   DIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAA  141

Query  108  RVMIPKTR  85
            RVM P  R
Sbjct  142  RVMKPAGR  149



>gb|KCW83009.1| hypothetical protein EUGRSUZ_C04391, partial [Eucalyptus grandis]
Length=287

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++T +LFS+HGAKV+IAD++DDLG+ VC +L + +A+FVHCDV+ E+DVENA
Sbjct  22   TGGAGGIGESTARLFSKHGAKVIIADIRDDLGKSVCVDLGAETASFVHCDVSIESDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            + TAV KFGKLD+M NNA I    K +ILD+D ++FE+V+  NL G FLGTKHAAR MIP
Sbjct  82   IATAVDKFGKLDIMVNNAAISDPLKANILDNDKADFERVISVNLTGVFLGTKHAARAMIP  141

Query  93   KTRTG  79
             +R+G
Sbjct  142  -SRSG  145



>ref|XP_006424147.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
 gb|ESR37387.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
Length=273

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELE-----SGSAAFVHCDVTKEA  289
            TG A  IG+   +LFS+HGAKV+IAD++DDLG  VC ++      +   ++VHCDVTKE 
Sbjct  19   TGGAGSIGECAARLFSKHGAKVLIADIKDDLGESVCEDISSSSSSANGCSYVHCDVTKEK  78

Query  288  DVENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAA  109
            D+ENAVNTAVS++GKLD+M+NNAGI    KP+ILD+D +EFE+++  NLVGAFLGTKHAA
Sbjct  79   DIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAA  138

Query  108  RVMIPKTR  85
            RVM P  R
Sbjct  139  RVMKPAGR  146



>ref|XP_010051779.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=318

 Score =   163 bits (413),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++T +LFS+HGAKV+IAD++DDLG+ VC +L + +A+FVHCDV+ E+DVENA
Sbjct  22   TGGAGGIGESTARLFSKHGAKVIIADIRDDLGKSVCVDLGAETASFVHCDVSIESDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            + TAV KFGKLD+M NNA I    K +ILD+D ++FE+V+  NL G FLGTKHAAR MIP
Sbjct  82   IATAVDKFGKLDIMVNNAAISDPLKANILDNDKADFERVISVNLTGVFLGTKHAARAMIP  141

Query  93   KTRTG  79
             +R+G
Sbjct  142  -SRSG  145



>ref|XP_009388139.1| PREDICTED: momilactone A synthase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=242

 Score =   161 bits (407),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+AT KLF+RHGA++VIADVQDD G  +C  L    A++VHCDVT E+DV+ A
Sbjct  22   TGAASGIGEATAKLFARHGARIVIADVQDDKGHALCSALGPSVASYVHCDVTNESDVQQA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+  VS  GKLDVM+NNAGI G     +L+S+ S+FE VV TNLVG++LGTKHAAR M+P
Sbjct  82   VDATVSHHGKLDVMFNNAGIIGEPCLRLLESEKSDFEHVVATNLVGSYLGTKHAARAMLP  141

Query  93   KTR  85
              R
Sbjct  142  ARR  144



>gb|KCW45306.1| hypothetical protein EUGRSUZ_L01036, partial [Eucalyptus grandis]
Length=230

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++T +LFS+HGA+V+I D++DDLG+ VC +L   +A+FVHCDV+ E+D++NA
Sbjct  22   TGGAGGIGESTARLFSKHGARVIIGDIRDDLGKSVCKDLGPETASFVHCDVSSESDIKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            + TAV K GKLD+M NNA IG  +K SILD+D ++FE+VV  NL G FLGTKHA R MIP
Sbjct  82   IATAVDKHGKLDIMVNNAAIGDPSKASILDNDKADFEKVVSVNLTGVFLGTKHATRAMIP  141

Query  93   KTR  85
              R
Sbjct  142  SQR  144



>dbj|BAC53872.1| alcohol dehydroge [Phaseolus lunatus]
Length=274

 Score =   162 bits (409),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 93/123 (76%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG AT +LFS HGA VVIAD+QDDLG  VC EL+S  A +VHCDVTKE DVE  
Sbjct  22   TGGASGIGAATARLFSEHGAHVVIADIQDDLGLSVCNELKS--AVYVHCDVTKEEDVEKC  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN  VSK+GKLD+M NNAG     K SI+D+  SEFE+V+  N+VG FLGTKHAARVMIP
Sbjct  80   VNVTVSKYGKLDIMLNNAGTCHELKDSIVDNITSEFERVISVNVVGPFLGTKHAARVMIP  139

Query  93   KTR  85
              R
Sbjct  140  AKR  142



>ref|XP_006481516.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=276

 Score =   162 bits (409),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 102/128 (80%), Gaps = 5/128 (4%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAA-----FVHCDVTKEA  289
            TG A GIG+ T +LFS+HGAKV+IAD++DDLG  VC ++ S S++     +VHCDVTKE 
Sbjct  22   TGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIGSSSSSASGCSYVHCDVTKEK  81

Query  288  DVENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAA  109
            D+ENAVNTAV+++GKLD+M+NNAG     KP+ILD+D +EFE+++  NLVGAFLGTKHAA
Sbjct  82   DIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFERILSINLVGAFLGTKHAA  141

Query  108  RVMIPKTR  85
            RVM P  R
Sbjct  142  RVMKPAGR  149



>ref|XP_010691689.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   161 bits (408),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG  T KLF++HGAKV+IA++QDDLG  VC  L+   A+++HCDVT E  V+NA
Sbjct  22   TGGASGIGACTAKLFTKHGAKVMIAEIQDDLGLSVCKSLDPSVASYIHCDVTNEDHVQNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLN-KPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            V++ V+K+ KLD+M+NNAGI G + KP+ILD   S+FE+ V+TNL+G FLGTKHAARVMI
Sbjct  82   VDSTVAKYKKLDIMFNNAGIAGSHPKPNILDITQSDFEETVKTNLIGPFLGTKHAARVMI  141

Query  96   P  94
            P
Sbjct  142  P  142



>ref|XP_002272549.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG  T KLFS+HGAKV+IAD+QD+ G  +C +L   SA+F+HCDVTKE DV NA
Sbjct  22   TGGAGGIGSCTAKLFSQHGAKVLIADIQDEKGHLICRDLGPSSASFIHCDVTKELDVSNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++ AV+K GKLD+M+NNAGI G    +ILD+D +EFE  +R N++GAFLGTKHAARVM+P
Sbjct  82   IDEAVAKHGKLDIMFNNAGILGPKIINILDNDAAEFENTMRVNVLGAFLGTKHAARVMVP  141

Query  93   KTR  85
              R
Sbjct  142  AGR  144



>ref|XP_007152489.1| hypothetical protein PHAVU_004G135000g [Phaseolus vulgaris]
 gb|ESW24483.1| hypothetical protein PHAVU_004G135000g [Phaseolus vulgaris]
Length=270

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG+   KLF +HGAKVVIAD++D LG+ +  E+ +  A +VHCDV+KE DVENA
Sbjct  22   TGGARGIGEFMAKLFCKHGAKVVIADIRDQLGQALQHEIGTECATYVHCDVSKETDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN  VSK+GKLD+M NNA I    KP+ILD+D ++FE+VVR NLVG FLGTKHAARVMIP
Sbjct  82   VNITVSKYGKLDIMVNNAAISDDAKPNILDNDVTDFERVVRVNLVGPFLGTKHAARVMIP  141

Query  93   KTR  85
              R
Sbjct  142  AKR  144



>ref|XP_007152499.1| hypothetical protein PHAVU_004G135300g [Phaseolus vulgaris]
 gb|ESW24493.1| hypothetical protein PHAVU_004G135300g [Phaseolus vulgaris]
Length=270

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG+   KLF +HGAKVVIAD++D LG+ +  E+ +  A +VHCDV+KE DVENA
Sbjct  22   TGGARGIGEFMAKLFCKHGAKVVIADIRDQLGQALQHEIGTECATYVHCDVSKETDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN  VSK+GKLD+M NNA I    KP+ILD+D ++FE+VVR NLVG FLGTKHAARVMIP
Sbjct  82   VNITVSKYGKLDIMVNNAAISDDAKPNILDNDVTDFERVVRVNLVGPFLGTKHAARVMIP  141

Query  93   KTR  85
              R
Sbjct  142  AKR  144



>ref|XP_002275746.2| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=280

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELES-GSAAFVHCDVTKEADVEN  277
            TG ASGIG++T +LF RHGAKV+IADVQDD+G  +C  L S G+A+FVHCDVT ++DV+N
Sbjct  22   TGGASGIGESTARLFVRHGAKVIIADVQDDIGLSICEALGSHGTASFVHCDVTSDSDVKN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             V+TAVSK+GKLD+M+NNAGI G   P+IL ++N  F +V   N+ GAFLG KHAARVMI
Sbjct  82   VVDTAVSKYGKLDIMFNNAGISGNLDPTILGTENENFRRVFDVNVYGAFLGAKHAARVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PAKK  145



>ref|XP_002272838.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG  T KLF +HGAKV+IAD+Q + G  +C +L   SA+FVHCDVTKE DV NA
Sbjct  22   TGGAGGIGSCTAKLFCQHGAKVLIADIQYEKGHSICKDLGPTSASFVHCDVTKELDVGNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++ A+SK+GKLD+M+NNAGI G  +P+ILD+D  EFE  +R N++G FLGTKHAARVM P
Sbjct  82   IDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFLGTKHAARVMAP  141

Query  93   KTR  85
              R
Sbjct  142  AGR  144



>ref|XP_010040330.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=253

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++T +LFS+HGA+V+I D++DDLG+ VC +L   +A+FVHCDV+ E+D++NA
Sbjct  22   TGGAGGIGESTARLFSKHGARVIIGDIRDDLGKSVCKDLGPETASFVHCDVSSESDIKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            + TAV K GKLD+M NNA IG  +K SILD+D ++FE+VV  NL G FLGTKHA R MIP
Sbjct  82   IATAVDKHGKLDIMVNNAAIGDPSKASILDNDKADFEKVVSVNLTGVFLGTKHATRAMIP  141

Query  93   KTR  85
              R
Sbjct  142  SQR  144



>ref|XP_010050120.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++T +LF +HGAKV+IAD++DDLG+ VC +L + +A+FVHCDV+ E+DVENA
Sbjct  22   TGGAGGIGESTARLFLKHGAKVIIADIRDDLGKLVCKDLGAETASFVHCDVSIESDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            + TAV KFGKLD+M NNA I    K +ILD+D ++FE+V+  NL G FLGTKHAAR MIP
Sbjct  82   IATAVDKFGKLDIMVNNAAISDPPKANILDNDKADFERVISVNLTGVFLGTKHAARAMIP  141

Query  93   KTRTG  79
             +R+G
Sbjct  142  -SRSG  145



>gb|KCW83006.1| hypothetical protein EUGRSUZ_C04389, partial [Eucalyptus grandis]
Length=265

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++T +LF +HGAKV+IAD++DDLG+ VC +L + +A+FVHCDV+ E+DVENA
Sbjct  22   TGGAGGIGESTARLFLKHGAKVIIADIRDDLGKLVCKDLGAETASFVHCDVSIESDVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            + TAV KFGKLD+M NNA I    K +ILD+D ++FE+V+  NL G FLGTKHAAR MIP
Sbjct  82   IATAVDKFGKLDIMVNNAAISDPPKANILDNDKADFERVISVNLTGVFLGTKHAARAMIP  141

Query  93   KTRTG  79
             +R+G
Sbjct  142  -SRSG  145



>ref|XP_007132474.1| hypothetical protein PHAVU_011G097100g [Phaseolus vulgaris]
 gb|ESW04468.1| hypothetical protein PHAVU_011G097100g [Phaseolus vulgaris]
Length=268

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS HGA VVIAD+QDDLG  +C ELES  A +VHCDVTKE DVE  
Sbjct  22   TGGASGIGEATARLFSEHGAHVVIADIQDDLGLSLCNELES--AVYVHCDVTKEEDVEKC  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN AVSK+GKLD++ NNAG     K SI+++   +FE+V+  NLVG FLGTKHAARVMIP
Sbjct  80   VNVAVSKYGKLDIVLNNAGTCDEFKRSIVENSKCDFERVINVNLVGPFLGTKHAARVMIP  139

Query  93   KTR  85
              R
Sbjct  140  AKR  142



>gb|ACU19531.1| unknown [Glycine max]
Length=269

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 2/123 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASG+G AT +LFS+HGA VVIAD+QDDLG  V  ELES  A++VHCDVT E DVEN 
Sbjct  22   TGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKELES--ASYVHCDVTNEIDVENC  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+++NNAGI    K SI+D+  S+FE+V+   LVG FLGTKHAARVMIP
Sbjct  80   VNTAVSKYGKLDIIFNNAGIIDEIKTSIVDNSKSDFERVIGVILVGPFLGTKHAARVMIP  139

Query  93   KTR  85
              +
Sbjct  140  AKK  142



>ref|XP_006481517.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=276

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 98/128 (77%), Gaps = 5/128 (4%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL-----ESGSAAFVHCDVTKEA  289
            TG ASG G+ T +LFSRHGAKV+IAD++DDLG  VC ++      +   ++VHCDVTKE 
Sbjct  22   TGGASGFGECTARLFSRHGAKVLIADIKDDLGESVCKDIGSSSSSANGCSYVHCDVTKEK  81

Query  288  DVENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAA  109
            ++ENAVNTAVS++GKLD+M+NNAGI    K +ILD+D +EFE V+  NLVG FLGTKHAA
Sbjct  82   EIENAVNTAVSQYGKLDIMFNNAGIVDEAKHNILDNDQAEFELVLSVNLVGVFLGTKHAA  141

Query  108  RVMIPKTR  85
            RVM P  R
Sbjct  142  RVMKPAGR  149



>ref|XP_010040326.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW45304.1| hypothetical protein EUGRSUZ_L01033 [Eucalyptus grandis]
Length=270

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++T +LFS+HGA+V+IAD++DDLG  VC +L   +A+FVHCDV+ E+DVE A
Sbjct  22   TGGAGGIGESTARLFSKHGARVIIADIRDDLGESVCKDLGPETASFVHCDVSSESDVEKA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            +NTAV K GKLD+M NNA  G   K +ILD+D ++FE+VV  NL G FLGTKHAAR MIP
Sbjct  82   INTAVDKHGKLDIMVNNAATGEPVKANILDNDKADFERVVSVNLTGVFLGTKHAARAMIP  141

Query  93   KTR  85
              R
Sbjct  142  SRR  144



>emb|CBI28276.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG  T KLFS+HGAKV+IAD+QD+ G  +C +L   SA+F+HCDVTKE DV NA
Sbjct  57   TGGAGGIGSCTAKLFSQHGAKVLIADIQDEKGHLICRDLGPSSASFIHCDVTKELDVSNA  116

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++ AV+K GKLD+M+NNAGI G    +ILD+D +EFE  +R N++GAFLGTKHAARVM+P
Sbjct  117  IDEAVAKHGKLDIMFNNAGILGPKIINILDNDAAEFENTMRVNVLGAFLGTKHAARVMVP  176

Query  93   KTR  85
              R
Sbjct  177  AGR  179



>ref|XP_010691680.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691681.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691682.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691683.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691684.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691685.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691686.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T +LF++HGAKV+IAD+QDDLG+ VC  L    A+++HCDVT EA V+NA
Sbjct  22   TGGASGIGEYTAELFTKHGAKVMIADIQDDLGQSVCKNLGPSVASYIHCDVTNEAHVQNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGG-LNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            V++ V+K+ KLD+M+NNAGI G   K +ILD   SEFE++++ NL+G FLGTKHAARVMI
Sbjct  82   VDSTVAKYEKLDIMFNNAGIAGSYPKLNILDITQSEFEEIIKVNLIGPFLGTKHAARVMI  141

Query  96   P  94
            P
Sbjct  142  P  142



>gb|EYU18087.1| hypothetical protein MIMGU_mgv1a0119322mg, partial [Erythranthe 
guttata]
Length=165

 Score =   156 bits (394),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T KLF++HGAKVVIAD+QDDLGR V   L   ++ +VHCDVT E  V NA
Sbjct  22   TGGASGIGECTAKLFTKHGAKVVIADIQDDLGRSVVNALGPTNSTYVHCDVTDEDHVSNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV+ +GKLD+M+NNAG     KP I D+  S+FE+V+R NL G FLG KHAARVM+P
Sbjct  82   VDEAVAAYGKLDIMFNNAGTLDDPKPRIADNKKSDFERVLRVNLTGVFLGMKHAARVMVP  141

Query  93   KTRTG  79
              R G
Sbjct  142  AARGG  146



>gb|AFV30207.1| borneol dehydrogenase [Lavandula x intermedia]
Length=259

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 97/125 (78%), Gaps = 4/125 (3%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG++  +LFSRHGAKVVIAD+QD+L   +C +L S    FVHCDVTKE DVE A
Sbjct  17   TGAASGIGESAARLFSRHGAKVVIADIQDELALNICKDLGS---TFVHCDVTKEFDVETA  73

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVS +GKLD+M NNAGI G  K  I ++  S+F++VV  NLVG FLGTKHAARVMIP
Sbjct  74   VNTAVSTYGKLDIMLNNAGISGAPKYKISNTQLSDFKRVVDVNLVGVFLGTKHAARVMIP  133

Query  93   KTRTG  79
              R+G
Sbjct  134  N-RSG  137



>ref|XP_010917564.1| PREDICTED: momilactone A synthase-like [Elaeis guineensis]
Length=270

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT KLF+RHGA+V+IADVQDD GR +C  L S  A++VHCD+T E+ V +A
Sbjct  17   TGGASGIGEATAKLFTRHGARVMIADVQDDKGRALCESLGSSVASYVHCDMTDESHVRDA  76

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AVS+ GKLD+M+NNAGI G     IL S+ ++FE+VV  NLVG++LGTKHAARVMIP
Sbjct  77   VDAAVSRHGKLDIMFNNAGIIGSPCMQILKSEKADFERVVGINLVGSYLGTKHAARVMIP  136

Query  93   KTR  85
              R
Sbjct  137  ARR  139



>gb|KDP36160.1| hypothetical protein JCGZ_08804 [Jatropha curcas]
Length=278

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG+ T +LF +HGAKV+IADVQDDLG  +C E +S  + +FVHCDV+ ++DV+N
Sbjct  22   TGGASGIGECTARLFVKHGAKVLIADVQDDLGLSLCQEFDSPETISFVHCDVSSDSDVKN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AVS++GKLD+MYNNAGIGG   PSIL ++N +F++V   N+ G+FLG K+AA+VMI
Sbjct  82   AVDLAVSRYGKLDIMYNNAGIGGNPDPSILSAENEDFKKVFDVNVFGSFLGAKYAAKVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PNKK  145



>ref|XP_002323404.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEF05165.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=279

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSA-AFVHCDVTKEADVEN  277
            TG ASGIG+ T +LF +HG+KV+IADVQDDLGR +C E  S    ++VHC+VT ++DV+N
Sbjct  22   TGGASGIGECTARLFVQHGSKVLIADVQDDLGRALCQEYGSEEIISYVHCNVTVDSDVQN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TAVS++GKLD+M+NNAGI G  K SIL+SDN +F +V+  N+ G FLG KHAARVMI
Sbjct  82   AVDTAVSRYGKLDIMFNNAGISGNTKSSILNSDNEDFMRVLNINVCGGFLGAKHAARVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PAKK  145



>ref|XP_010917565.1| PREDICTED: momilactone A synthase-like isoform X1 [Elaeis guineensis]
Length=272

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT KLF+RHGA+V+IAD+QDD GR +C  L S  A++VHCDVT E+ V +A
Sbjct  22   TGGASGIGEATAKLFTRHGARVMIADIQDDKGRALCESLGSAVASYVHCDVTDESHVRDA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AVS+ GKLD+M+NNAGI G     I +S+ ++FE+V+  NLVG++LGTKHAARVMIP
Sbjct  82   VDAAVSRHGKLDIMFNNAGIAGSLCMQIRESEKADFERVMGINLVGSYLGTKHAARVMIP  141

Query  93   KTR  85
              R
Sbjct  142  ARR  144



>ref|XP_010049793.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW82605.1| hypothetical protein EUGRSUZ_C03995 [Eucalyptus grandis]
Length=270

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A  IG++T +LFS+HGA+V+IAD++DDLG  VC +L   +A+FVHCDV+ E+DVE A
Sbjct  22   TGGAGDIGESTARLFSKHGARVIIADIRDDLGESVCKDLGPETASFVHCDVSSESDVEKA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            +NTAV K GKLD+M NNA  G   K +ILD+D ++FE+VV  NL G FLGTKHAAR MIP
Sbjct  82   INTAVEKHGKLDIMVNNAATGEPVKANILDNDKADFERVVSVNLTGVFLGTKHAARAMIP  141

Query  93   KTR  85
              R
Sbjct  142  SRR  144



>ref|XP_009411944.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=275

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T KLF RHGAKVV+ADVQD+LG  VC  L   +A+F+HCDVT E DV  A
Sbjct  22   TGGASGIGECTAKLFCRHGAKVVVADVQDELGTAVCSGLGP-AASFIHCDVTSEDDVSAA  80

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV+KFG+LD+M+NNAGI G    +IL  + S+FE+VV  NLVG FLGTKHAARVMIP
Sbjct  81   VDHAVAKFGRLDIMFNNAGITGAACHNILQCEKSDFERVVGVNLVGPFLGTKHAARVMIP  140

Query  93   KTR  85
              +
Sbjct  141  ARK  143



>ref|XP_002308448.2| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEE91971.2| alcohol dehydroge family protein [Populus trichocarpa]
Length=277

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 100/126 (79%), Gaps = 5/126 (4%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG+++T+LF RHGAKVVIAD+QDDLG  VC E+ S  S ++VHCDVT+E+DVE 
Sbjct  22   TGGASGIGESSTRLFVRHGAKVVIADIQDDLGHSVCEEIGSDESLSYVHCDVTRESDVEK  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKP--SILDSDNSEFEQVVRTNLVGAFLGTKHAARV  103
            AVNTAVSK+GKLD+ ++NAGI G   P  S +D DN  F++V  TN+ GAFLG KHA+RV
Sbjct  82   AVNTAVSKYGKLDIFFSNAGILGKGDPQASAIDYDN--FKRVFDTNVYGAFLGAKHASRV  139

Query  102  MIPKTR  85
            MIP+ +
Sbjct  140  MIPEKK  145



>gb|KDP36168.1| hypothetical protein JCGZ_08812 [Jatropha curcas]
Length=277

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL-ESGSAAFVHCDVTKEADVEN  277
            TG ASGIG AT+ LF +HGAKVVI DVQDDLG+ +C E+ ++ + +++HCDVT ++DV+N
Sbjct  22   TGGASGIGAATSTLFVKHGAKVVIGDVQDDLGQSLCKEIDQNDTVSYLHCDVTDDSDVKN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             V+  VSK+GKLD+MYNNAGI G   P IL SDN  F++V   N+ G FLG KHAARVMI
Sbjct  82   VVDFTVSKYGKLDIMYNNAGITGDVDPKILGSDNENFKRVFDVNVYGGFLGAKHAARVMI  141

Query  96   PKTR  85
            PK +
Sbjct  142  PKNK  145



>gb|KDP34947.1| hypothetical protein JCGZ_09235 [Jatropha curcas]
Length=232

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A+ IG +  + F +HGAKV+I D+QDDLG+ +  EL +  A FVHCDVT E+D+ENA
Sbjct  22   TGGATSIGASIARTFCKHGAKVIIVDIQDDLGQSLSKELGTDKAIFVHCDVTIESDIENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+T +S FGKLD+M NNA  G  +KPSI+D++ ++FE+VV+ NL+G F+GTKHAARVMIP
Sbjct  82   VDTVISIFGKLDIMVNNAATGDPHKPSIVDNNVADFERVVKVNLIGVFIGTKHAARVMIP  141



>ref|XP_011043648.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=279

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSA-AFVHCDVTKEADVEN  277
            TG ASGIG+ T +LF +HG+KV+IADVQDDLG  +C E  S    ++VHC+VT ++DV+N
Sbjct  22   TGGASGIGECTARLFVQHGSKVLIADVQDDLGLALCQEYGSEEIISYVHCNVTVDSDVQN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TAVS++GKLD+M+NNAGI G +K SIL+SDN +F +V+  N+ G FLG KHAARVMI
Sbjct  82   AVDTAVSRYGKLDIMFNNAGISGNSKSSILNSDNEDFMRVLNINVYGGFLGAKHAARVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PAKK  145



>gb|KDP34949.1| hypothetical protein JCGZ_09237 [Jatropha curcas]
Length=270

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A+ IG +  + F +HGAKV+I D+QDDLG+ +  EL +  A FVHCDVT E+D+ENA
Sbjct  22   TGGATSIGASIVRTFCKHGAKVIIVDIQDDLGQSLSKELGTDKAIFVHCDVTIESDIENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+TA+  F KLD+M NNA IG   KPSI+D+D ++FE+VV+ NL+G FLGTKHAARVMIP
Sbjct  82   VDTAIFIFKKLDIMVNNAAIGDPRKPSIVDNDIADFERVVKVNLIGVFLGTKHAARVMIP  141



>gb|KDP34951.1| hypothetical protein JCGZ_09239 [Jatropha curcas]
Length=246

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A+ IG +  + F +HGAKV+I D+QDDLG+ +  EL +  A FVHCDVT E+D+ENA
Sbjct  22   TGGATSIGASIARTFCKHGAKVIIVDIQDDLGQSLSKELGTDKAVFVHCDVTIESDIENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+TA+S FGKLD++ NNA IG   KPSI+D+D  +F++VV+ NL+G FLG KHAARVMIP
Sbjct  82   VDTAISIFGKLDIIVNNAAIGDPRKPSIVDNDVVDFKRVVKVNLIGVFLGPKHAARVMIP  141



>ref|XP_009399160.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 96/122 (79%), Gaps = 6/122 (5%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T KLF+RHGA+V++AD+QDD GR +C  L  G A++VHCDVT EADVE A
Sbjct  22   TGGASGIGECTAKLFARHGARVIVADIQDDKGRALCAAL--GPASYVHCDVTDEADVERA  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKP--SILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            V+TAV+  GKLDVM+NNAG+  ++ P    L SD + FE+V+ TN +GAFLGTKHAARVM
Sbjct  80   VDTAVALHGKLDVMFNNAGV--MDPPVNGFLASDRAAFERVMATNALGAFLGTKHAARVM  137

Query  99   IP  94
            +P
Sbjct  138  VP  139



>gb|KDP36156.1| hypothetical protein JCGZ_08800 [Jatropha curcas]
Length=278

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG+ T +LF +HGAKV+IADV+DDLG  +C E  S  + ++VHCDV+ ++DV+ 
Sbjct  22   TGGASGIGECTARLFVKHGAKVLIADVKDDLGLSLCQEFSSPETISYVHCDVSSDSDVKK  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AVS++GKLD+MYNNAGI G+  P IL ++N +F++V   NL G+FLG KHAARVMI
Sbjct  82   AVDLAVSRYGKLDIMYNNAGIVGIPDPRILSTENEDFKKVFDVNLFGSFLGAKHAARVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PNKK  145



>ref|XP_008462605.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Cucumis melo]
Length=279

 Score =   154 bits (389),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 98/127 (77%), Gaps = 2/127 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TGAASG GK+T +LF +HGA+VV+ADVQD+L + +C EL S  S +++HCDVT ++DV+N
Sbjct  19   TGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEESVSYIHCDVTSDSDVKN  78

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AV ++GKLD+MYNNAGI G   P+IL +D   F++V   N+ G FLG KHAARVMI
Sbjct  79   AVDFAVERYGKLDIMYNNAGITGQMDPTILGTDGENFKKVFEVNVYGGFLGAKHAARVMI  138

Query  96   PKTRTGV  76
            P  R+GV
Sbjct  139  P-NRSGV  144



>ref|XP_010246229.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=274

 Score =   154 bits (389),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            T  ASG+G++  KLFS+HGAKVVIAD+QD+LG  VC EL   SA+F+HCDVT E+DVENA
Sbjct  23   TDGASGLGRSCAKLFSQHGAKVVIADIQDELGHSVCKELGPSSASFIHCDVTNESDVENA  82

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            VN AV++ GKLD+M  NAGI G    +IL +D  +F+QV+  N++G FLGTKHAARVMI
Sbjct  83   VNGAVARHGKLDIMLINAGIIGSPTVNILANDRGDFQQVLNVNVIGPFLGTKHAARVMI  141



>ref|XP_010262933.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010262934.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010262935.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=277

 Score =   154 bits (388),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 92/121 (76%), Gaps = 1/121 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELES-GSAAFVHCDVTKEADVEN  277
            TG ASGIG++T +LF+ HGAKVVIADV+D+LG  +C E+ S G+  F+HCDVTK+ADV N
Sbjct  22   TGGASGIGRSTARLFANHGAKVVIADVEDELGHSICEEVGSEGTICFIHCDVTKDADVRN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV++ V K GKLD+M++NAGI G     ILDSDN  F +V+  N  GAFLG KHA RVMI
Sbjct  82   AVDSTVDKHGKLDIMFSNAGITGSPTKKILDSDNENFRKVLEVNTFGAFLGAKHATRVMI  141

Query  96   P  94
            P
Sbjct  142  P  142



>gb|ADK56099.1| alcohol dehydrogenase [Artemisia annua]
Length=265

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG+   +LF +HGAKVVIADV DDLG+ +C +L S  A FVHCDVT E+D+EN 
Sbjct  18   TGGARGIGECIVRLFVKHGAKVVIADVNDDLGKLLCQDLGSKFACFVHCDVTIESDIENL  77

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            +NT ++K G+LD+M NNAG     K SILD++ S+F++VV  NL G FLGTKHAARVMIP
Sbjct  78   INTTIAKHGQLDIMVNNAGTVDEPKLSILDNEKSDFDRVVSINLAGVFLGTKHAARVMIP  137

Query  93   K  91
            K
Sbjct  138  K  138



>gb|KDP36159.1| hypothetical protein JCGZ_08803 [Jatropha curcas]
Length=279

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG+ T ++F +HGAKV+IAD+QDDLG+ +C E  S  + ++VHCDV+ ++DV+N
Sbjct  22   TGGASGIGECTARVFVKHGAKVLIADIQDDLGKSICQEYSSPETISYVHCDVSSDSDVKN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AVS++GKLD+M+NNAGI G  +  I  +DN +F++V+  N+ GAFLG KHAARVMI
Sbjct  82   AVDLAVSRYGKLDIMFNNAGISGTMEQRISSTDNQDFKKVIDVNVFGAFLGAKHAARVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PNKK  145



>gb|KCW58914.1| hypothetical protein EUGRSUZ_H01537, partial [Eucalyptus grandis]
Length=235

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = -2

Query  426  ATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENAVNTAVSKFG  247
            +T +LFS+HGAKV+IAD+ DDLG+ VC  L   +A+FVHCDV+ E DVENAV TAV K G
Sbjct  1    STARLFSKHGAKVIIADINDDLGKSVCKNLGPETASFVHCDVSSEPDVENAVATAVDKHG  60

Query  246  KLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIPKTRTGV  76
            KLD+M NNA IG   K +ILD+D ++FE+V+  NL G FLGTKHAAR MIP  R  +
Sbjct  61   KLDIMVNNAAIGDPTKLNILDNDKADFEKVISVNLTGVFLGTKHAARAMIPSQRGSI  117



>gb|KDP36157.1| hypothetical protein JCGZ_08801 [Jatropha curcas]
Length=254

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG+ T +LF +H AKV+IADVQDDLG  +C E  S  + ++VHCDV+ + DV+N
Sbjct  22   TGGASGIGECTVRLFVKHAAKVLIADVQDDLGLSLCQEFGSPETISYVHCDVSNDLDVKN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AVS++GKLD+M+NNAGI G   P IL +DN +F++VV  N  GAF+G KHAARVMI
Sbjct  82   AVDLAVSRYGKLDIMFNNAGISGNPDPRILSTDNQDFKKVVDVNAFGAFVGAKHAARVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PNKK  145



>ref|XP_009420509.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=266

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++T KLF R+GA+VVIAD+QDD GR +C  L +  A +VHCDVT E+D+ NA
Sbjct  23   TGGASGIGESTAKLFVRYGARVVIADIQDDKGRALCDLLGTADACYVHCDVTDESDMRNA  82

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+TAV++FGKLD+M++NAG        + DSD +EFE+V+  N+VGAFL TKHAARVM P
Sbjct  83   VDTAVARFGKLDIMFSNAGTLREFGKGLADSDKAEFERVMAVNVVGAFLATKHAARVMAP  142

Query  93   KTR  85
              R
Sbjct  143  ARR  145



>gb|KCW90500.1| hypothetical protein EUGRSUZ_A02619 [Eucalyptus grandis]
Length=283

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T ++F+ HGAKVVIADV D LG  VC  L   +A+FVHC+VT E+  + A
Sbjct  28   TGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVCDSLGRDTASFVHCNVTDESQTKAA  87

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V  AVS FGKLD+M+NNAGIGGLNK  I+D+D ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  88   VAEAVSTFGKLDIMFNNAGIGGLNKTRIIDNDKADFERVLAVNVTGVFLGVKHAAQAMIP  147

Query  93   KTR  85
              R
Sbjct  148  ARR  150



>emb|CBI30355.3| unnamed protein product [Vitis vinifera]
Length=188

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 95/126 (75%), Gaps = 2/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAF-VHCDVTKEADVEN  277
            TG ASGIG  T KLF +HGAKV++ADVQD LGR +C E+      F VHCDVT ++DV+N
Sbjct  19   TGGASGIGACTAKLFVKHGAKVIVADVQDQLGRSLCQEIGPAETVFDVHCDVTCDSDVQN  78

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TA+SK+GKLD+M++NAG+ G  +  I+ SDN+ F++V   N+ GAFL  KHAARVMI
Sbjct  79   AVDTAISKYGKLDIMFSNAGVHGEMESRIILSDNTNFKRVFDVNVYGAFLAAKHAARVMI  138

Query  96   PKTRTG  79
            P  +TG
Sbjct  139  P-AKTG  143



>ref|XP_003553613.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN02191.1| Momilactone A synthase [Glycine soja]
Length=280

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG AT KLF +HGAKV+IADVQD+LG+  C  L + +  +VHCDVT ++DV+N 
Sbjct  22   TGGASGIGAATAKLFVQHGAKVIIADVQDELGQFHCKTLGTTNIHYVHCDVTSDSDVKNV  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V  AVSK+GKLD+MYNNAGI G +  SI  SDN  F+ V   N+ GAFLG KHAARVMIP
Sbjct  82   VEFAVSKYGKLDIMYNNAGISGDSNRSITTSDNEGFKNVFGVNVYGAFLGAKHAARVMIP  141

Query  93   KTR  85
              R
Sbjct  142  AKR  144



>gb|KDP36165.1| hypothetical protein JCGZ_08809 [Jatropha curcas]
Length=354

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG+ T +LF +HGAKV+IADVQDDLG  +C E  S  + ++VHCDV+ ++DV+N
Sbjct  98   TGGASGIGECTARLFVKHGAKVLIADVQDDLGLSLCQEFSSPETISYVHCDVSSDSDVKN  157

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AVS++GKLD+MYNNAGIGG   P IL ++N +F++V   N+ G+FLG K+AA+VMI
Sbjct  158  AVDLAVSRYGKLDIMYNNAGIGGNPDPRILSTENEDFKKVFDVNVFGSFLGAKYAAKVMI  217

Query  96   PKTR  85
            P  +
Sbjct  218  PNKK  221



>ref|XP_010059374.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=321

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T ++F+ HGAKVVIADV D LG  VC  L   +A+FVHC+VT E+  + A
Sbjct  66   TGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVCDSLGRDTASFVHCNVTDESQTKAA  125

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V  AVS FGKLD+M+NNAGIGGLNK  I+D+D ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  126  VAEAVSTFGKLDIMFNNAGIGGLNKTRIIDNDKADFERVLAVNVTGVFLGVKHAAQAMIP  185

Query  93   KTR  85
              R
Sbjct  186  ARR  188



>ref|XP_007043248.1| Short chain alcohol dehydrogenase [Theobroma cacao]
 gb|EOX99079.1| Short chain alcohol dehydrogenase [Theobroma cacao]
Length=271

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+   +LF  HGAKV+IAD+QD+LG+ VC ++    A+FVHCD+ KE+DVE A
Sbjct  22   TGGASGIGECIARLFCEHGAKVIIADIQDELGQSVCKDIGLAVASFVHCDIVKESDVEIA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTA+S  GKLD+M NNA +    KPSI++++ ++FE+V+  NL G FLGTKHAARVMIP
Sbjct  82   VNTAISLHGKLDIMVNNAAVIDDAKPSIVENNVADFERVISVNLTGVFLGTKHAARVMIP  141

Query  93   KTR  85
              +
Sbjct  142  ARK  144



>gb|KDP36095.1| hypothetical protein JCGZ_08739 [Jatropha curcas]
Length=275

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGS---AAFVHCDVTKEADV  283
            TG ASGIG+AT +LF+RHGAKV+IADVQ+ LG+ +  E+ S +    +++ CDVT+E DV
Sbjct  22   TGGASGIGEATARLFARHGAKVLIADVQNKLGQSLSEEIRSETGQPVSYIQCDVTQETDV  81

Query  282  ENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARV  103
            ENAVNTAVS  GKLD+MYNNAGI G   P+IL  +  +F+ V+  NL GAFLG KHAARV
Sbjct  82   ENAVNTAVSMHGKLDIMYNNAGIIGKFDPNILSLEREDFKSVMDINLYGAFLGAKHAARV  141

Query  102  MIPKTR  85
            M+P+ +
Sbjct  142  MVPEKK  147



>ref|XP_004139501.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 ref|XP_004159104.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 gb|KGN64962.1| TASSELSEED2-like protein [Cucumis sativus]
Length=271

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG+ T KLF +HGAKVVIAD+QD LG+ +C +L   S+ FVHCDVTKE DVE A
Sbjct  21   TGGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLGQSSSVFVHCDVTKEKDVETA  80

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPS--ILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            V+TAVSK+GKLD+M NNAG+     P+  IL  D   F++VV  NLVGAFLGTKHAARVM
Sbjct  81   VDTAVSKYGKLDIMLNNAGVFE-ESPNFDILKDDPLTFQRVVNVNLVGAFLGTKHAARVM  139

Query  99   IPKTR  85
             P  R
Sbjct  140  KPAGR  144



>ref|XP_010246256.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Nelumbo nucifera]
Length=281

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG A+GIG++T +LF RHGAKVV+ADVQD+LGR VC ++ S  +  + HCDV+++A V +
Sbjct  22   TGGAAGIGESTARLFVRHGAKVVVADVQDELGRAVCNDIGSEETICYAHCDVSRDAHVRD  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ +VSK+GKLD+M+NNA I G +   IL +DN +F++VV  NL GAFLG KHAARVM+
Sbjct  82   AVDMSVSKYGKLDIMFNNAAIPGKSSKEILSTDNEDFKRVVDVNLYGAFLGAKHAARVMV  141

Query  96   PKTR  85
            P  R
Sbjct  142  PLKR  145



>ref|XP_010246261.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Nelumbo nucifera]
Length=281

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG A+GIG++T +LF RHGAKVV+ADVQD+LGR VC ++ S  +  + HCDV+++A V +
Sbjct  22   TGGAAGIGESTARLFVRHGAKVVVADVQDELGRAVCNDIGSEETICYAHCDVSRDAHVRD  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ +VSK+GKLD+M+NNA I G +   IL +DN +F++VV  NL GAFLG KHAARVM+
Sbjct  82   AVDMSVSKYGKLDIMFNNAAIPGKSSKEILSTDNEDFKRVVDVNLYGAFLGAKHAARVMV  141

Query  96   PKTR  85
            P  R
Sbjct  142  PLKR  145



>ref|XP_011094346.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=268

 Score =   151 bits (381),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 95/124 (77%), Gaps = 3/124 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG+AT KLF++HGAKV+IAD+QD+ G  +C E  S S  +VHCDVTKE+DV++A
Sbjct  13   TGGARGIGEATAKLFAKHGAKVIIADIQDERGHAICKEFPSIS--YVHCDVTKESDVKSA  70

Query  273  VNTAVSKFGKLDVMYNNAGIG-GLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            V+ AVS+ GKLD+M+NNAGI   +   S+LDS+ S FE+V   N+ GAFLG KHAARVMI
Sbjct  71   VDGAVSQHGKLDIMFNNAGITVPMQYSSVLDSEKSHFEKVFNVNVYGAFLGAKHAARVMI  130

Query  96   PKTR  85
            P  +
Sbjct  131  PAKK  134



>gb|EYU26737.1| hypothetical protein MIMGU_mgv1a011831mg [Erythranthe guttata]
Length=269

 Score =   151 bits (381),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A  +G AT KLF  HGAK++IADVQDDLGR++C  L   +A+++HCD+T E+ VENA
Sbjct  22   TGGAGRLGSATAKLFHEHGAKILIADVQDDLGRRICKTLSPQTASYIHCDITNESHVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V  A+SK GKLD+M+NNAG+ G     +L    S+FE+V+  N+ G FLGTKHAARVM P
Sbjct  82   VEEAISKHGKLDIMFNNAGVMGPTNTDMLVETKSDFERVLNVNITGTFLGTKHAARVMKP  141

Query  93   KTR  85
              R
Sbjct  142  AHR  144



>gb|KEH24184.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=195

 Score =   149 bits (375),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG AT KLF +HGAKV+IAD+QD++G+ +C EL   +  +VHC+VT E+D++N 
Sbjct  16   TGGASGIGAATAKLFVQHGAKVIIADIQDEVGQSLCNELGPKNILYVHCNVTTESDIKNV  75

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+TAVS +GKLD+M+NNAGI       IL+ D+  F++V   N+ GAFLG KHAARVMIP
Sbjct  76   VDTAVSNYGKLDIMFNNAGISDDKNREILNYDSEAFKRVFDVNVYGAFLGAKHAARVMIP  135

Query  93   KTR  85
              +
Sbjct  136  NKK  138



>gb|AFK45740.1| unknown [Lotus japonicus]
Length=274

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 92/125 (74%), Gaps = 2/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG--SAAFVHCDVTKEADVE  280
            TG ASGIG AT KLF +HGAKV+IAD+QDDLG  +C  LE    +  + HCDVT ++DV+
Sbjct  14   TGGASGIGAATAKLFVQHGAKVIIADIQDDLGMSLCKTLEPNFNNIIYAHCDVTNDSDVK  73

Query  279  NAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            NAV+ AVSK+GKLD+MYNNAGI G    SIL S +  F++V   N+ GAFLG KHAARVM
Sbjct  74   NAVDMAVSKYGKLDIMYNNAGITGDLNLSILASSDECFKRVFDVNVYGAFLGAKHAARVM  133

Query  99   IPKTR  85
            IP  R
Sbjct  134  IPAKR  138



>ref|XP_011094266.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Sesamum indicum]
Length=284

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSA-AFVHCDVTKEADVEN  277
            TG ASGIG+ T +LF +HGAKVVIADVQD+LG+  C ++ S    ++VHCDVT E DVEN
Sbjct  27   TGGASGIGEYTARLFVQHGAKVVIADVQDELGQTACRDIGSSEVISYVHCDVTNETDVEN  86

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             VNTAVSK+GKLD+M++NAG+ G N P IL +D  +  +V   N+ G FL  KHAARVMI
Sbjct  87   VVNTAVSKYGKLDIMFSNAGVPGNNDPRILATDYEDLRRVFDVNVFGGFLCAKHAARVMI  146

Query  96   PKTR  85
            P  R
Sbjct  147  PAKR  150



>ref|XP_011046902.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=279

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL-ESGSAAFVHCDVTKEADVEN  277
            TG ASGIG  T +LF +HGAKV+IAD+QDDLG   C E     + ++VHC+VT ++DV+N
Sbjct  22   TGGASGIGACTARLFVQHGAKVLIADIQDDLGHSFCQEFGPQETISYVHCNVTCDSDVQN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TAVSK+GKLD+M+NNAGI G  K  IL  DN  F++V+  N+ G FLG KHAARVMI
Sbjct  82   AVDTAVSKYGKLDIMFNNAGIPGDRKSGILTCDNENFKRVLDVNVYGGFLGAKHAARVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PAKK  145



>ref|XP_002275723.3| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=277

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 96/126 (76%), Gaps = 2/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAF-VHCDVTKEADVEN  277
            TG ASGIG+ T +LF +HGAKV++ADVQD LGR +C E+ S    F VHCDVT +AD++N
Sbjct  20   TGGASGIGECTARLFVKHGAKVIVADVQDQLGRSLCQEIGSEETIFYVHCDVTCDADIQN  79

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TA+SK+GKLD+M++NAGI G  +  I+ SDN+ F++V   N  GAFL  KHAARVMI
Sbjct  80   AVDTAISKYGKLDIMFSNAGISGEMESRIILSDNTNFKRVFDVNAYGAFLAGKHAARVMI  139

Query  96   PKTRTG  79
            P  +TG
Sbjct  140  P-AKTG  144



>dbj|BAE72096.1| Lactuca sativa short-chain dehydrogenase/reductase 1
Length=270

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+ T KLF+ HGAKVVIAD+QD LG+ VC  + + ++ +VHCDVT E D++NA
Sbjct  16   TGAASGIGECTAKLFAEHGAKVVIADIQDQLGQAVCEAIGTSNSIYVHCDVTNEEDIKNA  75

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+TAV+ +GKLD+M+NNAG+    K  I+D++ + FE+V+  N+ G FL  KHAARVM+P
Sbjct  76   VDTAVTTYGKLDIMFNNAGVVDPIKARIIDNEKTNFERVLNVNVTGVFLCMKHAARVMVP  135

Query  93   K  91
            +
Sbjct  136  Q  136



>ref|XP_011046907.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Populus euphratica]
Length=277

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 94/121 (78%), Gaps = 1/121 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELES-GSAAFVHCDVTKEADVEN  277
            TG ASGIG++T++LF  HGAKV+IADVQD +G+ +C EL +  +  +VHCDVT + DV+N
Sbjct  22   TGGASGIGESTSRLFVEHGAKVIIADVQDQVGQSLCKELLTEDNVCYVHCDVTSDTDVKN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             V+ A+SK+GKLD+M+NNAGI G   P+IL +DN +F++V   N+ G FLG KHAARVMI
Sbjct  82   VVDVAISKYGKLDIMHNNAGITGNIDPTILGTDNEDFKRVFEVNVYGGFLGAKHAARVMI  141

Query  96   P  94
            P
Sbjct  142  P  142



>ref|XP_011094267.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Sesamum indicum]
Length=280

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSA-AFVHCDVTKEADVEN  277
            TG ASGIG+ T +LF +HGAKVVIADVQD+LG+  C ++ S    ++VHCDVT E DVEN
Sbjct  23   TGGASGIGEYTARLFVQHGAKVVIADVQDELGQTACRDIGSSEVISYVHCDVTNETDVEN  82

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             VNTAVSK+GKLD+M++NAG+ G N P IL +D  +  +V   N+ G FL  KHAARVMI
Sbjct  83   VVNTAVSKYGKLDIMFSNAGVPGNNDPRILATDYEDLRRVFDVNVFGGFLCAKHAARVMI  142

Query  96   PKTR  85
            P  R
Sbjct  143  PAKR  146



>ref|XP_002523206.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF39237.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=270

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAA+ IG+   + F +HGAKVVIAD+QDDLG+ V  +     A FVHCDV+ E+DV+NA
Sbjct  22   TGAATSIGECIARSFCKHGAKVVIADIQDDLGQSVAKDHGQDVAMFVHCDVSVESDVKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+TAVS FGKLD+M NNA  G   KPSI+D+D ++ E+ +R NL+G FLGTKHAARVMIP
Sbjct  82   VDTAVSIFGKLDIMVNNAATGEPRKPSIVDNDLADVERALRVNLIGPFLGTKHAARVMIP  141



>ref|XP_011046906.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Populus euphratica]
Length=281

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 94/121 (78%), Gaps = 1/121 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELES-GSAAFVHCDVTKEADVEN  277
            TG ASGIG++T++LF  HGAKV+IADVQD +G+ +C EL +  +  +VHCDVT + DV+N
Sbjct  26   TGGASGIGESTSRLFVEHGAKVIIADVQDQVGQSLCKELLTEDNVCYVHCDVTSDTDVKN  85

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             V+ A+SK+GKLD+M+NNAGI G   P+IL +DN +F++V   N+ G FLG KHAARVMI
Sbjct  86   VVDVAISKYGKLDIMHNNAGITGNIDPTILGTDNEDFKRVFEVNVYGGFLGAKHAARVMI  145

Query  96   P  94
            P
Sbjct  146  P  146



>gb|KDP36171.1| hypothetical protein JCGZ_08815 [Jatropha curcas]
Length=276

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T K+F+ HGAK+VIADVQD+LG+ V   L   ++ +VHC+VT EA ++NA
Sbjct  21   TGGASGIGECTAKVFAHHGAKIVIADVQDELGQAVSQALGPSNSTYVHCNVTNEAHIKNA  80

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV+ +GKLD+M+NNAGI   NKP I+D++  +FE+V+  N+ G FLG KHAARVMIP
Sbjct  81   VDKAVATYGKLDIMFNNAGIVDPNKPRIIDNEKEDFERVLSVNVTGVFLGIKHAARVMIP  140

Query  93   KTR  85
              +
Sbjct  141  ARK  143



>ref|XP_002530513.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF31845.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=226

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 96/125 (77%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG  T K+F+ HGAKVVIADVQD+LG  V   L   ++ +VHC+VT E+ ++ A
Sbjct  22   TGGASGIGACTAKVFAHHGAKVVIADVQDELGHSVSESLGPSNSTYVHCNVTDESHIKIA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AVS +GKLD+M+NNAGI  +NKP I+D++ ++FE+V+  N+ G FLG KHAARVMIP
Sbjct  82   VDKAVSTYGKLDIMFNNAGIVDVNKPRIVDNEKADFERVLSVNVTGVFLGIKHAARVMIP  141

Query  93   KTRTG  79
             +R+G
Sbjct  142  -SRSG  145



>ref|XP_004305639.1| PREDICTED: momilactone A synthase-like [Fragaria vesca subsp. 
vesca]
Length=288

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG--SAAFVHCDVTKEADVE  280
            TG ASGIG++T +LF  HGAKV+IADVQD+L   +C EL+    S  +VHCDVT ++DV+
Sbjct  27   TGGASGIGESTARLFVYHGAKVIIADVQDELALSLCKELDPDQESIPYVHCDVTIDSDVK  86

Query  279  NAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            N V+ A+S +GKLD+MYNNAGI G   P+IL +D+  F+QV   N+ GAFLG KHAARVM
Sbjct  87   NVVDVAISNYGKLDIMYNNAGIPGNLDPTILGADHQNFKQVFDVNVYGAFLGAKHAARVM  146

Query  99   IP  94
            IP
Sbjct  147  IP  148



>ref|XP_002530176.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32231.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=340

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL-ESGSAAFVHCDVTKEADVEN  277
            TG ASGIG  T+ LF+++GAKV+IAD+Q+ LG+ +C E+ + G+ ++VHCDVT + DV+N
Sbjct  23   TGGASGIGAITSALFAQNGAKVIIADIQESLGQSLCQEIGKDGNVSYVHCDVTSDKDVKN  82

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             V+ A+SK+GKLD+MYNNAGI G N P+IL +DN  F++V   N+ G FLG KHAARVMI
Sbjct  83   IVDFAMSKYGKLDIMYNNAGISGNNDPTILGTDNENFKRVFEINVYGGFLGAKHAARVMI  142

Query  96   PKTR  85
            P  +
Sbjct  143  PAKK  146



>gb|AAK83036.1|AF286651_1 TASSELSEED2-like protein [Cucumis sativus]
Length=271

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG+ T KLF +HGAKVVIAD+QD LG+ +C +L   S+ FVHCDVTKE DVE A
Sbjct  21   TGGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLGQSSSVFVHCDVTKEKDVETA  80

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPS--ILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            V+TAVSK+GKLD+M NNAG+     P+   L  D   F++VV  NLVGAFLGTKHAARVM
Sbjct  81   VDTAVSKYGKLDIMLNNAGVFE-ESPNFDFLKDDPLTFQRVVNVNLVGAFLGTKHAARVM  139

Query  99   IPKTR  85
             P  R
Sbjct  140  KPAGR  144



>ref|XP_011043647.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=281

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG+ T KLF  HGAKVVIAD+QDDLG  V   L S  + +++HCDVT ++DV+ 
Sbjct  23   TGGASGIGECTAKLFVLHGAKVVIADIQDDLGEMVSKNLGSQETISYIHCDVTCDSDVKK  82

Query  276  AVNTAVSKFGKLDVMYNNAG-IGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            AV+ AVSK+GKLD+M+NNAG IG    P ILD +N EF++V+  NL GAFLG KHAARVM
Sbjct  83   AVDMAVSKYGKLDIMFNNAGVIGTCKAPRILDVENEEFKRVLDVNLFGAFLGAKHAARVM  142

Query  99   IPKTR  85
            IP  +
Sbjct  143  IPAKK  147



>ref|XP_010654129.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=282

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 95/126 (75%), Gaps = 2/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAF-VHCDVTKEADVEN  277
            TG ASGIG  T KLF +HGAKV++ADVQD LGR +C E+      F VHCDVT ++DV+N
Sbjct  19   TGGASGIGACTAKLFVKHGAKVIVADVQDQLGRSLCQEIGPAETVFHVHCDVTCDSDVQN  78

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TA+SK+GKLD+M++NAG+ G  +  I+ SDN+ F++V   N+ GAFL  KHAARVMI
Sbjct  79   AVDTAISKYGKLDIMFSNAGVHGEMESRIILSDNTNFKRVFDVNVYGAFLAAKHAARVMI  138

Query  96   PKTRTG  79
            P  +TG
Sbjct  139  P-AKTG  143



>gb|KDP36152.1| hypothetical protein JCGZ_08796 [Jatropha curcas]
Length=274

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSA-AFVHCDVTKEADVEN  277
            TG ASGIG+ T +LF   GAKV+IADVQDDLG  +C E  +    +++HC+VT ++DV+N
Sbjct  18   TGGASGIGECTARLFVEQGAKVLIADVQDDLGHSICQEFNNQEIISYIHCNVTSDSDVKN  77

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TAVS++GKLD+M+NNAG+ G    +IL SDN EF++V   N+ G FLG KHAARVMI
Sbjct  78   AVDTAVSRYGKLDIMFNNAGVSGSPGANILGSDNEEFKKVFDVNVFGPFLGAKHAARVMI  137

Query  96   PKTR  85
            P+ +
Sbjct  138  PEKK  141



>gb|KEH30870.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=151

 Score =   146 bits (369),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIGK T ++F + GAKVVIAD+QD+LG  V   + S +  +VHCDVT E+ ++NA
Sbjct  21   TGGASGIGKRTAEIFVQQGAKVVIADIQDELGHSVAQTIGSSTCTYVHCDVTDESQIKNA  80

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+T V  +GKL++M+NNAGIGG N   I+D+D ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  81   VDTTVQTYGKLNIMFNNAGIGGPNNSRIIDNDKADFERVLSVNVTGVFLGIKHAAQAMIP  140



>ref|XP_006653365.1| PREDICTED: momilactone A synthase-like [Oryza brachyantha]
Length=277

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T +LF++HGA+VV+AD+QD+ G ++CGEL  G+A++V CDVT E +V  A
Sbjct  25   TGGASGIGECTARLFAKHGARVVVADIQDEAGARLCGELGEGNASYVQCDVTVEEEVAAA  84

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV++FG LDVM+NNAGIGG    SIL+S  ++FE+V+  NLVG FLGTKHAARVM+P
Sbjct  85   VDHAVARFGALDVMFNNAGIGGEACHSILESSKADFERVLSVNLVGPFLGTKHAARVMVP  144

Query  93   KTRTG  79
              R G
Sbjct  145  AGRGG  149



>ref|XP_002526911.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF35464.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=282

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 98/125 (78%), Gaps = 2/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSA--AFVHCDVTKEADVE  280
            TG ASG+G+++ +LF +HGAKVV+ADVQD+LG  +C EL S     +++HCDVT ++DV+
Sbjct  22   TGGASGMGESSARLFVKHGAKVVVADVQDELGYSLCKELGSDQEIISYIHCDVTCDSDVQ  81

Query  279  NAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            NAV+ AVSK+GKLD+M++NAG+ G   PSI+D++N +F++V   N+ GAFL  KHAARVM
Sbjct  82   NAVDFAVSKYGKLDIMFSNAGVAGNVYPSIVDTENEDFKRVFDINVFGAFLAAKHAARVM  141

Query  99   IPKTR  85
            IP  +
Sbjct  142  IPAKK  146



>gb|KGN48288.1| hypothetical protein Csa_6G454360 [Cucumis sativus]
Length=279

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 98/127 (77%), Gaps = 2/127 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TGAASG GK+T +LF +HGA+VV+ADVQD+L + +C EL S  + +++HCDVT+++DV+ 
Sbjct  19   TGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEETVSYIHCDVTRDSDVKE  78

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AV ++GKLD+MYNNAGI G   P+IL ++   F++V   N+ G FLG KHAARVMI
Sbjct  79   AVDFAVERYGKLDIMYNNAGITGQMDPTILGTNGENFKKVFEVNVYGGFLGAKHAARVMI  138

Query  96   PKTRTGV  76
            P  R+GV
Sbjct  139  PN-RSGV  144



>ref|XP_002281352.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=282

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 95/126 (75%), Gaps = 2/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAF-VHCDVTKEADVEN  277
            TG ASGIG  T KLF +HGAKV++ADVQD LGR +C E+      F VHCDVT ++DV+N
Sbjct  19   TGGASGIGACTAKLFVKHGAKVIVADVQDQLGRSLCQEIGPAETVFDVHCDVTCDSDVQN  78

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TA+SK+GKLD+M++NAG+ G  +  I+ SDN+ F++V   N+ GAFL  KHAARVMI
Sbjct  79   AVDTAISKYGKLDIMFSNAGVHGEMESRIILSDNTNFKRVFDVNVYGAFLAAKHAARVMI  138

Query  96   PKTRTG  79
            P  +TG
Sbjct  139  P-AKTG  143



>emb|CBI30358.3| unnamed protein product [Vitis vinifera]
Length=195

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAF-VHCDVTKEADVEN  277
            TG ASGIG +T KLF +HGAKV++ADVQD LG  VC E+      F VHCDVT ++DV+N
Sbjct  19   TGGASGIGASTAKLFVKHGAKVIVADVQDQLGLSVCKEIGPEETVFYVHCDVTCDSDVQN  78

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TA+SK+GKLD+M++NAGI G  +  IL  DN+ F++V   N+ GAFL  KHAARVMI
Sbjct  79   AVDTAISKYGKLDIMFSNAGISGEMESGILLVDNTNFKRVFDVNVYGAFLAAKHAARVMI  138

Query  96   PKTRTG  79
            P  +TG
Sbjct  139  P-AKTG  143



>gb|KDP36172.1| hypothetical protein JCGZ_08816 [Jatropha curcas]
Length=277

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T K+F+ HGAK+VIADVQD+LG+ V   L   ++ +VHC+VT EA ++NA
Sbjct  21   TGGASGIGECTAKVFAHHGAKLVIADVQDELGQAVSQALGPSNSTYVHCNVTNEAHIKNA  80

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV+ +GKLD+M+NNAGI   NKP I+D++  +FE+V+  N+ G FLG KHAARVMIP
Sbjct  81   VDKAVATYGKLDIMFNNAGIVDPNKPRIIDNEKEDFERVLSVNVTGVFLGIKHAARVMIP  140

Query  93   KTRTGV  76
              +  +
Sbjct  141  ARKGSI  146



>gb|KDP36166.1| hypothetical protein JCGZ_08810 [Jatropha curcas]
Length=281

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 99/127 (78%), Gaps = 4/127 (3%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG+ T +LF +HGAKV+IAD+QDDLG+ +C E  S  + ++VHC+V+ ++DV+N
Sbjct  22   TGGASGIGECTARLFVKHGAKVLIADIQDDLGQSLCQEFSSPETISYVHCNVSSDSDVKN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGG---LNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAAR  106
            AV+ AVS++GKLD+M+NNAGI G    +   IL ++N +F++V+  N+ GAFLGTKHAAR
Sbjct  82   AVDLAVSRYGKLDIMFNNAGILGNPDFSNTRILPTENQDFKKVIDVNVFGAFLGTKHAAR  141

Query  105  VMIPKTR  85
            +MIP  +
Sbjct  142  IMIPNKK  148



>ref|XP_002309406.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE92929.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=270

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T K+F+ HGAKVV+AD+QD+ GR +   L   ++ +VHCDVT EA V+NA
Sbjct  18   TGGASGIGECTAKVFAHHGAKVVVADIQDESGRSLAKALGPSNSTYVHCDVTDEAQVKNA  77

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN AV+ +GKLD+M+NNAGI   +K  I+D++  +FE+V++TN+ G FLG KHAARVMIP
Sbjct  78   VNAAVTTYGKLDIMFNNAGIADESKARIIDNEKVDFERVLQTNVTGVFLGIKHAARVMIP  137



>gb|AAF98270.1|AF188188_1 sex determination protein [Cucumis sativus]
Length=118

 Score =   145 bits (365),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 89/119 (75%), Gaps = 3/119 (3%)
 Frame = -2

Query  450  GAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENAV  271
            G A GIG+ T KLF +HGAKVVIAD+QD LG+ +C +L   S+ FVHCDVTKE DVE AV
Sbjct  1    GGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLGQSSSVFVHCDVTKEKDVETAV  60

Query  270  NTAVSKFGKLDVMYNNAGIGGLNKPS--ILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            +TAVSK+GKLD+M NNAG+     P+  IL  D   F++VV  NLVGAFLGTKHAAR M
Sbjct  61   DTAVSKYGKLDIMLNNAGVFE-ESPNFDILKDDPLTFQRVVNVNLVGAFLGTKHAARAM  118



>emb|CDP02837.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAA GIG    ++F  HGAKVV  D+ ++LGR VC +L + +A+F++CDVTKE+D+ENA
Sbjct  93   TGAAQGIGACMARVFVNHGAKVVCVDINEELGRSVCDDLGAENASFLYCDVTKESDIENA  152

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            +N  V + GKLD+M NNAGI    K SILD+D S+FE+V+R NL G FLG KHAARVMIP
Sbjct  153  INRTVHEHGKLDIMINNAGIADEGKTSILDNDLSDFERVMRLNLSGVFLGIKHAARVMIP  212

Query  93   KTRTGV  76
                G+
Sbjct  213  ARSGGI  218



>ref|XP_004143392.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
Length=284

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 98/127 (77%), Gaps = 2/127 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TGAASG GK+T +LF +HGA+VV+ADVQD+L + +C EL S  + +++HCDVT+++DV+ 
Sbjct  19   TGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEETVSYIHCDVTRDSDVKE  78

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AV ++GKLD+MYNNAGI G   P+IL ++   F++V   N+ G FLG KHAARVMI
Sbjct  79   AVDFAVERYGKLDIMYNNAGITGQMDPTILGTNGENFKKVFEVNVYGGFLGAKHAARVMI  138

Query  96   PKTRTGV  76
            P  R+GV
Sbjct  139  PN-RSGV  144



>ref|XP_004170965.1| PREDICTED: zerumbone synthase-like, partial [Cucumis sativus]
Length=281

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 98/127 (77%), Gaps = 2/127 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TGAASG GK+T +LF +HGA+VV+ADVQD+L + +C EL S  + +++HCDVT+++DV+ 
Sbjct  19   TGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEETVSYIHCDVTRDSDVKE  78

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AV ++GKLD+MYNNAGI G   P+IL ++   F++V   N+ G FLG KHAARVMI
Sbjct  79   AVDFAVERYGKLDIMYNNAGITGQMDPTILGTNGENFKKVFEVNVYGGFLGAKHAARVMI  138

Query  96   PKTRTGV  76
            P  R+GV
Sbjct  139  PN-RSGV  144



>gb|KDP34955.1| hypothetical protein JCGZ_09243 [Jatropha curcas]
Length=270

 Score =   149 bits (376),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A+GIG +    F +HGAKV+I D+QDDLG+ +  EL +  A FVHCDVT E+D++NA
Sbjct  22   TGGATGIGASIATTFCKHGAKVIIVDIQDDLGQSLSKELGTDKAIFVHCDVTIESDIKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ A+S F KLD+M NNA I    K SI+D+D S+FE+VV+ NL+G FLGTKHAARVMIP
Sbjct  82   VDIAISIFRKLDIMVNNAAIADPRKLSIVDNDISDFERVVKVNLIGVFLGTKHAARVMIP  141



>ref|XP_010059357.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW90497.1| hypothetical protein EUGRSUZ_A02615 [Eucalyptus grandis]
Length=284

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 92/116 (79%), Gaps = 1/116 (1%)
 Frame = -2

Query  429  KATTKLFSRHGAKVVIADVQDDLGRKVCGEL-ESGSAAFVHCDVTKEADVENAVNTAVSK  253
            ++T +LF RHGAKVV+ADVQD LG  +C EL   G+ ++VHCDVT++ DV+NAV+ AV+K
Sbjct  37   ESTARLFVRHGAKVVVADVQDKLGPSLCEELGAEGAVSYVHCDVTRDEDVKNAVDFAVAK  96

Query  252  FGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIPKTR  85
            +GKLD+MYNNAGI G   P++LD+D  +F++V+  N+ GAFLG KHAARVMIP  R
Sbjct  97   YGKLDIMYNNAGITGKVYPTVLDADGEDFKRVLDINVCGAFLGAKHAARVMIPAKR  152



>ref|XP_010104812.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01953.1| Momilactone A synthase [Morus notabilis]
Length=275

 Score =   149 bits (376),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T K+F+ HGAK+VIAD+QDDLG  VC  L   ++ +VHC+VT E+ VENA
Sbjct  22   TGGASGIGECTAKVFAHHGAKLVIADIQDDLGHSVCESLGQTNSKYVHCNVTDESHVENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV  +G+LD+M+NNAGI   NK  I+DS+ ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  82   VDEAVKTYGRLDIMFNNAGIADENKARIIDSEKADFERVMSVNVTGVFLGIKHAAQAMIP  141



>ref|XP_002530171.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32226.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=282

 Score =   149 bits (375),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 98/125 (78%), Gaps = 2/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL--ESGSAAFVHCDVTKEADVE  280
            TG ASG+G+++ +LF +HGAKVV+ADVQD+LG  +C EL  +    +++HCDVT ++DV+
Sbjct  22   TGGASGMGESSARLFVKHGAKVVVADVQDELGHSLCRELGPDQEIISYIHCDVTCDSDVQ  81

Query  279  NAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            NAV+ AVSK+GKLD+M++NAG+ G   PSI+D++N +F++V   N+ GAFL  KHAARVM
Sbjct  82   NAVDFAVSKYGKLDIMFSNAGVAGNVYPSIVDTENEDFKRVFDINVFGAFLAAKHAARVM  141

Query  99   IPKTR  85
            IP  +
Sbjct  142  IPAKK  146



>ref|XP_011094268.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=275

 Score =   149 bits (375),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 2/127 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELE-SGSAAFVHCDVTKEADVEN  277
            TG ASG G++T +LF+RHGAKVVIADVQDD G+ +C +L      ++VHCDVT ++DV N
Sbjct  20   TGGASGFGESTARLFARHGAKVVIADVQDDRGQSLCRDLNLPDQISYVHCDVTSDSDVRN  79

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             V+ AVSK+G LD+M+NNAGI G    +I D+DN  F++V   N+ GAFLG KHAARVMI
Sbjct  80   VVDFAVSKYGNLDIMFNNAGIPGNLDFTIADADNDNFKRVFEVNVYGAFLGAKHAARVMI  139

Query  96   PKTRTGV  76
            P+ R GV
Sbjct  140  PE-RKGV  145



>gb|KDP36096.1| hypothetical protein JCGZ_08740 [Jatropha curcas]
Length=269

 Score =   148 bits (374),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 94/129 (73%), Gaps = 3/129 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGS---AAFVHCDVTKEADV  283
            TG ASGIG+AT +LF+R GAKVVI D+Q DLG  V  ++ES S    +++HCDV+KE+DV
Sbjct  16   TGGASGIGEATARLFARQGAKVVITDIQSDLGHSVSNQIESESNQPVSYIHCDVSKESDV  75

Query  282  ENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARV  103
            +NAVN AVS  G LD+M+NNAGI G   PSIL  +  +F++V+  N+ G  LG KHAARV
Sbjct  76   QNAVNAAVSMHGHLDIMFNNAGITGNYNPSILSIEREDFKKVMDINVYGGLLGAKHAARV  135

Query  102  MIPKTRTGV  76
            MIP+ +  +
Sbjct  136  MIPEKKGAI  144



>ref|XP_002309402.2| hypothetical protein POPTR_0006s22270g, partial [Populus trichocarpa]
 gb|EEE92925.2| hypothetical protein POPTR_0006s22270g, partial [Populus trichocarpa]
Length=275

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL-ESGSAAFVHCDVTKEADVEN  277
            TG ASGIG  T +LF +HGAKV+IAD+QDDLG   C E     + ++VHC+VT ++DV+N
Sbjct  9    TGGASGIGACTARLFVQHGAKVLIADIQDDLGHSFCQEFGPQETISYVHCNVTCDSDVQN  68

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TAV K+GKLD+M+NNAGI G  K  IL  DN  F++V+  N+ G FLG KHAARVMI
Sbjct  69   AVDTAVFKYGKLDIMFNNAGIPGDRKSGILTCDNENFKRVLDVNVYGGFLGAKHAARVMI  128

Query  96   PKTR  85
            P  +
Sbjct  129  PAKK  132



>emb|CBI30357.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFV-HCDVTKEADVEN  277
            TG ASGIG +T KLF +HGAKV++ DVQD LGR VC E+      F  HCDVT ++DV+N
Sbjct  72   TGGASGIGASTAKLFVKHGAKVIVTDVQDQLGRSVCKEIGPEETVFYDHCDVTCDSDVQN  131

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TA+SK+GKLD+M++NAGI G     IL SDN+ F++V   N  GAFL  KHAARVMI
Sbjct  132  AVDTAISKYGKLDIMFSNAGISGEVDSEILLSDNTNFKRVFDVNAYGAFLAAKHAARVMI  191

Query  96   PKTRTG  79
            P  +TG
Sbjct  192  P-AKTG  196



>ref|XP_006338927.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=279

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG+A T+LF++HGAKVV+AD+QDDLG+ +C EL S  + +F HCDVT E D+EN
Sbjct  22   TGGASGIGEAATRLFTKHGAKVVVADIQDDLGQALCKELGSNDTISFTHCDVTNENDMEN  81

Query  276  AVNTAVSKFGKLDVMYNNAGI-GGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            A++ AVS++GKLD+M++NAGI G +  PSIL +D + F+ V   N+ GAFLG K AA+ M
Sbjct  82   AIDRAVSRYGKLDIMFSNAGITGNMKDPSILATDYNNFKNVFDVNVYGAFLGAKIAAKAM  141

Query  99   IPKTR  85
            IP  +
Sbjct  142  IPTKK  146



>ref|XP_011046903.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
 ref|XP_011046904.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=277

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG+++ +LF RHGAKVVIAD+QDD G  VC E+ S  S ++V CDVT+E+DVE 
Sbjct  22   TGGASGIGESSARLFVRHGAKVVIADIQDDPGHSVCEEICSNESLSYVRCDVTRESDVEK  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKP--SILDSDNSEFEQVVRTNLVGAFLGTKHAARV  103
            AVNTAVSK+GKLD+ ++NAGI G   P  S +D DN  F++V  TN+ GAFLG KHA+RV
Sbjct  82   AVNTAVSKYGKLDIFFSNAGIFGKGDPQASAIDYDN--FKRVFDTNVYGAFLGAKHASRV  139

Query  102  MIPKTR  85
            MIP+ +
Sbjct  140  MIPEKK  145



>ref|XP_011043649.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=276

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 95/125 (76%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T K+FS HGAKV+IAD+QD+LG  V   L   ++ +V CDVT+EA ++N 
Sbjct  22   TGGASGIGECTAKVFSHHGAKVIIADIQDELGHSVVEALGPSNSTYVRCDVTEEAQIKNV  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+TA+S +GKLD+M NNAGI   NK  I+D++ ++FE+V++ N+ G FLG KHAARVMIP
Sbjct  82   VDTAISTYGKLDIMLNNAGIADDNKSRIIDNEMADFERVLKINVTGVFLGIKHAARVMIP  141

Query  93   KTRTG  79
              R+G
Sbjct  142  -ARSG  145



>ref|XP_002309405.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEE92928.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=277

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL-ESGSAAFVHCDVTKEADVEN  277
            TG ASGIG++T++LF  HGA V+IADVQD +G+ +C EL    +  +VHCDVT + DV+N
Sbjct  22   TGGASGIGESTSRLFVEHGANVIIADVQDQVGQSLCKELGTENNVYYVHCDVTSDTDVKN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             V+ A+SK+GKLD+MYNNAGI G   P+IL ++N  F++V   N+ G FLG KHAARVMI
Sbjct  82   VVDFAISKYGKLDIMYNNAGITGNIDPTILGTENENFKRVFEVNVYGGFLGAKHAARVMI  141

Query  96   P  94
            P
Sbjct  142  P  142



>gb|EPS74091.1| hypothetical protein M569_00663 [Genlisea aurea]
Length=318

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELE-SGSAAFVHCDVTKEADVEN  277
            TG ASG G+ T +LF RHGAKVVIADVQD+ GR +C EL      ++VHCDVTK++DV++
Sbjct  22   TGGASGFGETTARLFLRHGAKVVIADVQDERGRCICEELSFPDQISYVHCDVTKDSDVKS  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AV K+G+LDVM+NNAGI G    +I D+DN  F++V   N+ G FLG KHAARVMI
Sbjct  82   AVDFAVDKYGRLDVMFNNAGIPGRLDFTISDADNDNFKRVFEVNVYGGFLGAKHAARVMI  141

Query  96   PKTR  85
            P  R
Sbjct  142  PARR  145



>ref|XP_011094269.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=276

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T KLFS+HGAKV IAD+QD+L   V   +   ++ ++HCDVT E  V+NA
Sbjct  22   TGGASGIGECTAKLFSKHGAKVAIADIQDELAHSVVNSIGHSNSTYIHCDVTNEDHVKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+  VS +GKLD+M+NNAGI    KP I+D++ S+FE+V+  N+ G FLG KHAARVM+P
Sbjct  82   VDKTVSTYGKLDIMFNNAGIADRPKPRIIDNEKSDFERVMSINVTGVFLGMKHAARVMVP  141

Query  93   KTRTG  79
              R+G
Sbjct  142  -ARSG  145



>ref|XP_010104809.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01950.1| Momilactone A synthase [Morus notabilis]
Length=277

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T K+F+ HGAK+VIAD+QDDLG  V   +   S  +VHCDVT E+ V+NA
Sbjct  22   TGGASGIGECTAKVFAHHGAKLVIADIQDDLGYSVVESIGQTSCKYVHCDVTDESHVKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV  +GKLD+M NNAGI   NK  I+D++ ++FE+V+  N+ G FLG KHAARVMIP
Sbjct  82   VDEAVKTYGKLDIMLNNAGIADENKARIIDNEKADFERVMSVNVTGVFLGIKHAARVMIP  141

Query  93   KTR  85
              R
Sbjct  142  ARR  144



>ref|XP_002323403.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEF05164.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=279

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG+ + +LF +HGAKV+IAD+QDDLG  +C  L S  S +++HCDVT ++DV+N
Sbjct  22   TGGASGIGECSARLFVQHGAKVLIADIQDDLGEALCKNLGSQESISYIHCDVTCDSDVKN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNK-PSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            AV+ AVSK+GKLD+M+NNAGI G  K P IL  +  +F++V+  NL GAFLG KHAARVM
Sbjct  82   AVDMAVSKYGKLDIMFNNAGIVGTCKAPRILAVEIEDFKRVLDVNLFGAFLGAKHAARVM  141

Query  99   IPKTR  85
            IP  +
Sbjct  142  IPAKK  146



>ref|XP_010654128.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=282

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFV-HCDVTKEADVEN  277
            TG ASGIG +T KLF +HGAKV++ DVQD LGR VC E+      F  HCDVT ++DV+N
Sbjct  19   TGGASGIGASTAKLFVKHGAKVIVTDVQDQLGRSVCKEIGPEETVFYDHCDVTCDSDVQN  78

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TA+SK+GKLD+M++NAGI G     IL SDN+ F++V   N  GAFL  KHAARVMI
Sbjct  79   AVDTAISKYGKLDIMFSNAGISGEVDSEILLSDNTNFKRVFDVNAYGAFLAAKHAARVMI  138

Query  96   PKTRTG  79
            P  +TG
Sbjct  139  P-AKTG  143



>ref|XP_002281290.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=282

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFV-HCDVTKEADVEN  277
            TG ASGIG +T KLF +HGAKV++ DVQD LGR VC E+      F  HCDVT ++DV+N
Sbjct  19   TGGASGIGASTAKLFVKHGAKVIVTDVQDQLGRSVCKEIGPEETVFYDHCDVTCDSDVQN  78

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TA+SK+GKLD+M++NAGI G     IL SDN+ F++V   N  GAFL  KHAARVMI
Sbjct  79   AVDTAISKYGKLDIMFSNAGISGEVDSEILLSDNTNFKRVFDVNAYGAFLAAKHAARVMI  138

Query  96   PKTRTG  79
            P  +TG
Sbjct  139  P-AKTG  143



>dbj|BAE72097.1| Lactuca sativa short-chain dehydrogenase/reductase 2
Length=271

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 93/125 (74%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+   KLF+ HGAK+VIAD+QD LG+ VC  + S ++ ++HCDVT E DV  A
Sbjct  16   TGAASGIGECAAKLFAEHGAKIVIADIQDQLGQAVCEAIGSSNSIYIHCDVTNEEDVRKA  75

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ A++ +GKLD+M+ NAGI   NK  I+D++ S+FE+V+  N+ G FL  KHAARVM+P
Sbjct  76   VDIAIATYGKLDIMFCNAGIIDPNKDHIIDNEKSDFERVLSVNVTGVFLSMKHAARVMVP  135

Query  93   KTRTG  79
             TR G
Sbjct  136  -TRAG  139



>ref|XP_009789920.1| PREDICTED: xanthoxin dehydrogenase-like [Nicotiana sylvestris]
Length=280

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL-ESGSAAFVHCDVTKEADVEN  277
            TG ASGIG++  +LF +HGAKV IAD+QD+LG+ +C  L    SA FVHCDVT EAD+ N
Sbjct  24   TGGASGIGESIVRLFHKHGAKVCIADIQDELGQNICSTLGNDQSACFVHCDVTAEADISN  83

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+  + KFG LD+M NNAG+ G   P I D + S FE V+  NL G FLG KHAAR+MI
Sbjct  84   AVDLTIQKFGTLDIMVNNAGLSGPPIPDIRDYELSVFESVLDVNLKGTFLGIKHAARIMI  143

Query  96   PKTR  85
            P+ +
Sbjct  144  PQKK  147



>gb|AAK83035.1|AF286650_1 CTA [Cucumis sativus]
Length=271

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG+ T KLF +HGAKVVIAD+QD LG+ +C +L   S+ FVHCDVTKE DVE A
Sbjct  21   TGGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLGQSSSVFVHCDVTKEKDVETA  80

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPS--ILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            V+TAVSK+GKLD+M NNAG+     P+  IL  D   F++VV  NLVGA LGT+HAARVM
Sbjct  81   VDTAVSKYGKLDIMLNNAGVFE-ESPNFDILKDDPLTFQRVVNVNLVGASLGTRHAARVM  139

Query  99   IPKTR  85
             P  R
Sbjct  140  KPAGR  144



>ref|XP_010654127.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=282

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAF-VHCDVTKEADVEN  277
            TG ASGIG +T KLF +HGAKV++ADVQD LG  VC E+      F VHCDVT ++DV+N
Sbjct  19   TGGASGIGASTAKLFVKHGAKVIVADVQDQLGLSVCKEIGPEETVFYVHCDVTCDSDVQN  78

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TA+SK+GKLD+M++NAGI G  +  IL  DN+ F++V   N+ GAFL  KHAARVMI
Sbjct  79   AVDTAISKYGKLDIMFSNAGISGEMESGILLVDNTNFKRVFDVNVYGAFLAAKHAARVMI  138

Query  96   PKTRTG  79
            P  +TG
Sbjct  139  P-AKTG  143



>ref|XP_010104808.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01949.1| Momilactone A synthase [Morus notabilis]
Length=323

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 94/127 (74%), Gaps = 2/127 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL-ESGSAAFVHCDVTKEADVEN  277
            TG ASG+G+ T +LF RHGAKVVIAD+QD+LG  +  EL  S   ++VHCDVT ++DV++
Sbjct  60   TGGASGLGEGTARLFVRHGAKVVIADIQDELGLSLSQELGPSDVVSYVHCDVTSDSDVKS  119

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             V+ AVSK GKLD+MYNNAGI G   P+IL SDN  F++V   N+ G FLG KHAARVMI
Sbjct  120  LVDFAVSKHGKLDIMYNNAGITGDLDPTILGSDNDNFKRVFEVNVFGGFLGAKHAARVMI  179

Query  96   PKTRTGV  76
            P  R GV
Sbjct  180  P-ARKGV  185



>ref|XP_007162946.1| hypothetical protein PHAVU_001G193500g [Phaseolus vulgaris]
 gb|ESW34940.1| hypothetical protein PHAVU_001G193500g [Phaseolus vulgaris]
Length=279

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAA-FVHCDVTKEADVEN  277
            TG ASGIG +T KLF +HGAKV+IADVQD LG  +C    + +   ++HCDVT ++D++N
Sbjct  16   TGGASGIGASTAKLFLQHGAKVIIADVQDALGHSLCKTFSTNTPIHYLHCDVTSDSDIKN  75

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             V  A++K+GKLD+MYNNAGI G +  SI+ SD  EF++V   N+ GAFLG+KHAAR M+
Sbjct  76   VVEVAITKYGKLDIMYNNAGISGDSNRSIVTSDEEEFKRVFEVNVYGAFLGSKHAARFMV  135

Query  96   PKTR  85
            P  R
Sbjct  136  PAKR  139



>ref|XP_007027903.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08405.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=277

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T +LF   GAKVVIAD+QDDLG+ +C EL   S ++VHCDVT+++DV NA
Sbjct  22   TGGASGIGECTARLFVHQGAKVVIADIQDDLGQSICEELGHQSISYVHCDVTRDSDVRNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AVS +G LD+M+NNAGI G +K SI+ SD+ +F++V+  N+ G +LG K+AA+VMIP
Sbjct  82   VDLAVSTYGSLDIMFNNAGIAGPDK-SIVSSDDEKFKKVLDVNVFGGYLGAKYAAKVMIP  140

Query  93   KTR  85
              +
Sbjct  141  ARK  143



>ref|XP_008798880.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Phoenix dactylifera]
Length=269

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T +LFS+HGAKVV+AD+QD+ GR VC  +    A FVHCDVTKE+DV+ A
Sbjct  17   TGGASGIGECTARLFSQHGAKVVVADIQDERGRSVCDTI---GATFVHCDVTKESDVQKA  73

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++TAV+  GKLD+M+NNAGI    KP I D+  S+F +V+   + GAFLGTKHAARVM+P
Sbjct  74   IDTAVTGHGKLDIMFNNAGIIDAGKP-ITDTALSDFHKVIDVIVTGAFLGTKHAARVMVP  132

Query  93   KTR  85
              R
Sbjct  133  AGR  135



>ref|XP_004975524.1| PREDICTED: momilactone A synthase-like [Setaria italica]
Length=275

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T +LF +HGA+VV+AD+QD+LG ++C EL + +A++VHCDVT EADV   
Sbjct  24   TGGASGIGECTARLFVKHGARVVVADIQDELGGRLCAELGAAAASYVHCDVTAEADVAAV  83

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV++FG LD+M+NNAGIGG    SI +S   +FE+V+  NLVG FLGTKHAARVM+P
Sbjct  84   VDHAVARFGGLDIMFNNAGIGGAACHSIRESTKEDFERVLSVNLVGPFLGTKHAARVMVP  143

Query  93   KTRTG  79
              R G
Sbjct  144  AGRGG  148



>ref|XP_007027908.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08410.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=274

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASG+G++T +LF +HGAKV+IAD+QD+LG  +C EL + + ++VHCDVT E+DV+NA
Sbjct  19   TGGASGLGESTARLFVQHGAKVLIADIQDELGHSLCQELGTETISYVHCDVTCESDVQNA  78

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V  AVSK+ KLD+M NNAGI G ++  + D+D   F+ V   N++G FLG KHAARVM+P
Sbjct  79   VELAVSKYRKLDIMLNNAGIMGHHEVRVTDADTENFKTVFDINVLGGFLGAKHAARVMVP  138

Query  93   KTR  85
              +
Sbjct  139  AKK  141



>ref|XP_006359043.1| PREDICTED: xanthoxin dehydrogenase-like [Solanum tuberosum]
Length=280

 Score =   147 bits (370),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL-ESGSAAFVHCDVTKEADVEN  277
            TG ASGIG++  +LF +HGAKV I D+QD+LG++VC  L +  SA F+HCDVT E DV N
Sbjct  24   TGGASGIGESIVRLFHKHGAKVCIVDIQDELGQRVCESLGDEESACFIHCDVTSETDVSN  83

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AV KFG LD+M NNAG+ G    +ILD D S F+ V+  N+ G FLG KHAAR+MI
Sbjct  84   AVDFAVEKFGTLDIMVNNAGLTGAPCSNILDYDLSVFDNVLDVNVRGVFLGMKHAARIMI  143

Query  96   PKTR  85
            P+ R
Sbjct  144  PRKR  147



>gb|KHG10215.1| hypothetical protein F383_13541 [Gossypium arboreum]
Length=272

 Score =   146 bits (368),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG++TT++F  HGA V++AD+QD+LG+ +C +L S  + ++ HCDV  E+DV+N
Sbjct  20   TGGASGIGESTTRVFVEHGATVLVADIQDELGQSLCKQLGSPETVSYTHCDVKSESDVQN  79

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+TAVS++GKLD+M+NNAGI G  +P ++ S+   F++V   N++G FLG KHAARVMI
Sbjct  80   AVDTAVSRYGKLDIMFNNAGIAGEAEPRLIASNLHNFKRVFDVNVLGGFLGAKHAARVMI  139

Query  96   PKTR  85
            P  +
Sbjct  140  PAKK  143



>ref|XP_004169912.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
Length=274

 Score =   146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++  K F  HGAKVVIAD+ DDLG  +   L S S +FVHC+VTKE DVEN 
Sbjct  21   TGGARGIGESIAKHFFNHGAKVVIADILDDLGNSLSNHLSSSSTSFVHCNVTKETDVENV  80

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+M+NNAGI G  K +IL+++ S+F+ V+  NLVGAFLGTKHAA+ MIP
Sbjct  81   VNTAVSKYGKLDIMFNNAGIPGALKFNILENEYSDFQNVLNVNLVGAFLGTKHAAKAMIP  140



>emb|CDP20435.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   146 bits (368),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELES-GSAAFVHCDVTKEADVEN  277
            TG ASG G++T +LF +HGA+V+IADVQDDLG  +  EL S G   FVHCDVTK+ DV+N
Sbjct  25   TGGASGFGESTVRLFVQHGARVIIADVQDDLGHSLREELSSSGDVTFVHCDVTKDIDVKN  84

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
             V+ A+S++GKLD+MYNNAGI G    +I+D+DN  F++V   N+ GAFLG K+AA+VMI
Sbjct  85   LVDLAMSQYGKLDIMYNNAGIPGNLDFTIVDADNENFKRVFDVNVYGAFLGAKYAAKVMI  144

Query  96   PKTR  85
            P  +
Sbjct  145  PAKK  148



>ref|XP_007202842.1| hypothetical protein PRUPE_ppa014608mg, partial [Prunus persica]
 gb|EMJ04041.1| hypothetical protein PRUPE_ppa014608mg, partial [Prunus persica]
Length=263

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T K+F++HGAK+VIADVQDDLG  V   +      FVHCDVT EA ++NA
Sbjct  9    TGGASGIGECTAKIFAQHGAKIVIADVQDDLGHSVRESMGPTDCTFVHCDVTDEAQIKNA  68

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV+ +GKLD+M+NNAGI   NK  I+D++ ++FE+++  N+ G FLG KHAA+VMIP
Sbjct  69   VHKAVATYGKLDIMFNNAGIVDDNKARIIDNEKADFERILSVNVTGVFLGIKHAAQVMIP  128



>ref|XP_004136701.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
 ref|XP_004164972.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
Length=278

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGE-LESGSAAFVHCDVTKEADVEN  277
            TG ASGIG+ T KLF  HGAKVVIAD+QDDLG  +C   L S ++ +VHCDVT+E+ V+ 
Sbjct  24   TGGASGIGECTAKLFVHHGAKVVIADIQDDLGHALCANVLGSTNSLYVHCDVTEESQVQE  83

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV  AV  FGKLD+M NNAGI   +KP I+D+D  +F++V+  N+ G FLG KHAA+ MI
Sbjct  84   AVAAAVETFGKLDIMMNNAGIADPSKPRIIDNDKHDFDRVLSINVTGVFLGIKHAAQAMI  143

Query  96   PKTRTG  79
            P  +TG
Sbjct  144  P-AKTG  148



>ref|XP_002323405.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEF05166.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=276

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 95/125 (76%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T K+FS HGAKVVIAD+QD+LG  V   L   ++ +V CDVT+EA ++NA
Sbjct  22   TGGASGIGECTAKVFSHHGAKVVIADIQDELGHSVVEALGPSNSTYVRCDVTEEAQIKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ A+S +GKLD+M NNAGI   +K  I+D++ ++FE+V++ N+ G FLG KHAARVMIP
Sbjct  82   VDKAISTYGKLDIMLNNAGIADDSKARIIDNEMADFERVLKINVTGVFLGIKHAARVMIP  141

Query  93   KTRTG  79
              R+G
Sbjct  142  -ARSG  145



>ref|XP_002524074.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF38284.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=211

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELES---GSAAFVHCDVTKEADV  283
            TG ASGIG++T +LF+++GAKVVIAD+Q +LG+ V  +++S      ++VHCDV  E DV
Sbjct  22   TGGASGIGESTARLFAKNGAKVVIADIQSELGQSVSAKIQSEFGQPVSYVHCDVATETDV  81

Query  282  ENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARV  103
            ENAVNTAVS  GKLD+M+NNAGIGG    SI  +++  F +V+  N+ G FLG KHA+RV
Sbjct  82   ENAVNTAVSLHGKLDIMFNNAGIGGPPDISISSTEHEAFRRVMDVNVYGGFLGAKHASRV  141

Query  102  MIPKTR  85
            MIPK +
Sbjct  142  MIPKKK  147



>ref|XP_007043243.1| Short chain alcohol dehydrogenase [Theobroma cacao]
 gb|EOX99074.1| Short chain alcohol dehydrogenase [Theobroma cacao]
Length=271

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASG+G+   +LF  HGAKV+I D+QD+LG+ VC ++    A+FV CD+ KE+DVE A
Sbjct  22   TGGASGLGECIARLFCEHGAKVIITDIQDELGQSVCKDIGLAVASFVLCDIVKESDVEIA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTA+S  GKLD+M NNA +    KPSI++++ ++FE+V+  NL G FLGTKHAARVMIP
Sbjct  82   VNTAISLHGKLDIMVNNAAVIDDAKPSIVENNVADFERVISINLTGVFLGTKHAARVMIP  141

Query  93   KTR  85
              +
Sbjct  142  ARK  144



>ref|XP_006430117.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
 gb|ESR43357.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
Length=275

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 95/125 (76%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG  T K+F++ GAKVVIAD+Q+ LG  V   + + ++++VHCDVT E+ ++NA
Sbjct  22   TGGASGIGACTAKVFAQQGAKVVIADIQEQLGHSVVESIGTSNSSYVHCDVTNESHIKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++  V+  GKLD+M+NNAGIGG NK  I+D++ ++FE+V+  N+ G FLG KHAARVMIP
Sbjct  82   IDQTVATHGKLDIMFNNAGIGGANKTRIIDNEKADFERVLSVNVTGVFLGIKHAARVMIP  141

Query  93   KTRTG  79
              R+G
Sbjct  142  -ARSG  145



>gb|KDO35956.1| hypothetical protein CISIN_1g046809mg, partial [Citrus sinensis]
Length=269

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 96/125 (77%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG  T K+F++ GAKVVIAD+Q++LG  V   + + ++++VHCDVT E+ ++NA
Sbjct  16   TGGASGIGACTAKVFAQQGAKVVIADIQEELGHSVVESIGTSNSSYVHCDVTNESHIKNA  75

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++  V+  GKLD+M+NNAGIGG NK  I+D++ ++FE+V+  N+ G FLG KHAARVMIP
Sbjct  76   IDQTVATHGKLDIMFNNAGIGGPNKTRIIDNEKADFERVLSVNVTGVFLGIKHAARVMIP  135

Query  93   KTRTG  79
              R+G
Sbjct  136  -ARSG  139



>ref|XP_006481701.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=275

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 96/125 (77%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG  T K+F++ GAKVVIAD+Q++LG  V   + + ++++VHCDVT E+ ++NA
Sbjct  22   TGGASGIGACTAKVFAQQGAKVVIADIQEELGHSVVESIGTSNSSYVHCDVTNESHIKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++  V+  GKLD+M+NNAGIGG NK  I+D++ ++FE+V+  N+ G FLG KHAARVMIP
Sbjct  82   IDQTVATHGKLDIMFNNAGIGGPNKTRIIDNEKADFERVLSVNVTGVFLGIKHAARVMIP  141

Query  93   KTRTG  79
              R+G
Sbjct  142  -ARSG  145



>ref|XP_009626741.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Nicotiana 
tomentosiformis]
Length=268

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG  T K F ++GAKVVI DVQDD G  +C E+ S   ++VHCDVT E  VE A
Sbjct  11   TGGASGIGATTAKFFVKNGAKVVILDVQDDFGHSLCNEIGSDHISYVHCDVTNEIQVEKA  70

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++ AVSK+GKLD+MYNNAGI G   P I  +D    ++V   N+ GAFLG KHAARVMIP
Sbjct  71   IDFAVSKYGKLDIMYNNAGITGSIDPRITTTDYENLKKVFDINVFGAFLGAKHAARVMIP  130

Query  93   KTRTG  79
              +TG
Sbjct  131  -AKTG  134



>ref|XP_008243483.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=293

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (73%), Gaps = 2/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG--SAAFVHCDVTKEADVE  280
            TG ASGIG++T +LF +HGAKV+IADVQD+L   +C EL+    S  ++ CDVT E+DV+
Sbjct  32   TGGASGIGESTVRLFVKHGAKVIIADVQDELSLSLCKELDPDEESVCYIRCDVTVESDVK  91

Query  279  NAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            N V+ A+SK+ KLD+MYNNAGI G  +P+IL +    F+QV   N+ GAFLG KHAAR M
Sbjct  92   NVVDLALSKYAKLDIMYNNAGIPGNLEPTILSARAENFKQVFDVNVYGAFLGAKHAARAM  151

Query  99   IPKTR  85
            IP  +
Sbjct  152  IPAKK  156



>ref|XP_009387285.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=267

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T KLF++HGA+VV+ D+QDD G  +C +L    A++VHCDVT EADV++A
Sbjct  22   TGGASGIGECTAKLFAQHGARVVVVDIQDDKGHSLCADLGPAVASYVHCDVTIEADVKHA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+TAVS  GKLD+M+NNAG+        L+ + S FE VV  N++GA+LGTKHAARVM P
Sbjct  82   VDTAVSLHGKLDIMFNNAGVVDDLSSGFLNCEKSAFEMVVAVNVLGAYLGTKHAARVMAP  141



>sp|Q94KL7.1|SILD_FORIN RecName: Full=Secoisolariciresinol dehydrogenase, partial [Forsythia 
x intermedia]
 gb|AAK38665.1| stem secoisolariciresinol dehydrogenase [Forsythia x intermedia]
Length=277

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 93/125 (74%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T KLFS+HGAKV IADVQD+LG  V   + + ++ ++HCDVT E  V+NA
Sbjct  23   TGGASGIGETTAKLFSQHGAKVAIADVQDELGHSVVEAIGTSNSTYIHCDVTNEDGVKNA  82

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+  VS +GKLD+M++NAGI   N+P I+D++ ++FE+V   N+ G FL  KHAARVMIP
Sbjct  83   VDNTVSTYGKLDIMFSNAGISDPNRPRIIDNEKADFERVFSVNVTGVFLCMKHAARVMIP  142

Query  93   KTRTG  79
              R+G
Sbjct  143  -ARSG  146



>gb|KDP37624.1| hypothetical protein JCGZ_06967 [Jatropha curcas]
Length=279

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG++T +LF +HGAKV+I D+QD LG  +C EL S  + +++HCDVT ++DV+N
Sbjct  20   TGGASGIGESTVRLFLKHGAKVIIGDIQDTLGHSLCQELNSKETLSYIHCDVTCDSDVQN  79

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AVN A+SK+GKLD+M++NAGI G N  SI+D  N +F++    N+ GAFL  KHAARVMI
Sbjct  80   AVNFAISKYGKLDIMFSNAGIAG-NMDSIIDIKNEDFKRCFDVNVFGAFLVAKHAARVMI  138

Query  96   PKTR  85
            P  +
Sbjct  139  PAKK  142



>ref|XP_011089208.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=278

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A G+G  T KLF  HGAKV+IAD +DD G  +C  L    A+F+HCDVT E+D++NA
Sbjct  22   TGGAGGLGSVTAKLFHEHGAKVLIADARDDRGHLICQNLSPERASFIHCDVTSESDIQNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            V TAVS +GKLD+M+NNAGI     P++L+   ++FE V+R N+VGAFLGTKHAA  M
Sbjct  82   VETAVSTYGKLDIMFNNAGILDPVIPNVLNYSQADFEHVLRVNVVGAFLGTKHAASFM  139



>ref|XP_008243484.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=276

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T K+F++HGAK+VIADVQDDLG  V   +      FVHCDVT EA ++NA
Sbjct  22   TGGASGIGECTAKIFAQHGAKIVIADVQDDLGHSVRESIGPTDCTFVHCDVTDEAQIKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV+ +GKLD+M+NNAGI   NK  I+D++ ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  82   VHKAVATYGKLDIMFNNAGIVDDNKARIIDNEKADFERVLSVNVTGVFLGIKHAAQAMIP  141



>ref|XP_010104810.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01951.1| Momilactone A synthase [Morus notabilis]
Length=275

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG++  KLF+ HGAKVVIAD+QD+LG  VC  +   ++ +VHCDVT E+ V+NA
Sbjct  22   TGGASGIGESAAKLFAHHGAKVVIADIQDNLGHSVCESIGQTNSKYVHCDVTDESQVKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ A+  +GKLD+M+NNAGI   + P I +++ + FE V+  N+ G FLG KHAARVMIP
Sbjct  82   VDEAIKTYGKLDIMFNNAGIIDKSSPRITENEKAVFEHVLSVNVTGVFLGIKHAARVMIP  141

Query  93   KTRTG  79
              R+G
Sbjct  142  -ARSG  145



>gb|ABS87381.1| short-chain dehydrogenase/reductase protein [Lactuca sativa]
Length=271

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TGAASGIG+   KLF+ HGAKV+IADVQD LG+ V   + S ++ ++HCD+T E +V+N 
Sbjct  16   TGAASGIGECCAKLFAAHGAKVIIADVQDQLGQAVSEAIGSSNSMYIHCDITNEEEVKNT  75

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++TAV+ +GKLD+M+NNAGI    KP I+D++  + E+V+  N++G FL  KHAARVM+P
Sbjct  76   IDTAVATYGKLDIMFNNAGIADAFKPRIMDNEKKDIERVLGVNVIGTFLCMKHAARVMVP  135

Query  93   K  91
            +
Sbjct  136  Q  136



>ref|XP_006430116.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
 gb|ESR43356.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
Length=312

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 95/125 (76%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG  T K+F++ GAKVVIAD+Q+ LG  V   + + ++++VHCDVT E+ ++NA
Sbjct  59   TGGASGIGACTAKVFAQQGAKVVIADIQEQLGHSVVESIGTSNSSYVHCDVTNESHIKNA  118

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++  V+  GKLD+M+NNAGIGG NK  I+D++ ++FE+V+  N+ G FLG KHAARVMIP
Sbjct  119  IDQTVATHGKLDIMFNNAGIGGANKTRIIDNEKADFERVLSVNVTGVFLGIKHAARVMIP  178

Query  93   KTRTG  79
              R+G
Sbjct  179  -ARSG  182



>ref|XP_009631424.1| PREDICTED: xanthoxin dehydrogenase-like [Nicotiana tomentosiformis]
Length=280

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL-ESGSAAFVHCDVTKEADVEN  277
            TG A GIG++  +LF +HGAKV IAD+QD+LG+ VCG L    +A FVHCDVT EAD+ N
Sbjct  24   TGGAIGIGESIVRLFHKHGAKVCIADIQDELGQNVCGTLGNDQNACFVHCDVTAEADISN  83

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+  V KFG LD+M NNAG+ G   P I + + S FE V+  NL G FLG KHAAR+MI
Sbjct  84   AVDLTVQKFGTLDIMVNNAGLSGPPIPDIRNYELSVFESVLDVNLKGTFLGIKHAARIMI  143

Query  96   PKTR  85
            P+ +
Sbjct  144  PQKK  147



>ref|XP_009349369.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009349694.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=286

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG--SAAFVHCDVTKEADVE  280
            TG ASGIG++T +LF  HGAKVVIADVQD+L   +C EL S   S +++ CDVT + DV+
Sbjct  25   TGGASGIGESTARLFVFHGAKVVIADVQDELALSLCKELNSDGESISYIRCDVTIDLDVK  84

Query  279  NAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            N V+ A+SK+GKLD+MYNNAGI G   PSIL +D   F+QV   N+ GAFLG KHAAR M
Sbjct  85   NVVDVALSKYGKLDIMYNNAGISGKLDPSILGADAENFKQVFDVNVYGAFLGAKHAARAM  144

Query  99   I  97
            I
Sbjct  145  I  145



>ref|XP_010059365.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW90499.1| hypothetical protein EUGRSUZ_A02618 [Eucalyptus grandis]
Length=277

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T ++F+ HGAKVVIADV D LG  +   L   +A+FVHCDVT E+ V+ A
Sbjct  22   TGGASGIGEITARVFAHHGAKVVIADVNDSLGHSIRDSLSRDNASFVHCDVTDESQVKAA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V  AVS +GKLD+M+NNAGI G NK  I+D+D ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  82   VAEAVSTYGKLDIMFNNAGITGPNKSRIVDNDKADFERVLAVNVTGVFLGMKHAAQAMIP  141

Query  93   KTR  85
              R
Sbjct  142  VRR  144



>ref|XP_002513344.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF48747.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=283

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSA-AFVHCDVTKEADVEN  277
            TG ASG+G  + KLF  HGAKV+IAD+QD++G  +C ++ S    ++VHCDVT ++DV N
Sbjct  22   TGGASGLGATSAKLFVEHGAKVLIADIQDEIGSSLCKQIGSQDIISYVHCDVTCDSDVRN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AVSK+GKLD+M+NNAG+ G     IL ++N EF++V + N+ GA+LG KHAARVMI
Sbjct  82   AVDLAVSKYGKLDIMFNNAGVAGKLDTRILATENEEFKRVFKINMFGAYLGAKHAARVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PAKK  145



>ref|XP_007027886.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY08388.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=276

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 93/125 (74%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIGK T K+F+ HGAKVVIAD+QD+LG  VC  +   + ++VHC+VT E  ++NA
Sbjct  22   TGGASGIGKCTAKVFAHHGAKVVIADIQDELGHSVCEAVGPSNCSYVHCNVTDEDQIKNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV+  GKLD+M+NNAGI    K  I+D++ S+FE+V+  N+ G FLG KHAARVM+P
Sbjct  82   VDKAVATHGKLDIMFNNAGITDPIKARIIDNEKSDFERVLSVNVTGVFLGIKHAARVMVP  141

Query  93   KTRTG  79
              R+G
Sbjct  142  -ARSG  145



>ref|XP_009618318.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGS-AAFVHCDVTKEADVEN  277
            TG ASGIG+AT KLFS HGAKVVIADVQD+LG  V   L S S + ++HCDVT E  V+N
Sbjct  36   TGGASGIGEATAKLFSEHGAKVVIADVQDELGNSVSNALGSPSHSIYIHCDVTNEDHVQN  95

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+  +S FGKLD+M  NAGI    KP I+D+   +FE+V+  N+ G FL  KHAARVM+
Sbjct  96   AVDRTISTFGKLDIMICNAGISDETKPRIIDNMKEDFERVLSINVTGVFLSMKHAARVMV  155

Query  96   PKTRTG  79
            P TR+G
Sbjct  156  P-TRSG  160



>ref|XP_008392031.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Malus 
domestica]
Length=268

 Score =   143 bits (361),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T K+F +HGAKVVIADVQDDLG  V   +      FVHCDVT E+ +++A
Sbjct  14   TGGASGIGECTAKIFVQHGAKVVIADVQDDLGHSVRESIGPSDCTFVHCDVTDESQIKDA  73

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV+ +GKLD+M+NNAGI   NK  I+D++ ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  74   VHKAVATYGKLDIMFNNAGIVDPNKARIIDNEKADFERVLSINVTGVFLGIKHAAQAMIP  133

Query  93   KTRTG  79
              RTG
Sbjct  134  -ARTG  137



>ref|XP_008360614.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Malus domestica]
Length=280

 Score =   144 bits (362),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 91/125 (73%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T K+F +HGAKVVIADVQDDLG  V   +      FVHCDVT E  +++A
Sbjct  26   TGGASGIGECTAKIFVQHGAKVVIADVQDDLGHSVRESIGPSDCTFVHCDVTDEXQIKDA  85

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ AV+ +GKLD+M+NNAGI   NK  I+D++ ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  86   VHKAVATYGKLDIMFNNAGIXDPNKARIIDNEKADFERVLSINVTGVFLGIKHAAQAMIP  145

Query  93   KTRTG  79
              RTG
Sbjct  146  -ARTG  149



>ref|XP_010061228.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Eucalyptus grandis]
 gb|KCW68145.1| hypothetical protein EUGRSUZ_F01817 [Eucalyptus grandis]
Length=277

 Score =   143 bits (361),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T ++F+ HGAKVVIADV D LG  V   L   +A+FVHCDVT E+ ++ A
Sbjct  22   TGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVRDSLSRDTASFVHCDVTDESQIKAA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V  AVS +GKLD+M+NNAGI G N+  I+D+D ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  82   VAEAVSTYGKLDIMFNNAGITGPNETRIIDNDKADFERVLAVNVTGVFLGMKHAAQAMIP  141

Query  93   KTR  85
              R
Sbjct  142  VRR  144



>ref|XP_010061227.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Eucalyptus grandis]
Length=307

 Score =   144 bits (363),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T ++F+ HGAKVVIADV D LG  V   L   +A+FVHCDVT E+ ++ A
Sbjct  52   TGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVRDSLSRDTASFVHCDVTDESQIKAA  111

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V  AVS +GKLD+M+NNAGI G N+  I+D+D ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  112  VAEAVSTYGKLDIMFNNAGITGPNETRIIDNDKADFERVLAVNVTGVFLGMKHAAQAMIP  171

Query  93   KTR  85
              R
Sbjct  172  VRR  174



>ref|XP_007027905.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08407.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=281

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGS-AAFVHCDVTKEADVEN  277
            TG ASGIG++T +LF +HGAKV+IAD+QD+LG  +C EL +    +++HCDVT E DV+N
Sbjct  20   TGGASGIGESTARLFVKHGAKVLIADIQDELGHSLCKELGTPDFISYIHCDVTCETDVQN  79

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AVS++GKLD+M+NNAGI G  +   + SD   F++V+  N+ GAFLG KHAARVMI
Sbjct  80   AVDLAVSEYGKLDIMFNNAGIPGDLEIRAITSDIENFKRVLDVNVFGAFLGAKHAARVMI  139

Query  96   PKTR  85
            P  +
Sbjct  140  PAKK  143



>gb|ABD65462.1| short chain alcohol dehydrogenase [Gossypium hirsutum]
Length=284

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASG+GK T  LF +HGAKV+IAD+QD+LG  VC EL + + ++VHCD+T ++DVENA
Sbjct  19   TGGASGLGKCTATLFVKHGAKVLIADIQDELGDSVCQELGTENISYVHCDITCKSDVENA  78

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VN AVSK+GKLD+M+NNA   G N+  +  +   +F++V   N++G FLG K+AARVM+P
Sbjct  79   VNLAVSKYGKLDIMFNNADTHGDNETRVTHASTEDFKKVFDINVLGGFLGAKYAARVMVP  138

Query  93   KTR  85
              +
Sbjct  139  AKK  141



>ref|XP_007162945.1| hypothetical protein PHAVU_001G193400g [Phaseolus vulgaris]
 gb|ESW34939.1| hypothetical protein PHAVU_001G193400g [Phaseolus vulgaris]
Length=273

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIGK T ++F++HGAKVVIAD+QD+LG  V   +   +  +VHCDVT E  V+NA
Sbjct  20   TGGASGIGKRTAEVFAQHGAKVVIADIQDELGHSVAESIGPSTCCYVHCDVTDEDQVKNA  79

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++ AV  +GKLD+M+NNAGI   NK  I+D+D ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  80   IHRAVETYGKLDIMFNNAGIADPNKHRIIDNDKADFERVLAVNVTGVFLGMKHAAQAMIP  139



>gb|KDP36155.1| hypothetical protein JCGZ_08799 [Jatropha curcas]
Length=280

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG-SAAFVHCDVTKEADVEN  277
            TG ASGIG+A  +LF  HGAKVVIADVQD+LG  +C E  S  +  +VHCDVT + DV+N
Sbjct  23   TGGASGIGEAAVRLFVEHGAKVVIADVQDELGLSLCQEFSSQENICYVHCDVTSDEDVKN  82

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ A S++GKLD+MY+NAGIGG  +  +L   N  F++V   N+ GAFL  KHAARVMI
Sbjct  83   AVDLAFSRYGKLDIMYSNAGIGGKLETEVLGCSNENFKKVFDVNVFGAFLVAKHAARVMI  142

Query  96   PKTR  85
            P  +
Sbjct  143  PAKK  146



>ref|XP_002513332.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF48735.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=284

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSA-AFVHCDVTKEADVEN  277
            TG ASGIG  T KLF R+GAKVV+ADVQD+LG  +C +L S    ++VHCDVT ++D++N
Sbjct  22   TGGASGIGAGTAKLFVRNGAKVVVADVQDELGHNLCKQLGSEDIISYVHCDVTSDSDMKN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AVSK+GKLD+M++NAGI G    +IL +DN +F +V   N+ G FL  KHAARVMI
Sbjct  82   AVDLAVSKYGKLDIMFSNAGIAGGMDNTILGTDNDDFNRVFEINVFGGFLAAKHAARVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PAKK  145



>ref|XP_007204705.1| hypothetical protein PRUPE_ppa009636mg [Prunus persica]
 gb|EMJ05904.1| hypothetical protein PRUPE_ppa009636mg [Prunus persica]
Length=283

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 2/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG--SAAFVHCDVTKEADVE  280
            TG ASGIG++T +LF +HGAKV+IADVQD+L   +C EL+    S  +  CDV  E+DV+
Sbjct  22   TGGASGIGESTVRLFVQHGAKVIIADVQDELSLSLCKELDPDEESVCYTRCDVKVESDVK  81

Query  279  NAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            N V+ A+SK+GKLD+MYNNAGI G  +P+IL +    F+QV   N+ GAFLG KHAAR M
Sbjct  82   NVVDLALSKYGKLDIMYNNAGIPGNLEPTILSAGAENFKQVFDVNVYGAFLGAKHAARAM  141

Query  99   IPKTR  85
            IP  +
Sbjct  142  IPAKK  146



>ref|XP_009350131.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009350149.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=276

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+ T K+F +HGAKVVIADVQDDLG  V   +      FVHCDVT EA +++A
Sbjct  22   TGGASGIGECTAKIFVQHGAKVVIADVQDDLGHSVRESIGPSDCTFVHCDVTDEAQIKDA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+ +V+ +GKLD+M+NNAG+   NK  I+D++ ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  82   VHKSVATYGKLDIMFNNAGVVDPNKARIIDNEKADFERVLSINVTGVFLGIKHAAQAMIP  141

Query  93   KTRTG  79
              RTG
Sbjct  142  -ARTG  145



>gb|AHH81852.1| short-chain alcohol dehydrogenase [Perilla citriodora]
 gb|AHH81854.1| short-chain alcohol dehydrogenase [Perilla citriodora]
Length=277

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A+GIG++T KLFS+HGAKV I DV D+LG  V  ++   ++ ++HCDVT E DV NA
Sbjct  22   TGGAAGIGESTAKLFSKHGAKVAIVDVHDELGHSVIKQIGPSNSTYIHCDVTNEDDVRNA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+  VS +GKLD+M+NNAGI    K  I+D++  +FE+V+  N+ G FLG KHAARVMIP
Sbjct  82   VDKTVSTYGKLDIMFNNAGIADQPKLRIVDNEKHDFERVLAVNVTGVFLGMKHAARVMIP  141



>ref|XP_008351500.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Malus domestica]
 ref|XP_008360592.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Malus domestica]
Length=286

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 90/125 (72%), Gaps = 2/125 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESG--SAAFVHCDVTKEADVE  280
            TG ASGIG++T +LF  HGAKV IADVQD+L   +C EL S   S +++ CDVT ++DV+
Sbjct  25   TGGASGIGESTARLFVFHGAKVXIADVQDELALSLCKELNSDGESISYIRCDVTIDSDVK  84

Query  279  NAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            N V+ A+SK+GKLD+MYNNAGI G   PSIL +D   F+QV   N+ GAFLG KHAAR M
Sbjct  85   NVVDVALSKYGKLDIMYNNAGISGKLDPSILGADAENFKQVFDVNVYGAFLGAKHAARAM  144

Query  99   IPKTR  85
            I   +
Sbjct  145  IAAKK  149



>emb|CBI30352.3| unnamed protein product [Vitis vinifera]
Length=245

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG +T +LF  +GAKV+IAD+QDDLG+ +  +L     +++HCDV+ E DV+N 
Sbjct  15   TGGASGIGASTVRLFWENGAKVIIADIQDDLGQDITNKLGQ-DVSYIHCDVSNEDDVQNL  73

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+T +SK G+LD+MYNNAGI   +  SILD+  S+ ++++  NLVG+FLG KHAARVMIP
Sbjct  74   VDTTISKHGRLDIMYNNAGILDRHLGSILDTQKSDLDRLIGVNLVGSFLGAKHAARVMIP  133

Query  93   KTR  85
            + +
Sbjct  134  QKK  136



>ref|XP_009763487.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=280

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG  T K F ++GAKVVI DVQDDLG  +C E+     ++VHCDVT E  VE A
Sbjct  23   TGGASGIGATTAKFFIKNGAKVVILDVQDDLGHSLCNEIGPDHISYVHCDVTNEIQVEKA  82

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            ++ AVSK+GKLD+MY+NAGI G   P I  +D    ++V   N+ GAFLG KHAARVMIP
Sbjct  83   IDFAVSKYGKLDIMYSNAGITGSVDPRITTTDYENLKKVFDINVFGAFLGAKHAARVMIP  142

Query  93   KTRTG  79
              +TG
Sbjct  143  -AKTG  146



>gb|KDP32262.1| hypothetical protein JCGZ_14783 [Jatropha curcas]
Length=277

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSA-AFVHCDVTKEADVEN  277
            TG ASGIG+++ +LF + GAKVVIAD+QD+LG+ +C EL S    +++HCDVT +++V+N
Sbjct  22   TGGASGIGESSARLFVKQGAKVVIADIQDELGQSLCKELGSEEIISYIHCDVTNDSNVQN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AVSK+GKLD+M++NAGI G   P IL ++  +F++V   N+ GAFL  KHAA+VMI
Sbjct  82   AVDLAVSKYGKLDIMFSNAGIAGNLDPRILATEKEDFKRVFDVNVFGAFLAAKHAAKVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PAKK  145



>gb|KDP42340.1| hypothetical protein JCGZ_02813 [Jatropha curcas]
Length=270

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL--ESGSA-AFVHCDVTKEADV  283
            TG ASGIG+ T +LF+RHGAKV+IADVQ +LGR V  ++  E+G    +V C+VT E+DV
Sbjct  22   TGGASGIGECTARLFARHGAKVIIADVQSELGRSVAEKIGSETGQPVTYVDCNVTVESDV  81

Query  282  ENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARV  103
            ENAVNTAVS  GKLD+M+NNAGI G N   IL ++  +F +V+  N+ G  LG KHAARV
Sbjct  82   ENAVNTAVSLHGKLDIMFNNAGIAGNNHDKILSTEREDFMRVLDINIYGGVLGAKHAARV  141

Query  102  MIPKTR  85
            MIP+ +
Sbjct  142  MIPEKK  147



>gb|EYU18090.1| hypothetical protein MIMGU_mgv1a010990mg [Erythranthe guttata]
Length=295

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELE-SGSAAFVHCDVTKEADVEN  277
            TG ASG G+AT +LF  HGAKVVIADVQDD G+ +C E+      ++VHCDVT +ADV  
Sbjct  37   TGGASGFGEATARLFVLHGAKVVIADVQDDRGQSLCREINLPDQISYVHCDVTSDADVSA  96

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AVSK+G LDVM+NNAGI G    ++ D+DN  F++V   N+ GAFLG KHAARVMI
Sbjct  97   AVDFAVSKYGGLDVMFNNAGIPGKLDFAVADADNDNFKRVFEVNVYGAFLGAKHAARVMI  156

Query  96   P  94
            P
Sbjct  157  P  157



>ref|XP_004139590.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
 gb|KGN64963.1| hypothetical protein Csa_1G168890 [Cucumis sativus]
Length=274

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG A GIG++  K F   GAKVVIAD+ DDLG  +   L S S +FVHC+VTKE DVEN 
Sbjct  21   TGGARGIGESIAKHFFNPGAKVVIADILDDLGNSLSNHLSSSSTSFVHCNVTKETDVENV  80

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            VNTAVSK+GKLD+M+NNAGI G  K +IL+++ S+F+ V+  NLVGAFLGTKHAA+ MIP
Sbjct  81   VNTAVSKYGKLDIMFNNAGIPGALKFNILENEYSDFQNVLNVNLVGAFLGTKHAAKAMIP  140



>ref|XP_006428245.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428246.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428251.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428253.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428254.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428256.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006480290.1| PREDICTED: xanthoxin dehydrogenase isoform X1 [Citrus sinensis]
 ref|XP_006480291.1| PREDICTED: xanthoxin dehydrogenase isoform X2 [Citrus sinensis]
 ref|XP_006480292.1| PREDICTED: xanthoxin dehydrogenase isoform X3 [Citrus sinensis]
 ref|XP_006480293.1| PREDICTED: xanthoxin dehydrogenase isoform X4 [Citrus sinensis]
 gb|ESR41485.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41486.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41491.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41493.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41494.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41496.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|KDO45361.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45362.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45363.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45364.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
Length=280

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELE-SGSAAFVHCDVTKEADVEN  277
            TG A+GIG++T +LF +HGAKV IADVQD+LG++VC  L       F HCDVTKE DV +
Sbjct  24   TGGATGIGESTVRLFHKHGAKVCIADVQDNLGQQVCQSLGGEPDTFFCHCDVTKEEDVCS  83

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+  V KFG LD+M NNAGI G   P I ++D SEFE+V   N+ G F G KHAAR+MI
Sbjct  84   AVDLTVEKFGTLDIMVNNAGISGAPCPDIREADLSEFEKVFDINVKGVFHGMKHAARIMI  143

Query  96   PKTR  85
            P+T+
Sbjct  144  PQTK  147



>gb|ACJ84780.1| unknown [Medicago truncatula]
Length=119

 Score =   137 bits (346),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG+AT +LFS HGA+VVIAD+QDD+G  +C EL   SA +VHCDVTKE D+ENA
Sbjct  22   TGGASGIGEATARLFSNHGAQVVIADIQDDIGHSICQELHKSSATYVHCDVTKEKDIENA  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQ  160
            VNT VSK GKLD+M+NNAGI G+NK + L ++   F++
Sbjct  82   VNTTVSKHGKLDIMFNNAGITGINKQTYLKTNYPNFKK  119



>gb|KDP36170.1| hypothetical protein JCGZ_08814 [Jatropha curcas]
Length=278

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 94/125 (75%), Gaps = 4/125 (3%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG +T KLF  +GAKVVIAD+QD+LG  +  +L   + +++HCDV KE  + N 
Sbjct  23   TGGASGIGASTVKLFHENGAKVVIADIQDNLGEAIVSKLGGNNISYMHCDVGKEDGIINL  82

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKP--SILDSDNSEFEQVVRTNLVGAFLGTKHAARVM  100
            ++T +SK+G+LD+MYNNAGI  ++KP  SILDS   E ++++  NL+GAFLG KHAARVM
Sbjct  83   IDTTISKYGELDIMYNNAGI--IDKPFGSILDSTKLELDRLLSVNLIGAFLGAKHAARVM  140

Query  99   IPKTR  85
            IP+ +
Sbjct  141  IPQGK  145



>ref|XP_002275768.1| PREDICTED: tropinone reductase-like 1 [Vitis vinifera]
Length=275

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG ASGIG +T +LF  +GAKV+IAD+QDDLG+ +  +L     +++HCDV+ E DV+N 
Sbjct  23   TGGASGIGASTVRLFWENGAKVIIADIQDDLGQDITNKLGQ-DVSYIHCDVSNEDDVQNL  81

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+T +SK G+LD+MYNNAGI   +  SILD+  S+ ++++  NLVG+FLG KHAARVMIP
Sbjct  82   VDTTISKHGRLDIMYNNAGILDRHLGSILDTQKSDLDRLIGVNLVGSFLGAKHAARVMIP  141

Query  93   KTR  85
            + +
Sbjct  142  QKK  144



>gb|KDP25017.1| hypothetical protein JCGZ_24000 [Jatropha curcas]
Length=277

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSA-AFVHCDVTKEADVEN  277
            TG ASGIG+++ +LF + GAKVVIAD+QD+LG+ +C EL S    +++HCDVT ++ V+N
Sbjct  22   TGGASGIGESSARLFVKQGAKVVIADIQDELGQSLCKELGSEEIISYIHCDVTNDSHVQN  81

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AVSK+GKLD+M++NAGI G   P IL ++  +F++V   N+ GAFL  KHAA+VMI
Sbjct  82   AVDLAVSKYGKLDIMFSNAGIAGNLDPRILATEKEDFKRVFDVNVFGAFLAAKHAAKVMI  141

Query  96   PKTR  85
            P  +
Sbjct  142  PAKK  145



>gb|KEH24173.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=274

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGSAAFVHCDVTKEADVENA  274
            TG AS IGK T ++F + GAKVVIAD+QD+LG  V   + S +  +VHCDVT E+ ++N 
Sbjct  21   TGGASRIGKRTAEIFVQKGAKVVIADIQDELGHSVAQTIGSSTCTYVHCDVTDESQIKNV  80

Query  273  VNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMIP  94
            V+T V  +GKLD+M+NNAGIGG N   I+D+D ++FE+V+  N+ G FLG KHAA+ MIP
Sbjct  81   VDTTVQTYGKLDIMFNNAGIGGPNNSRIIDNDKADFERVLSINVTGVFLGIKHAAQAMIP  140



>ref|NP_001275796.1| short chain alcohol dehydrogenase [Citrus sinensis]
 gb|ADH82118.1| short chain alcohol dehydrogenase [Citrus sinensis]
Length=280

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELE-SGSAAFVHCDVTKEADVEN  277
            TG A+GIG++T +LF +HGAKV IADVQD+LG++VC  L       F HCDVTKE DV +
Sbjct  24   TGGATGIGESTVRLFHKHGAKVCIADVQDNLGQQVCQSLGGEPDTFFCHCDVTKEEDVCS  83

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+  V KFG LD+M NNAGI G   P I ++D SEFE+V   N  G F G KHAAR+MI
Sbjct  84   AVDLTVEKFGTLDIMVNNAGISGAPCPDIREADLSEFEKVFDINXKGVFHGMKHAARIMI  143

Query  96   PKTR  85
            P+T+
Sbjct  144  PQTK  147



>dbj|BAD93612.1| hypothetical protein [Cucumis melo]
Length=198

 Score =   139 bits (351),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 95/128 (74%), Gaps = 4/128 (3%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGELESGS---AAFVHCDVTKEADV  283
            TG ASGIG++T +LF  +GAKVV+ADVQDDLG  +C EL+ G+    ++ HCDVT E+D+
Sbjct  22   TGGASGIGESTVRLFVENGAKVVVADVQDDLGAVLCKELDDGTGYNVSYFHCDVTDESDI  81

Query  282  ENAVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARV  103
             NAV+ AV K+GKLD+M+NNAGI G    + L +D ++F++V   N+ G+F+G KHAARV
Sbjct  82   SNAVDYAVEKYGKLDIMFNNAGIRGDVGATTLTTDMNDFKKVFDVNVFGSFMGAKHAARV  141

Query  102  MIPKTRTG  79
            M P  +TG
Sbjct  142  MAP-AKTG  148



>ref|XP_004237829.1| PREDICTED: xanthoxin dehydrogenase-like [Solanum lycopersicum]
Length=280

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = -2

Query  453  TGAASGIGKATTKLFSRHGAKVVIADVQDDLGRKVCGEL-ESGSAAFVHCDVTKEADVEN  277
            TG ASGIG++  +LF +HGAKV I D+QD  G++VC  L +  SA F+HCDVT E DV N
Sbjct  24   TGGASGIGESIVRLFHKHGAKVCIVDIQDAFGKRVCESLGDEDSACFIHCDVTSETDVSN  83

Query  276  AVNTAVSKFGKLDVMYNNAGIGGLNKPSILDSDNSEFEQVVRTNLVGAFLGTKHAARVMI  97
            AV+ AV +FG LD++ NNAG+ G    +ILD D S F+ V+  N+ G FLG KHAAR+MI
Sbjct  84   AVDFAVERFGTLDIIVNNAGLTGAPCSNILDYDLSVFDNVLDVNVRGVFLGMKHAARIMI  143

Query  96   PKTR  85
            P+ R
Sbjct  144  PRKR  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507136922424