BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c43540_g1_i1 len=428 path=[1:0-427]

Length=428
                                                                      Score     E

ref|XP_003598202.1|  60S ribosomal protein L23                        77.8    8e-14   
ref|XP_002531759.1|  conserved hypothetical protein                   71.6    8e-13   Ricinus communis
ref|XP_002532007.1|  conserved hypothetical protein                   72.0    1e-12   Ricinus communis
ref|XP_008343287.1|  PREDICTED: aspartic proteinase-like protein 2    72.0    8e-12   
ref|XP_003636511.1|  hypothetical protein MTR_043s0014                66.6    4e-11   
ref|XP_003607468.1|  hypothetical protein MTR_4g078340                65.1    2e-10   
ref|XP_003597249.1|  hypothetical protein MTR_2g094480                64.7    3e-10   
ref|XP_008337941.1|  PREDICTED: uncharacterized protein LOC103401016  64.7    9e-10   
gb|EEE59647.1|  hypothetical protein OsJ_12023                        66.2    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AAP44645.1|  putative reverse transcriptase                        65.1    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003624140.1|  hypothetical protein MTR_7g079670                62.4    1e-09   
ref|XP_003601858.1|  Estradiol 17-beta-dehydrogenase                  64.7    2e-09   
ref|XP_003601635.1|  hypothetical protein MTR_3g083790                61.6    3e-09   
ref|XP_003609437.1|  hypothetical protein MTR_4g115700                60.8    4e-09   
ref|XP_003614116.1|  hypothetical protein MTR_5g045010                60.8    5e-09   
ref|XP_009623190.1|  PREDICTED: uncharacterized protein LOC104114439  63.2    5e-09   
gb|KHN31016.1|  hypothetical protein glysoja_020314                   60.8    6e-09   
gb|EEC75888.1|  hypothetical protein OsI_12930                        63.9    7e-09   Oryza sativa Indica Group [Indian rice]
gb|AAU89136.1|  F-box domain containing protein                       63.9    7e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006603254.1|  PREDICTED: uncharacterized protein LOC102660201  60.8    9e-09   
gb|ADK92871.1|  retrotransposon protein                               63.2    1e-08   
ref|XP_002512628.1|  conserved hypothetical protein                   60.8    1e-08   Ricinus communis
ref|XP_003588770.1|  hypothetical protein MTR_1g012560                60.5    1e-08   
gb|KHN31589.1|  hypothetical protein glysoja_043032                   59.7    1e-08   
ref|XP_006470496.1|  PREDICTED: uncharacterized protein LOC102617255  62.4    1e-08   
ref|XP_009800085.1|  PREDICTED: uncharacterized protein LOC104246050  62.8    1e-08   
ref|XP_006593242.1|  PREDICTED: uncharacterized protein LOC102666191  59.7    2e-08   
ref|XP_002522452.1|  nucleic acid binding protein, putative           61.6    2e-08   Ricinus communis
ref|XP_010680095.1|  PREDICTED: uncharacterized protein LOC104895323  59.7    3e-08   
gb|KDP37578.1|  hypothetical protein JCGZ_08269                       58.2    3e-08   
ref|XP_010692677.1|  PREDICTED: uncharacterized protein LOC104905754  61.6    3e-08   
ref|XP_003615350.1|  hypothetical protein MTR_5g066880                57.8    4e-08   
ref|XP_003616537.1|  hypothetical protein MTR_5g081540                57.8    5e-08   
ref|XP_006343420.1|  PREDICTED: uncharacterized protein LOC102579274  58.2    6e-08   
gb|EPS63384.1|  hypothetical protein M569_11402                       58.2    1e-07   
ref|XP_010680492.1|  PREDICTED: uncharacterized protein LOC104895629  59.3    1e-07   
ref|XP_009151504.1|  PREDICTED: uncharacterized protein LOC103874823  57.0    1e-07   
ref|XP_003593283.1|  hypothetical protein MTR_2g009730                58.2    1e-07   
ref|XP_003595869.1|  hypothetical protein MTR_2g062740                56.6    1e-07   
ref|XP_002529689.1|  conserved hypothetical protein                   56.2    1e-07   Ricinus communis
ref|XP_010679712.1|  PREDICTED: uncharacterized protein LOC104895014  57.0    1e-07   
ref|XP_003617609.1|  hypothetical protein MTR_5g093480                57.0    2e-07   
ref|XP_010668107.1|  PREDICTED: uncharacterized protein LOC104885102  56.2    3e-07   
ref|XP_003596206.1|  hypothetical protein MTR_2g071530                55.5    3e-07   
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...  58.9    3e-07   Oryza sativa Japonica Group [Japonica rice]
gb|AAP54617.2|  retrotransposon protein, putative, unclassified       58.9    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002531249.1|  hypothetical protein RCOM_0494170                57.8    3e-07   Ricinus communis
ref|XP_010665576.1|  PREDICTED: uncharacterized protein LOC104882857  55.8    3e-07   
ref|XP_009109961.1|  PREDICTED: uncharacterized protein LOC103835530  57.8    4e-07   
ref|XP_002532287.1|  conserved hypothetical protein                   57.4    4e-07   Ricinus communis
gb|EEE56566.1|  hypothetical protein OsJ_05904                        57.8    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662398.1|  PREDICTED: uncharacterized protein LOC102702136  57.4    5e-07   
gb|EEC72753.1|  hypothetical protein OsI_06384                        57.8    5e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010495785.1|  PREDICTED: uncharacterized protein LOC104772929  57.8    6e-07   
ref|XP_010666711.1|  PREDICTED: uncharacterized protein LOC104883845  57.8    7e-07   
ref|XP_009119792.1|  PREDICTED: uncharacterized protein LOC103844732  54.3    1e-06   
ref|XP_003627699.1|  hypothetical protein MTR_8g036680                53.9    1e-06   
ref|XP_010676258.1|  PREDICTED: uncharacterized protein LOC104892125  54.3    1e-06   
ref|XP_002455221.1|  hypothetical protein SORBIDRAFT_03g006485        53.9    2e-06   Sorghum bicolor [broomcorn]
gb|ABN09176.1|  Polynucleotidyl transferase, Ribonuclease H fold      55.1    2e-06   Medicago truncatula
ref|XP_002526185.1|  conserved hypothetical protein                   53.9    2e-06   Ricinus communis
ref|XP_003593473.1|  Receptor-like kinase CR4                         55.5    2e-06   
ref|XP_009109977.1|  PREDICTED: putative ribonuclease H protein A...  55.8    2e-06   
ref|XP_004305091.1|  PREDICTED: ribonuclease HI-like                  53.5    2e-06   
gb|EEC72520.1|  hypothetical protein OsI_05906                        53.1    3e-06   Oryza sativa Indica Group [Indian rice]
gb|EEE55133.1|  hypothetical protein OsJ_02920                        55.8    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009126342.1|  PREDICTED: uncharacterized protein LOC103851250  54.3    3e-06   
ref|XP_003614267.1|  hypothetical protein MTR_5g047270                52.4    3e-06   
ref|XP_010673863.1|  PREDICTED: uncharacterized protein LOC104890171  53.5    3e-06   
ref|XP_006404270.1|  hypothetical protein EUTSA_v10011157mg           54.3    3e-06   
ref|XP_006409412.1|  hypothetical protein EUTSA_v10023022mg           53.9    3e-06   
gb|EPS61425.1|  hypothetical protein M569_13371                       55.8    3e-06   
gb|AAQ56556.1|  hypothetical protein OSJNBa0070J19.14                 54.3    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006476142.1|  PREDICTED: uncharacterized protein LOC102616098  55.1    3e-06   
ref|XP_009123637.1|  PREDICTED: putative ribonuclease H protein A...  54.7    3e-06   
emb|CAN76892.1|  hypothetical protein VITISV_005356                   55.8    3e-06   Vitis vinifera
ref|XP_009140657.1|  PREDICTED: uncharacterized protein LOC103864646  54.3    4e-06   
ref|XP_003623678.1|  hypothetical protein MTR_7g074420                53.9    4e-06   
gb|EMT07061.1|  Casein kinase I-2-like protein                        55.5    4e-06   
ref|XP_002513210.1|  conserved hypothetical protein                   53.1    4e-06   Ricinus communis
ref|XP_006353445.1|  PREDICTED: uncharacterized protein LOC102588376  54.3    4e-06   
ref|XP_010474088.1|  PREDICTED: uncharacterized protein LOC104753549  54.3    4e-06   
ref|XP_004298184.1|  PREDICTED: putative ribonuclease H protein A...  53.5    4e-06   
gb|EPS59181.1|  hypothetical protein M569_15629                       54.3    5e-06   
ref|XP_010684219.1|  PREDICTED: putative ribonuclease H protein A...  54.3    5e-06   
emb|CAN63032.1|  hypothetical protein VITISV_024672                   55.1    5e-06   Vitis vinifera
gb|EEC71228.1|  hypothetical protein OsI_03168                        55.1    5e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_002525921.1|  conserved hypothetical protein                   52.4    8e-06   Ricinus communis
emb|CDY13696.1|  BnaA06g32270D                                        51.2    8e-06   
ref|XP_010678407.1|  PREDICTED: uncharacterized protein LOC104893963  51.6    8e-06   
ref|XP_009109964.1|  PREDICTED: putative ribonuclease H protein A...  53.9    9e-06   
ref|XP_010686484.1|  PREDICTED: uncharacterized protein LOC104900691  53.5    9e-06   
gb|EAY78455.1|  hypothetical protein OsI_33544                        51.2    1e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_003616534.1|  hypothetical protein MTR_5g081500                53.5    1e-05   
ref|XP_010678308.1|  PREDICTED: uncharacterized protein LOC104893877  53.9    1e-05   
ref|XP_010687191.1|  PREDICTED: uncharacterized protein LOC104901327  52.8    1e-05   
ref|XP_003607028.1|  hypothetical protein MTR_4g071380                52.4    1e-05   
ref|XP_009138598.1|  PREDICTED: uncharacterized protein LOC103862665  53.5    1e-05   
ref|XP_010682938.1|  PREDICTED: uncharacterized protein LOC104897699  53.1    1e-05   
ref|XP_009129032.1|  PREDICTED: uncharacterized protein LOC103853884  53.9    1e-05   
gb|KHN06267.1|  hypothetical protein glysoja_030333                   50.4    1e-05   
emb|CDY59043.1|  BnaAnng15680D                                        50.4    1e-05   
ref|XP_010692627.1|  PREDICTED: uncharacterized protein LOC104905716  51.2    1e-05   
ref|XP_010681977.1|  PREDICTED: uncharacterized protein LOC104896888  53.5    1e-05   
ref|XP_004305406.1|  PREDICTED: putative ribonuclease H protein A...  53.1    1e-05   
ref|XP_010462680.1|  PREDICTED: uncharacterized protein LOC104743275  52.8    2e-05   
ref|XP_003613174.1|  hypothetical protein MTR_5g033620                50.1    2e-05   
ref|XP_003623409.1|  hypothetical protein MTR_7g070460                50.8    2e-05   
ref|XP_006427454.1|  hypothetical protein CICLE_v10027161mg           50.4    2e-05   
ref|XP_009122880.1|  PREDICTED: uncharacterized protein LOC103847539  52.0    2e-05   
ref|XP_004954924.1|  PREDICTED: uncharacterized protein LOC101756955  53.1    2e-05   
ref|XP_009145301.1|  PREDICTED: uncharacterized protein LOC103869012  52.4    2e-05   
ref|XP_010495559.1|  PREDICTED: uncharacterized protein LOC104772669  50.8    2e-05   
ref|XP_006483704.1|  PREDICTED: uncharacterized protein LOC102620092  52.0    3e-05   
ref|XP_010693085.1|  PREDICTED: uncharacterized protein LOC104906074  50.8    3e-05   
ref|XP_003617799.1|  hypothetical protein MTR_5g095600                50.8    3e-05   
gb|EPS57564.1|  hypothetical protein M569_17254                       52.4    3e-05   
ref|XP_010495420.1|  PREDICTED: uncharacterized protein LOC104772516  51.2    3e-05   
ref|XP_004293076.1|  PREDICTED: putative ribonuclease H protein A...  52.4    3e-05   
ref|XP_003599515.1|  hypothetical protein MTR_3g034390                49.3    3e-05   
ref|XP_009101684.1|  PREDICTED: uncharacterized protein LOC103827880  52.8    3e-05   
ref|XP_003593940.1|  hypothetical protein MTR_2g019570                49.3    3e-05   
ref|XP_004515632.1|  PREDICTED: uncharacterized protein LOC101505764  50.4    3e-05   
ref|XP_010667928.1|  PREDICTED: uncharacterized protein LOC104884923  52.4    3e-05   
ref|XP_008358038.1|  PREDICTED: uncharacterized protein LOC103421772  51.2    3e-05   
ref|XP_009139688.1|  PREDICTED: uncharacterized protein LOC103863688  52.0    3e-05   
ref|XP_003612608.1|  Replication protein A 70 kDa DNA-binding sub...  52.4    4e-05   
ref|XP_010693052.1|  PREDICTED: uncharacterized protein LOC104906048  52.4    4e-05   
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385  52.4    4e-05   
gb|KHN38789.1|  hypothetical protein glysoja_047929                   50.1    4e-05   
emb|CDX71715.1|  BnaC08g31590D                                        49.7    4e-05   
gb|KFK31076.1|  hypothetical protein AALP_AA6G065100                  51.6    4e-05   
ref|XP_010686122.1|  PREDICTED: uncharacterized protein LOC104900404  52.4    4e-05   
ref|XP_010686471.1|  PREDICTED: uncharacterized protein LOC104900678  51.2    5e-05   
gb|EEC83326.1|  hypothetical protein OsI_28710                        52.0    5e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_003596081.1|  hypothetical protein MTR_2g065980                48.9    5e-05   
ref|XP_009140970.1|  PREDICTED: uncharacterized protein LOC103864947  52.0    5e-05   
ref|XP_010665605.1|  PREDICTED: uncharacterized protein LOC104882889  50.4    5e-05   
gb|KDP20045.1|  hypothetical protein JCGZ_05814                       49.3    5e-05   
ref|XP_010678557.1|  PREDICTED: uncharacterized protein LOC104894089  49.7    5e-05   
ref|XP_008367209.1|  PREDICTED: uncharacterized protein LOC103430850  49.7    5e-05   
ref|XP_010423650.1|  PREDICTED: uncharacterized protein LOC104708728  51.2    6e-05   
ref|XP_010695539.1|  PREDICTED: uncharacterized protein LOC104908151  51.2    6e-05   
ref|XP_006292284.1|  hypothetical protein CARUB_v10018494mg           50.8    6e-05   
ref|XP_010436406.1|  PREDICTED: uncharacterized protein LOC104720143  51.2    6e-05   
gb|EPS73861.1|  hypothetical protein M569_00896                       51.6    6e-05   
ref|XP_008349430.1|  PREDICTED: uncharacterized protein LOC103412666  48.9    7e-05   
ref|XP_010490394.1|  PREDICTED: uncharacterized protein LOC104768166  49.7    7e-05   
ref|XP_003604713.1|  hypothetical protein MTR_4g016830                48.1    7e-05   
ref|XP_008382811.1|  PREDICTED: uncharacterized protein LOC103445579  50.8    8e-05   
ref|XP_009152173.1|  PREDICTED: uncharacterized protein LOC103875407  50.4    8e-05   
ref|XP_010681975.1|  PREDICTED: uncharacterized protein LOC104896887  48.1    8e-05   
ref|XP_010673165.1|  PREDICTED: uncharacterized protein LOC104889605  49.3    8e-05   
ref|XP_002522294.1|  conserved hypothetical protein                   48.9    8e-05   Ricinus communis
ref|XP_010436807.1|  PREDICTED: uncharacterized protein LOC104720624  50.8    8e-05   
gb|KHN11193.1|  hypothetical protein glysoja_043927                   48.1    8e-05   
ref|XP_009107615.1|  PREDICTED: putative ribonuclease H protein A...  50.8    8e-05   
ref|XP_002520660.1|  conserved hypothetical protein                   47.4    9e-05   Ricinus communis
ref|XP_006397448.1|  hypothetical protein EUTSA_v10001854mg           50.1    1e-04   
ref|XP_010677668.1|  PREDICTED: uncharacterized protein LOC104893266  49.3    1e-04   
ref|XP_007206269.1|  hypothetical protein PRUPE_ppa016210mg           48.9    1e-04   
ref|XP_010686870.1|  PREDICTED: uncharacterized protein LOC104901026  50.1    1e-04   
ref|XP_003622135.1|  hypothetical protein MTR_7g028110                50.4    1e-04   
gb|EAZ10420.1|  hypothetical protein OsJ_00252                        50.4    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003622145.1|  Cell differentiation protein RCD1-like protein   50.4    1e-04   
gb|KHN14619.1|  hypothetical protein glysoja_024714                   49.7    1e-04   
ref|XP_010692477.1|  PREDICTED: uncharacterized protein LOC104905588  50.8    1e-04   
emb|CCA66054.1|  hypothetical protein                                 50.8    1e-04   
ref|XP_009109953.1|  PREDICTED: uncharacterized protein LOC103835521  50.4    1e-04   
ref|XP_009117699.1|  PREDICTED: uncharacterized protein LOC103842788  50.1    1e-04   
gb|ABD28710.1|  Polynucleotidyl transferase, Ribonuclease H fold      50.1    1e-04   Medicago truncatula
ref|XP_010670097.1|  PREDICTED: uncharacterized protein LOC104887199  48.5    1e-04   
gb|KHN34964.1|  hypothetical protein glysoja_004730                   47.8    1e-04   
gb|AAK52166.1|AC084831_20  putative reverse transcriptase             50.4    1e-04   Oryza sativa [red rice]
ref|XP_008372934.1|  PREDICTED: putative ribonuclease H protein A...  50.4    2e-04   
ref|XP_009130307.1|  PREDICTED: putative ribonuclease H protein A...  50.1    2e-04   
ref|XP_003626499.1|  hypothetical protein MTR_7g116560                47.4    2e-04   
emb|CDY12378.1|  BnaC08g08270D                                        50.1    2e-04   
ref|XP_009114471.1|  PREDICTED: uncharacterized protein LOC103839734  49.7    2e-04   
ref|XP_010445339.1|  PREDICTED: uncharacterized protein LOC104727990  50.1    2e-04   
ref|XP_010678022.1|  PREDICTED: uncharacterized protein LOC104893592  47.8    2e-04   
ref|XP_008341962.1|  PREDICTED: uncharacterized protein LOC103404776  49.7    2e-04   
emb|CDY08832.1|  BnaA06g23920D                                        47.8    2e-04   
ref|XP_009142128.1|  PREDICTED: uncharacterized protein LOC103866010  48.5    2e-04   
ref|XP_010693383.1|  PREDICTED: uncharacterized protein LOC104906342  50.1    2e-04   
gb|AFK33762.1|  unknown                                               47.0    2e-04   
ref|XP_007203200.1|  hypothetical protein PRUPE_ppa025309mg           47.8    2e-04   
ref|XP_003607874.1|  hypothetical protein MTR_4g083950                47.4    2e-04   
ref|XP_003614550.1|  hypothetical protein MTR_5g055330                47.4    2e-04   
ref|XP_007224090.1|  hypothetical protein PRUPE_ppa015515mg           47.8    2e-04   
emb|CDY61093.1|  BnaC06g41610D                                        48.9    2e-04   
ref|XP_003614776.1|  hypothetical protein MTR_5g059090                48.9    2e-04   
ref|XP_009141437.1|  PREDICTED: uncharacterized protein LOC103865394  47.4    3e-04   
emb|CDP14369.1|  unnamed protein product                              48.9    3e-04   
ref|XP_008228072.1|  PREDICTED: uncharacterized protein LOC103327517  48.9    3e-04   
ref|XP_009119970.1|  PREDICTED: uncharacterized protein LOC103844893  48.9    3e-04   
gb|EMT06316.1|  Glucan endo-1,3-beta-glucosidase 14                   49.3    3e-04   
gb|EMT25602.1|  F-box/WD-40 repeat-containing protein                 49.3    3e-04   
ref|XP_003638396.1|  hypothetical protein MTR_130s0012                46.6    3e-04   
ref|XP_010669786.1|  PREDICTED: uncharacterized protein LOC104886930  48.9    3e-04   
ref|XP_008383144.1|  PREDICTED: uncharacterized protein LOC103445866  48.5    3e-04   
emb|CDX72015.1|  BnaC08g28590D                                        48.1    3e-04   
gb|KHN37148.1|  hypothetical protein glysoja_038768                   46.2    3e-04   
gb|AFW65836.1|  hypothetical protein ZEAMMB73_825751                  48.5    3e-04   
ref|XP_003608212.1|  Isoflavone-7-O-methyltransferase                 48.9    3e-04   
ref|XP_003621486.1|  Isoflavone-7-O-methyltransferase                 48.9    3e-04   
ref|XP_008243683.1|  PREDICTED: uncharacterized protein LOC103341914  47.8    3e-04   
ref|XP_010695719.1|  PREDICTED: uncharacterized protein LOC104908324  46.6    3e-04   
ref|XP_010678924.1|  PREDICTED: uncharacterized protein LOC104894403  48.1    4e-04   
ref|XP_010688546.1|  PREDICTED: uncharacterized protein LOC104902454  48.1    4e-04   
ref|XP_009113456.1|  PREDICTED: uncharacterized protein LOC103838755  49.3    4e-04   
ref|XP_003624705.1|  hypothetical protein MTR_7g086560                48.1    4e-04   
ref|XP_003604942.1|  Cyclin D3                                        48.1    4e-04   
ref|XP_009113626.1|  PREDICTED: uncharacterized protein LOC103838926  48.1    4e-04   
ref|XP_010463404.1|  PREDICTED: uncharacterized protein LOC104744076  48.9    4e-04   
ref|XP_010666976.1|  PREDICTED: uncharacterized protein LOC104884079  48.9    4e-04   
emb|CDX95987.1|  BnaA07g27440D                                        48.1    4e-04   
gb|EMT22207.1|  Protein SRG1                                          48.5    5e-04   
ref|XP_009135908.1|  PREDICTED: uncharacterized protein LOC103860050  48.9    5e-04   
ref|XP_003615631.1|  hypothetical protein MTR_5g070290                48.1    5e-04   
ref|XP_010682807.1|  PREDICTED: uncharacterized protein LOC104897588  48.5    5e-04   
emb|CDX95988.1|  BnaA07g27430D                                        48.5    5e-04   
ref|XP_009105597.1|  PREDICTED: uncharacterized protein LOC103831468  48.5    5e-04   
emb|CCA66044.1|  hypothetical protein                                 48.9    5e-04   
ref|XP_010480547.1|  PREDICTED: uncharacterized protein LOC104759300  46.2    5e-04   
ref|XP_003599243.1|  hypothetical protein MTR_3g030670                46.2    5e-04   
ref|XP_010673155.1|  PREDICTED: uncharacterized protein LOC104889595  48.5    6e-04   
ref|XP_003630976.1|  hypothetical protein MTR_8g105730                48.1    6e-04   
gb|AFK38936.1|  unknown                                               47.8    6e-04   
ref|XP_010474119.1|  PREDICTED: uncharacterized protein LOC104753583  48.5    7e-04   
ref|XP_010666728.1|  PREDICTED: uncharacterized protein LOC104883861  47.0    7e-04   
ref|XP_009334567.1|  PREDICTED: uncharacterized protein LOC103927376  48.1    7e-04   
gb|EEE52627.1|  hypothetical protein OsJ_34967                        48.5    7e-04   Oryza sativa Japonica Group [Japonica rice]
gb|KHN00089.1|  hypothetical protein glysoja_046125                   46.2    7e-04   
ref|XP_008391838.1|  PREDICTED: uncharacterized protein LOC103454030  48.5    7e-04   
ref|XP_010680467.1|  PREDICTED: uncharacterized protein LOC104895604  47.8    7e-04   
ref|XP_010682232.1|  PREDICTED: uncharacterized protein LOC104897109  47.8    7e-04   
emb|CDY23830.1|  BnaC04g02070D                                        46.6    7e-04   
ref|XP_004309432.1|  PREDICTED: uncharacterized protein LOC101293741  45.4    7e-04   
ref|XP_009102787.1|  PREDICTED: uncharacterized protein LOC103828902  48.1    8e-04   
ref|XP_009106481.1|  PREDICTED: uncharacterized protein LOC103832258  46.2    8e-04   
emb|CDY65917.1|  BnaC07g48670D                                        45.8    8e-04   
gb|EEC68711.1|  hypothetical protein OsI_37193                        48.1    8e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010675428.1|  PREDICTED: uncharacterized protein LOC104891430  47.8    8e-04   
ref|XP_010687523.1|  PREDICTED: uncharacterized protein LOC104901631  47.8    8e-04   
ref|XP_003621044.1|  hypothetical protein MTR_7g006490                47.4    9e-04   
ref|XP_009119921.1|  PREDICTED: uncharacterized protein LOC103844846  46.6    0.001   
ref|XP_010468814.1|  PREDICTED: uncharacterized protein LOC104748940  47.8    0.001   
gb|ABN08693.1|  Polynucleotidyl transferase, Ribonuclease H fold      45.4    0.001   Medicago truncatula



>ref|XP_003598202.1| 60S ribosomal protein L23 [Medicago truncatula]
Length=547

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 51/133 (38%), Positives = 67/133 (50%), Gaps = 4/133 (3%)
 Frame = +1

Query  37   PLPPGGLYCFTDAAIHGTSPTYGFYAC-NAQGG--LEAAANGPLICPNDPLLAEAMAVRE  207
            P   G L C  DAAI      +G   C   Q G  L+AA N    CP  P  AEA+ +R+
Sbjct  59   PPAAGFLKCNVDAAIFSEQNRFGTGMCVRDQRGRFLKAATNWYEGCP-PPQEAEAVGLRD  117

Query  208  ALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
            A+ WL      NV +  DC ++V S  D    ++  G I+D C  L   F +  I FVRR
Sbjct  118  AILWLGQLELSNVQLELDCKLVVDSIYDKNNNQAEFGSIIDDCRSLLQQFTNFKISFVRR  177

Query  388  DANMVAHALAKHS  426
             AN+VAH+ A+ S
Sbjct  178  QANVVAHSFARVS  190



>ref|XP_002531759.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30615.1| conserved hypothetical protein [Ricinus communis]
Length=163

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P +AE +A++EALSW RDR   NV    DC  +V +     T RS LG+I+  C  L +S
Sbjct  78   PEIAEGLAIQEALSWARDRQLLNVVFELDCLHIVEALLRKGTDRSSLGLIIKDCKLLSSS  137

Query  355  FDSCSIKFVRRDANMVAHALAKHS  426
              +CS  FV+R  N VAH LA+ S
Sbjct  138  ISNCSFAFVKRSRNEVAHKLARVS  161



>ref|XP_002532007.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30380.1| conserved hypothetical protein [Ricinus communis]
Length=273

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 59/126 (47%), Gaps = 2/126 (2%)
 Frame = +1

Query  49   GGLYCFTDAAIH--GTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWL  222
            G L C  D  +        +GF   N  G   AA NG +  P DP +AEA+++RE L W+
Sbjct  135  GWLKCNIDVVVFVANNRLGFGFIFQNDSGTFRAATNGLISGPLDPQVAEALSLREDLCWV  194

Query  223  RDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMV  402
            +      V   SDC  LV++   V    S  G+++  C       +   I FV+R  N V
Sbjct  195  KGLDLNYVVSESDCLTLVNAVNKVGVNSSLFGLLIGDCRSFLKEMNHAHIVFVKRFGNRV  254

Query  403  AHALAK  420
            AH LA+
Sbjct  255  AHLLAR  260



>ref|XP_008343287.1| PREDICTED: aspartic proteinase-like protein 2 [Malus domestica]
Length=505

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 57/107 (53%), Gaps = 0/107 (0%)
 Frame = +1

Query  100  YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVS  279
            +G  + +  G   AA  G     + PL+ EAMAVR  L W  DRG+ ++ I +D   +V 
Sbjct  70   FGAISKDFNGCFVAATTGRFDDVSSPLIPEAMAVRAGLQWAIDRGYHSLIIETDSLQIVQ  129

Query  280  SFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAK  420
            + RD     S +G + + C  L N+    +I  +RR+AN+ AH LAK
Sbjct  130  ALRDPTLNSSIIGQVAEDCKALLNTITKANITHIRRNANIDAHCLAK  176



>ref|XP_003636511.1| hypothetical protein MTR_043s0014 [Medicago truncatula]
Length=132

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 51/101 (50%), Gaps = 0/101 (0%)
 Frame = +1

Query  118  NAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVM  297
            NAQG    A          PL AEA+ +++ + WL + G   V I  DC ++V S  +  
Sbjct  5    NAQGHFFKALTKWFDYYPTPLEAEALGLKDTIVWLGELGLSMVQIELDCKLVVDSIMENS  64

Query  298  TYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAK  420
              +S  G I+ SC  L N F +  I FVRR AN VAH L +
Sbjct  65   NNQSDFGNIISSCRSLLNQFRNFKISFVRRQANYVAHTLTR  105



>ref|XP_003607468.1| hypothetical protein MTR_4g078340 [Medicago truncatula]
Length=181

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 61/133 (46%), Gaps = 3/133 (2%)
 Frame = +1

Query  37   PLPPGGLYCFTDAAI--HGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREA  210
            P   G   C  DAA   H      G    +A+G    A      C     + EA+ +  A
Sbjct  24   PHVAGRYKCNIDAAFTSHVNCTCIGICVRDAEGTFVLAKTMTYPCTVSVDVGEALGMHSA  83

Query  211  LSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN-SFDSCSIKFVRR  387
            L WL D  F NV   +D  +   +F   M   S  G I+ SC  LF+ SF +  ++FVR+
Sbjct  84   LQWLSDMQFDNVDFETDSKLTADAFLSTMNDLSEFGCIIFSCRSLFSTSFSNFRVEFVRQ  143

Query  388  DANMVAHALAKHS  426
             AN+VAHAL + +
Sbjct  144  QANVVAHALTRET  156



>ref|XP_003597249.1| hypothetical protein MTR_2g094480 [Medicago truncatula]
Length=165

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 61/136 (45%), Gaps = 21/136 (15%)
 Frame = +1

Query  76   AIHGTSPTYGFYACNAQGGLEAAAN--GPLICPND--------------PL----LAEAM  195
             IH   P  G Y CN      ++ N  G  IC  D              PL    + EA+
Sbjct  12   VIHWEKPMRGSYKCNIDASFSSSLNRVGIDICIRDDAGDFVLARTDWFSPLCEVTIGEAV  71

Query  196  AVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLF-NSFDSCSI  372
             +  A+ W+ D  F NV    D   +V+SF   +   S LG I+ +C QLF +SF +  +
Sbjct  72   GLHTAMQWILDLQFDNVDFVLDSKQVVNSFHTEVDDDSELGCIITACRQLFQDSFQNSHV  131

Query  373  KFVRRDANMVAHALAK  420
            KF  R AN V H LA+
Sbjct  132  KFNMRQANGVTHELAR  147



>ref|XP_008337941.1| PREDICTED: uncharacterized protein LOC103401016 [Malus domestica]
Length=298

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 64/129 (50%), Gaps = 2/129 (2%)
 Frame = +1

Query  40   LPPGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREAL  213
            LP G +    D + +      GF A   ++ G   A   G       PLL+EAMA++  L
Sbjct  166  LPHGRIKMNIDGSWNVGRLIAGFGAIIRDSDGCFVATRTGSFKDICSPLLSEAMAMKVGL  225

Query  214  SWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDA  393
             W  DRG+Q + I +D   +V + RD+    S +G +++    L N+    +I ++ R+A
Sbjct  226  LWAIDRGYQFLIIETDSLQIVEALRDLTLNLSIIGQVVEDYKALLNTITEANITYIHRNA  285

Query  394  NMVAHALAK  420
            N  AH LAK
Sbjct  286  NAAAHYLAK  294



>gb|EEE59647.1| hypothetical protein OsJ_12023 [Oryza sativa Japonica Group]
Length=1145

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 42/132 (32%), Positives = 70/132 (53%), Gaps = 2/132 (2%)
 Frame = +1

Query  37    PLPPGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREA  210
             PLP G     +DAAI  +S T G  A   +  G    A +  +     P LAEA+A+R A
Sbjct  989   PLPAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRA  1048

Query  211   LSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRD  390
             L   ++ G Q++ + SDC  ++   +     RS +G +++   +L ++F  CS   V R 
Sbjct  1049  LGLAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRL  1108

Query  391   ANMVAHALAKHS  426
             +N+ AH+LA+++
Sbjct  1109  SNLAAHSLARNA  1120



>gb|AAP44645.1| putative reverse transcriptase [Oryza sativa Japonica Group]
Length=404

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 70/132 (53%), Gaps = 2/132 (2%)
 Frame = +1

Query  37   PLPPGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREA  210
            PLP G     +DAAI  +S T G  A   +  G    A +  +     P LAEA+A+R A
Sbjct  248  PLPAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRA  307

Query  211  LSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRD  390
            L   ++ G Q++ + SDC  ++   +     RS +G +++   +L ++F  CS   V R 
Sbjct  308  LGLAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRL  367

Query  391  ANMVAHALAKHS  426
            +N+ AH+LA+++
Sbjct  368  SNLAAHSLARNA  379



>ref|XP_003624140.1| hypothetical protein MTR_7g079670 [Medicago truncatula]
Length=166

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 57/124 (46%), Gaps = 2/124 (2%)
 Frame = +1

Query  55   LYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRG  234
            L C  D +I G +    +Y  +  G     A   +  P+DP +AEAM V+ AL W+   G
Sbjct  15   LICDVDLSIGGDNLVEIWYRID--GRPVVVATRTVEAPDDPCMAEAMGVKVALDWIEVNG  72

Query  235  FQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHAL  414
            +++V I SD   +V         R Y G I   CL+   S  + S+ +  R+ N  AH  
Sbjct  73   WRSVIIESDAKKIVDGINKQSLSRRYWGRIGRYCLKKMRSLHNVSLNWTSRNRNWAAHTT  132

Query  415  AKHS  426
             K +
Sbjct  133  TKWT  136



>ref|XP_003601858.1| Estradiol 17-beta-dehydrogenase [Medicago truncatula]
Length=526

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 62/139 (45%), Gaps = 21/139 (15%)
 Frame = +1

Query  67   TDAAIHGTSPTYGFYACNAQGGLEAAAN--GPLICPND--------------PL----LA  186
            T   +H   P  G Y CN      ++ N  G  IC  D              PL    + 
Sbjct  372  TQEVVHWKKPARGRYKCNIDASFSSSLNRVGIGICIRDDAGDFVLAKTDWFSPLCEVTIG  431

Query  187  EAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLF-NSFDS  363
            EA+ +  AL W+ D  F NV    D    V SF   +   + LG I+ +C QLF +SF +
Sbjct  432  EAVGLHTALQWISDLQFDNVDFALDSKQDVDSFHTGVDDDNELGCIITACRQLFQDSFQN  491

Query  364  CSIKFVRRDANMVAHALAK  420
              ++F RR AN VAH LA+
Sbjct  492  SHVEFNRRQANGVAHELAR  510



>ref|XP_003601635.1| hypothetical protein MTR_3g083790 [Medicago truncatula]
Length=175

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query  178  LLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLF-NS  354
            ++ EA+ +  AL W+ D  F NV    D   +V SF   +   S LG I+ +C QLF +S
Sbjct  1    MIGEAIGLHTALQWISDLQFDNVDFVLDSKQIVDSFHTGVDDDSELGCIITACRQLFQDS  60

Query  355  FDSCSIKFVRRDANMVAHALAK  420
            F +  ++F RR AN VAH LA+
Sbjct  61   FQNTHVEFNRRQANEVAHKLAR  82



>ref|XP_003609437.1| hypothetical protein MTR_4g115700 [Medicago truncatula]
Length=111

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P  AEA+ +R+A+ WL   G   V I  DC ++V S  D    +S  G IL +C  L   
Sbjct  11   PQEAEALGLRDAIIWLGHLGMSKVHIELDCKLVVESIGDRTKDQSEFGNILATCRDLLQH  70

Query  355  FDSCSIKFVRRDANMVAHALAK  420
            F +  I F+RR AN V H L +
Sbjct  71   FPNFKISFIRRQANYVVHCLVR  92



>ref|XP_003614116.1| hypothetical protein MTR_5g045010 [Medicago truncatula]
Length=147

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 50/99 (51%), Gaps = 3/99 (3%)
 Frame = +1

Query  133  LEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSY  312
            L      P + P D  + EA+ +R  L WL D  F NV   +D  +   +F       S 
Sbjct  26   LAKTVTHPCLLPVD--VGEALGLRLVLQWLSDMQFDNVDFETDFKLTSDAFLSDRNDTSE  83

Query  313  LGIILDSCLQLFNS-FDSCSIKFVRRDANMVAHALAKHS  426
             G I+ SC  LF S F +  +KFVRR AN VAHALA+ +
Sbjct  84   FGCIISSCRSLFTSLFSNSRVKFVRRQANGVAHALAREA  122



>ref|XP_009623190.1| PREDICTED: uncharacterized protein LOC104114439 [Nicotiana tomentosiformis]
Length=362

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 60/131 (46%), Gaps = 3/131 (2%)
 Frame = +1

Query  37   PLPPGGLYCFTDAA--IHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREA  210
            P  PG L C  DA+  ++      G    +           PL   +D ++AE + VREA
Sbjct  202  PPDPGTLKCNIDASYDVNSGRAWDGMLIRSTHENFVRGFTTPLEASHDAVIAEILTVREA  261

Query  211  LSWLRDRGFQN-VAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
            LSWL+ +  ++ + I  DC +   +        SY  II+  C  L   F S S+ FV+R
Sbjct  262  LSWLKMQHHKSPITIEMDCLLAKQALERSDNGNSYFDIIVQDCKVLMCDFTSISLSFVKR  321

Query  388  DANMVAHALAK  420
             AN  AH L +
Sbjct  322  SANQCAHMLVR  332



>gb|KHN31016.1| hypothetical protein glysoja_020314, partial [Glycine soja]
Length=142

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/132 (27%), Positives = 65/132 (49%), Gaps = 2/132 (2%)
 Frame = +1

Query  37   PLPPGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREA  210
            P P   + C TDA+I      +G      +  G   +  +        PL AEA +++ A
Sbjct  1    PPPYDFVKCNTDASIFQDQSKFGLATSVQDTDGTFISVMSSWFSGIPSPLEAEARSLQLA  60

Query  211  LSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRD  390
            L W   +   N+ + +DC  +++  +      + +G IL +C++  ++F +C ++FV + 
Sbjct  61   LDWQSSQKQNNLILETDCKQIINCIKAKKFQNNEVGDILRNCVEKISTFQNCIVQFVTQQ  120

Query  391  ANMVAHALAKHS  426
            AN V H+LA+ S
Sbjct  121  ANQVVHSLARAS  132



>gb|EEC75888.1| hypothetical protein OsI_12930 [Oryza sativa Indica Group]
Length=834

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 70/133 (53%), Gaps = 2/133 (2%)
 Frame = +1

Query  34   MPLPPGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVRE  207
             PLP G     +DAAI  +S T G  A   +  G    A +  +     P LAEA+A+R 
Sbjct  677  QPLPAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRR  736

Query  208  ALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
            AL   ++ G Q++ + SDC  ++   +     RS +G +++   +L ++F  CS   V R
Sbjct  737  ALGLAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNR  796

Query  388  DANMVAHALAKHS  426
             +N+ AH+LA+++
Sbjct  797  LSNLAAHSLARNA  809



>gb|AAU89136.1| F-box domain containing protein [Oryza sativa Japonica Group]
Length=855

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 70/133 (53%), Gaps = 2/133 (2%)
 Frame = +1

Query  34   MPLPPGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVRE  207
             PLP G     +DAAI  +S T G  A   +  G    A +  +     P LAEA+A+R 
Sbjct  698  QPLPAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRR  757

Query  208  ALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
            AL   ++ G Q++ + SDC  ++   +     RS +G +++   +L ++F  CS   V R
Sbjct  758  ALGLAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNR  817

Query  388  DANMVAHALAKHS  426
             +N+ AH+LA+++
Sbjct  818  LSNLAAHSLARNA  830



>ref|XP_006603254.1| PREDICTED: uncharacterized protein LOC102660201 [Glycine max]
Length=214

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 62/132 (47%), Gaps = 2/132 (2%)
 Frame = +1

Query  37   PLPPGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREA  210
            P  PG + C  D A       +G   C  + +G    A         +    EA+ + + 
Sbjct  72   PPGPGFVKCNIDVAYFQEQQWWGKGMCIQDDKGWFVRATMNIRHGMPEVHEGEALVLLQT  131

Query  211  LSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRD  390
            L+WL++  +Q V + SDC  L  S    +   S  G+IL+ C ++  SF +  +  +R+ 
Sbjct  132  LTWLKNMDYQYVEVESDCKRLTDSLDRNIMDDSEFGMILNKCKRILMSFPNHKVSLIRKQ  191

Query  391  ANMVAHALAKHS  426
            AN +AH+LA+ S
Sbjct  192  ANCIAHSLARAS  203



>gb|ADK92871.1| retrotransposon protein [Hypericum perforatum]
Length=593

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 42/129 (33%), Positives = 55/129 (43%), Gaps = 19/129 (15%)
 Frame = +1

Query  91   SPTYGFYACNAQGGLEAAANGP--LICPND-----------------PLLAEAMAVREAL  213
            +PT GFY  N   GL A   G   ++  +D                 P L E  AV   L
Sbjct  438  APTAGFYKINVDAGLRAERGGQVGIVVRDDTGAFVMATTRSFPNLVHPTLLEGQAVYTGL  497

Query  214  SWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDA  393
             +    G + V + SDC  +V       T RS L  I+D C  L ++F    I  VRR+A
Sbjct  498  EFANALGLERVELESDCLPVVMQLSKGYTDRSDLSNIIDDCKMLLSNFQQVRIAHVRREA  557

Query  394  NMVAHALAK  420
            N  AH +AK
Sbjct  558  NQAAHEMAK  566



>ref|XP_002512628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50080.1| conserved hypothetical protein [Ricinus communis]
Length=223

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            +P LAEA+A++EA+ W     F  V   SD  + V + R +    S  GII+D C  L +
Sbjct  111  EPRLAEAVALKEAIRWAIQMRFSLVVFESDSKIAVDAIRSLAADWSEFGIIIDECRSLLS  170

Query  352  SFDSCSIKFVRRDANMVAHALAKHS  426
               +  + FV+R ANMVAH LA  S
Sbjct  171  LGLNFQVYFVKRQANMVAHVLAMSS  195



>ref|XP_003588770.1| hypothetical protein MTR_1g012560 [Medicago truncatula]
Length=214

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 58/135 (43%), Gaps = 21/135 (16%)
 Frame = +1

Query  79   IHGTSPTYGFYACNAQGGLEAAAN--GPLICPND--------------PL----LAEAMA  198
            +  + P YG Y CN      ++ N  G  IC  D              PL    + EA+ 
Sbjct  53   VEWSKPAYGRYKCNIDTSFSSSMNMVGIGICFRDDRGEFVSAKIDCFPPLCDVAVGEAVG  112

Query  199  VREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN-SFDSCSIK  375
                L W+ +  + NV    D  ++V  FR  +   S  G I+  C QLF  SF +  ++
Sbjct  113  FHTKLKWMAELHYDNVDFALDSKIVVDHFRSSLEDDSEFGCIMYDCKQLFEISFQNSHVE  172

Query  376  FVRRDANMVAHALAK  420
            F RR AN VAH L +
Sbjct  173  FNRRQANGVAHELVR  187



>gb|KHN31589.1| hypothetical protein glysoja_043032, partial [Glycine soja]
Length=155

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 58/124 (47%), Gaps = 3/124 (2%)
 Frame = +1

Query  55   LYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRD  228
            + C  DAA+      +GF AC  N++G   +A +     P  P  AE+ AV   L W+ D
Sbjct  22   MKCNVDAALFQEDNKFGFAACIRNSEGVFISAISWFQGIP-KPQEAESYAVLSTLQWISD  80

Query  229  RGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAH  408
                NV I +DC  +  +      +    G IL  C +   +  +C I+FV R+AN V H
Sbjct  81   LQLTNVIIETDCKAIPHAIHSKRFHELEAGRILCICAKKICNLHNCRIQFVSREANQVTH  140

Query  409  ALAK  420
             L +
Sbjct  141  NLTR  144



>ref|XP_006470496.1| PREDICTED: uncharacterized protein LOC102617255 [Citrus sinensis]
Length=440

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  184  AEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDS  363
            AEA+ VREALSW++     NV I  DC  + ++  + ++  S   +I++ C  L NS   
Sbjct  334  AEALGVREALSWIKQLQLSNVTIEMDCLTVYNALVNNLSGPSSFSLIIEDCRALSNSIRD  393

Query  364  CSIKFVRRDANMVAHALAK  420
             S  FVRR AN VAH +A+
Sbjct  394  VSFSFVRRSANSVAHYVAQ  412



>ref|XP_009800085.1| PREDICTED: uncharacterized protein LOC104246050 [Nicotiana sylvestris]
Length=690

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 41/131 (31%), Positives = 62/131 (47%), Gaps = 3/131 (2%)
 Frame = +1

Query  37   PLPPGGLYCFTDA--AIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREA  210
            P  PG L C  DA   ++      G    +  G      +  L   +D ++AE + VREA
Sbjct  530  PPDPGTLKCNIDAFYEVNSGRAWAGMLIRDTHGNFVRGFSTLLGASHDAVIAEILTVREA  589

Query  211  LSWLRDRGFQN-VAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
            LSWL+ +  ++ + I  DC +   +     +  SY  II+  C +L   F S S+ FV+R
Sbjct  590  LSWLKMQHHRSPITIEMDCLLAKQALERSDSGNSYFDIIVQDCKELMRDFTSISLYFVKR  649

Query  388  DANMVAHALAK  420
             A   AH LA+
Sbjct  650  SAKQRAHMLAR  660



>ref|XP_006593242.1| PREDICTED: uncharacterized protein LOC102666191 [Glycine max]
Length=192

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 58/124 (47%), Gaps = 3/124 (2%)
 Frame = +1

Query  55   LYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRD  228
            + C  DAA+      +GF AC  N++G   +A +     P  P  AE+ AV   L W+ D
Sbjct  43   MKCNVDAALFQEDNKFGFAACIRNSEGVFISAISWFQGIPK-PQEAESYAVLSTLQWISD  101

Query  229  RGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAH  408
                NV I +DC  +  +      +    G IL  C +   +  +C I+FV R+AN V H
Sbjct  102  LQLTNVIIETDCKAIPHAIHSKRFHELEAGRILCICAKKICNLHNCRIQFVSREANQVTH  161

Query  409  ALAK  420
             L +
Sbjct  162  NLTR  165



>ref|XP_002522452.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF39944.1| nucleic acid binding protein, putative [Ricinus communis]
Length=483

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            +P +AEA A++EALSW+  +G + V I +DC   +    + +   SYL  +L  C  L  
Sbjct  392  NPDVAEAWALKEALSWIHAKGMEEVQIETDCLRNIELLEEELHPNSYLLCLLKDCQDLLR  451

Query  352  SFDSCSIKFVRRDANMVAHALAK  420
              + C++ FV   AN VAH ++K
Sbjct  452  VLNRCNLVFVYGSANTVAHMISK  474



>ref|XP_010680095.1| PREDICTED: uncharacterized protein LOC104895323 [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  43   PPGGLYCFT-DAAIHGTSPT-YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALS  216
            PPG L     DA+++G      G  A + Q  +  +A         P +AEA A+  A+ 
Sbjct  67   PPGNLVKVNADASLNGEGWVGLGAVARDNQENVLFSAVRRTRAWWPPDVAEAKAIYMAVL  126

Query  217  WLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDAN  396
            W ++ G + V I SD  VLVS    V  + S L  IL   + L + F+  S   VRR+ N
Sbjct  127  WAKNHGLKEVIIESDAQVLVSRLSSVALFHSDLDAILGDIVNLCSWFNVISFSHVRREGN  186

Query  397  MVAHALAK  420
             VAH LAK
Sbjct  187  YVAHHLAK  194



>gb|KDP37578.1| hypothetical protein JCGZ_08269 [Jatropha curcas]
Length=95

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +1

Query  169  NDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLF  348
            +DP  A+A+  REALSW++ +G   V   ++  +LV + +  +   +Y G I+  C  L 
Sbjct  7    HDPHTADAILFREALSWVKGKGMDRVLFETNSQMLVQALQRPLNDGTYFGSIVADCKLLI  66

Query  349  NSFDSCSIKFVRRDANMVAHALA  417
                 CS  F++R AN VAH L 
Sbjct  67   EELSHCSFCFMKRSANRVAHLLT  89



>ref|XP_010692677.1| PREDICTED: uncharacterized protein LOC104905754 [Beta vulgaris 
subsp. vulgaris]
Length=965

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 66/162 (41%), Gaps = 24/162 (15%)
 Frame = +1

Query  1    QHATVLPVAL-------EMPLPPG--------------GLYCFTDAAIHGTSPTYGFYAC  117
            QH T L   L       E P PPG               L+   D +    SP  G  A 
Sbjct  792  QHVTFLTKPLACHRALAEGPGPPGFLMAHFGSSFSGVPQLHIQVDGSWAKQSPLAGI-AW  850

Query  118  NAQGGLEAAANGPLIC--PNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRD  291
             AQ G      G  IC   +  LLAEAMA  EAL W   +G+Q VA+ +D  ++V S R+
Sbjct  851  VAQIGTNHTHQGKGICILADSALLAEAMACLEALVWANGQGYQRVAVHTDSEIVVQSLRN  910

Query  292  VMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALA  417
                 + +   L+    +   F  C I  V R    +AH LA
Sbjct  911  PRIQPTTIAWTLNDVRSIGEQFHWCRITKVNRSQVQIAHDLA  952



>ref|XP_003615350.1| hypothetical protein MTR_5g066880 [Medicago truncatula]
Length=110

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +1

Query  181  LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFD  360
            + EA+ +  AL WL D  F NV   ++  +   +F       S  G I+ SC  LFN+F 
Sbjct  11   VGEALGMHSALQWLSDMQFDNVDFETNSKLTAQAFLSTRNDLSEFGCIISSCCSLFNTFF  70

Query  361  SCS-IKFVRRDANMVAHALAKH  423
            S S ++FVRR  N+V HALA+ 
Sbjct  71   SNSRMEFVRRQVNVVVHALARE  92



>ref|XP_003616537.1| hypothetical protein MTR_5g081540 [Medicago truncatula]
Length=122

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 3/92 (3%)
 Frame = +1

Query  154  PLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDS  333
            P   P D  + EA+ +  AL WL D  F NV   +D  + V +F       S  G I+ S
Sbjct  5    PCFLPID--MGEALGLYLALQWLSDMQFDNVDFETDFNLTVDAFLYDRNDTSEFGCIITS  62

Query  334  CLQLFNS-FDSCSIKFVRRDANMVAHALAKHS  426
            C  LFNS F +  ++F RR AN +AHALA+ +
Sbjct  63   CRSLFNSLFSNSRVEFFRRQANGIAHALARDT  94



>ref|XP_006343420.1| PREDICTED: uncharacterized protein LOC102579274 [Solanum tuberosum]
Length=197

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 68/137 (50%), Gaps = 9/137 (7%)
 Frame = +1

Query  34   MPLPPGGLYCFTDAAIHGTSPT--YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVRE  207
            + +   G+  F DA++H    T   G  A ++ G L  A   P+      + AEA+A+R 
Sbjct  56   ITMAQDGIVVFADASVHKEKKTASIGVVALDSYGNLLHAFGSPIQYVGKVITAEAIAIRM  115

Query  208  ALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILD-SCLQLFN---SFDSCSIK  375
            AL   R++G+  V I SD      +  D++  R+ +   ++ +C  ++N    F+  ++ 
Sbjct  116  ALENAREKGWTKVQILSDAK---KNVVDLVLQRTIVSWEIETTCEDIWNLMKCFEVVAVN  172

Query  376  FVRRDANMVAHALAKHS  426
             + R  N+VAH LAK S
Sbjct  173  HIPRSWNLVAHNLAKFS  189



>gb|EPS63384.1| hypothetical protein M569_11402 [Genlisea aurea]
Length=254

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 60/133 (45%), Gaps = 8/133 (6%)
 Frame = +1

Query  43   PP--GGLYCFTDAAIHGTSPTYGFYACNAQG---GLEAAANGPLICPNDPLLAEAMAVRE  207
            PP  G L    D+   G   T+     + +G   G  + +  P++   DP   E +A + 
Sbjct  100  PPAMGSLKINVDSGKIGNHTTWAGLIRDGRGRCIGWYSKSISPIL---DPEHGEYLATKW  156

Query  208  ALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
             L + R  G   + + +DC  LVS+  D       L  +L     L   FDSC + F+RR
Sbjct  157  GLIFARFLGISTITLEADCLALVSAITDDTMLNGTLQNLLTDIRVLLQEFDSCQVIFIRR  216

Query  388  DANMVAHALAKHS  426
            +AN  AH LAK S
Sbjct  217  NANKAAHLLAKSS  229



>ref|XP_010680492.1| PREDICTED: uncharacterized protein LOC104895629 [Beta vulgaris 
subsp. vulgaris]
Length=389

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 61/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  43   PPGGLYCFT-DAAIHGTSPT-YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALS  216
            PP GL     DA+++G      G  A + +G +  +A         P +AEA A+  A+ 
Sbjct  232  PPSGLVKVNADASVNGEGWVGLGAVARDDKGSVLFSAVRRTRAWWPPDVAEAKAIYMAVL  291

Query  217  WLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDAN  396
            W +  G + V I SD  VLVS       + S L  IL   + L + F+  S   VRRD N
Sbjct  292  WAKHHGLKEVVIESDAQVLVSRLSSAALFHSDLDAILGDIINLCSWFNIISFSHVRRDGN  351

Query  397  MVAHALAK  420
             VAH LAK
Sbjct  352  YVAHHLAK  359



>ref|XP_009151504.1| PREDICTED: uncharacterized protein LOC103874823 [Brassica rapa]
Length=170

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 58/122 (48%), Gaps = 1/122 (1%)
 Frame = +1

Query  55   LYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRG  234
            +Y  TDAA        G           A+  G     N  LLAE++A+REAL   ++  
Sbjct  37   VYVRTDAAWRSEDKAAGLGWTIQDTRQGASFKGYQKRVNSALLAESLALREALLMCKEME  96

Query  235  FQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHAL  414
              N+ + SD +VL+ + R         G+I D  L L +SF S S  ++ RD N VAH L
Sbjct  97   VTNLRVESDSSVLIKAARGTEPVAELHGVISDIRL-LSSSFQSISFGWISRDQNGVAHKL  155

Query  415  AK  420
            AK
Sbjct  156  AK  157



>ref|XP_003593283.1| hypothetical protein MTR_2g009730 [Medicago truncatula]
Length=268

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 61/146 (42%), Gaps = 21/146 (14%)
 Frame = +1

Query  52   GLYCFTDAAIHGTSPTYGFYACNAQGGLEA--AANGPLICPNDP----LLA---------  186
            G Y  T       +P  G Y CN      +     G  IC  D     +LA         
Sbjct  101  GFYYGTTCCYFVEAPYSGRYKCNIDATFSSRFKRTGIDICVRDSDSTFVLAKTVTYPCIV  160

Query  187  -----EAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
                 EA+ +  AL WL D  F +V   +D  V   +F       S  G I+ SC  LF+
Sbjct  161  SVDVGEALGLHSALQWLSDMQFDSVDFETDSKVTSDAFLSTRNDTSEFGSIISSCRLLFS  220

Query  352  SFDSCS-IKFVRRDANMVAHALAKHS  426
            SF S S ++FVRR  N V HALA+ +
Sbjct  221  SFFSNSKVEFVRRQTNTVTHALARET  246



>ref|XP_003595869.1| hypothetical protein MTR_2g062740 [Medicago truncatula]
Length=155

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +1

Query  181  LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSC-LQLFNSF  357
            + EA+ +  A+ W++D  F NV    D  +   +F  + T  +  G I+D C +Q F+SF
Sbjct  48   VGEALGLYHAIQWMQDMQFDNVDFKLDSKIKRDAFHSLETDVTEFGNIIDECRVQFFSSF  107

Query  358  DSCSIKFVRRDANMVAHALAK  420
             +  ++F+RR  N+ AH LA+
Sbjct  108  TNSRVEFIRRQMNVAAHGLAR  128



>ref|XP_002529689.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32700.1| conserved hypothetical protein [Ricinus communis]
Length=119

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P  AEA+++REALSWL+ + F+   I SD   ++ + +   + +S   +I+D C  L   
Sbjct  15   PREAEAISIREALSWLKQQIFEECIIESDALQVIEALK-APSSQSCFHLIIDDCKHLVQH  73

Query  355  FDSCSIKFVRRDANMVAHALAK  420
            F     +FVRR AN  A  +A+
Sbjct  74   FRQVHFQFVRRSANTAAQIVAR  95



>ref|XP_010679712.1| PREDICTED: uncharacterized protein LOC104895014 [Beta vulgaris 
subsp. vulgaris]
Length=197

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 57/130 (44%), Gaps = 19/130 (15%)
 Frame = +1

Query  94   PTYGFYACNAQ-----------GGLEAAANGPLICPNDPLL--------AEAMAVREALS  216
            P  G Y  N+            GG+   ANG ++      L        AEA A R AL 
Sbjct  38   PVEGHYKVNSDAAIYKDCTVGLGGVMRDANGDIMGATSMHLKLDMEVHEAEACAARHALK  97

Query  217  WLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDAN  396
               + GF+N+ + SDC  L+S  +      +  G I++  L L N   S S   VRR+ N
Sbjct  98   IAMEAGFRNIVLESDCLKLISHLKRKKRDDTSFGNIVEDILWLGNCCSSISFSHVRREGN  157

Query  397  MVAHALAKHS  426
             VAH LA+ S
Sbjct  158  RVAHILAQRS  167



>ref|XP_003617609.1| hypothetical protein MTR_5g093480 [Medicago truncatula]
Length=222

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 54/111 (49%), Gaps = 8/111 (7%)
 Frame = +1

Query  79   IHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFS  258
            +H  +P  G Y CN      +  N       D  + EA+ + +A SW  + GF  +    
Sbjct  83   VHIHAP--GRYKCNVDASFSSDHNNV-----DVEVGEALGLSQAFSWAVELGFDGMNFLL  135

Query  259  DCAVLVSSFRDVMTYRSYLGIILDSCLQLF-NSFDSCSIKFVRRDANMVAH  408
            D  ++V +F D     + L II+  C ++F NSF +  ++F RR AN +AH
Sbjct  136  DSKIMVDAFNDGNKQNTKLVIIIHHCRKVFNNSFHNYVVEFSRRQANGIAH  186



>ref|XP_010668107.1| PREDICTED: uncharacterized protein LOC104885102 [Beta vulgaris 
subsp. vulgaris]
Length=194

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 4/128 (3%)
 Frame = +1

Query  43   PPGGLYC--FTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALS  216
            PP G Y   F  + +      +GF   + +G +     G L   +  LLAEA  +RE + 
Sbjct  30   PPRGFYKMNFDGSKVSNGQAAFGFVIRDEEGKIMLCGAGSLDKSDSILLAEAKGMREGIR  89

Query  217  WLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYL-GIILDSCLQLFNSFDSCSIKFVRRDA  393
              +  G  N+ +  D  V+++S R +      +  IILD+  +L N FD   I  V R+A
Sbjct  90   GAKSLGISNIIVEGDNMVVINSIRKLWKIPWMIKSIILDTEQELAN-FDEVHIYHVFREA  148

Query  394  NMVAHALA  417
            NM A  +A
Sbjct  149  NMAADWMA  156



>ref|XP_003596206.1| hypothetical protein MTR_2g071530 [Medicago truncatula]
Length=126

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 45/84 (54%), Gaps = 1/84 (1%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            D  + EA+ +   L W+ D  + NV    DC  +V  F   +   S L  I+ +C QLF+
Sbjct  16   DVDVGEAVGLHTTLQWMADLHYDNVDFVLDCKSVVEHFNSNLGDSSELDCIIQACRQLFD  75

Query  352  -SFDSCSIKFVRRDANMVAHALAK  420
             +F +  ++F RR AN VAH LA+
Sbjct  76   CNFQNSHVEFNRRQANGVAHELAR  99



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 70/131 (53%), Gaps = 3/131 (2%)
 Frame = +1

Query  43    PPGGLYCF-TDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREAL  213
             PP  ++   +DAAI  +S T G  A   +  G    A +  +     P LAEA+A+R AL
Sbjct  1227  PPASVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRAL  1286

Query  214   SWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDA  393
                ++ G +++ + SDC  ++   +     RS +G +++   +L ++F  CS   V R +
Sbjct  1287  GLAKEEGLEHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLS  1346

Query  394   NMVAHALAKHS  426
             N+ AH+LA+++
Sbjct  1347  NLAAHSLARNA  1357



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 70/131 (53%), Gaps = 3/131 (2%)
 Frame = +1

Query  43    PPGGLYCF-TDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREAL  213
             PP  ++   +DAAI  +S T G  A   +  G    A +  +     P LAEA+A+R AL
Sbjct  1184  PPASVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRAL  1243

Query  214   SWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDA  393
                ++ G +++ + SDC  ++   +     RS +G +++   +L ++F  CS   V R +
Sbjct  1244  GLAKEEGLEHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLS  1303

Query  394   NMVAHALAKHS  426
             N+ AH+LA+++
Sbjct  1304  NLAAHSLARNA  1314



>ref|XP_002531249.1| hypothetical protein RCOM_0494170 [Ricinus communis]
 gb|EEF31146.1| hypothetical protein RCOM_0494170 [Ricinus communis]
Length=329

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 62/132 (47%), Gaps = 2/132 (2%)
 Frame = +1

Query  37   PLPPGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREA  210
            P  PG + C  D A+   S   GF     ++ G     A+G      +  LAEA+ +REA
Sbjct  170  PPQPGFVKCNVDGAVFTASGRSGFGMVIRDSAGSFVMGADGSSPGLFNVKLAEAIGLREA  229

Query  211  LSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRD  390
            + W+   G  NV    D  V+V +           G ++  C  L     + S++F+R+ 
Sbjct  230  VQWVLSLGRSNVIFEYDAKVVVDAVLSGAADLFEFGAVIADCRLLLQHGCNYSVQFIRKQ  289

Query  391  ANMVAHALAKHS  426
            AN+VAH+LA+ S
Sbjct  290  ANLVAHSLARAS  301



>ref|XP_010665576.1| PREDICTED: uncharacterized protein LOC104882857 [Beta vulgaris 
subsp. vulgaris]
Length=182

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 61/130 (47%), Gaps = 6/130 (5%)
 Frame = +1

Query  43   PPGGLYCF-TDAAIHGTSPT-YGFYACNAQGGL--EAAANGPLICPNDPLLAEAMAVREA  210
            PP GL    TDA++        G  A + +G +            P+D  +AEA A+  A
Sbjct  25   PPAGLVKINTDASLADEGVVGLGAVARDTEGRVLFSVVRRTRAWWPSD--IAEAKAIHMA  82

Query  211  LSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRD  390
            + W + +G ++V I SD  V+VS       + S L  IL   L L + F   S   VRRD
Sbjct  83   ILWAKKQGLRSVIIESDAQVIVSRLARASIFFSDLDSILGDILSLCSFFHDISFSHVRRD  142

Query  391  ANMVAHALAK  420
             N VAH LAK
Sbjct  143  ENFVAHHLAK  152



>ref|XP_009109961.1| PREDICTED: uncharacterized protein LOC103835530 [Brassica rapa]
Length=427

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 45/84 (54%), Gaps = 1/84 (1%)
 Frame = +1

Query  169  NDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLF  348
            + PL+AE +A+REAL   R +G+  + +FSD   LV +  D    +   GII D  LQL 
Sbjct  332  SSPLMAEGLAIREALLQARRQGYSTLTVFSDAQTLVRAINDRKPLKELFGIIHD-ILQLS  390

Query  349  NSFDSCSIKFVRRDANMVAHALAK  420
              F   S  ++ R  N  A ALAK
Sbjct  391  LEFSVISFVYISRLNNSAADALAK  414



>ref|XP_002532287.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30102.1| conserved hypothetical protein [Ricinus communis]
Length=346

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  184  AEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDS  363
            +E M +REALSW+R + +Q V    DC  +V +  + +      G ++  C +L    +S
Sbjct  239  SETMRLREALSWIRGKWYQRVIFELDCQQIVHAVTNFLASVDEFGSLIRECAELLAENNS  298

Query  364  CSIKFVRRDANMVAHALAK  420
             S+ FV+R AN +A+ LA+
Sbjct  299  YSVIFVKRQANEIAYMLAR  317



>gb|EEE56566.1| hypothetical protein OsJ_05904 [Oryza sativa Japonica Group]
Length=420

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 59/129 (46%), Gaps = 3/129 (2%)
 Frame = +1

Query  43   PPGGLYCF-TDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREAL  213
            PP G++   TDAA+       G      +  G    AAN   +   DP  AEA A+R AL
Sbjct  265  PPAGVFLINTDAAVFQAERQMGVGVVIRDQHGNCLLAANTRFMGITDPETAEACAIRHAL  324

Query  214  SWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDA  393
               ++ GF NV +  DC  ++         RS +G +++   +L   F S S   V   +
Sbjct  325  WLAKEEGFHNVIVACDCLSVIQKLNSPGRDRSKIGCLVEDIKKLGVEFISVSFIHVSHCS  384

Query  394  NMVAHALAK  420
            N+ AH LA+
Sbjct  385  NVAAHTLAR  393



>ref|XP_006662398.1| PREDICTED: uncharacterized protein LOC102702136 [Oryza brachyantha]
Length=390

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            + L+AEA+A R+ L + + RG  N+ + +DC VLV  + D +  RS +  IL    +L  
Sbjct  136  NALMAEALACRDGLLFAQSRGVVNLWLETDCQVLVRLWEDRVKQRSEVSFILREMAELSA  195

Query  352  SFDSCSIKFVRRDANMVAHALAK  420
            SF S ++ F  R+ N VAH  A+
Sbjct  196  SFVSLTLSFANRNCNRVAHECAR  218



>gb|EEC72753.1| hypothetical protein OsI_06384 [Oryza sativa Indica Group]
Length=556

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 59/129 (46%), Gaps = 3/129 (2%)
 Frame = +1

Query  43   PPGGLYCF-TDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREAL  213
            PP G++   TDAA+       G      +  G    AAN   +   DP  AEA A+R AL
Sbjct  401  PPAGVFLINTDAAVFQAERQMGVGVVIRDQHGNCLLAANTRFMGITDPETAEACAIRHAL  460

Query  214  SWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDA  393
               ++ GF NV +  DC  ++         RS +G +++   +L   F S S   V   +
Sbjct  461  WLAKEEGFHNVIVACDCLSVIQKLNSPGRDRSKIGCLVEDIKKLGVEFISVSFIHVSHCS  520

Query  394  NMVAHALAK  420
            N+ AH LA+
Sbjct  521  NVAAHTLAR  529



>ref|XP_010495785.1| PREDICTED: uncharacterized protein LOC104772929 [Camelina sativa]
Length=1074

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 45/145 (31%), Positives = 71/145 (49%), Gaps = 7/145 (5%)
 Frame = +1

Query  4     HATVLPVALE-MPLPPGGLYCFTDAAIHGTSPT---YGFYACNAQGGLEAAANGPLICPN  171
              + V P++L    +P   + C TDAA      T   + F   +    L+ ++N  LI   
Sbjct  925   QSRVFPLSLRPAQIPSSRILCSTDAAWKNDGITGCGWIFKNSSESTLLQGSSNSRLI--R  982

Query  172   DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
              PL+AEA+A  +AL    + GF  V   SD  +LV +     + +   GII D+ L L +
Sbjct  983   SPLMAEAIATFKALGVAIESGFTQVQFASDSQLLVQALNRRSSPKEIHGIIYDA-LSLAS  1041

Query  352   SFDSCSIKFVRRDANMVAHALAKHS  426
              FD C+  ++ ++ N  A ALAK +
Sbjct  1042  QFDFCNFFYIPKNCNRQADALAKSA  1066



>ref|XP_010666711.1| PREDICTED: uncharacterized protein LOC104883845 [Beta vulgaris 
subsp. vulgaris]
Length=849

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P +AEA A+  A+SW + +  +++ + SD  V+VS       Y S L  IL   L L + 
Sbjct  738  PNIAEAKAIFLAISWAKKQSLKDIIVESDAQVIVSRLSRAAVYFSDLDGILGDALSLCSC  797

Query  355  FDSCSIKFVRRDANMVAHALAK  420
            F S S   V+R  N VAH LAK
Sbjct  798  FHSISFSHVKRSGNFVAHHLAK  819



>ref|XP_009119792.1| PREDICTED: uncharacterized protein LOC103844732 [Brassica rapa]
Length=170

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 1/128 (1%)
 Frame = +1

Query  37   PLPPGGLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALS  216
            P PP  L   TDAA   TS   GF          ++  G        L+AE +A+REAL+
Sbjct  31   PRPPHCLVLNTDAAWKATSMLAGFGWTTRDSARTSSFTGYERFVGSALVAEGLALREALT  90

Query  217  WLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDAN  396
              + +G + +   SD + L+ +           GI+ D  L+L +SFD  S  ++ R+ N
Sbjct  91   RCKAQGVRKLVCESDSSQLIKAINSGAVKPEIYGIVSD-ILELASSFDVISFGWISRERN  149

Query  397  MVAHALAK  420
            + A  +AK
Sbjct  150  LNADKIAK  157



>ref|XP_003627699.1| hypothetical protein MTR_8g036680 [Medicago truncatula]
Length=116

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P  AEA  + EA+     RG Q V   SDC ++V +    +   + LG I+  C QL + 
Sbjct  18   PSEAEATGLLEAVKLAIARGMQPVIFESDCKIVVDAVNSSVNPHNELGDIIFYCKQLLSL  77

Query  355  FDSCSIKFVRRDANMVAHALAKHS  426
              + S++FVRR AN V H +AK S
Sbjct  78   HANFSVRFVRRQANKVTHNIAKAS  101



>ref|XP_010676258.1| PREDICTED: uncharacterized protein LOC104892125 [Beta vulgaris 
subsp. vulgaris]
Length=175

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 63/141 (45%), Gaps = 1/141 (1%)
 Frame = +1

Query  1    QHATVLPVALEMPLPPGGLYCFTDAAIHGTSPT-YGFYACNAQGGLEAAANGPLICPNDP  177
            Q ATV   +     PPG +   TDA +        G  A ++ G +  +A         P
Sbjct  5    QKATVASSSKWRAPPPGVIKVNTDACVGNDGWIGLGVVARDSDGRVCFSAVRRCRAWWPP  64

Query  178  LLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSF  357
             +AE  A+   +   +D G ++V + SD  V+ +     + Y S L  IL   L L   F
Sbjct  65   EIAECKAIHLGVRLAKDHGLRDVLVESDSQVVTTRLTKAVLYYSDLDFILGDVLALSYVF  124

Query  358  DSCSIKFVRRDANMVAHALAK  420
            +S S   V+RD N VAH LA+
Sbjct  125  NSVSFVHVKRDGNAVAHNLAR  145



>ref|XP_002455221.1| hypothetical protein SORBIDRAFT_03g006485 [Sorghum bicolor]
 gb|EES00341.1| hypothetical protein SORBIDRAFT_03g006485 [Sorghum bicolor]
Length=186

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +1

Query  178  LLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSF  357
            L  EAMA R+ + + R+RG + + + +DC VLV+ + +    +S +   +    QL  SF
Sbjct  75   LATEAMACRDGMQFARERGVRKLLVETDCQVLVNLWENRAMQKSEIEPFMHQMAQLSRSF  134

Query  358  DSCSIKFVRRDANMVAHALAK  420
            +  S+ FV R+ N +AH  AK
Sbjct  135  EVFSLCFVSRNCNRLAHECAK  155



>gb|ABN09176.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=260

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 63/134 (47%), Gaps = 3/134 (2%)
 Frame = +1

Query  31   EMPLPPGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVR  204
            E P P   + C  + A+   +   G+  C  ++ G      +        P  AEA  + 
Sbjct  103  EKP-PLTVVKCNVECALFNNNSIMGYGLCFRDSMGHFLPGMSNYEFLRVTPSEAEATGLL  161

Query  205  EALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVR  384
            EA+     RG Q+V   SDC ++V +    +   + LG I+  C QL +   + S++FVR
Sbjct  162  EAVKLAIARGMQSVIFKSDCKIVVDAVNSSVNPHNELGDIIFYCKQLLSLHANFSVRFVR  221

Query  385  RDANMVAHALAKHS  426
            R AN VAH +A+ S
Sbjct  222  RQANKVAHNIARAS  235



>ref|XP_002526185.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36189.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 47/91 (52%), Gaps = 3/91 (3%)
 Frame = +1

Query  1    QHATVLPVALEMPLPP-GGLYCFTDAAIHGTSPT--YGFYACNAQGGLEAAANGPLICPN  171
            QH     VA++      G + C  DA+I+ T     +G    +A G    A NG +    
Sbjct  82   QHTNGYSVAVKWQKSGIGYVKCNMDASIYLTKGNIAFGMVTRDADGRFLEARNGLINAIM  141

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDC  264
            DPLLAEA++ REALSWL+  G + V +  DC
Sbjct  142  DPLLAEALSCREALSWLKTAGKEKVLVEYDC  172



>ref|XP_003593473.1| Receptor-like kinase CR4 [Medicago truncatula]
Length=349

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 54/118 (46%), Gaps = 8/118 (7%)
 Frame = +1

Query  76   AIHGTSPTYGFYACNAQGGLEAAAN--GPLICPNDPLLAEAMAVREALSWLRDRGFQNVA  249
            A H T P+ G + CNA      + N  G  IC     + EAM +  AL W+RD    N+ 
Sbjct  118  AAHWTKPSAGRFKCNADASFSNSRNRVGIGIC-----IREAMGLLSALLWVRDLNLVNMD  172

Query  250  IFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS-FDSCSIKFVRRDANMVAHALAK  420
               D  V   S        S    I++ C    ++   +  +KF+RR AN V+H++AK
Sbjct  173  FEIDSKVATDSIYSSSDGVSDFIAIINDCRHFLDTDLSNSDVKFIRRQANGVSHSIAK  230



>ref|XP_009109977.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=490

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 42/129 (33%), Positives = 63/129 (49%), Gaps = 3/129 (2%)
 Frame = +1

Query  40   LPPGGLYCFTDAAIHGTS--PTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREAL  213
            +P   L CF+DAA   +S     G+ A +  G +    +         L+AEAMA++ +L
Sbjct  343  VPTNSLICFSDAAWISSSGDSGLGWVAKDPDGTVRFQGSDTRQFVASALMAEAMALKSSL  402

Query  214  SWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDA  393
            S     GF++V  F+D   LV       +  +  GII D  + L +S +S S +F+ RD 
Sbjct  403  SLAISSGFKDVVCFTDSKSLVGLLTGTSSVVALKGIIHDISV-LSSSLNSISYQFISRDC  461

Query  394  NMVAHALAK  420
            N  A  LAK
Sbjct  462  NSDADRLAK  470



>ref|XP_004305091.1| PREDICTED: ribonuclease HI-like [Fragaria vesca subsp. vesca]
Length=180

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 63/127 (50%), Gaps = 2/127 (2%)
 Frame = +1

Query  43   PPGGLYCFT-DAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSW  219
            PP        D ++   S   GF   +A G   +AA+ P+   + P+ AEA+A+R+ L  
Sbjct  17   PPNSFVKINFDGSVTSNSAACGFIIRDANGRPISAASNPIGRASVPI-AEAVALRDGLLK  75

Query  220  LRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANM  399
             +++GF NV +  D  +++ +          L  +++    L  SFDS + + V R+AN 
Sbjct  76   AKEKGFTNVEVEGDSKLVIDAVNGRFEPPWRLIKLVEDIKTLATSFDSITFRHVLREANF  135

Query  400  VAHALAK  420
            VA A+A 
Sbjct  136  VADAIAN  142



>gb|EEC72520.1| hypothetical protein OsI_05906 [Oryza sativa Indica Group]
Length=175

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P +AEA A+R+ L+  +  G +NV + +DC  +VS+  D     +    + D C  +++ 
Sbjct  76   PTMAEAFALRDGLALAQHIGAKNVIVQTDCMQVVSTMMDGGFSATAAMSVFDDCKLMWDG  135

Query  355  FDSCSIKFVRRDANMVAHALAK  420
            F + SI+   R++N VAH LA+
Sbjct  136  FGTISIEHCNRNSNQVAHELAR  157



>gb|EEE55133.1| hypothetical protein OsJ_02920 [Oryza sativa Japonica Group]
Length=1049

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +1

Query  16    LPVALEMPLPPGGLYCFTDAAIHGTSPTYG--FYACNAQGGLEAAANGPLICPNDPLLAE  189
             LPV    P PPG +   +DAA+   S   G  F   +       AAN  +     P LAE
Sbjct  927   LPVTKWKPPPPGMVLINSDAALFQASNQTGLAFVIRDHSATCLLAANKRITGLLSPELAE  986

Query  190   AMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCS  369
             A+A+R AL   +  GFQNV + SDC  ++   +      S +G+I+    +L   F  CS
Sbjct  987   ALAIRFALEHAKAEGFQNVLMASDCLSVIKRIQSGARDLSVVGVIVRDIKKLETEFLECS  1046



>ref|XP_009126342.1| PREDICTED: uncharacterized protein LOC103851250 [Brassica rapa]
Length=241

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 63/136 (46%), Gaps = 19/136 (14%)
 Frame = +1

Query  43   PPGGLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDP-------LLAEAMAV  201
            P       TDAA H      G       G    A+  P++C   P       LLAE +A 
Sbjct  102  PASTFIVRTDAAWHKEERKAGL------GWTVKASFTPVMCHKRPIHHVSSALLAEGLAA  155

Query  202  REALSWLRDRGFQNVAIFSDCAVLVSSFRD---VMTYRSYLGIILDSCLQLFNSFDSCSI  372
            REAL + RDRG   + + SD + L+ + +    V+     L  IL     LF SF SCS 
Sbjct  156  REALLFCRDRGMDRIHLESDSSQLIKAIQQEEPVIEIHGVLADILHLTKSLFVSF-SCS-  213

Query  373  KFVRRDANMVAHALAK  420
             ++ R+ N+VA +L+K
Sbjct  214  -WIPRNLNLVADSLSK  228



>ref|XP_003614267.1| hypothetical protein MTR_5g047270 [Medicago truncatula]
Length=116

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 3/90 (3%)
 Frame = +1

Query  154  PLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDS  333
            PL+C  D  + EA+A+  A+ W+ +    NV    D   +   F +     +  G I+DS
Sbjct  2    PLLCSVD--VGEALALYHAIQWIHELQLSNVDFEVDSKRVAGYFNNGRGDVTEFGSIMDS  59

Query  334  CLQLFNS-FDSCSIKFVRRDANMVAHALAK  420
             +Q  N+   +  ++F+RR AN VAHALAK
Sbjct  60   SVQFCNTNLSNSHVEFIRRQANEVAHALAK  89



>ref|XP_010673863.1| PREDICTED: uncharacterized protein LOC104890171 [Beta vulgaris 
subsp. vulgaris]
Length=200

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 64/137 (47%), Gaps = 16/137 (12%)
 Frame = +1

Query  43   PPGGLYCF-TDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPN--------DPLLAEAM  195
            P  G +   +DAA++G   T GF      GG+     G ++           D  +AEAM
Sbjct  41   PTSGTFKINSDAAVYGDG-TLGF------GGIVRDEMGEVMLATCDVYEGGCDTDVAEAM  93

Query  196  AVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIK  375
            A R A+    + G +N+ + SDC  L++  +  +   S   +I+   L   +S  S +  
Sbjct  94   AARHAVKVAVEAGLRNIVLESDCLKLITHLKKGLLENSGFSLIVKDILLFRSSNVSLAFN  153

Query  376  FVRRDANMVAHALAKHS  426
             VRR+ N VAH LA+ S
Sbjct  154  HVRREGNRVAHQLAQMS  170



>ref|XP_006404270.1| hypothetical protein EUTSA_v10011157mg, partial [Eutrema salsugineum]
 gb|ESQ45723.1| hypothetical protein EUTSA_v10011157mg, partial [Eutrema salsugineum]
Length=259

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 3/89 (3%)
 Frame = +1

Query  163  CPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILD-SCL  339
            C   PL+AE MA+R ALS       +N+++FSD   L+ +     T     GI+ D SCL
Sbjct  165  CIPSPLIAEGMAMRSALSVAAAEDIRNLSVFSDSLTLIKAINSGTTVSEIHGILEDISCL  224

Query  340  QLFNSFDSCSIKFVRRDANMVAHALAKHS  426
                 FDS S  FV R  N+   ALAK++
Sbjct  225  SEL--FDSISFNFVPRRLNVTVDALAKNA  251



>ref|XP_006409412.1| hypothetical protein EUTSA_v10023022mg [Eutrema salsugineum]
 gb|ESQ50865.1| hypothetical protein EUTSA_v10023022mg [Eutrema salsugineum]
Length=232

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 48/89 (54%), Gaps = 3/89 (3%)
 Frame = +1

Query  163  CPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILD-SCL  339
            C   PL+AE MA+R ALS       +N+++FSD  +L+ +     T     GI+ D SCL
Sbjct  137  CIPSPLIAEGMAMRSALSIAAAEDIRNLSVFSDFLILIKAINSGTTISEIYGILKDISCL  196

Query  340  QLFNSFDSCSIKFVRRDANMVAHALAKHS  426
                 F+S S KF  R  N+ A  LAK++
Sbjct  197  SKL--FESISFKFFPRRFNVTADVLAKNA  223



>gb|EPS61425.1| hypothetical protein M569_13371 [Genlisea aurea]
Length=1255

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = +1

Query  166   PNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQL  345
             P DP   E +A +  L + R  G Q V + SDC  LVS+  + + + + L  IL+    L
Sbjct  1143  PLDPEHGEYLAAKSGLEFARFLGLQAVTLESDCLTLVSAVNENVMHNASLFNILNDITAL  1202

Query  346   FNSFDSCSIKFVRRDANMVAHALAK  420
               +FD+  + FVRR AN  AH L K
Sbjct  1203  LATFDTYHVIFVRRQANNAAHLLGK  1227



>gb|AAQ56556.1| hypothetical protein OSJNBa0070J19.14 [Oryza sativa Japonica 
Group]
Length=275

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            D L+ EA+A R+ +   R++G   + + +DC  L   ++   + RS++  I+   ++L +
Sbjct  162  DALMMEALACRDGIQLAREKGVLRIQVETDCQELTKLWKQGGSQRSHVASIISDAIELSS  221

Query  352  SFDSCSIKFVRRDANMVAHALAKH  423
            SF   ++ +  R  N VAH LAK 
Sbjct  222  SFHGFTLLYTPRSCNHVAHVLAKQ  245



>ref|XP_006476142.1| PREDICTED: uncharacterized protein LOC102616098 [Citrus sinensis]
Length=510

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 57/122 (47%), Gaps = 2/122 (2%)
 Frame = +1

Query  61   CFTDAAIHGTSPT--YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRG  234
            C  DA    +S T  YG    N++G    A +  LI       AEA+ VRE LSWL+   
Sbjct  364  CNVDATTFLSSGTIMYGAVIQNSEGEFVTARSNWLISSFGAREAEAIGVREILSWLKGLP  423

Query  235  FQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHAL  414
            F +V I  D   + ++        +  G+++D C  L  S    +  FVRR AN  AH++
Sbjct  424  FLHVIIEMDSLQVFTALTMDSFSPNGFGLLIDDCRALAQSLGDVTFSFVRRSANSAAHSV  483

Query  415  AK  420
             +
Sbjct  484  TR  485



>ref|XP_009123637.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=300

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 63/124 (51%), Gaps = 7/124 (6%)
 Frame = +1

Query  61   CFTDAAIHGTSPT--YGFYACNAQGG--LEAAANGPLICPNDPLLAEAMAVREALSWLRD  228
            C+TD A    S +   G+   NA+G   +  ++N   +C    L+AEA+A+R+AL   ++
Sbjct  171  CWTDGAWQEISKSGGMGWIIKNAEGEVLMRGSSNREFVC--SALMAEALAIRDALIKAKE  228

Query  229  RGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAH  408
                ++ +FSD  VLVS+ R  +      G++LD    L   F   S  F+ R  N  A 
Sbjct  229  LNLHSIQLFSDSQVLVSALRSGLDVIEIAGVLLD-IRNLATLFCPLSFIFIPRLENRQAD  287

Query  409  ALAK  420
            +LA+
Sbjct  288  SLAR  291



>emb|CAN76892.1| hypothetical protein VITISV_005356 [Vitis vinifera]
Length=1793

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 47/110 (43%), Gaps = 7/110 (6%)
 Frame = +1

Query  91    SPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAV  270
              P YG+   N  G        P        + EA+ VRE LSW+ +R    + + +DC +
Sbjct  1664  KPDYGWIXINVDGA-------PFPHQTLXEVVEALGVREVLSWIHERSRSRIVVETDCLL  1716

Query  271   LVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAK  420
             +V + +         G I+  CL +        + + RR AN  AH LAK
Sbjct  1717  VVQAIQHKSCPNMSFGFIIADCLDVLQHLVDVQVVYARRSANSAAHCLAK  1766



>ref|XP_009140657.1| PREDICTED: uncharacterized protein LOC103864646 [Brassica rapa]
Length=263

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 56/127 (44%), Gaps = 3/127 (2%)
 Frame = +1

Query  49   GGLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLI--CPNDPLLAEAMAVREALSWL  222
              + C TDA+   TS   G      +     A  G  I    + PL+AEA+A+R  L   
Sbjct  125  SAIICTTDASWDATSKRAGLAWIFRENNGTIATQGSEIQHSVSSPLMAEALAIRSTLVMA  184

Query  223  RDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMV  402
             +  F N+ I+SD   L+ +    M  +   GI+ D   Q+ + F S S  F+ R  N  
Sbjct  185  AEHEFPNLRIYSDSLTLIRAINTKMQDKEIYGILCD-IHQISSVFGSISFSFLPRSKNRE  243

Query  403  AHALAKH  423
            A  LAK 
Sbjct  244  ADELAKR  250



>ref|XP_003623678.1| hypothetical protein MTR_7g074420 [Medicago truncatula]
Length=245

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 56/136 (41%), Gaps = 4/136 (3%)
 Frame = +1

Query  13   VLPVALEMPLPPGGLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEA  192
            V+PV  + PL  G   C  D A   +    G         L  A + P + P D  + EA
Sbjct  86   VVPVCWQCPLL-GRYKCNIDDAFSYSHNRTGIDIYEGIFVLAKAVSFPCVSPVD--VGEA  142

Query  193  MAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS-FDSCS  369
              V   L WL D  F N+    D  + + +F       S    I+ SC  LFNS F +  
Sbjct  143  FEVHNTLQWLSDMQFDNIDFEVDSNITLDAFHSTCDNISEFRCIIASCRSLFNSYFTNSR  202

Query  370  IKFVRRDANMVAHALA  417
            ++F  R AN+  H L 
Sbjct  203  VEFAMRQANVATHTLV  218



>gb|EMT07061.1| Casein kinase I-2-like protein [Aegilops tauschii]
Length=955

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 68/143 (48%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    QHATVLPVALEMPLPPGGLYCFTDAAIHGTSPTYGFYAC-NAQGGLEAAANGPLICPNDP  177
            Q A++LP     P   G +   TDAA+  ++   G      ++  L  A   PL    DP
Sbjct  782  QQASLLPGHGWRPPELGEVKINTDAAVRHSAEMSGAGGVARSKNALLGAWCKPLHGVTDP  841

Query  178  LLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSF  357
            ++ EA+A+R+ + +   RG+  V + +DC  +V+ +   +  RS +  +     +L  +F
Sbjct  842  MIIEALALRDGVIFANLRGYAQVMMETDCLEIVNLWNTRLNSRSVVAPVFYEIEELAANF  901

Query  358  DSCSIKFVRRDANMVAHALAKHS  426
            DS  I  V R  N  AH  A+ +
Sbjct  902  DSFVINHVSRSTNGPAHLYAQRA  924



>ref|XP_002513210.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49201.1| conserved hypothetical protein [Ricinus communis]
Length=185

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 57/127 (45%), Gaps = 1/127 (1%)
 Frame = +1

Query  43   PPGGLYCFT-DAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSW  219
            P  GLY    DA++       G    N +G +       +    +  LAE  AV   L  
Sbjct  48   PLAGLYTLNCDASVKDDKAAVGVVLSNERGEVMFCVGKQIGGCLEVELAEGQAVLFGLWC  107

Query  220  LRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANM  399
              D GF ++ I SDC+ L+     ++   S + +++D    L  SF   S + + R  N+
Sbjct  108  AIDCGFSSIVIESDCSTLIQKLTSIVHGSSPMQLLVDDINHLSESFPFVSFEHINRKVNL  167

Query  400  VAHALAK  420
            VAH+LAK
Sbjct  168  VAHSLAK  174



>ref|XP_006353445.1| PREDICTED: uncharacterized protein LOC102588376 [Solanum tuberosum]
Length=343

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 61/133 (46%), Gaps = 2/133 (2%)
 Frame = +1

Query  28   LEMPLPPGGLYCFTDAAIHGTS--PTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAV  201
            + + L   G+  FTDA +       + G  A ++ G L  A   P+      + AEA+A+
Sbjct  176  VTITLARDGIVVFTDACLQREKGKASIGMAAIDSCGHLLHAFGTPIQFVGKAITAEALAI  235

Query  202  REALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFV  381
            REAL     +G+  V I SD   ++   +  +     +  I     +L  S++   I ++
Sbjct  236  REALERALQKGWSKVHILSDAKNVMQMLQKNLITSWDIETICKDVWRLMKSYEEIKIIYI  295

Query  382  RRDANMVAHALAK  420
             R  N++AH LAK
Sbjct  296  PRTWNVLAHNLAK  308



>ref|XP_010474088.1| PREDICTED: uncharacterized protein LOC104753549 [Camelina sativa]
Length=298

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 65/134 (49%), Gaps = 2/134 (1%)
 Frame = +1

Query  28   LEMPLPPGGLYCFTDAAIHGTS-PTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVR  204
            ++ P+P   L CFTDAA         G+   N+Q  +    +  ++  + PL+AEAMA  
Sbjct  158  IKPPIPMNALTCFTDAAWKDDGCAGLGWVFMNSQEQVSCEGSSCVLSVSSPLMAEAMATL  217

Query  205  EALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVR  384
             AL    +   + +   SD  +LV++    ++ +   GI+ D  L+L  +    S  F+ 
Sbjct  218  AALCVAVESDLKTIQFASDSQMLVNALNGKLSSKELHGILYD-ILELSANLSFVSYSFIP  276

Query  385  RDANMVAHALAKHS  426
            R+ N  A ALAK +
Sbjct  277  RNFNRHADALAKEA  290



>ref|XP_004298184.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=241

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 1/126 (1%)
 Frame = +1

Query  43   PPGGLYCFTDAAI-HGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSW  219
            P G L    D A     S   G    + +G ++ A +  L   N PL AEAMA RE L  
Sbjct  83   PRGKLKLNLDGAYREDGSGGAGMLVRDEKGIVKGAWSVHLTNLNSPLQAEAMACREGLRR  142

Query  220  LRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANM  399
              ++G+ N+ + SDC VLV++          +  I+D+C       ++  ++ + R+AN 
Sbjct  143  AVEQGWLNIDVESDCEVLVAALNGENGGGLEVSRIIDNCRYYLILLNNSVVRHIYREANN  202

Query  400  VAHALA  417
             AH LA
Sbjct  203  GAHRLA  208



>gb|EPS59181.1| hypothetical protein M569_15629, partial [Genlisea aurea]
Length=367

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 41/84 (49%), Gaps = 1/84 (1%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRD-VMTYRSYLGIILDSCLQLF  348
            DP L EA+A R+ L   R      + +  DC  ++ +  D   TY S LG IL   ++L 
Sbjct  260  DPELGEALAARKILELARAMQIPKIILEGDCLTVIQALADRSATYFSSLGNILQDSIRLM  319

Query  349  NSFDSCSIKFVRRDANMVAHALAK  420
              FD C +   RR  N  AH LAK
Sbjct  320  EEFDDCRLSHTRRQFNGAAHYLAK  343



>ref|XP_010684219.1| PREDICTED: putative ribonuclease H protein At1g65750 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 1/125 (1%)
 Frame = +1

Query  46   PGGLYCFTDAAI-HGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWL  222
             G L   TDAA+  G    +G    ++ G +  A  G +     P +AEAMA+RE L+  
Sbjct  241  EGSLKLNTDAAVLAGGMIGFGGVVRDSMGEVRLACCGRMDGRFAPDIAEAMAIREVLAIA  300

Query  223  RDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMV  402
               GF+ + + +DC  L+S  +  +   S  G I+   L    +F+  S   + R  N V
Sbjct  301  GAAGFREIILENDCLKLISQLKKHVLENSSFGNIVKDILDYVQAFNVVSFNHICRSGNTV  360

Query  403  AHALA  417
            AH LA
Sbjct  361  AHNLA  365



>emb|CAN63032.1| hypothetical protein VITISV_024672 [Vitis vinifera]
Length=1413

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 0/83 (0%)
 Frame = +1

Query  172   DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
             D  + EA+ VRE LSW+ +R    + +  DC  +V + +      +  G I+  CL +  
Sbjct  1304  DESVVEALGVREVLSWIHERSRSRIVVEIDCLRVVQAIQHKSCPNTSFGFIIADCLDVLQ  1363

Query  352   SFDSCSIKFVRRDANMVAHALAK  420
                   + + RR AN  AH LAK
Sbjct  1364  HLVDVQVVYARRSANSAAHCLAK  1386



>gb|EEC71228.1| hypothetical protein OsI_03168 [Oryza sativa Indica Group]
Length=995

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 55/120 (46%), Gaps = 2/120 (2%)
 Frame = +1

Query  16   LPVALEMPLPPGGLYCFTDAAIHGTSPTYG--FYACNAQGGLEAAANGPLICPNDPLLAE  189
            LPV    P PPG +   +DAA+   S   G  F   +       AAN  +     P LAE
Sbjct  873  LPVTKWTPPPPGMVLINSDAALFQASNQTGLAFVIRDHSATCMLAANKRITGLLSPELAE  932

Query  190  AMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCS  369
            A+ +R AL   +  GFQNV + SDC  ++   +      S +G+I+    +L   F  CS
Sbjct  933  ALVIRFALEHAKAEGFQNVLMASDCLSVIKRIQSGARDLSVVGVIVRDIKKLETEFLECS  992



>ref|XP_002525921.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36441.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 54/110 (49%), Gaps = 5/110 (5%)
 Frame = +1

Query  100  YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDC-AVLV  276
            YG    N    L AA    +    +  LAEAMAVREALSW++   +  V+I  D   V V
Sbjct  78   YGMVVRNHAANLVAARALIIHGVYEANLAEAMAVREALSWIKHMNWSRVSIDMDSLGVCV  137

Query  277  SSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAKHS  426
            +   D +++    G+I+D C  +  +    +   +RR  N  AH LA+ S
Sbjct  138  ALTSDNLSF----GLIIDGCKHVVANIHDAAFTCIRRSTNHCAHMLARAS  183



>emb|CDY13696.1| BnaA06g32270D [Brassica napus]
Length=118

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = +1

Query  103  GFYACNAQGGL--EAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLV  276
            G+   N  G +    +A+ P +C    L+AEA+A+REALS  +D   +++ +FSD  VLV
Sbjct  2    GWIIKNETGEVLCRGSAHRPFVC--SALMAEALAIREALSKAKDLNLRSLQLFSDSQVLV  59

Query  277  SSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALA  417
            ++ R  +      G++ D    L   F   S +F+ R  N  A ALA
Sbjct  60   TALRSELEVNEIAGVLHD-IRNLATLFCPLSFRFIPRLENRQADALA  105



>ref|XP_010678407.1| PREDICTED: uncharacterized protein LOC104893963 [Beta vulgaris 
subsp. vulgaris]
Length=155

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  GFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSS  282
            G   C++ G +  +A   +     P +AE  A+  A+   + +G  NV I SD  V+ + 
Sbjct  18   GVVVCDSAGRVAFSAARRVRAFWPPEVAECKAIHMAVRLAKAQGLANVIIESDSQVVTTR  77

Query  283  FRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAK  420
                  Y S L  IL   L++ N F+  S   V+RD N  AH LA+
Sbjct  78   LTTAALYFSDLDTILGDILEICNGFNPISFTHVKRDGNTAAHNLAR  123



>ref|XP_009109964.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=539

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 31/84 (37%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            PLLAE +A+REA+   RD G  +V   SD A L+    + ++     G+  D  + L  +
Sbjct  443  PLLAEGLAMREAIIKCRDLGLSSVRFESDSATLIKVLNEQVSNAELYGVAAD-IISLSLT  501

Query  355  FDSCSIKFVRRDANMVAHALAKHS  426
            F+S S  ++ RD N+VA  LAK +
Sbjct  502  FESFSFNWIPRDRNLVADRLAKQA  525



>ref|XP_010686484.1| PREDICTED: uncharacterized protein LOC104900691 [Beta vulgaris 
subsp. vulgaris]
Length=334

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 62/138 (45%), Gaps = 2/138 (1%)
 Frame = +1

Query  13   VLPVALEMPLPPGGLYCFT-DAAIHGTSPT-YGFYACNAQGGLEAAANGPLICPNDPLLA  186
            V+P   +  +PP G Y    DA++        G  A ++ G +  AA   +     P LA
Sbjct  167  VVPSPRQWTVPPCGSYKLNVDASLTVDGWVGLGVVARDSNGDVRFAATRRVRAYWSPELA  226

Query  187  EAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSC  366
            EA A+   +   +  G Q V + SDC V++    + ++  S L + L         F S 
Sbjct  227  EAKAITMGIRLGKRFGLQEVVLESDCQVVIRRLANNVSSLSELDVFLHDIFSSCVYFKSI  286

Query  367  SIKFVRRDANMVAHALAK  420
            S   V+RD N VAH LAK
Sbjct  287  SWSHVKRDGNFVAHHLAK  304



>gb|EAY78455.1| hypothetical protein OsI_33544 [Oryza sativa Indica Group]
Length=133

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P +AEAMA+R A+S  ++  F+ + + SDC  ++   +     RS +G ++    +L  +
Sbjct  26   PEIAEAMAIRRAMSLAKEESFEKIILASDCVSVILRIKLATRDRSNVGCLVGDMKKLATN  85

Query  355  FDSCSIKFVRRDANMVAHALA  417
            F  CS + V R +N+ AH++A
Sbjct  86   FLECSFQHVER-SNVAAHSVA  105



>ref|XP_003616534.1| hypothetical protein MTR_5g081500 [Medicago truncatula]
Length=357

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 52/115 (45%), Gaps = 7/115 (6%)
 Frame = +1

Query  97   TYGFYACNAQGGLEAAAN----GPLICPN-DPLLAEAMAVREALSWLRDRGFQ-NVAIFS  258
            TYG Y  N      +  N      L  P  D  + E + +   L WL D  +  NV    
Sbjct  216  TYGRYNLNIDASFSSFLNMVGIDKLFSPLCDVDVGEVVGLHTTLKWLADLHYDYNVDFAM  275

Query  259  DCAVLVSSFRDVMTYRSYLGIILDSCLQLF-NSFDSCSIKFVRRDANMVAHALAK  420
            D   +V  F+      S LG ++ +C QLF NSF +  ++F RR  N VAH LA+
Sbjct  276  DSKTIVYPFKSNAENNSELGCVIHACRQLFVNSFQNSCVEFNRRQTNEVAHELAQ  330



>ref|XP_010678308.1| PREDICTED: uncharacterized protein LOC104893877 [Beta vulgaris 
subsp. vulgaris]
Length=581

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P LAEA AV   L   +  GF++V I SDC V+V+     + Y S L I+L         
Sbjct  470  PELAEAKAVSMGLRLGKRFGFRDVIIESDCQVVVNRLSKSVHYLSDLDIVLSDIHSASLP  529

Query  355  FDSCSIKFVRRDANMVAHALAK  420
            F S     V+RD N VAH LAK
Sbjct  530  FHSVRWSHVKRDGNFVAHHLAK  551



>ref|XP_010687191.1| PREDICTED: uncharacterized protein LOC104901327 [Beta vulgaris 
subsp. vulgaris]
Length=252

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 57/130 (44%), Gaps = 4/130 (3%)
 Frame = +1

Query  40   LPPGGLYCFT---DAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREA  210
            +PP GLY        A+ G     G  A N +GG+       +     P +AEA A+   
Sbjct  86   VPPDGLYKINVDVSLAVEGWI-GLGVIARNHEGGVLFTTTRRVRAHWTPEIAEAKAIEWG  144

Query  211  LSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRD  390
            +   R  G Q++ + SDC  +++       Y S L  +L + L    SF S     V+RD
Sbjct  145  VRLGRRFGLQDIILESDCQSVINRLSKNAIYLSDLDNVLTNILVSCASFSSFHWSHVKRD  204

Query  391  ANMVAHALAK  420
             N V H LAK
Sbjct  205  GNFVVHHLAK  214



>ref|XP_003607028.1| hypothetical protein MTR_4g071380 [Medicago truncatula]
Length=218

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = +1

Query  181  LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFD  360
            + EA+ + EAL WL D  F N+    D  +    F       S  G I++SC  LF +F 
Sbjct  116  VGEALGLFEALQWLSDMSFNNIDFEIDYKITRDVFHSRRKDVSEFGHIINSCKSLFTAFF  175

Query  361  SCS-IKFVRRDANMVAHALA  417
            + S ++F +R AN+ AHALA
Sbjct  176  TNSRVEFSKRQANVAAHALA  195



>ref|XP_009138598.1| PREDICTED: uncharacterized protein LOC103862665 [Brassica rapa]
Length=382

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 64/134 (48%), Gaps = 7/134 (5%)
 Frame = +1

Query  31   EMPLPPGGLYCFTDAAIHGTSPTYG----FYACNAQGGLEAAANGPLICPNDPLLAEAMA  198
            E  LPP  + C TDAA   +S   G    F+  +A      ++N   +  +   +AEA+A
Sbjct  247  EKELPPNTITCNTDAAWIASSTKAGLGWIFFDSSAMEINRGSSNQLHV--SSACMAEALA  304

Query  199  VREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKF  378
            VREAL      GF  + + SD  VL+ +           G++ D  + L +SF  C   F
Sbjct  305  VREALLHASSLGFTKIWLRSDSQVLMRAINQKRGPTELFGVLSD-IVSLSSSFQFCCFSF  363

Query  379  VRRDANMVAHALAK  420
            + RD N +A ++AK
Sbjct  364  LPRDLNGLADSIAK  377



>ref|XP_010682938.1| PREDICTED: uncharacterized protein LOC104897699 [Beta vulgaris 
subsp. vulgaris]
Length=326

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 65/163 (40%), Gaps = 26/163 (16%)
 Frame = +1

Query  1    QHATVL--------PVALEMPLPPG--------------GLYCFTDAAIHGTSPTYGFYA  114
            QH T L        P+A E P PPG               L+   D +    SP  G  A
Sbjct  153  QHVTFLARPFTCSKPLA-EGPGPPGFLIAHFGSSFSGVPQLHIQVDGSWTNNSPLAGI-A  210

Query  115  CNAQGGLEAAANGPLIC--PNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFR  288
              AQ        G  IC   +  LLAEAMA  +AL W   + +Q VA+ +D  V+V S R
Sbjct  211  WVAQTVHNQTQEGQGICIHADSALLAEAMACLDALVWAHGQAYQRVAVHTDSEVVVQSLR  270

Query  289  DVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALA  417
            +  T    +   L     +   F  C I  V R    +AH LA
Sbjct  271  NPRTQPIAITWTLSDIRSIGQQFHWCRIMKVNRSHVQLAHDLA  313



>ref|XP_009129032.1| PREDICTED: uncharacterized protein LOC103853884 [Brassica rapa]
Length=1091

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 39/133 (29%), Positives = 63/133 (47%), Gaps = 7/133 (5%)
 Frame = +1

Query  40    LPPGGLYCFTDAAIHGTSPTYG----FYACNAQGGLEAAANGPLICPNDPLLAEAMAVRE  207
             L    + C TDAA   T    G    F + + Q  +  + +  LI    PL+AEA+A+R 
Sbjct  955   LSDDAISCSTDAAWDKTRKKAGLGWIFSSSSLQTPIHGSGSQDLI--GSPLIAEAVAMRS  1012

Query  208   ALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
             AL      GF N+ +F+D + L+ +    +  +  +GI+ D  L +   F S    F  R
Sbjct  1013  ALCMASSLGFTNLRVFTDSSTLLRAISGKLQSKEIIGIVCD-ILSISFGFASIEFFFHPR  1071

Query  388   DANMVAHALAKHS  426
               N +A ++AK +
Sbjct  1072  SQNKIADSIAKKA  1084



>gb|KHN06267.1| hypothetical protein glysoja_030333, partial [Glycine soja]
 gb|KHN22194.1| hypothetical protein glysoja_036940, partial [Glycine soja]
Length=90

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +1

Query  217  WLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDAN  396
            WL ++   NV   SDC  +V   +      +  G IL+    +  S+ S SI++VRR AN
Sbjct  1    WLTNQNIPNVITESDCKHIVYHIKSKEEDITSCGFILNQIRDILRSYPSYSIEYVRRQAN  60

Query  397  MVAHALAKHS  426
            +VAH+LA++S
Sbjct  61   LVAHSLARNS  70



>emb|CDY59043.1| BnaAnng15680D [Brassica napus]
Length=118

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = +1

Query  103  GFYACNAQGGL--EAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLV  276
            G+   N  G +    +A+ P +C    L+AEA+A+ EALS  +D  F+++ +FSD  VLV
Sbjct  2    GWIIKNETGEVLCRGSAHRPFVC--SALMAEALAISEALSKAKDLNFRSLQLFSDSQVLV  59

Query  277  SSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALA  417
            ++ R  +      G++ D    L   F   S +F+ R  N  A ALA
Sbjct  60   TALRSELEVNEIAGVLHD-IRNLATLFCPLSFRFIPRLENRQADALA  105



>ref|XP_010692627.1| PREDICTED: uncharacterized protein LOC104905716 [Beta vulgaris 
subsp. vulgaris]
Length=158

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 2/119 (2%)
 Frame = +1

Query  64   FTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQN  243
            F  + +      +GF   + +G +     G L   +  LLAEA  +RE +   +  G  N
Sbjct  3    FDGSKLSNGQAAFGFVIRDEEGKIMLCGAGSLDKSDSILLAEAKGLREGIRGAKSLGISN  62

Query  244  VAIFSDCAVLVSSFRDVMTYRSYL-GIILDSCLQLFNSFDSCSIKFVRRDANMVAHALA  417
            + +  D  V+++S R +      +  IILD+  +L N FD   I  V R+ANM A  +A
Sbjct  63   IIVEGDNMVVINSIRKLWKIPWMIKSIILDTEQELAN-FDEVHIYHVFREANMAADWMA  120



>ref|XP_010681977.1| PREDICTED: uncharacterized protein LOC104896888 [Beta vulgaris 
subsp. vulgaris]
Length=1131

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +1

Query  175   PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
             P +AEA AV  A+   R  G Q V + SDC V++        + S L ++L + L    S
Sbjct  1020  PEIAEAKAVELAVKLGRRYGLQEVILESDCQVVIKRLSKNSIFLSDLDLVLSNILASCTS  1079

Query  355   FDSCSIKFVRRDANMVAHALAK  420
             F S     V+RD N VAH LAK
Sbjct  1080  FSSIVWSHVKRDGNYVAHHLAK  1101



>ref|XP_004305406.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=399

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 54/118 (46%), Gaps = 1/118 (1%)
 Frame = +1

Query  70   DAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVA  249
            D ++ G S   GF   N+ G +  AA   L     P  AEA A+R+ L   RDRG+ NV 
Sbjct  242  DGSVQGRSAVGGFVFRNSDGNVILAAAKGLGSTTIPT-AEATALRDNLVKARDRGYMNVQ  300

Query  250  IFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAKH  423
            +  D  +++ +    ++    L  I+     +  SF S     V R+AN VA A A  
Sbjct  301  VEGDSKLVIDAINGKLSPPWRLQKIVQDIRTIATSFSSVCFNHVYREANFVADAFANE  358



>ref|XP_010462680.1| PREDICTED: uncharacterized protein LOC104743275 [Camelina sativa]
Length=322

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 3/124 (2%)
 Frame = +1

Query  55   LYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPN--DPLLAEAMAVREALSWLRD  228
            + CF+DAA H  S   G     ++    +  +   +  N   PLLAEA+A+ +A+    D
Sbjct  186  IRCFSDAAWHEESRLAGLGWVFSKQFPRSDISSRSVAYNVHSPLLAEALALFQAVKHAID  245

Query  229  RGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAH  408
             G+QN++  SD   L+ +  +   Y   L  IL   L L  +F+ C  +FV R+ N  A 
Sbjct  246  LGYQNLSFASDSQHLIKAL-NSEPYSKELHRILHDILVLSLNFNVCEFRFVNREMNKKAD  304

Query  409  ALAK  420
             +AK
Sbjct  305  EVAK  308



>ref|XP_003613174.1| hypothetical protein MTR_5g033620 [Medicago truncatula]
Length=119

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 43/85 (51%), Gaps = 1/85 (1%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P + EA+ +  A+ W+ +    NV    D  ++V  F       S  G IL+ C +  N 
Sbjct  10   PEIGEALGLLYAIQWVHELQLTNVDFEMDAKLVVDYFNKGSNNVSEFGAILEECKRCRNV  69

Query  355  -FDSCSIKFVRRDANMVAHALAKHS  426
             F++  +KF RR AN VAH LA+ +
Sbjct  70   YFENSKVKFSRRQANEVAHTLAREA  94



>ref|XP_003623409.1| hypothetical protein MTR_7g070460 [Medicago truncatula]
Length=163

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 51/114 (45%), Gaps = 8/114 (7%)
 Frame = +1

Query  103  GFYACNAQGG-----LEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCA  267
            GF+    + G     L  A +   I P D  + EA+ +  +L WL D  F NV    +  
Sbjct  27   GFWGVTKKEGIGTFVLAKAFSYLCIVPVD--VGEALGLHSSLQWLSDMQFDNVDFDINSK  84

Query  268  VLVSSFRDVMTYRSYLGIILDSCLQLF-NSFDSCSIKFVRRDANMVAHALAKHS  426
            V   +        S  G I+ SC  LF N F +  ++FVRR  N V HAL + +
Sbjct  85   VTADALLASRNDLSKFGCIISSCRSLFSNLFSNSRVEFVRRQVNAVTHALTRET  138



>ref|XP_006427454.1| hypothetical protein CICLE_v10027161mg, partial [Citrus clementina]
 gb|ESR40694.1| hypothetical protein CICLE_v10027161mg, partial [Citrus clementina]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 58/129 (45%), Gaps = 3/129 (2%)
 Frame = +1

Query  43   PPGGLYCFTDAAIHGTSPT--YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALS  216
            PP       DAA+  T      G   CN+ G + AA+   +I   D    EA+AV   L 
Sbjct  7    PPSWYKVNVDAAVSSTEDRAGIGVLVCNSTGEVMAASICTVIFSRDIEFVEAVAVHNGLQ  66

Query  217  WLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSC-SIKFVRRDA  393
             + D G     I SD   +V+   + +  R  +G ++    ++ +S +S   +KF  R  
Sbjct  67   LVMDIGLAPAIIESDSFNVVNLINNKIHSRCEVGWLISDVQEVLSSSESSFQVKFAPRSC  126

Query  394  NMVAHALAK  420
            N VAH L+K
Sbjct  127  NEVAHHLSK  135



>ref|XP_009122880.1| PREDICTED: uncharacterized protein LOC103847539 [Brassica rapa]
Length=245

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 59/127 (46%), Gaps = 1/127 (1%)
 Frame = +1

Query  46   PGGLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLR  225
            PG     +DAA   T  + G     A     ++ + P      PL AE +A+REA+   +
Sbjct  106  PGVYLVKSDAAWSETQQSAGLGWTIAINDRTSSYSIPARNVASPLAAEGLALREAILKCK  165

Query  226  DRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVA  405
            + G   +   S  A+LV + +   +     GI+ D    L +SFD  S  ++ R+ N VA
Sbjct  166  ELGLSKIKCESHSAILVKALKSGSSLAGLYGILAD-LKSLASSFDVISFNWISRERNTVA  224

Query  406  HALAKHS  426
             +LAK S
Sbjct  225  DSLAKQS  231



>ref|XP_004954924.1| PREDICTED: uncharacterized protein LOC101756955 [Setaria italica]
Length=1203

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  118   NAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVM  297
             ++ GG+ AAA+  L    D  +AEA A++E L   +  G   + + SDC  +V   RD  
Sbjct  1071  DSNGGILAAAHSYLPHLIDAPMAEAYALKEGLMLAQHIGCNRLIVQSDCMEVVQIMRDGG  1130

Query  298   TYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAKHS  426
                +    I D C  ++N F   SI+   R+AN  AH LA+ +
Sbjct  1131  FTANSAAPIYDECNIVWNGFQEISIEHCYREANQAAHLLARRA  1173



>ref|XP_009145301.1| PREDICTED: uncharacterized protein LOC103869012 [Brassica rapa]
Length=395

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 61/133 (46%), Gaps = 7/133 (5%)
 Frame = +1

Query  46   PGGLYC----FTDAAIHGTSPTYGF-YAC-NAQGGLEAAANGPLICPNDPLLAEAMAVRE  207
            P GL      FTDAA    S T G  ++C +  G +    + P        LAE +A+RE
Sbjct  257  PSGLNTRFTIFTDAAWRKESLTAGLAWSCTDNHGNIVFQGSTPEPWVESAQLAEGLAIRE  316

Query  208  ALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
            AL   + +G  N+ I SD  ++V +  +  + +   G + D   +L    D  S  F+ R
Sbjct  317  ALLQAQAQGLNNITIKSDAQIIVRAINNRESIKELFGTLHD-IHRLSCDLDVVSFIFIPR  375

Query  388  DANMVAHALAKHS  426
              N  A ALAK +
Sbjct  376  TENSTADALAKRA  388



>ref|XP_010495559.1| PREDICTED: uncharacterized protein LOC104772669 [Camelina sativa]
Length=190

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 59/125 (47%), Gaps = 2/125 (2%)
 Frame = +1

Query  55   LYCFTDAA-IHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDR  231
            + CFTDA  I       G+   + Q       +        PL+AEA+A   A+      
Sbjct  59   ITCFTDATWISEPKAGLGWVFMDQQNRTLLQGSDLATHVQSPLMAEAIATLTAVEVAIAS  118

Query  232  GFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHA  411
            GF +++I SD   LV + +  +  +   GI+ D  L L N F  C+ +F+ R  N +A A
Sbjct  119  GFSHLSIASDSQTLVKALKLKVHSKELHGILHD-ILDLSNQFTVCNFRFIPRTQNRIADA  177

Query  412  LAKHS  426
            +AK++
Sbjct  178  IAKNA  182



>ref|XP_006483704.1| PREDICTED: uncharacterized protein LOC102620092 [Citrus sinensis]
Length=340

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = +1

Query  184  AEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDS  363
            AEA+ VREALSWL+   F +V +  D   + ++  D  +Y +  G I+D C  L  S   
Sbjct  243  AEAIEVREALSWLKKFAFYSVILDMDSLQVFNALHDKTSYFNGFGSIIDDCRALVRSLGE  302

Query  364  CSIKFVRRDANMVAHALAK  420
                FVR  AN  A  +A+
Sbjct  303  VVFSFVRGSANSAAFTVAQ  321



>ref|XP_010693085.1| PREDICTED: uncharacterized protein LOC104906074 [Beta vulgaris 
subsp. vulgaris]
Length=196

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 53/107 (50%), Gaps = 2/107 (2%)
 Frame = +1

Query  103  GFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDR-GFQNVAIFSDCAVLVS  279
            G  A + +G +  AA+  +       +AE  A+  AL  L DR G Q+V + SD  VLV+
Sbjct  61   GVVARDREGRVMFAASRRVRATWPVEIAEGKAILMALR-LADRFGLQHVTLESDSQVLVT  119

Query  280  SFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAK  420
                  TY S L  +LD  L    +F S     V+RD N VAH LAK
Sbjct  120  RLSRATTYSSDLDTVLDDILAKSCNFLSVDWSHVKRDGNAVAHHLAK  166



>ref|XP_003617799.1| hypothetical protein MTR_5g095600 [Medicago truncatula]
Length=192

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 39/73 (53%), Gaps = 0/73 (0%)
 Frame = +1

Query  190  AMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCS  369
            A+ ++EA+ WL + G   V+I  DC ++V    D    +S  G +L  C  L   + +  
Sbjct  120  AIGLKEAIIWLGELGLSKVSIELDCKLVVDDIGDRSVSQSEFGNLLSLCRSLLIQYPNFE  179

Query  370  IKFVRRDANMVAH  408
            I FVRR AN VAH
Sbjct  180  INFVRRQANYVAH  192



>gb|EPS57564.1| hypothetical protein M569_17254 [Genlisea aurea]
Length=407

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 1/102 (1%)
 Frame = +1

Query  118  NAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVM  297
            +AQG  +A  +     P DP L EA+A R+ L       F  V +  DC +++ +  D  
Sbjct  278  DAQGQCQAWFSYYHASPLDPELGEALAARKILELAVMMKFTKVILEGDCLMVIQALADRS  337

Query  298  TYR-SYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAK  420
            + + S +G IL   + L   F+ C ++  RR+ N  AH LAK
Sbjct  338  SVQYSSIGNILQDSVLLMEKFEDCRLRHTRREFNGAAHHLAK  379



>ref|XP_010495420.1| PREDICTED: uncharacterized protein LOC104772516 [Camelina sativa]
Length=216

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 60/133 (45%), Gaps = 4/133 (3%)
 Frame = +1

Query  37   PLPP---GGLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVRE  207
            P PP        FTDAA    S   G+   +  G ++A  +      + PL+AEA+A   
Sbjct  79   PQPPRLRSNTTYFTDAAWRDGSAGLGWAIIDQSGQIQAEGSSSTTHVSSPLMAEALATLT  138

Query  208  ALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
            A+    +   ++++  SD  +LV +       +   G + D  L L ++F+ CS  FV R
Sbjct  139  AVRVAIESNIRDISFASDSFMLVQALNQKFHQKELHGTLHD-VLSLSSNFNVCSFNFVSR  197

Query  388  DANMVAHALAKHS  426
              N  A  L K++
Sbjct  198  TLNHHADRLTKNA  210



>ref|XP_004293076.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=487

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 1/116 (1%)
 Frame = +1

Query  70   DAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVA  249
            D ++ G S   GF   N+ G +  AA   L     P  AEA A+R++L   RDRG+ NV 
Sbjct  334  DGSVQGRSAAGGFVFRNSDGNVILAAAKGLGSTTIPT-AEATALRDSLVKARDRGYMNVQ  392

Query  250  IFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALA  417
            +  D  +++ +    ++    L  I+     +  SF S     V R+AN +A A A
Sbjct  393  VEGDSKLVIDAINGKLSPPWRLQKIVQDIRTIATSFSSVCFNHVYREANFMADAFA  448



>ref|XP_003599515.1| hypothetical protein MTR_3g034390 [Medicago truncatula]
Length=103

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 38/75 (51%), Gaps = 1/75 (1%)
 Frame = +1

Query  193  MAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN-SFDSCS  369
            M +  AL WL D  F NV    D    V +F +     S  G+I+ +C  LF+  F +  
Sbjct  1    MGLYYALEWLSDMRFDNVDFALDSKTTVDAFNNSRPDVSEFGLIISACRSLFDLKFTNSK  60

Query  370  IKFVRRDANMVAHAL  414
            +KF RR AN VAH L
Sbjct  61   VKFNRRQANEVAHTL  75



>ref|XP_009101684.1| PREDICTED: uncharacterized protein LOC103827880 [Brassica rapa]
Length=1295

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 62/145 (43%), Gaps = 9/145 (6%)
 Frame = +1

Query  1     QHATVLPVALEMPLPPGGLYCFTDAAIHGTSPTYG--FYACNAQGGLEAAANGPLICPND  174
             Q +  LP  L  P     + CFTDAA    S   G  +   + +              + 
Sbjct  1150  QLSRTLPPTLTSPF----VVCFTDAAWQAGSKKAGCGWIFTDHRDAWLKQGTSTFNYTSS  1205

Query  175   PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILD-SCLQLFN  351
             PL+AEA+AVR AL    + G+  + I SDC  LV+            GI  D   L L  
Sbjct  1206  PLMAEALAVRTALLNALEAGYTRICIKSDCQALVAIISSKQHPADLHGITRDIEFLSL--  1263

Query  352   SFDSCSIKFVRRDANMVAHALAKHS  426
             SFD  S  F+ R+ N  A ALAK S
Sbjct  1264  SFDCISFVFISRNLNSAADALAKSS  1288



>ref|XP_003593940.1| hypothetical protein MTR_2g019570 [Medicago truncatula]
Length=102

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 37/75 (49%), Gaps = 4/75 (5%)
 Frame = +1

Query  202  REALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFV  381
            RE   W       NV I  DC ++V S  D    +   G I+D C  L   F +  I FV
Sbjct  18   RERRRW----ELSNVKIELDCKLVVDSIYDKNNNQVEFGSIIDDCRSLLQQFTNFKISFV  73

Query  382  RRDANMVAHALAKHS  426
            RR+AN+VA + A+ S
Sbjct  74   RREANIVARSFARVS  88



>ref|XP_004515632.1| PREDICTED: uncharacterized protein LOC101505764 [Cicer arietinum]
Length=191

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 54/119 (45%), Gaps = 5/119 (4%)
 Frame = +1

Query  79   IHGTSPTY-----GFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQN  243
            I  TSP Y     G    ++ G    AA   +    D  +A+A+  R +L +  D  F N
Sbjct  45   IDATSPDYDKWRTGTIIGDSYGVFLVAATWKVSTLTDATIAKALGTRISLHFGLDLSFWN  104

Query  244  VAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAK  420
            +    +   ++ + R+    +SY G+I+  C  L   F S +I  V+R AN+  H L K
Sbjct  105  MNFEGNSLNVIKAIRNSNQDQSYFGLIIVDCYNLLALFSSYTINHVKRSANVSTHILVK  163



>ref|XP_010667928.1| PREDICTED: uncharacterized protein LOC104884923 [Beta vulgaris 
subsp. vulgaris]
Length=834

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P +AEA A+   +   +  G Q+V + SDC  +++  R    + S L IIL +       
Sbjct  723  PEIAEAKAIEMGVRLGKHFGLQHVVVESDCQTVINRLRKTSLFLSDLDIILSNIFSTSTC  782

Query  355  FDSCSIKFVRRDANMVAHALAK  420
            F S     V+RD N VAH LAK
Sbjct  783  FRSLVWSHVKRDGNFVAHHLAK  804



>ref|XP_008358038.1| PREDICTED: uncharacterized protein LOC103421772 [Malus domestica]
Length=244

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (49%), Gaps = 0/103 (0%)
 Frame = +1

Query  118  NAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVM  297
            ++ G   A  +   +  + P   EA+AVRE L+    RGFQN+ + SD   +V +     
Sbjct  117  DSDGNFLAGLSKSSLYISSPFFXEAIAVREGLALAYSRGFQNIIVESDSXQIVQALCYSS  176

Query  298  TYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAKHS  426
               S +G+I +    +  +    S   +RR AN VAH  A++S
Sbjct  177  PDLSXVGLIXEDSRAIAXAITGVSFTHIRRQANEVAHRXARYS  219



>ref|XP_009139688.1| PREDICTED: uncharacterized protein LOC103863688 [Brassica rapa]
Length=395

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 61/133 (46%), Gaps = 7/133 (5%)
 Frame = +1

Query  46   PGGL----YCFTDAAIHGTSPTYGF-YAC-NAQGGLEAAANGPLICPNDPLLAEAMAVRE  207
            P GL      FTDAA    S T G  ++C +  G +    + P        LAE +A+RE
Sbjct  257  PSGLNTRFTIFTDAAWRKESLTAGLAWSCTDNHGNIVFQGSTPEPWVESAQLAEGLAIRE  316

Query  208  ALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
            AL   + +G  N+ I SD  +++ +  +  + +   G + D   +L    D  S  F+ R
Sbjct  317  ALLQAQAQGLNNITIKSDAQIIIRAINNRESIKELFGTLHD-IHRLSCDLDVVSFIFIPR  375

Query  388  DANMVAHALAKHS  426
              N  A ALAK +
Sbjct  376  TENSTADALAKRA  388



>ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula]
Length=1723

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 39/127 (31%), Positives = 57/127 (45%), Gaps = 3/127 (2%)
 Frame = +1

Query  49    GGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREALSWL  222
             G   C  DAA    S   G   C  +  G L  A         D    EA+ +  A+ W 
Sbjct  1570  GHFKCNVDAAFFKESNRVGIGICIRDDSGRLVKARTSWSTLLLDVPEGEAIGLLYAIRWA  1629

Query  223   RDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCS-IKFVRRDANM  399
             +++   N+    D   +V SF +     S LG I+  C   F+SF + S ++F+RR AN 
Sbjct  1630  KEQNLNNITFELDSKRVVYSFHNTRNDVSDLGAIIRECRTTFSSFFTNSRVEFIRRQANE  1689

Query  400   VAHALAK  420
             V H+LA+
Sbjct  1690  VVHSLAR  1696



>ref|XP_010693052.1| PREDICTED: uncharacterized protein LOC104906048 [Beta vulgaris 
subsp. vulgaris]
Length=1259

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  112   ACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRD  291
             A ++QG +  AA   +       +AEA A+  AL   R  G Q + + SDC V+V+    
Sbjct  1127  ARDSQGTVLFAAVRRIRSHWTAEIAEAKAIEMALRLGRRYGLQAIMVESDCQVVVNRLSK  1186

Query  292   VMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALA  417
                Y + L IIL + L    SF S     V+RDAN VAH LA
Sbjct  1187  QALYLADLDIILHNVLSACVSFSSVVWSHVKRDANAVAHHLA  1228



>ref|XP_010689711.1| PREDICTED: uncharacterized protein LOC104903385 [Beta vulgaris 
subsp. vulgaris]
Length=1533

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +1

Query  175   PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
             P +AE  AV  A+   +  G Q+V I SD  ++ +       + S L  IL   L L  S
Sbjct  1422  PEVAECKAVHFAIRLAKSHGLQSVVIESDSQIVTTRLSRAALFYSDLDSILGDVLALCRS  1481

Query  355   FDSCSIKFVRRDANMVAHALAK  420
             F+S +   V+RD N VAH LA+
Sbjct  1482  FNSVNFMHVKRDGNTVAHNLAR  1503



>gb|KHN38789.1| hypothetical protein glysoja_047929, partial [Glycine soja]
Length=187

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 2/102 (2%)
 Frame = +1

Query  37   PLPPGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREA  210
            P P G L C  DA+I    P++G   C  +  G    A     +    P  AEA A++++
Sbjct  84   PPPLGSLKCNVDASIFKEEPSFGIGMCLHDDNGTFVKARTASSMSIPKPDEAEAFALKKS  143

Query  211  LSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSC  336
            L W++    QNV + +DC ++           S   +IL +C
Sbjct  144  LEWIQSLHLQNVVVETDCKLVTDHIDSRQKGLSDFILILANC  185



>emb|CDX71715.1| BnaC08g31590D [Brassica napus]
Length=161

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            PL+AE +A+REAL   +D G + + + SD   L++S  +  T     GI+ D  L L   
Sbjct  76   PLMAEGLALREALQKSKDLGIKTLNVESDSKNLINSILNDNTISELYGIVAD-ILLLSGC  134

Query  355  FDSCSIKFVRRDANMVAHALAK  420
            FD  S +++ R+AN     +AK
Sbjct  135  FDFVSFRWISREANYAVDLVAK  156



>gb|KFK31076.1| hypothetical protein AALP_AA6G065100 [Arabis alpina]
Length=392

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 60/123 (49%), Gaps = 3/123 (2%)
 Frame = +1

Query  61   CFTDAAIHGTSPTYGF-YACNAQGGLEAAANGPLI-CPNDPLLAEAMAVREALSWLRDRG  234
            C+TDAA    +   G  +       +       L+   ++PL+AEA+++REAL+ L+ R 
Sbjct  254  CYTDAAWRADTKEAGLGWIVKDHNNITILQGSALVDHVSNPLMAEALSMREALTQLKHRN  313

Query  235  FQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHAL  414
             Q+++I SD   L+S   + M +    G++ D  + L       S  F+ R  N  +  +
Sbjct  314  LQHLSISSDSNQLISLINNGMNHMEIYGVLHD-IISLSKEIGIISFNFISRTLNGKSDRI  372

Query  415  AKH  423
            AK+
Sbjct  373  AKN  375



>ref|XP_010686122.1| PREDICTED: uncharacterized protein LOC104900404 [Beta vulgaris 
subsp. vulgaris]
Length=1546

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +1

Query  175   PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
             P +AE  A+  A+   + RG QNV + SD  V++S       + S L  I+     L   
Sbjct  1435  PDIAECKAILFAVRMAKARGLQNVMVESDALVVISRLSKAALFYSDLDAIMGDVFSLSVY  1494

Query  355   FDSCSIKFVRRDANMVAHALAK  420
             F++ S   V+RD N VAH LA+
Sbjct  1495  FNAISFNHVKRDGNAVAHHLAR  1516



>ref|XP_010686471.1| PREDICTED: uncharacterized protein LOC104900678 [Beta vulgaris 
subsp. vulgaris]
Length=337

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P +AEA A+  A+ W + +GF+ V I SD  V+VS       Y S L  IL   + L   
Sbjct  226  PDVAEAKAIHLAMIWAKKQGFREVIIESDAQVIVSRLSKSAIYFSDLDAILGDIISLCTD  285

Query  355  FDSCSIKFVRRDANMVAHALAK  420
            F + S   V+R  N  A  LAK
Sbjct  286  FHAISFSHVKRGGNYAADHLAK  307



>gb|EEC83326.1| hypothetical protein OsI_28710 [Oryza sativa Indica Group]
Length=794

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            D L+ EA+A R+ +   R++G   + + +DC  L   ++   + RS++  I+   ++L +
Sbjct  230  DALMMEALACRDGIQLAREKGVLRIQVETDCQELTKLWKQGGSQRSHVASIISDAIELSS  289

Query  352  SFDSCSIKFVRRDANMVAHALAKH  423
             F   ++ +  R  N VAH LAK 
Sbjct  290  GFHGFTLLYTPRSCNHVAHVLAKQ  313



>ref|XP_003596081.1| hypothetical protein MTR_2g065980 [Medicago truncatula]
Length=122

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +1

Query  181  LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSF-  357
            + EA+ +  AL W+ +     +    D   +V SF       +  GII+ +C  LF  + 
Sbjct  26   IEEALGLISALEWVHELNLGPIDFEMDVKRVVDSFLSSRHDVTEFGIIIQNCKTLFRHYY  85

Query  358  DSCSIKFVRRDANMVAHALAK  420
            ++ +++FVRR AN VAH LAK
Sbjct  86   ENSTVEFVRRQANKVAHKLAK  106



>ref|XP_009140970.1| PREDICTED: uncharacterized protein LOC103864947 [Brassica rapa]
Length=1547

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 1/128 (1%)
 Frame = +1

Query  37    PLPPGGLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALS  216
             P PP  +   TDAA   +S T G     +     ++ + P       L AEA+A+REAL+
Sbjct  1407  PPPPDCITVHTDAAWKASSQTAGLGWIISNASSTSSFSKPARHVGSALCAEALAMREALT  1466

Query  217   WLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDAN  396
               ++ G + +   SD + LVSS    ++     GII D  + L   FD  S  ++ R+ N
Sbjct  1467  KCKELGIKRILCKSDSSQLVSSINSGVSNPELYGIISD-VMDLSFHFDVISFMWISREKN  1525

Query  397   MVAHALAK  420
               A  +AK
Sbjct  1526  KAADNVAK  1533



>ref|XP_010665605.1| PREDICTED: uncharacterized protein LOC104882889 [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 1/127 (1%)
 Frame = +1

Query  43   PPGGLYCFTDAAIHGTSPT-YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSW  219
            PPG +    DA++        G  A N+ G +  +A+  +     P +AEA A+  A+  
Sbjct  68   PPGMVKINADASLEVDGWVGIGVIARNSDGDVLFSASRRIRAYWTPEIAEAKAIAVAVRL  127

Query  220  LRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANM  399
             +  GF+ V   SDC V+++       + S L  IL   L     F   +   V+RD N 
Sbjct  128  GKHFGFKEVIFESDCQVVINRLSSNAIFLSDLDSILHEILSSSTFFSYVAWSHVKRDGNC  187

Query  400  VAHALAK  420
            VAH LAK
Sbjct  188  VAHHLAK  194



>gb|KDP20045.1| hypothetical protein JCGZ_05814 [Jatropha curcas]
Length=138

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 8/127 (6%)
 Frame = +1

Query  61   CFTDAAIHGTSPTYGFYACNA-----QGGLEAAANGPLICPNDPLLAEAMAVREALSWLR  225
            CF DAA+  T+    F  C A     +G      +G      +P +AEA+A+R  L +L+
Sbjct  10   CFVDAAVFSTTD---FIGCGAVVEDLEGAFLGGYSGFQEGSANPTIAEAIALRNRLVFLQ  66

Query  226  DRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVA  405
            +R      I+SDC  LV+         S L +++     + +S     +K++RR +N+ A
Sbjct  67   NRFPLAGCIYSDCQPLVNIVYSSCLDNSELCLVVLDWRSILHSRLDIHVKWIRRHSNVEA  126

Query  406  HALAKHS  426
            HAL + S
Sbjct  127  HALEQAS  133



>ref|XP_010678557.1| PREDICTED: uncharacterized protein LOC104894089 [Beta vulgaris 
subsp. vulgaris]
Length=187

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +1

Query  181  LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFD  360
            +AE  A+  A+   +  G+ NV + SD  VL+S     M Y S L  +L+  L   + F+
Sbjct  77   IAEGKALLMAVRLAKRFGYDNVVLESDSKVLISRLSKAMVYFSDLDAVLEDILMSSSCFN  136

Query  361  SCSIKFVRRDANMVAHALAK  420
            S     V+RD N+VAH LAK
Sbjct  137  SLFWSHVKRDGNVVAHHLAK  156



>ref|XP_008367209.1| PREDICTED: uncharacterized protein LOC103430850 [Malus domestica]
Length=174

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 51/115 (44%), Gaps = 1/115 (1%)
 Frame = +1

Query  85   GTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDC  264
            G+   +G    N++GG  AA           L AEA   R  + +LR  G + V +  D 
Sbjct  45   GSVGGFGIVVRNSEGGFMAAKAIKEEGVRSTLHAEAADARAVMLFLRKWGTERVQVAGDA  104

Query  265  AVLVSSFRDVMTYRS-YLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAKHS  426
             ++ S+ ++     S + G + +   QL   F    + F RR+ N V H LA+ S
Sbjct  105  LLVTSAIQNAGAALSGHYGQLFEDTRQLLQGFKQWKVTFGRRETNKVVHRLARFS  159



>ref|XP_010423650.1| PREDICTED: uncharacterized protein LOC104708728 [Camelina sativa]
Length=399

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 63/146 (43%), Gaps = 8/146 (5%)
 Frame = +1

Query  10   TVLPVALEMPLPPGG------LYCFTDAAIHGTSPT-YGFYACNAQGGLEAAANGPLICP  168
            +++P  ++ P  P        L CFTD +        YG+   +     +   +   I  
Sbjct  244  SIIPQPVKAPKSPTTNRSTPTLTCFTDVSWKENEKAGYGWIIKDQSDATQLQGSASAIDV  303

Query  169  NDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLF  348
              PL+ EA+A   A+  + + G  ++   SD  VLV +       +   G + D  L L 
Sbjct  304  GSPLMTEALATLTAMRVVSEPGITDITFASDSQVLVQALCQKNLQKELHGTLHD-VLALS  362

Query  349  NSFDSCSIKFVRRDANMVAHALAKHS  426
             +F+SC   F+ R+ N  A ALAK +
Sbjct  363  ATFNSCLFTFIPRNQNRQADALAKEA  388



>ref|XP_010695539.1| PREDICTED: uncharacterized protein LOC104908151 [Beta vulgaris 
subsp. vulgaris]
Length=397

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 3/131 (2%)
 Frame = +1

Query  34   MPLPPGGLYCFTDA--AIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVRE  207
            +P PPG L    DA  AI+G     G  A +++G +  AA           +AEA A++ 
Sbjct  237  VPPPPGVLKINVDASLAINGW-IGLGSVARDSKGKVLFAATRRTRADWSAEIAEAKAIKM  295

Query  208  ALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
            A+   +  GF ++ + SDC  ++        + S L I+L + L     F S     V+R
Sbjct  296  AMRLCKRFGFHHLILESDCQAVIQRLTKNAVFLSDLDIVLHNILSSCIYFTSIVWSHVKR  355

Query  388  DANMVAHALAK  420
            D N VAH LAK
Sbjct  356  DGNSVAHNLAK  366



>ref|XP_006292284.1| hypothetical protein CARUB_v10018494mg [Capsella rubella]
 gb|EOA25182.1| hypothetical protein CARUB_v10018494mg [Capsella rubella]
Length=282

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 61/129 (47%), Gaps = 6/129 (5%)
 Frame = +1

Query  43   PPGGLYCFTDAA-IHGTSPTYGFYACNAQGGLEAAANGPLICPN--DPLLAEAMAVREAL  213
            PP  +   TDAA +       G+   ++Q      + G + C +   PL+AEA+A   A+
Sbjct  147  PPDTVTIHTDAAWMDSGQAGLGWIFTDSQN--RTCSTGSMACRHVRSPLMAEALATLTAV  204

Query  214  SWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDA  393
                + G  NV   SD  +LV +   V+  +   GI+ D  L+L ++F SC   F+ R+ 
Sbjct  205  RVATESGLSNVLFASDSLILVKALNLVLPSKELHGILHD-ILELSSNFSSCFFTFISREL  263

Query  394  NMVAHALAK  420
            N     LAK
Sbjct  264  NRRDDTLAK  272



>ref|XP_010436406.1| PREDICTED: uncharacterized protein LOC104720143 [Camelina sativa]
Length=465

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = +1

Query  169  NDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLF  348
            + PL+AEA+A   A+      GF +++I SD   LV +    +  +   GI+ D  L L 
Sbjct  373  SSPLMAEALATLTAVEVAIASGFTHLSIASDSQTLVKALNLKLHSKDLHGILHD-ILDLS  431

Query  349  NSFDSCSIKFVRRDANMVAHALAKHS  426
            N F SC+ +F+ R  N +A+ LAK +
Sbjct  432  NRFSSCNFRFIPRTQNQIANELAKRA  457



>gb|EPS73861.1| hypothetical protein M569_00896, partial [Genlisea aurea]
Length=1651

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 48/100 (48%), Gaps = 1/100 (1%)
 Frame = +1

Query  124   QGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRD-VMT  300
             QG  +A  +  L    DP   EA+A R+ L      GF  V +  DC  ++ +  D  +T
Sbjct  1546  QGRCQAWFSYQLDTELDPEAGEALAARKILELALAMGFTRVIVEGDCLTVLQALADQAVT  1605

Query  301   YRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAK  420
               + LG +L   L+L   F++C +   RR  N  AH LAK
Sbjct  1606  LFASLGNVLQDSLRLMEQFEACRLSHTRRQFNAAAHHLAK  1645



>ref|XP_008349430.1| PREDICTED: uncharacterized protein LOC103412666 [Malus domestica]
Length=155

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 49/106 (46%), Gaps = 0/106 (0%)
 Frame = +1

Query  103  GFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSS  282
            G+   +  G L+AA        +    AEA A+R AL    D GF NV I SD  V++  
Sbjct  17   GWVGSDFAGLLQAAGGSGTSFCHSTAAAEACAIRSALLACIDNGFDNVVIKSDALVIIQM  76

Query  283  FRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAK  420
             +   T+   +  IL     L     S +  FV R++N  AH++AK
Sbjct  77   LKKESTHDYSIECILGDIELLVQRLTSVTFSFVPRESNRAAHSVAK  122



>ref|XP_010490394.1| PREDICTED: uncharacterized protein LOC104768166 [Camelina sativa]
Length=189

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 57/123 (46%), Gaps = 2/123 (2%)
 Frame = +1

Query  55   LYCFTDAA-IHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDR  231
            + CF DA+ I       G+   +    +    +      + PL+AEA+A   A+      
Sbjct  58   ITCFVDASWISEPKAGLGWVFTDQHEQILQQGSDLATHVSSPLMAEALATLTAVEVAIAS  117

Query  232  GFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHA  411
            GF +++I SD   LV +  ++  +   L  IL   L L N F SC+ +F+ R  N +A  
Sbjct  118  GFTHLSIASDSQTLVKAL-NLKLHSKDLHEILHDILDLSNRFSSCNFRFIPRTQNQIADE  176

Query  412  LAK  420
            LAK
Sbjct  177  LAK  179



>ref|XP_003604713.1| hypothetical protein MTR_4g016830 [Medicago truncatula]
Length=108

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 42/83 (51%), Gaps = 0/83 (0%)
 Frame = +1

Query  178  LLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSF  357
            L AEA A+ EA+      GFQ V   +DC  L  +      + + +G I+  C  L  + 
Sbjct  4    LEAEATALSEAIKLAISLGFQTVRFETDCMTLADAIHTTSAHLNEVGDIISQCRGLLFTN  63

Query  358  DSCSIKFVRRDANMVAHALAKHS  426
                + ++RR AN VAH++A+ S
Sbjct  64   TDFKVSYIRRQANRVAHSIARAS  86



>ref|XP_008382811.1| PREDICTED: uncharacterized protein LOC103445579 [Malus domestica]
Length=333

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFR-DVMTYRSYLGIILDSCLQLFN  351
            PLLAE +A REA  +++    Q V +  D  +++++ + D+      LG +L     L  
Sbjct  221  PLLAETIAAREAALFVQQWKLQKVILEGDALLVIAAIQNDLDVNHGPLGHVLSDIHLLLQ  280

Query  352  SFDSCSIKFVRRDANMVAHALAKH  423
             F      FVRRDAN VAH LA+ 
Sbjct  281  PFQQWKAHFVRRDANTVAHWLARR  304



>ref|XP_009152173.1| PREDICTED: uncharacterized protein LOC103875407 [Brassica rapa]
Length=319

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 58/144 (40%), Gaps = 7/144 (5%)
 Frame = +1

Query  1    QHATVLPVALEMPLPPGGLYCFTDAAIHGTSPTYG--FYACNAQGGLEAAANGPLICPND  174
             H   LP  L  P     + C TDAA    S   G  +   + +              + 
Sbjct  174  HHNRTLPPTLTSPF----VVCLTDAAWQAGSKKAGCGWILMDHRDAWLKQGTSTFNYTSS  229

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            PL+AEA+AVR AL    + G+  + I SDC  LV+            GI  D    L  S
Sbjct  230  PLMAEALAVRTALLNALEVGYTRICIKSDCLALVAIISSKQRPADLHGITRD-IEHLSLS  288

Query  355  FDSCSIKFVRRDANMVAHALAKHS  426
            FD  S  F+ R+ N  A AL K S
Sbjct  289  FDCISFVFISRNLNSAADALVKSS  312



>ref|XP_010681975.1| PREDICTED: uncharacterized protein LOC104896887 [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            D  LAEA+AVR  L    + GF ++ +  D   + S  +      S LG IL    +L N
Sbjct  2    DVALAEALAVRHGLQIAIEAGFSSLVLEMDNFTVYSKLQRRKQEASTLGSILHDIHRLAN  61

Query  352  SFDSCSIKFVRRDANMVAHALAKHS  426
               + S  FV+R+ N VAHALAK S
Sbjct  62   QCFNVSFSFVKREGNGVAHALAKLS  86



>ref|XP_010673165.1| PREDICTED: uncharacterized protein LOC104889605 [Beta vulgaris 
subsp. vulgaris]
Length=188

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 57/127 (45%), Gaps = 1/127 (1%)
 Frame = +1

Query  43   PPGGLYCFTDAAIHGTSPT-YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSW  219
            P G +   TDA++        G  A +++G +  AA   +     P +AE  A+  A   
Sbjct  33   PAGAIKLNTDASLADEGWVGLGVVARDSEGKVCFAAARRVRAFWPPEVAECKAIYMATRL  92

Query  220  LRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANM  399
             +  G+++V   SD  V          + S L  IL   L + N+F S S   VRRD N 
Sbjct  93   AKAHGYRDVIFESDSLVATKRLTKAAIFLSDLDAILGDILSMCNAFSSVSFSHVRRDGNS  152

Query  400  VAHALAK  420
            VAH LA+
Sbjct  153  VAHNLAR  159



>ref|XP_002522294.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40152.1| conserved hypothetical protein [Ricinus communis]
Length=169

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = +1

Query  184  AEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDS  363
            AEA+  REALSW++ R F N+ I  +   L ++ +  +T  +YLG ++  C  L N  + 
Sbjct  96   AEAICTREALSWIKSRFF-NLPILLESDSL-NALKIRITSDAYLGSVIGDCKALANELNL  153

Query  364  CSIKFVRRDANMVAHA  411
             S  F+RR  N +AHA
Sbjct  154  ISCSFIRRSENNIAHA  169



>ref|XP_010436807.1| PREDICTED: uncharacterized protein LOC104720624 [Camelina sativa]
Length=445

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 45/84 (54%), Gaps = 1/84 (1%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            PL+AEA+A  +AL    + GF  V   SD  +LV +     + +   GI+ DS   L + 
Sbjct  355  PLMAEALATFKALEVAIESGFNQVHFASDSQLLVKALNQKSSPKELHGILYDS-QSLISQ  413

Query  355  FDSCSIKFVRRDANMVAHALAKHS  426
            F  C+  F+ R+ N  A ALAK++
Sbjct  414  FHLCTFNFIPRNCNRQADALAKNA  437



>gb|KHN11193.1| hypothetical protein glysoja_043927, partial [Glycine soja]
Length=115

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 39/85 (46%), Gaps = 0/85 (0%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            +P  AE  A+ + L W+      NV I  DC V+ +  +  +   S    IL  C  L  
Sbjct  15   EPHEAEGWALMKTLQWITKLELNNVIIEIDCKVMANVMKTRLKGSSKFHYILAKCKNLLF  74

Query  352  SFDSCSIKFVRRDANMVAHALAKHS  426
               +  + F+RR AN  AHAL + S
Sbjct  75   LNQNSRVSFIRRQANQGAHALTRTS  99



>ref|XP_009107615.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=526

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 58/125 (46%), Gaps = 7/125 (6%)
 Frame = +1

Query  64   FTDAAIHGTSPTYG----FYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDR  231
            +TDAA      T G     Y  +++   + A     +    PL+AEA+AVREAL  ++  
Sbjct  399  YTDAAWRAQDKTAGCGWIIYTPHSEDARKVATTEMFVA--TPLMAEALAVREALLQVKAE  456

Query  232  GFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHA  411
               N+   SD  VL+ +           GI LD   +L +SF S    +V R+ N  A A
Sbjct  457  HLSNICCKSDNQVLIKALNSNQHPVELYGINLD-IEKLASSFSSIVFSYVPRNLNFAADA  515

Query  412  LAKHS  426
            LAK +
Sbjct  516  LAKSA  520



>ref|XP_002520660.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41622.1| conserved hypothetical protein [Ricinus communis]
Length=70

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  181  LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYL  315
            +AE  A++EALSWL DRGFQ V I SDC  +V   ++ +   SY+
Sbjct  1    MAEVWALKEALSWLYDRGFQGVQIKSDCQQIVELIQEEIQPNSYV  45



>ref|XP_006397448.1| hypothetical protein EUTSA_v10001854mg, partial [Eutrema salsugineum]
 gb|ESQ38901.1| hypothetical protein EUTSA_v10001854mg, partial [Eutrema salsugineum]
Length=255

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +1

Query  178  LLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSF  357
            L AEA A+REAL    D GF  + +FSD  +L++      T+ + L I+ D   QL  SF
Sbjct  165  LAAEAWALREALISAIDEGFDEMQVFSDSQILMNLINSQETHTNILEIVYD-IRQLALSF  223

Query  358  DSCSIKFVRRDANMVAHALAKHS  426
                 K+V R  N VA  LAK++
Sbjct  224  SVILFKYVLRGVNAVADTLAKNA  246



>ref|XP_010677668.1| PREDICTED: uncharacterized protein LOC104893266 [Beta vulgaris 
subsp. vulgaris]
Length=190

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 56/127 (44%), Gaps = 1/127 (1%)
 Frame = +1

Query  43   PPGGLYCFTDAAIHGTSPT-YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSW  219
            P G +   TDA++        G  A N++G +  AA   +     P +AE  A+  A   
Sbjct  33   PAGAIKLNTDASLAEEGWVGIGVIARNSEGKVCFAATRRVRAYWPPEVAECKAIYMATRL  92

Query  220  LRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANM  399
             +  G+ +V   SD  V          + S L  IL   L + N+F S S   V+RD N 
Sbjct  93   AKAHGYGDVIFESDSLVATRRLTKAAIFFSDLDAILGDILAMCNAFSSVSFSHVKRDGNT  152

Query  400  VAHALAK  420
            VAH LA+
Sbjct  153  VAHNLAR  159



>ref|XP_007206269.1| hypothetical protein PRUPE_ppa016210mg [Prunus persica]
 gb|EMJ07468.1| hypothetical protein PRUPE_ppa016210mg [Prunus persica]
Length=186

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  EAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSC  366
            EA+A R       +RG+QNV   SD   +V++ R+    RS +G +++    L       
Sbjct  96   EALAARTGTILAMERGYQNVVFESDALQIVTALRNHSIDRSVIGPVVEDTKSLLTQITGE  155

Query  367  SIKFVRRDANMVAHALAK  420
                +RR AN VAH LA+
Sbjct  156  GFTHIRRTANGVAHRLAR  173



>ref|XP_010686870.1| PREDICTED: uncharacterized protein LOC104901026 [Beta vulgaris 
subsp. vulgaris]
Length=320

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +1

Query  181  LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFD  360
            +AE  ++  A+   +  G++NV + SD  VL+S     M Y S L  +L+  L   + F+
Sbjct  210  IAEGTSLLMAVRLAKRFGYENVVLESDSQVLISRLSKAMVYFSDLDAVLEDILMSSSCFN  269

Query  361  SCSIKFVRRDANMVAHALAK  420
            S  +  V+R+ N+VAH LAK
Sbjct  270  SLVLSHVKREGNVVAHHLAK  289



>ref|XP_003622135.1| hypothetical protein MTR_7g028110 [Medicago truncatula]
Length=521

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 39/77 (51%), Gaps = 1/77 (1%)
 Frame = +1

Query  187  EAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQ-LFNSFDS  363
            EA+ +   L W+ ++ F NV    DC  +V      +  RS  G I+ +C Q L + F +
Sbjct  4    EAVRLHTTLDWISNQPFDNVDFVLDCKRVVDCVNSSLDDRSEFGCIITACKQRLVDRFQN  63

Query  364  CSIKFVRRDANMVAHAL  414
              I+F RR  N VAH L
Sbjct  64   SHIEFNRRQTNRVAHEL  80



>gb|EAZ10420.1| hypothetical protein OsJ_00252 [Oryza sativa Japonica Group]
Length=499

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 0/81 (0%)
 Frame = +1

Query  178  LLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSF  357
            + AEA A+R AL   ++ GF NV + SDC  ++         RS +G +++   +    F
Sbjct  392  VQAEACAIRHALWLAKEEGFHNVIVASDCLYVIQKLNSTGQDRSKIGCLVEDVKKFGVEF  451

Query  358  DSCSIKFVRRDANMVAHALAK  420
             S S   V R +N+ AH LA+
Sbjct  452  ISVSFIHVSRCSNVAAHTLAR  472



>ref|XP_003622145.1| Cell differentiation protein RCD1-like protein [Medicago truncatula]
Length=539

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 52/109 (48%), Gaps = 8/109 (7%)
 Frame = +1

Query  103  GFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSS  282
            G Y CN      +  N   +        EA+ + +ALSW+ + GF  +  F D  ++V +
Sbjct  135  GRYKCNVYASFSSNHNKVEV-------GEALGLSQALSWVAELGFDGMDFFLDSKIVVDA  187

Query  283  FRDVMTYRSYLGIILDSCLQLF-NSFDSCSIKFVRRDANMVAHALAKHS  426
                  + + L II+  C Q+  N F +  ++F RR  N VA+ LA+ +
Sbjct  188  SDGGNKHNTKLDIIIQHCRQVVSNYFHNHVVEFSRRQVNGVAYELAQEN  236



>gb|KHN14619.1| hypothetical protein glysoja_024714 [Glycine soja]
Length=239

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 58/134 (43%), Gaps = 5/134 (4%)
 Frame = +1

Query  34   MPLPPGGLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAE--AMAVRE  207
            MP   G + C  DAA        G  AC              + P  P + E  A+A+  
Sbjct  1    MPPSKGRMKCNIDAAFREGGRRMGIGACLRDDRGHCVHAFTTLKPYLPTMKEDEALAILH  60

Query  208  ALSWLRDRGFQNVAIFSDCAV--LVSSFR-DVMTYRSYLGIILDSCLQLFNSFDSCSIKF  378
             L +L++ GF +  I+    V   + +F    MT  +    +++ C +      + SI F
Sbjct  61   TLEYLKNNGFHDTLIWWKLPVRWWLETFSVGTMTIWNLAASLINKCRRFLLDILNVSIGF  120

Query  379  VRRDANMVAHALAK  420
            +RR AN VAH+LAK
Sbjct  121  IRRQANSVAHSLAK  134



>ref|XP_010692477.1| PREDICTED: uncharacterized protein LOC104905588 [Beta vulgaris 
subsp. vulgaris]
Length=1260

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +1

Query  175   PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
             P +AEA AV  A+   R  G Q V + SDC V+++       + S L ++L + L     
Sbjct  1149  PEIAEAKAVELAVKLGRRYGLQRVILESDCQVVINRLSKNAIFLSDLDLVLFNILASCTY  1208

Query  355   FDSCSIKFVRRDANMVAHALAK  420
             F S     V+RD N VAH LAK
Sbjct  1209  FSSVVWSHVKRDGNYVAHHLAK  1230



>emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +1

Query  175   PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
             P +AEA AV  A+   R  G Q V + SDC V+++       + S L ++L + L     
Sbjct  1244  PEIAEAKAVELAVKLGRRYGLQRVILESDCQVVINRLSKNAIFLSDLDLVLFNILASCTY  1303

Query  355   FDSCSIKFVRRDANMVAHALAK  420
             F S     V+RD N VAH LAK
Sbjct  1304  FSSVVWSHVKRDGNYVAHHLAK  1325



>ref|XP_009109953.1| PREDICTED: uncharacterized protein LOC103835521 [Brassica rapa]
Length=722

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 39/130 (30%), Positives = 60/130 (46%), Gaps = 1/130 (1%)
 Frame = +1

Query  37   PLPPGGLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALS  216
            P PP      +DAA    S   GF     +     +  G        L+AE +A+REAL+
Sbjct  142  PRPPNCSVLNSDAAWKAESKLAGFGWTITEATGTVSFTGYESFVGSALVAEGLAMREALA  201

Query  217  WLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDAN  396
              ++RG + V   SD + L+ +           GI+ D C +L +SFD  +  ++ R+ N
Sbjct  202  GCKERGIRRVICESDSSQLIKAIDAGGEKPEIFGIVADIC-ELASSFDVINFVWIPREKN  260

Query  397  MVAHALAKHS  426
            + A  LAK S
Sbjct  261  VNADRLAKLS  270



>ref|XP_009117699.1| PREDICTED: uncharacterized protein LOC103842788 [Brassica rapa]
Length=371

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 61/148 (41%), Gaps = 9/148 (6%)
 Frame = +1

Query  1    QHATVLPVALEMPLPPGG------LYCFTDAAIHGTSPTYG--FYACNAQGGLEAAANGP  156
            Q + + P  L  P  P        L CFTDAA   ++   G  +Y  N +G      +  
Sbjct  217  QASLISPQVLRNPQGPSSHRAPTVLSCFTDAAWISSTNRAGCGWYIANTEGDTLLQGSCT  276

Query  157  LICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSC  336
                +  L+AE +A+R AL    + GF  + I SDC  L+++           GII D  
Sbjct  277  FKFISSALMAEGLAIRSALIHAAEAGFLTICIKSDCQALIAALSSKCHSIELYGIIRDIE  336

Query  337  LQLFNSFDSCSIKFVRRDANMVAHALAK  420
               F  F   S  F+ R  N  A  LAK
Sbjct  337  TLSFR-FSCISFSFIPRSLNCRADTLAK  363



>gb|ABD28710.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=393

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 9/130 (7%)
 Frame = +1

Query  49   GGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAAN---GPLICPNDPLLAEAMAVREAL  213
            G L C  DA+   +S   G   C  +++G    +      PL CP +  + EA+ +  A 
Sbjct  240  GRLKCNVDASFSTSSNKVGIGMCIRDSEGNHVRSKTMWFSPL-CPVN--IGEALGLYHAT  296

Query  214  SWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCS-IKFVRRD  390
             W+ +    NV    D   +   F       +  G I+++ +Q  N F + S ++F RR 
Sbjct  297  RWINELQLTNVDFEVDSKTIADYFNKARGDNTEFGSIMENTIQFCNIFLTNSHVEFTRRQ  356

Query  391  ANMVAHALAK  420
            AN VAH LAK
Sbjct  357  ANEVAHELAK  366



>ref|XP_010670097.1| PREDICTED: uncharacterized protein LOC104887199 [Beta vulgaris 
subsp. vulgaris]
Length=180

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            +P +AEA A+   +   ++  + ++ + SD  + + + R      S   +ILD  L L  
Sbjct  70   EPRIAEAKAIFHGVKLAKEMSYSHIEVESDSLLAIQALRSGKGGSSEFNLILDDVLDLAR  129

Query  352  SFDSCSIKFVRRDANMVAHALA  417
            SFD+    FV+R  N VAH LA
Sbjct  130  SFDNVIWCFVKRSGNKVAHMLA  151



>gb|KHN34964.1| hypothetical protein glysoja_004730, partial [Glycine soja]
Length=131

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 38/84 (45%), Gaps = 0/84 (0%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P   EA A+   + W++  G  NV I +DC   V  F+          +I +SC  L + 
Sbjct  32   PNEVEACALHSTIIWIKRLGLSNVVIETDCKTPVDCFQADTKNSIDFHVIFNSCRDLLSP  91

Query  355  FDSCSIKFVRRDANMVAHALAKHS  426
              +  + FV+R  N V H L + S
Sbjct  92   ISNFRVSFVKRHVNHVTHNLTRTS  115



>gb|AAK52166.1|AC084831_20 putative reverse transcriptase [Oryza sativa Japonica Group]
Length=1185

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +1

Query  172   DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
             D  +AEA A+R+ LS  +  G +NV + +DC  +VS+  D     +    + D C  +++
Sbjct  1042  DAPMAEAFALRDGLSLAQHIGAKNVIVQTDCMQVVSTMMDGGFSATAAMSVFDDCKLMWD  1101

Query  352   SFDSCSIKFVRRDANMVAHALAK  420
              F + SI+   R++N VAH LA+
Sbjct  1102  GFGTISIEHCNRNSNQVAHELAR  1124



>ref|XP_008372934.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=961

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 55/108 (51%), Gaps = 2/108 (2%)
 Frame = +1

Query  103  GFYACNAQGGLEAAA-NGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVS  279
            G+ A +  G L+AA   G  +C +    AE +A+R AL +    GF++VAI SD   ++ 
Sbjct  823  GWVARDFAGLLQAAGGTGGRLC-HSADAAEMLAIRSALDFCVRLGFKSVAIESDAKNIIQ  881

Query  280  SFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAKH  423
              R+  T    L   L     L    +S +  FV R++N  AH++AK+
Sbjct  882  MIRNETTLDCSLECTLGDIATLARGLESVTFDFVSRESNRAAHSVAKY  929



>ref|XP_009130307.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=552

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 38/127 (30%), Positives = 56/127 (44%), Gaps = 2/127 (2%)
 Frame = +1

Query  43   PPGGLYCFTDAAIHGTSPT-YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSW  219
            P   L CFTDAA   T+    G+Y  + +G +    +         ++AEA+A+R AL  
Sbjct  418  PLTELSCFTDAAWTSTNRAGCGWYIMSLEGNVLLKGSCVFEFITSAMMAEALAIRSALVH  477

Query  220  LRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANM  399
              + G   + I SDC  L+++           GI  D    L   F   S  F+ R  N 
Sbjct  478  ASEAGISKICIKSDCQALIAAISSTCHSVELYGIFRD-IENLSLRFSCISFSFISRSLNC  536

Query  400  VAHALAK  420
            +A +LAK
Sbjct  537  MADSLAK  543



>ref|XP_003626499.1| hypothetical protein MTR_7g116560 [Medicago truncatula]
Length=119

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 38/71 (54%), Gaps = 1/71 (1%)
 Frame = +1

Query  217  WLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCS-IKFVRRDA  393
            WL D  F NV   +D  +   +F       S  G ++ SC  LF+SF + S ++F RR A
Sbjct  24   WLSDMQFDNVDFETDSKITHDAFHSTQEDISEFGCVISSCRSLFSSFFTNSRVEFARRQA  83

Query  394  NMVAHALAKHS  426
            N+VAH LA  S
Sbjct  84   NVVAHVLAGES  94



>emb|CDY12378.1| BnaC08g08270D [Brassica napus]
Length=698

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 41/133 (31%), Positives = 60/133 (45%), Gaps = 5/133 (4%)
 Frame = +1

Query  34   MPL--PPGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAV  201
            +PL  P   L CFTDAA   ++   G   C  + +G +    +G        ++AEA+A+
Sbjct  558  LPLHRPLTELSCFTDAAWIASTYRAGCGWCIMSLEGDVLLKGSGVFEFIPSAMMAEALAI  617

Query  202  REALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFV  381
            R AL    + G   + I SDC  L+++           GII D    L   F   S  F+
Sbjct  618  RSALVHAAEAGISKICIKSDCQALIAAISSTCHSVELYGIIRD-IENLSFRFSCISFSFI  676

Query  382  RRDANMVAHALAK  420
             R  N +A +LAK
Sbjct  677  SRSLNCMADSLAK  689



>ref|XP_009114471.1| PREDICTED: uncharacterized protein LOC103839734 [Brassica rapa]
Length=473

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 44/86 (51%), Gaps = 1/86 (1%)
 Frame = +1

Query  169  NDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLF  348
            N PL+AE +A+REALS    +G + +   SD   L+ +  D        GI+ D  L L 
Sbjct  388  NSPLVAEGLALREALSCCIAKGLRRILCKSDSLRLIRALHDEAPVSEIYGIVAD-ILNLS  446

Query  349  NSFDSCSIKFVRRDANMVAHALAKHS  426
             +FD  S  + +R  N  A ALA+ +
Sbjct  447  LAFDFVSFAWTQRSENKAADALARQA  472



>ref|XP_010445339.1| PREDICTED: uncharacterized protein LOC104727990 [Camelina sativa]
Length=1030

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 56/125 (45%), Gaps = 6/125 (5%)
 Frame = +1

Query  61    CFTDAAIHGTSPTYGFYACNAQGG---LEAAANGPLICPNDPLLAEAMAVREALSWLRDR  231
             CFTDA       T   +    Q G   L+  +    I    PL+AEA+A    L    + 
Sbjct  901   CFTDAVWQVNGNTGCGWIFKDQSGDILLQGESTATHI--RSPLMAEALATLTVLGVAIES  958

Query  232   GFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHA  411
             GF  ++  S+  +LV +     + +   G++ DS   L + FD CS   + R  N  A A
Sbjct  959   GFNKISFASNSQMLVQALNRKTSPKELCGLLYDS-HSLSDRFDLCSFSHISRLDNFQADA  1017

Query  412   LAKHS  426
             LAKH+
Sbjct  1018  LAKHA  1022



>ref|XP_010678022.1| PREDICTED: uncharacterized protein LOC104893592 [Beta vulgaris 
subsp. vulgaris]
Length=161

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%), Gaps = 0/80 (0%)
 Frame = +1

Query  181  LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFD  360
            +AEA ++   +   R    QNV I SDC  +++       + S L I+L +   L  +F 
Sbjct  52   VAEAKSIEVVVRLRRRYELQNVIIESDCQTVINRLSKQAIFLSDLDIVLHNIFALSLNFT  111

Query  361  SCSIKFVRRDANMVAHALAK  420
            S     V+RD N+VAH LAK
Sbjct  112  SLIWSHVKRDGNVVAHNLAK  131



>ref|XP_008341962.1| PREDICTED: uncharacterized protein LOC103404776 [Malus domestica]
Length=353

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 2/127 (2%)
 Frame = +1

Query  46   PGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREALSW  219
            P  +   TD++        GF       +G   AA  G L     P+ A+AMA+RE++ W
Sbjct  219  PRKVKMNTDSSWSDVKKKXGFEVVIRGDRGVFMAAKCGMLEDVFSPIQAKAMAIRESMLW  278

Query  220  LRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANM  399
                G + + + +D   +V + +D     S +G I++    L  S    ++       N 
Sbjct  279  AMQMGIKKLVLKTDSLQIVEALQDSSLNMSAVGQIMEDIKVLLQSITEVAMTHTHHKVNS  338

Query  400  VAHALAK  420
            +AH LA+
Sbjct  339  IAHRLAR  345



>emb|CDY08832.1| BnaA06g23920D [Brassica napus]
Length=153

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 3/82 (4%)
 Frame = +1

Query  178  LLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS-  354
            L  EA+A+R ALS     G+  V +FSDC VLV +     +     G++ D  ++L +S 
Sbjct  64   LTGEALAIRLALSHALSLGYTRVCVFSDCQVLVRAICSKSSPVELYGLVCD--IELLSSL  121

Query  355  FDSCSIKFVRRDANMVAHALAK  420
            FD C++ F+ R  N  A  L K
Sbjct  122  FDYCTLSFISRSLNSEADLLVK  143



>ref|XP_009142128.1| PREDICTED: uncharacterized protein LOC103866010 [Brassica rapa]
Length=191

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 61/130 (47%), Gaps = 13/130 (10%)
 Frame = +1

Query  52   GLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPN--DPLLAEAMAVREALSWLR  225
            G    TDAA +  S   G      Q   E  ++  +I  N   PL+AE +A+REAL   R
Sbjct  57   GTILRTDAAWNEESSRAGLGWILTQD--EITSSLAIIAENVPSPLMAEGLALREALQKSR  114

Query  226  DRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILD----SCLQLFNSFDSCSIKFVRRDA  393
            + G + + + SD   L++S  +  +     GI+ D    SC      FD  S +++ R+A
Sbjct  115  ELGIKVLNVESDSKNLIASATNNKSVPELYGIVADIMSISCF-----FDYVSFRWIPREA  169

Query  394  NMVAHALAKH  423
            N  A  +AK 
Sbjct  170  NYAADLVAKQ  179



>ref|XP_010693383.1| PREDICTED: uncharacterized protein LOC104906342 [Beta vulgaris 
subsp. vulgaris]
Length=1157

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 41/80 (51%), Gaps = 0/80 (0%)
 Frame = +1

Query  181   LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFD  360
             +AE  A+  AL      G + V + SD  VL++     MTY S L  +LD  L    +F 
Sbjct  1048  IAEGKALLMALRLAERFGLRQVTLESDSQVLITRLSKAMTYFSDLDSVLDDILAKSCNFL  1107

Query  361   SCSIKFVRRDANMVAHALAK  420
             S     V+RD N+VAH LAK
Sbjct  1108  SVDWSHVKRDGNVVAHHLAK  1127



>gb|AFK33762.1| unknown [Lotus japonicus]
Length=100

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +1

Query  193  MAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSI  372
            M  R AL+   + G  ++   SDC  LV +F     + S   I+LD C QL NSF + S 
Sbjct  1    MCFRWALNLAANWGLDSLVFSSDCQQLVKAFHCPSEFPSLAHIMLD-CTQLVNSFRNFSF  59

Query  373  KFVRRDANMVAHALAKHS  426
             F  R  N VAHALA  S
Sbjct  60   CFEYRQTNRVAHALAAES  77



>ref|XP_007203200.1| hypothetical protein PRUPE_ppa025309mg, partial [Prunus persica]
 gb|EMJ04399.1| hypothetical protein PRUPE_ppa025309mg, partial [Prunus persica]
Length=155

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 50/104 (48%), Gaps = 1/104 (1%)
 Frame = +1

Query  118  NAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFR-DV  294
            N +G + AA   PL        AE MA+   + + RD GF ++ I SD   +V+  + D 
Sbjct  46   NDKGEVIAAMAFPLATATSSKHAEIMALHFRMKFARDAGFSSILIESDSQGVVNDVKKDE  105

Query  295  MTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAKHS  426
                +  G ++D   +    F+  +I F  R  N VAH LA+H+
Sbjct  106  EESWASDGHLIDDIKRSLQHFEEVTISFSPRGCNQVAHFLARHT  149



>ref|XP_003607874.1| hypothetical protein MTR_4g083950 [Medicago truncatula]
Length=133

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 42/81 (52%), Gaps = 1/81 (1%)
 Frame = +1

Query  181  LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSF-  357
            + EA  +   L W+ +    ++    D   +V SF       +  GII+ +C  LF  + 
Sbjct  26   IGEAFGLISTLEWVHELNLGSIDFEMDAKRVVDSFLSSRHDVTEFGIIIQNCKTLFRHYY  85

Query  358  DSCSIKFVRRDANMVAHALAK  420
            ++ +++FVRR AN +AH LAK
Sbjct  86   ENSTVEFVRRQANEIAHKLAK  106



>ref|XP_003614550.1| hypothetical protein MTR_5g055330 [Medicago truncatula]
Length=138

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 54/125 (43%), Gaps = 4/125 (3%)
 Frame = +1

Query  13   VLPVALEMPLPPGGLYCFTDAAIHGTSPT--YGFYACNAQGGLEAAANGPLICPNDPLLA  186
            V P + + P   G   C  DAA          G   C+  G    A   PL   ++ ++ 
Sbjct  14   VFPPSWQRP-SRGRFKCNIDAAFLNKQNVICLGMCICDEGGVFGLAKVIPLPVMHNVIVG  72

Query  187  EAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN-SFDS  363
            EAM +  AL WL D  F NV    D    + +F +     S  G+I+ +C  LFN  F +
Sbjct  73   EAMGLYHALEWLSDMRFDNVDFALDSKSTMDAFINPRPDISEFGLIISACRSLFNLKFTN  132

Query  364  CSIKF  378
             +IKF
Sbjct  133  SNIKF  137



>ref|XP_007224090.1| hypothetical protein PRUPE_ppa015515mg [Prunus persica]
 gb|EMJ25289.1| hypothetical protein PRUPE_ppa015515mg [Prunus persica]
Length=154

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 38/78 (49%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  EAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSC  366
            EA+A R       +RG+QNV   SD   + ++ R+    RS +G +++    L       
Sbjct  48   EALAARTGTILAMERGYQNVVFESDALQIFTALRNHSIDRSVIGPVVEDTKSLLTQITGE  107

Query  367  SIKFVRRDANMVAHALAK  420
                +RR AN VAH LA+
Sbjct  108  GFTHIRRTANGVAHRLAR  125



>emb|CDY61093.1| BnaC06g41610D [Brassica napus]
Length=291

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 4/97 (4%)
 Frame = +1

Query  136  EAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYL  315
            EAAA G +      L AEA+AVREAL      G  ++ I SD +VL+S+ R   T  + +
Sbjct  189  EAAARGFV---GSALTAEALAVREALKIASSSGIAHLKILSDSSVLISAMRS-ETVLNEI  244

Query  316  GIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAKHS  426
              +L     L + F + S   + R AN VA  LAK++
Sbjct  245  ARLLHEISHLISLFSTLSFVVILRSANSVADGLAKNA  281



>ref|XP_003614776.1| hypothetical protein MTR_5g059090 [Medicago truncatula]
Length=284

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 48/107 (45%), Gaps = 4/107 (4%)
 Frame = +1

Query  88   TSPTYGFYACNAQGGLEAAAN--GPLIC-PNDPLLAEAMAVREALSWLRDRGFQNVAIFS  258
              P  G Y C+       + N  G  +C  +D  + EA+ +  AL WL ++ F NV    
Sbjct  23   KKPASGRYKCSIDASFSTSLNRVGLDMCLRDDDGVGEAVGLHTALDWLSNQQFDNVDFVL  82

Query  259  DCAVLVSSFRDVMTYRSYLGIILDSCLQLF-NSFDSCSIKFVRRDAN  396
            DC  +V      +   S  G  + +C QL  + F +  ++F RR AN
Sbjct  83   DCKKVVDCVNSSLEDSSEFGCFITACKQLLVDKFQNTHVEFSRRQAN  129



>ref|XP_009141437.1| PREDICTED: uncharacterized protein LOC103865394 [Brassica rapa]
Length=156

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +1

Query  169  NDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILD-SCLQL  345
            + PL+AE +A+REAL +  ++  + V   +D  VLV +           GI+ D +CL L
Sbjct  57   SSPLVAEGLALREALQFCIEKNIRMVRCETDSLVLVKALNSGPPVAELYGIVADIACLSL  116

Query  346  FNSFDSCSIKFVRRDANMVAHALAKHS  426
              +FDS S  +++R  N  A ALAK +
Sbjct  117  --AFDSISFSWIKRGKNGDADALAKQA  141



>emb|CDP14369.1| unnamed protein product [Coffea canephora]
Length=347

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 58/126 (46%), Gaps = 3/126 (2%)
 Frame = +1

Query  49   GGLYCFTDAAIHGTSPT--YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWL  222
            G +   +DAA+   +    +G  A +  G    A   P  C +     EA+A+R A+   
Sbjct  188  GWVKINSDAAVQQKAERAGWGMIARDCLGNALGAWAVPDTCCSSAKQEEALALRSAMLMA  247

Query  223  RDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMV  402
            + +G++ V   SDC  L+ S            I+LD  + L ++F  C   F RR  N V
Sbjct  248  KQQGWRRVVFESDCKQLIDSINSGDGDSDIATILLD-IVSLKSNFYKCCFSFTRRMNNSV  306

Query  403  AHALAK  420
            +H+LAK
Sbjct  307  SHSLAK  312



>ref|XP_008228072.1| PREDICTED: uncharacterized protein LOC103327517 [Prunus mume]
Length=326

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = +1

Query  184  AEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDS  363
            AE +A+REAL + +D G     I  D   ++ S +D    RSYL  +   C    +  ++
Sbjct  220  AEDLALREALLFAKDIGPGPKLIEIDAQGVLHSVQDAQEDRSYLSCLFSDCKFFLSQVEN  279

Query  364  CSIKFVRRDANMVAHALAK  420
             SIKF  R+AN  AH LA+
Sbjct  280  TSIKFAFREANQAAHRLAR  298



>ref|XP_009119970.1| PREDICTED: uncharacterized protein LOC103844893 [Brassica rapa]
Length=278

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 1/119 (1%)
 Frame = +1

Query  67   TDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNV  246
            TDAA + +    G      + G E++ +        PL AE +A+REAL   RD G   +
Sbjct  146  TDAAWNESLNLAGLGWMTKRQGRESSFSSIAQHVATPLAAEGLALREALLKCRDMGLSKI  205

Query  247  AIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAKH  423
               SD A+L+ +           GI+ D    + +SFDS S  ++ R+ N  A  LAK+
Sbjct  206  RCESDSAILIKAINANSPLVGLYGILAD-INSIASSFDSISFNWISRERNGKADGLAKN  263



>gb|EMT06316.1| Glucan endo-1,3-beta-glucosidase 14 [Aegilops tauschii]
Length=530

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 43/85 (51%), Gaps = 2/85 (2%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            DP+  EA AV EAL+   D   Q + I SD  V+V   +     R+  G ++   +    
Sbjct  421  DPITFEAFAVSEALALSHDLYIQRLHIASDRKVVVEDIQK--RNRTSYGAVIQEIITHSV  478

Query  352  SFDSCSIKFVRRDANMVAHALAKHS  426
             F SC I +  R +N+ AH LAKH+
Sbjct  479  FFTSCKIVYENRSSNLQAHNLAKHA  503



>gb|EMT25602.1| F-box/WD-40 repeat-containing protein [Aegilops tauschii]
Length=779

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 43/86 (50%), Gaps = 2/86 (2%)
 Frame = +1

Query  169  NDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLF  348
            +DP   E +A+REA++   D     + I SDC V V        ++     I+   +Q  
Sbjct  90   SDPGTLETLAIREAMALANDLYVGRIQIASDCKVAVDDIH--QQFKGSYSAIVHEIIQYK  147

Query  349  NSFDSCSIKFVRRDANMVAHALAKHS  426
            ++FD C+I    R +N  AH LAKH+
Sbjct  148  STFDICNIGHEFRSSNTEAHKLAKHA  173



>ref|XP_003638396.1| hypothetical protein MTR_130s0012 [Medicago truncatula]
Length=100

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +1

Query  274  VSSFRDVMTYRSYLGIILDSCL-QLFNSFDSCSIKFVRRDANMVAHALAKHS  426
            + +F   MT  +  G I+D C  Q F SF + +++F+RR ANM AHALA+ +
Sbjct  24   IDAFHSRMTDITEFGNIIDECREQFFPSFTNSTVEFIRRQANMAAHALAREA  75



>ref|XP_010669786.1| PREDICTED: uncharacterized protein LOC104886930 [Beta vulgaris 
subsp. vulgaris]
Length=375

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +1

Query  232  GFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHA  411
            G QNV + S+  VL+S     MTY S L  +L+  L L  +F S S   V+RD N+VA+ 
Sbjct  292  GLQNVILESNSQVLISRLSKAMTYFSDLDSVLEDILSLSCNFLSVSWSHVKRDGNVVANH  351

Query  412  LAK  420
            LAK
Sbjct  352  LAK  354



>ref|XP_008383144.1| PREDICTED: uncharacterized protein LOC103445866 [Malus domestica]
Length=256

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFR-DVMTYRSYLGIILDSCLQLFN  351
            PLL E MA REAL + + +   +V +  D  ++ ++ + + +   S  G I+ +  Q+ N
Sbjct  157  PLLVEIMAAREALIFSQHQQTTHVEVEGDALMVSTTLQHEGLNDSSPFGHIITNIRQILN  216

Query  352  SFDSCSIKFVRRDANMVAHALAK  420
             F  C + F RR  N V H LA+
Sbjct  217  DFSQCKVTFGRRSTNKVVHRLAR  239



>emb|CDX72015.1| BnaC08g28590D [Brassica napus]
Length=198

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query  178  LLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSF  357
            L+AEAMA++  L     +G+++V   SD   LV    D  +  +  G+  D C+ L  S 
Sbjct  107  LVAEAMALKSGLDMAVTKGYKDVVCLSDSRCLVGLLTDKSSVIALKGLFHDICV-LSYSL  165

Query  358  DSCSIKFVRRDANMVAHALAKHS  426
            +S S KF+ R +NM+A  +AK++
Sbjct  166  NSISFKFIPRASNMIADRIAKNA  188



>gb|KHN37148.1| hypothetical protein glysoja_038768, partial [Glycine soja]
Length=81

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 39/76 (51%), Gaps = 0/76 (0%)
 Frame = +1

Query  193  MAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSI  372
            +A+  A+SW    G QNV   +DC  +V      ++  S   +IL +C +   +  +  +
Sbjct  1    LALYHAISWASGLGLQNVLFETDCKSIVDHLSSPISSFSDFNVILSNCRENLTNIPNSMV  60

Query  373  KFVRRDANMVAHALAK  420
             F+R   N++AH LA+
Sbjct  61   NFIRIQVNLIAHNLAR  76



>gb|AFW65836.1| hypothetical protein ZEAMMB73_825751 [Zea mays]
Length=279

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 58/139 (42%), Gaps = 4/139 (3%)
 Frame = +1

Query  19   PVALEMPLPPGGLYCFTDAAIHGTSPTYGFYAC---NAQGGLEAAANGPLICPNDPLLAE  189
            P+ L+   PP G Y       +      G + C      G   AA  G L   +  L AE
Sbjct  109  PMNLKWQPPPAGFYKINCDGSYLAKSGLGGWGCIIRGHDGSFLAAGAGTLTGISSTLHAE  168

Query  190  AMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCL-QLFNSFDSC  366
            ++A  + L      G QNV I +D A+L ++        S LG++      ++F+ F  C
Sbjct  169  SVACMKGLELAVFLGMQNVMIETDAAILKTALTSQEYDLSALGVVFKEIRSRMFSEFACC  228

Query  367  SIKFVRRDANMVAHALAKH  423
             +   +R  N+VA  L  H
Sbjct  229  IVSKCQRTCNLVADCLTAH  247



>ref|XP_003608212.1| Isoflavone-7-O-methyltransferase [Medicago truncatula]
Length=546

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            +P+LAEA+A R  L   +++G Q+V I SD   +V  FR   +  S   I+LD C  L  
Sbjct  457  EPVLAEALATRWCLHLAKEKGLQDVIIQSDALAVVKCFRGSNSLASIDLIVLD-CKALMK  515

Query  352  SFDSCSIKFVRRDANMV  402
             F S S  +V R+  ++
Sbjct  516  DFSSVSANYVCRNLKLI  532



>ref|XP_003621486.1| Isoflavone-7-O-methyltransferase [Medicago truncatula]
Length=546

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            +P+LAEA+A R  L   +++G Q+V I SD   +V  FR   +  S   I+LD C  L  
Sbjct  457  EPVLAEALATRWCLHLAKEKGLQDVIIQSDALAVVKCFRGSNSLASIDLIVLD-CKALMK  515

Query  352  SFDSCSIKFVRRDANMV  402
             F S S  +V R+  ++
Sbjct  516  DFSSVSANYVCRNLKLI  532



>ref|XP_008243683.1| PREDICTED: uncharacterized protein LOC103341914 [Prunus mume]
Length=196

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 62/133 (47%), Gaps = 13/133 (10%)
 Frame = +1

Query  43   PPGGLYCFT-DAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREAL  213
            PP G Y    DAA    +   G      N +G + AA   PL+    P  AE MA++  +
Sbjct  64   PPAGKYKLNVDAAYIPETCVGGIGGVVRNDKGEVMAAMALPLVTVTSPKYAEIMALQFGM  123

Query  214  SWLRDRGFQNVAIFSDCAVLVSSFR--DVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
             + RD GF ++ I SD   +VS  +  +  ++ S  G+    C QL    D  ++ F   
Sbjct  124  KFARDAGFSSILIESDSQGVVSDLKKDEEESWASVRGV----CEQL----DDVTVSFSPM  175

Query  388  DANMVAHALAKHS  426
              N VA+ LA+H+
Sbjct  176  GCNQVAYRLARHA  188



>ref|XP_010695719.1| PREDICTED: uncharacterized protein LOC104908324 [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 43/85 (51%), Gaps = 0/85 (0%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            + ++AEA+AVR  L    + GF ++ +  D   + S  +      + LG IL     L +
Sbjct  2    EVVMAEALAVRHGLKIAMEAGFTSLVLEMDNLYVYSKLKKARQENTILGSILHDIQVLAS  61

Query  352  SFDSCSIKFVRRDANMVAHALAKHS  426
               S S  FV+R+ N VAH LAK S
Sbjct  62   QCHSNSFSFVKREGNGVAHVLAKLS  86



>ref|XP_010678924.1| PREDICTED: uncharacterized protein LOC104894403 [Beta vulgaris 
subsp. vulgaris]
Length=232

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 57/129 (44%), Gaps = 4/129 (3%)
 Frame = +1

Query  40   LPPGGLYCFTDAAIHGTSPTYGFYAC--NAQGGLEAAANGPLICPNDPLLAEAMAVREAL  213
            LPP G +     A        G  A   +  GG+  AA   +     P +AEA A+   +
Sbjct  86   LPPTGSHKINVDASLAVDGWIGLGAIARDHAGGVLFAATRRVRANWAPEIAEAKALEWGV  145

Query  214  SWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDA  393
               R  G Q++ + SDC  +++       Y S L  IL +   L +SF S     V+RD 
Sbjct  146  RLCRRFGLQDITLESDCQSVINRLSKNDIYLSDLDNILTNI--LVSSFSSLHWSHVKRDG  203

Query  394  NMVAHALAK  420
            N VAH LAK
Sbjct  204  NYVAHHLAK  212



>ref|XP_010688546.1| PREDICTED: uncharacterized protein LOC104902454 [Beta vulgaris 
subsp. vulgaris]
Length=235

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 56/127 (44%), Gaps = 1/127 (1%)
 Frame = +1

Query  43   PPGGLYCFTDAAIHGTS-PTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSW  219
            P G +   TDA I G    +    A N  G +  AA         P +AE  A+  A+  
Sbjct  79   PEGVIKLNTDAHIEGNGWVSVATVARNTCGQVLFAAVRRQRAYWPPDIAECKAILFAVRM  138

Query  220  LRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANM  399
             + RG  NV + SD  V++S       + S L  I+     L   F++ S   V+RD N 
Sbjct  139  AKARGLPNVMVESDALVVISRLSKAALFYSDLDAIMGDVFSLSVCFNAISFNHVKRDGNA  198

Query  400  VAHALAK  420
            VAH LA+
Sbjct  199  VAHHLAR  205



>ref|XP_009113456.1| PREDICTED: uncharacterized protein LOC103838755 [Brassica rapa]
Length=1143

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 56/125 (45%), Gaps = 3/125 (2%)
 Frame = +1

Query  52    GLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLI--CPNDPLLAEAMAVREALSWLR  225
              + C TDA+   TS   G      +     A  G  I    + PL+AEA+A+R +L    
Sbjct  1001  AIICTTDASWDATSKRAGLAWIFRENNGTIAIQGSEIQHSVSSPLMAEALAIRSSLVMAV  1060

Query  226   DRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVA  405
             +    N+ I+SD   L+ +    M  +   GI+ D   Q+ + F S S  F+ R  N  A
Sbjct  1061  EHEIPNLRIYSDSLTLIRAINTKMHDKEIYGILCD-IHQISSVFGSISFSFLPRSKNREA  1119

Query  406   HALAK  420
               LAK
Sbjct  1120  DELAK  1124



>ref|XP_003624705.1| hypothetical protein MTR_7g086560 [Medicago truncatula]
Length=256

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 39/80 (49%), Gaps = 1/80 (1%)
 Frame = +1

Query  181  LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFD  360
            + EA+ +   L WL D  F NV   +D  +   +F            I  SC  LF+SF 
Sbjct  149  VGEALGLHSTLQWLSDMQFDNVDFETDSKLTCDAFHANRDDTYEFWCITSSCRSLFSSFF  208

Query  361  SCS-IKFVRRDANMVAHALA  417
            + S ++FVRR AN V H LA
Sbjct  209  TNSRVEFVRRQANRVVHVLA  228



>ref|XP_003604942.1| Cyclin D3 [Medicago truncatula]
Length=238

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/141 (25%), Positives = 66/141 (47%), Gaps = 4/141 (3%)
 Frame = +1

Query  13   VLPVALEMPLPP-GGLYCFT---DAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPL  180
            +LP++     PP  G Y      ++ I G     G    + +G +  A++  +    D  
Sbjct  80   ILPISDVHWTPPFSGFYKLNVDAESPIEGDKWGIGVVVRDNEGVVVGASSWQVFSSPDSE  139

Query  181  LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFD  360
            +A+ +A+++ L ++ D  F N+   SD + +V +        +Y+G I+  C+ +  SF 
Sbjct  140  VAKDIAMQKGLKFVNDMSFLNLIAESDASNVVLALNARQQPPNYVGSIIRDCISIKGSFR  199

Query  361  SCSIKFVRRDANMVAHALAKH  423
            S     VRR+ N  A+ LA +
Sbjct  200  SLIFLHVRREVNQAAYYLANY  220



>ref|XP_009113626.1| PREDICTED: uncharacterized protein LOC103838926 [Brassica rapa]
Length=278

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 56/123 (46%), Gaps = 3/123 (2%)
 Frame = +1

Query  64   FTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPN--DPLLAEAMAVREALSWLRDRGF  237
            F DAA   +S   G      +        G LI      PL+AE++A+R+ +S     G 
Sbjct  141  FVDAAWKVSSNQAGIAWILTENLSIEPITGSLIITEVASPLMAESLALRQGISEALRLGL  200

Query  238  QNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALA  417
             +++++SDCA L+ +       +   G++ D    L + F S S   V R  N+ A  LA
Sbjct  201  TSISVYSDCATLIRAISSDSQIKEIYGVLQD-IKNLSSHFHSISFLHVDRSQNIAADELA  259

Query  418  KHS  426
            K +
Sbjct  260  KRA  262



>ref|XP_010463404.1| PREDICTED: uncharacterized protein LOC104744076 [Camelina sativa]
Length=751

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 56/133 (42%), Gaps = 1/133 (1%)
 Frame = +1

Query  28   LEMPLPPGGLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVRE  207
            L  P P   L CFTDAA        G+        +    +  +   + PL+AEA+    
Sbjct  613  LNPPNPRPNLICFTDAAWRNDVAGLGWVFKGPNDLVIKEGSASMNHVSSPLMAEALETLT  672

Query  208  ALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRR  387
            A+    +     ++  SD  +LV +    +  +   G + D  L L ++F SCS  F+ R
Sbjct  673  AIRVALESNITELSFASDSLMLVQALNKKIQLKELHGTLHD-VLDLSSNFTSCSFNFISR  731

Query  388  DANMVAHALAKHS  426
              N  A  LAK +
Sbjct  732  SQNQQADCLAKEA  744



>ref|XP_010666976.1| PREDICTED: uncharacterized protein LOC104884079 [Beta vulgaris 
subsp. vulgaris]
Length=1268

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/82 (33%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +1

Query  175   PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
             P +AEA A+   +   +  G  NV I SDC  +++  +    Y S L  +L +   + ++
Sbjct  1157  PEIAEAKAIEMGVRLGKRFGLVNVVIESDCLTVINRLQKTSFYLSDLDNVLSNIFSMSSN  1216

Query  355   FDSCSIKFVRRDANMVAHALAK  420
             F S     V+RD N V+H LAK
Sbjct  1217  FHSLGWSHVKRDGNFVSHHLAK  1238



>emb|CDX95987.1| BnaA07g27440D [Brassica napus]
Length=286

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 57/124 (46%), Gaps = 5/124 (4%)
 Frame = +1

Query  64   FTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPN--DPLLAEAMAVREALSWLRDRGF  237
            FTDAA   +    G          ++  +G     N    L  EA+A+R ALS     G+
Sbjct  157  FTDAAWRASDGATGCGWIFKDSTRQSTQHGSKCFDNTASALTGEALAIRLALSHALSLGY  216

Query  238  QNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS-FDSCSIKFVRRDANMVAHAL  414
              V +FSDC VLV +     +     G++ D  ++L +S FD C++ F+ R  N  A  L
Sbjct  217  TRVCVFSDCQVLVRAICSKSSPVELYGLVCD--IELLSSLFDFCTLSFISRSLNSEADLL  274

Query  415  AKHS  426
             K +
Sbjct  275  VKSA  278



>gb|EMT22207.1| Protein SRG1 [Aegilops tauschii]
Length=345

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 47/85 (55%), Gaps = 10/85 (12%)
 Frame = +1

Query  130  GLEAAANGPLICPN--------DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSF  285
            GL+A  +G +I  N        DP   EA+A REALS  +D G Q++ I SDC  +V+  
Sbjct  159  GLKAHTDGSIITVNFADALGISDPASLEALACREALSLAQDLGLQHLQIASDCKHVVNHI  218

Query  286  RDVM--TYRSYLGIILDSCLQLFNS  354
            R  +  +Y S +  IL++ LQL  +
Sbjct  219  RQGVGGSYGSVIREILETGLQLLKN  243



>ref|XP_009135908.1| PREDICTED: uncharacterized protein LOC103860050 [Brassica rapa]
Length=1207

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 43/132 (33%), Positives = 58/132 (44%), Gaps = 9/132 (7%)
 Frame = +1

Query  40    LPPGGLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICP-----NDPLLAEAMAVR  204
             +P G + C TDAA    S T G             ++G   C      +  L+AE +A+R
Sbjct  1069  IPVGTVTCNTDAAWKKESLTAGLAWIFDSASSLTRSDG---CQYQTWVSSALMAEGLAIR  1125

Query  205   EALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVR  384
             EALS  +  G   + I SD   L+ +   V    +  GI+ D    L +SF  C   FV 
Sbjct  1126  EALSHAQHLGITKIWIRSDSLSLIRAINSVTKPVNLYGILSD-IESLSSSFVFCCFSFVS  1184

Query  385   RDANMVAHALAK  420
             RD N  A  LAK
Sbjct  1185  RDLNGQADNLAK  1196



>ref|XP_003615631.1| hypothetical protein MTR_5g070290 [Medicago truncatula]
Length=307

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 44/84 (52%), Gaps = 7/84 (8%)
 Frame = +1

Query  181  LAEAMAVREALSWLRDRGFQNVAIFSDCAV----LVSSFRDVMTYRSYLGIILDSCLQLF  348
            + EA+ +  AL W+ D  F N+    D       L S + D+  + +   II+ S   L 
Sbjct  207  IGEALDLYHALQWVSDMHFDNIDFEVDSKTTKNGLYSGWEDITEFGN---IIIASRSLLL  263

Query  349  NSFDSCSIKFVRRDANMVAHALAK  420
            + F +  ++FVRR AN+VAH LAK
Sbjct  264  SKFTNSRVEFVRRQANVVAHTLAK  287



>ref|XP_010682807.1| PREDICTED: uncharacterized protein LOC104897588 [Beta vulgaris 
subsp. vulgaris]
Length=389

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 55/119 (46%), Gaps = 2/119 (2%)
 Frame = +1

Query  67   TDA-AIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQN  243
            TDA  + G     G    +A G L+  A   ++  + P +AEA+AVR  L   R  GF  
Sbjct  244  TDAHVVEGVMAALGVAVRDAAGRLKVTATNRIVATS-PAMAEALAVRFGLLIARRFGFCK  302

Query  244  VAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAK  420
            + + SD    ++  + V    S L ++ D      N F SC    V+R  N VAH +A+
Sbjct  303  IELESDALAAINGVKCVAKGSSPLYLVFDDIRHDSNLFYSCVFSHVKRGCNTVAHMVAR  361



>emb|CDX95988.1| BnaA07g27430D [Brassica napus]
Length=550

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 45/84 (54%), Gaps = 3/84 (4%)
 Frame = +1

Query  178  LLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS-  354
            L  EA+A+R ALS     G+  V +FSDC VLV +     +     G++ D  ++L +S 
Sbjct  461  LTGEALAIRLALSHALSLGYTRVCVFSDCQVLVRAICSKSSPVELYGLVCD--IELLSSL  518

Query  355  FDSCSIKFVRRDANMVAHALAKHS  426
            FD C++ F+ R  N  A  L K +
Sbjct  519  FDYCTLSFISRSLNSEADLLVKSA  542



>ref|XP_009105597.1| PREDICTED: uncharacterized protein LOC103831468 [Brassica rapa]
Length=773

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query  169  NDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLF  348
            + PL+AEA+AVR+AL+  R  G   +   +D   LV +           GI+ D+ L L 
Sbjct  674  SSPLVAEALAVRDALAHCRALGILRLRCQTDSQQLVKALATKDPNPEIYGIVSDT-LILA  732

Query  349  NSFDSCSIKFVRRDANMVAHALAKHS  426
            +SFDS S +++ R  N VA ALAK +
Sbjct  733  SSFDSISFEWLPRAQNNVADALAKQA  758



>emb|CCA66044.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +1

Query  181   LAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFD  360
             +AEA A+  AL   R  GF  + + SDC V+V+       Y + L IIL +      +F 
Sbjct  1246  IAEAKAIEMALRLGRRYGFAAIIVESDCQVVVNRLSKQALYLADLDIILHNIFSSCINFP  1305

Query  361   SCSIKFVRRDANMVAHALAK  420
             S     V+RDAN VAH LAK
Sbjct  1306  SVLWSHVKRDANSVAHHLAK  1325



>ref|XP_010480547.1| PREDICTED: uncharacterized protein LOC104759300 [Camelina sativa]
Length=135

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 54/124 (44%), Gaps = 3/124 (2%)
 Frame = +1

Query  55   LYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPN--DPLLAEAMAVREALSWLRD  228
            + C TDAA +    T G             A G  + P+   P+ AEA+A+  A+   R+
Sbjct  2    ITCHTDAAWNSEQHTAGLGWIFTSADDSFTAQGSTLAPHTRSPVTAEALAILHAIQAARN  61

Query  229  RGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAH  408
             GF N+ I SD   ++ +       +   G+  D  L L ++F      FV R  N  A 
Sbjct  62   LGFSNLHIASDAKQVIEAINSGSLPKELHGMHHD-ILSLSSNFQKLVFSFVPRTCNREAD  120

Query  409  ALAK  420
            A+AK
Sbjct  121  AIAK  124



>ref|XP_003599243.1| hypothetical protein MTR_3g030670 [Medicago truncatula]
Length=127

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +1

Query  178  LLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS-  354
            +L  A+A+  A+ W+ +    NV    D   +   F +     +  G I+D+ +Q  N+ 
Sbjct  19   MLGRALALYHAIRWIHELQLSNVDFEVDSKRVADYFNNGHGDVTEFGSIMDNSVQFCNTN  78

Query  355  FDSCSIKFVRRDANMVAHALAK  420
              +  ++F+RR AN VAHALAK
Sbjct  79   LTNSHVEFIRRQANEVAHALAK  100



>ref|XP_010673155.1| PREDICTED: uncharacterized protein LOC104889595 [Beta vulgaris 
subsp. vulgaris]
Length=708

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 40/93 (43%), Gaps = 0/93 (0%)
 Frame = +1

Query  145  ANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGII  324
              G  I     L AEA A  EAL W +  G +++ +++DC +LV   R   T    +   
Sbjct  605  GQGSCIIAPSALSAEAKACLEALIWAQGHGLRHIMVYTDCELLVQGLRHQGTQPISIAWT  664

Query  325  LDSCLQLFNSFDSCSIKFVRRDANMVAHALAKH  423
            LD    +   F  C I  V R     AH LA H
Sbjct  665  LDDIRSIGQQFQWCRITKVSRLLVQQAHDLATH  697



>ref|XP_003630976.1| hypothetical protein MTR_8g105730 [Medicago truncatula]
Length=306

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 47/90 (52%), Gaps = 3/90 (3%)
 Frame = +1

Query  160  ICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCL  339
            +C +D  + EA+ +   + W+R+    NV    D   +V  F       S  G ++D C 
Sbjct  209  VCSSD--VGEALGLYHDIQWVRELQLSNVDFEMDAKKVVDYFNKGRNDISEFGAVMDECR  266

Query  340  Q-LFNSFDSCSIKFVRRDANMVAHALAKHS  426
            +   + F++  ++F RR +N+VAHALA+ +
Sbjct  267  KNSIDYFENSKVEFSRRQSNVVAHALAQEA  296



>gb|AFK38936.1| unknown [Medicago truncatula]
Length=297

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 52/114 (46%), Gaps = 4/114 (4%)
 Frame = +1

Query  82   HGTSPTYGFYACNAQGG-LEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFS  258
            HG   T+G    N +   L AA   P I   DPLL E + +R  +  + +    NV    
Sbjct  159  HGKV-TWGLVIRNHESEVLFAATQSPDIMA-DPLLVETLGLRWGIQTVLELQLSNVMFEL  216

Query  259  DCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAK  420
            D +V+V  F  + T  S    I D C  LF S    S+ FV R  N+ AH LA+
Sbjct  217  DASVVVKCFNGLSTIASISPFISD-CHDLFGSLVGSSVSFVNRSCNVAAHELAQ  269



>ref|XP_010474119.1| PREDICTED: uncharacterized protein LOC104753583 [Camelina sativa]
Length=1162

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 59/135 (44%), Gaps = 1/135 (1%)
 Frame = +1

Query  22    VALEMPLPPGGLYCFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAV  201
             V ++ P P   L C+TD +        G+   +    L+   +  +     PL+AEA+A 
Sbjct  1022  VGIQPPHPRTNLTCYTDTSWIDGKAGLGWIIKDQSDQLKGEGSTQIDHVGSPLMAEALAT  1081

Query  202   REALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFV  381
               A+    +    +++  SD  +LV +    +  +   G + D  L L + F+ CS  F+
Sbjct  1082  LTAVGVAIESNITHISFASDSLLLVQALNQKLQLKELHGTLHD-VLTLSSRFEFCSFNFI  1140

Query  382   RRDANMVAHALAKHS  426
              R  N  A  LAK +
Sbjct  1141  PRSKNRQADLLAKEA  1155



>ref|XP_010666728.1| PREDICTED: uncharacterized protein LOC104883861 [Beta vulgaris 
subsp. vulgaris]
Length=181

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            P +AEA A+   + W++ +GF+++ I SD   L+S       Y S L  IL   + + +S
Sbjct  70   PDVAEAKAIHLDVGWVKKQGFKDLVIESDAQDLISRLSRASIYFSDLDAILGDIIFIRSS  129

Query  355  FDSCSIKFVRRDANMVAHALAK  420
            F S S   VRR  N VAH LAK
Sbjct  130  FRSFSFSHVRRGGNFVAHHLAK  151



>ref|XP_009334567.1| PREDICTED: uncharacterized protein LOC103927376 [Pyrus x bretschneideri]
Length=541

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/104 (31%), Positives = 50/104 (48%), Gaps = 1/104 (1%)
 Frame = +1

Query  118  NAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRD-V  294
            N  G   AA    L     P+LAE  A REA  +      + V +  D  +++++ ++ +
Sbjct  410  NTAGDFIAATALKLTGIASPMLAEITAAREAALFAHQWQTEQVILEGDALLVIAAIQNNL  469

Query  295  MTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAKHS  426
                   G ++D   Q+  SF     KFVRRDAN +A+ LA+ S
Sbjct  470  AANHGPFGHLIDGTRQILQSFQLWKAKFVRRDANTMANRLARFS  513



>gb|EEE52627.1| hypothetical protein OsJ_34967 [Oryza sativa Japonica Group]
Length=1395

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 64/141 (45%), Gaps = 3/141 (2%)
 Frame = +1

Query  10   TVLPVALEMPLPPGGLYCFTDAAIH--GTSPTYGFYACNAQGGLEAAANGPLICPNDPLL  183
            +VL    + P P G +    DA     G   T G    +  GG+ AAA+  +    D  +
Sbjct  691  SVLRQGWKKP-PEGKVMVNVDAGFDEMGGCGTVGSVIRDCSGGVLAAAHSFVPHLVDAPM  749

Query  184  AEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDS  363
            AEA A++E L   +  G   + I SDC  +V    D     +    I + C  L++ F  
Sbjct  750  AEAFALKEGLMLAQQIGCNRLIIQSDCMEVVQIMTDGGFTANSAAAIYEDCNILWSGFAD  809

Query  364  CSIKFVRRDANMVAHALAKHS  426
             +I+   R+AN VAH LA+ +
Sbjct  810  ITIEHCSREANQVAHNLARRA  830



>gb|KHN00089.1| hypothetical protein glysoja_046125, partial [Glycine soja]
Length=147

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  187  EAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSC  366
            +A+A+  AL WL+D    ++ I SDC  + +   +  + +S  G+IL +C  +     + 
Sbjct  55   KALAMLVALQWLKDLEIDDIIIESDCLQVENEVYNCRSDKSKYGVILSNCRIMLRDLQNF  114

Query  367  SIKFVRRDANMVAHALAK  420
             + FV R AN V H+L +
Sbjct  115  WVCFVGRQANSVTHSLDR  132



>ref|XP_008391838.1| PREDICTED: uncharacterized protein LOC103454030 [Malus domestica]
Length=1374

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 4/121 (3%)
 Frame = +1

Query  67    TDAAIHGTS--PTYGFYACNAQGGLE-AAANGPLICPNDPLLAEAMAVREALSWLRDRGF  237
             TDAA  G+S     G+   +  G L+ A  +G  IC +     EA A+R AL    D GF
Sbjct  1162  TDAAWCGSSLRTGVGWVGRDFAGLLQFAGGSGTGIC-HSAAAVEACAIRSALMACIDNGF  1220

Query  238   QNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALA  417
               V I SD  V++     V  +   +  IL     L     S +  FV R++N+ AH++A
Sbjct  1221  DKVIIDSDALVIIKMLSKVSPHDYSIECILGDIEVLVQRLMSVTFSFVPRESNLAAHSVA  1280

Query  418   K  420
             K
Sbjct  1281  K  1281



>ref|XP_010680467.1| PREDICTED: uncharacterized protein LOC104895604 [Beta vulgaris 
subsp. vulgaris]
Length=349

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 57/128 (45%), Gaps = 2/128 (2%)
 Frame = +1

Query  43   PPGGLYCF-TDAAIHGTSPT-YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALS  216
            PP G+    TDA++        G  A +++G +  AA   +     P +AE  A+  A  
Sbjct  177  PPAGVIKLNTDASLADEGWVGLGVVARDSEGKVCFAATKRVRAFWPPEVAECKAIYMATR  236

Query  217  WLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDAN  396
              +  G+ +V   SD  V          + S L  IL   L + N+F S S   VRRD N
Sbjct  237  LAKAHGYGDVIFESDSLVATKRLTKAAIFFSDLDAILGDILSMCNAFSSVSFSHVRRDGN  296

Query  397  MVAHALAK  420
             VAH LA+
Sbjct  297  SVAHNLAR  304



>ref|XP_010682232.1| PREDICTED: uncharacterized protein LOC104897109 [Beta vulgaris 
subsp. vulgaris]
Length=332

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 58/129 (45%), Gaps = 1/129 (1%)
 Frame = +1

Query  37   PLPPGGLYCFTDAAI-HGTSPTYGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREAL  213
            P P   +    DA + HG   + G    +  G ++AA    +     P LAEA A R  L
Sbjct  176  PPPQSYVKVNVDAHVMHGNGVSMGMIIRDEHGSIKAAGVKRIASNWAPELAEAGAARFGL  235

Query  214  SWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDA  393
               R  GF  V +  D + +V   R+     + + +  D  L++ +SF S     V+R  
Sbjct  236  DVARRLGFDRVVLECDASNVVRCIRERRQGAAPIFLFYDDILEISSSFLSFDCVHVKRAG  295

Query  394  NMVAHALAK  420
            N VAH++A+
Sbjct  296  NTVAHSVAR  304



>emb|CDY23830.1| BnaC04g02070D [Brassica napus]
Length=172

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 49/89 (55%), Gaps = 7/89 (8%)
 Frame = +1

Query  169  NDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILD---SCL  339
            + PL+AE +A+REA+   ++ G +++ + SD A L+ + R  +      GII D   +CL
Sbjct  81   SSPLIAEGLAMREAVKKCKELGLRHIRLESDSAQLIKALRSKLEPPEIYGIISDIRINCL  140

Query  340  QLFNSFDSCSIKFVRRDANMVAHALAKHS  426
                +F++    ++ R  N VA  LAK +
Sbjct  141  ----AFETVYFAWIPRAKNSVADGLAKQA  165



>ref|XP_004309432.1| PREDICTED: uncharacterized protein LOC101293741 [Fragaria vesca 
subsp. vesca]
Length=108

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +1

Query  193  MAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSI  372
            +A+ E +S     G   + + +DC VLV + +  +   S LG ++D   +   +  + ++
Sbjct  2    LALIEGVSLAVQHGLVPLKVETDCQVLVDALQTRILRDSNLGFLMDDLREGLRTASAANL  61

Query  373  KFVRRDANMVAHALAK  420
             FVRR AN VAH+LA+
Sbjct  62   SFVRRSANRVAHSLAQ  77



>ref|XP_009102787.1| PREDICTED: uncharacterized protein LOC103828902 [Brassica rapa]
Length=938

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 56/124 (45%), Gaps = 3/124 (2%)
 Frame = +1

Query  61   CFTDAAIHGTSPTYGFYACNAQGGLEAAANGPLICPN--DPLLAEAMAVREALSWLRDRG  234
            CF DAA   T+   G      +     A +G  I  N   PL+AE++A+R  +  L   G
Sbjct  805  CFVDAAWDSTAKRAGSAWILNKHLPHHARSGSQIFDNVNSPLMAESLALRNGIEELIKAG  864

Query  235  FQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHAL  414
             Q   +FSDC  L+ +  +    +   G++ D   +L + F S   +F+ R  N     L
Sbjct  865  VQTTTVFSDCQTLIRAIVNKSQIKEVYGVLHD-IDRLSSLFVSIGFQFIPRSQNRETDFL  923

Query  415  AKHS  426
            AK +
Sbjct  924  AKQA  927



>ref|XP_009106481.1| PREDICTED: uncharacterized protein LOC103832258 [Brassica rapa]
Length=145

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 66/141 (47%), Gaps = 7/141 (5%)
 Frame = +1

Query  16   LPVALEMPLPPGGLYC--FTDAAIHGTSPT--YGFYACNAQGGLEAAANGPLICPNDPLL  183
            +PV    P P     C  FTDAA + T+     G+   +     + +A    +  + PL+
Sbjct  1    MPVIRIEPNPRRLDLCSIFTDAAWNSTTGNAGLGWIVDDLVSSSQHSATETFV--SSPLM  58

Query  184  AEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDS  363
            AE +AVR A+++    G +++AIFSD   L+ +           G + D  L + +SF +
Sbjct  59   AETLAVRSAITFALSIGLESIAIFSDSQNLIKTLSRKERNLEIFGALNDIYL-ISSSFKT  117

Query  364  CSIKFVRRDANMVAHALAKHS  426
             S  F+ R  N+ A   AK +
Sbjct  118  ISFTFISRTLNVRADHCAKQA  138



>emb|CDY65917.1| BnaC07g48670D [Brassica napus]
Length=143

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 47/107 (44%), Gaps = 1/107 (1%)
 Frame = +1

Query  100  YGFYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVS  279
            +G++  + Q  LE             L AEA+A+REAL    + G   + I SD  VL+S
Sbjct  26   FGWFIQDKQTKLEIKGAASRCHVASALTAEALALREALQVASNAGLTRLKIMSDSRVLLS  85

Query  280  SFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALAK  420
            + R         G +L     L + F + S   + R  N +A  LAK
Sbjct  86   ALRSGTVLNEIAG-LLHEISHLISLFSTLSFVVISRSVNAIADGLAK  131



>gb|EEC68711.1| hypothetical protein OsI_37193 [Oryza sativa Indica Group]
Length=1546

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 64/141 (45%), Gaps = 3/141 (2%)
 Frame = +1

Query  10   TVLPVALEMPLPPGGLYCFTDAAIH--GTSPTYGFYACNAQGGLEAAANGPLICPNDPLL  183
            +VL    + P P G +    DA     G   T G    +  GG+ AAA+  +    D  +
Sbjct  842  SVLRQGWKKP-PEGKVMVNVDAGFDEMGGCGTVGSVIRDCSGGVLAAAHSFVPHLVDAPM  900

Query  184  AEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDS  363
            AEA A++E L   +  G   + I SDC  +V    D     +    I + C  L++ F  
Sbjct  901  AEAFALKEGLMLAQQIGCNRLIIQSDCMEVVQIMTDGGFTANSAAAIYEDCNILWSGFAD  960

Query  364  CSIKFVRRDANMVAHALAKHS  426
             +I+   R+AN VAH LA+ +
Sbjct  961  ITIEHCSREANQVAHNLARRA  981



>ref|XP_010675428.1| PREDICTED: uncharacterized protein LOC104891430 [Beta vulgaris 
subsp. vulgaris]
Length=315

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 65/143 (45%), Gaps = 4/143 (3%)
 Frame = +1

Query  1    QHATVLPVALEMPL-PPGG--LYCFTDAAIHGT-SPTYGFYACNAQGGLEAAANGPLICP  168
            + AT++   +E    PPGG  +   TDAA+    S   G    N+ G +  A    ++  
Sbjct  144  KEATLVAANVEEKWKPPGGSSIKFNTDAAVFADGSIGCGGVMRNSDGDVLGAMCESVVGS  203

Query  169  NDPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLF  348
             D  +AEA A R AL    D G  N+ + SD + LVS  +      S  G ++   L L 
Sbjct  204  FDIDVAEAYAARSALRCALDMGRDNIILESDSSKLVSHLQRAHIENSGFGGVVADILHLS  263

Query  349  NSFDSCSIKFVRRDANMVAHALA  417
            +     S K V+R  N VAH LA
Sbjct  264  SRCIFFSCKHVKRGGNRVAHKLA  286



>ref|XP_010687523.1| PREDICTED: uncharacterized protein LOC104901631 [Beta vulgaris 
subsp. vulgaris]
Length=333

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (52%), Gaps = 2/93 (2%)
 Frame = +1

Query  145  ANGPLICPN--DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLG  318
            A G   C +  +P +AEA A+   +   ++ G++ V + SD  + + + ++  T  S   
Sbjct  212  AAGSFQCHDTWEPRVAEAKAIYFGIKLAKELGYRLVEVESDSLLAIQALKNGRTGCSEFH  271

Query  319  IILDSCLQLFNSFDSCSIKFVRRDANMVAHALA  417
            +I+D  L     FD+ S  FV+R  N VAH LA
Sbjct  272  LIIDDILAFVGCFDNVSWSFVKRSGNRVAHLLA  304



>ref|XP_003621044.1| hypothetical protein MTR_7g006490 [Medicago truncatula]
Length=263

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 51/122 (42%), Gaps = 3/122 (2%)
 Frame = +1

Query  61   CFTDAAIHGTSPTYGFYAC-NAQGGLEAAANGPLICPN-DPLLAEAMAVREALSWLRDRG  234
            CF DA+        G   C +   G    A      P  D  + E + +   L W     
Sbjct  123  CFIDASFSSAMNKVGIGMCFHDDAGDFVLAKKSWFSPLCDVNIGEVVGLHTILKWTSHLQ  182

Query  235  FQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS-FDSCSIKFVRRDANMVAHA  411
            F NV +  D   +V +FR  +   S  G I+  C QLF S F +  ++F RR AN + + 
Sbjct  183  FDNVDLALDSKKVVDAFRRCVGDSSEFGCIIVECRQLFQSRFQNSHVEFNRRQANGITYE  242

Query  412  LA  417
            LA
Sbjct  243  LA  244



>ref|XP_009119921.1| PREDICTED: uncharacterized protein LOC103844846 [Brassica rapa]
Length=188

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 54/121 (45%), Gaps = 3/121 (2%)
 Frame = +1

Query  64   FTDAAIHGTSPTYG--FYACNAQGGLEAAANGPLICPNDPLLAEAMAVREALSWLRDRGF  237
            FTDAA      T G  +   N Q           +C   PL+AEA+AVREAL   R    
Sbjct  61   FTDAAWKAQDRTAGCGWIIHNPQERETTHGTSTELCVASPLMAEALAVREALLHARSLHL  120

Query  238  QNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNSFDSCSIKFVRRDANMVAHALA  417
             N+ + SD  VLV +           GI LD    L +SF S S  ++ R  N  A ALA
Sbjct  121  SNICLKSDNQVLVKALTSKQHPVELYGINLD-IENLSSSFSSVSFSYISRTLNSAAGALA  179

Query  418  K  420
            K
Sbjct  180  K  180



>ref|XP_010468814.1| PREDICTED: uncharacterized protein LOC104748940 [Camelina sativa]
Length=714

 Score = 47.8 bits (112),  Expect = 0.001, Method: Composition-based stats.
 Identities = 40/144 (28%), Positives = 65/144 (45%), Gaps = 9/144 (6%)
 Frame = +1

Query  19   PVALEMPLPPGG-------LYCFTDAA-IHGTSPTYGFYACNAQGGLEAAANGPLICPND  174
            P+  ++PLPP         + CFTDA+ I       G+   + Q           +  + 
Sbjct  564  PLNPKIPLPPNRPQASEEVITCFTDASWIAEPKAGLGWVFKDYQDRTLKQGADLALNVSS  623

Query  175  PLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFNS  354
            PLLAEA+A   A+      G+ ++++ SD   LV +    +  +   GI+ D  L L  +
Sbjct  624  PLLAEAIATLTAVEVAIASGYTHLSVASDSQRLVKALNLKIHSKELHGILHD-ILDLSRN  682

Query  355  FDSCSIKFVRRDANMVAHALAKHS  426
               CS  F+ R+ N +  ALAK +
Sbjct  683  LSVCSFHFIPRNQNQIVDALAKRA  706



>gb|ABN08693.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=131

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +1

Query  172  DPLLAEAMAVREALSWLRDRGFQNVAIFSDCAVLVSSFRDVMTYRSYLGIILDSCLQLFN  351
            D  + E + +   L W     F NV +  D   +V +FR  +   S  G I+  C QLF 
Sbjct  30   DVNIGEVVGLHTILKWTSHLQFDNVDLALDSKKVVDAFRRCVGDSSEFGCIIVECRQLFQ  89

Query  352  S-FDSCSIKFVRRDANMVAHALA  417
            S F +  ++F RR AN + + LA
Sbjct  90   SRFQNSHVEFNRRQANGITYELA  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509248079690