BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4351_g2_i1 len=480 path=[301:0-479]

Length=480
                                                                      Score     E

gb|AFK31317.1|  acidic class III chitinase                              146   1e-39   
ref|XP_008809712.1|  PREDICTED: acidic endochitinase-like               145   5e-39   
gb|ABA26457.1|  acidic class III chitinase                              144   1e-38   Citrullus lanatus [wild melon]
ref|XP_003592154.1|  Chitinase                                          142   3e-38   
ref|XP_008809724.1|  PREDICTED: acidic endochitinase-like               143   3e-38   
gb|KDO37563.1|  hypothetical protein CISIN_1g044801mg                   140   6e-38   
ref|XP_007219529.1|  hypothetical protein PRUPE_ppa022614mg             139   6e-38   
ref|XP_008232959.1|  PREDICTED: hevamine-A-like                         139   7e-38   
ref|XP_004240090.1|  PREDICTED: acidic endochitinase                    142   7e-38   
sp|P29060.1|CHIA_TOBAC  RecName: Full=Acidic endochitinase; Flags...    138   9e-38   Nicotiana tabacum [American tobacco]
emb|CAB43737.2|  chitinase                                              139   1e-37   Trifolium repens [creeping white clover]
gb|AAL01886.1|AF404590_1  chitinase 3-like protein precursor            140   1e-37   Trichosanthes kirilowii [gua lou]
ref|XP_009616180.1|  PREDICTED: acidic endochitinase                    138   1e-37   
ref|XP_006832883.1|  hypothetical protein AMTR_s00095p00104690          141   2e-37   
ref|XP_008232971.1|  PREDICTED: LOW QUALITY PROTEIN: hevamine-A-like    138   2e-37   
ref|XP_008380389.1|  PREDICTED: acidic endochitinase-like               140   2e-37   
ref|XP_006421660.1|  hypothetical protein CICLE_v10005491mg             141   2e-37   
ref|XP_008380421.1|  PREDICTED: acidic endochitinase-like               141   2e-37   
ref|XP_008234803.1|  PREDICTED: acidic endochitinase-like               140   3e-37   
ref|XP_009375613.1|  PREDICTED: uncharacterized protein LOC103964407    138   4e-37   
gb|KCW71548.1|  hypothetical protein EUGRSUZ_E00090                     140   4e-37   
ref|XP_006645058.1|  PREDICTED: hevamine-A-like                         138   4e-37   
ref|XP_010924796.1|  PREDICTED: acidic endochitinase-like               140   4e-37   
ref|XP_004955980.1|  PREDICTED: acidic endochitinase-like               140   4e-37   
ref|XP_004306720.1|  PREDICTED: acidic endochitinase-like               139   4e-37   
ref|XP_010910507.1|  PREDICTED: acidic endochitinase-like               136   5e-37   
ref|XP_002279205.1|  PREDICTED: acidic endochitinase-like               139   5e-37   Vitis vinifera
ref|XP_002456672.1|  hypothetical protein SORBIDRAFT_03g040600          137   5e-37   Sorghum bicolor [broomcorn]
dbj|BAC65326.1|  chitinase III                                          137   6e-37   Vitis vinifera
ref|XP_008813710.1|  PREDICTED: hevamine-A-like                         135   7e-37   
emb|CBI22574.3|  unnamed protein product                                137   8e-37   
ref|XP_006837296.1|  hypothetical protein AMTR_s00111p00033060          139   8e-37   
ref|XP_006345574.1|  PREDICTED: acidic endochitinase-like               138   9e-37   
ref|XP_008791482.1|  PREDICTED: hevamine-A-like                         139   9e-37   
ref|XP_004970661.1|  PREDICTED: hevamine-A-like                         134   9e-37   
ref|XP_010915157.1|  PREDICTED: acidic endochitinase-like               137   1e-36   
ref|XP_006847601.1|  hypothetical protein AMTR_s00014p00238430          139   1e-36   
ref|XP_009375569.1|  PREDICTED: acidic endochitinase SE2-like           139   1e-36   
gb|AAS79333.1|  endochitinase class III PR3                             136   1e-36   Malus domestica [apple tree]
ref|XP_010055072.1|  PREDICTED: chitinase 1-like                        140   1e-36   
ref|XP_008347023.1|  PREDICTED: hevamine-A-like                         139   1e-36   
ref|XP_007051676.1|  Hevamine-A precursor                               138   1e-36   
ref|XP_008780850.1|  PREDICTED: acidic endochitinase-like               135   1e-36   
ref|XP_006832973.1|  hypothetical protein AMTR_s00095p00172710          139   2e-36   
dbj|BAA08708.1|  chitinase                                              135   2e-36   Psophocarpus tetragonolobus [asparagus bean]
ref|XP_007219784.1|  hypothetical protein PRUPE_ppa024550mg             138   2e-36   
ref|XP_009352075.1|  PREDICTED: acidic endochitinase-like               138   2e-36   
ref|XP_009352115.1|  PREDICTED: acidic endochitinase SE2-like           138   2e-36   
ref|NP_001268048.1|  acidic endochitinase precursor                     136   2e-36   
gb|ACH54087.1|  class III chitinase                                     135   2e-36   Vitis vinifera
ref|XP_010911581.1|  PREDICTED: hevamine-A-like                         138   2e-36   
ref|XP_007219586.1|  hypothetical protein PRUPE_ppa023419mg             134   2e-36   
ref|XP_010251576.1|  PREDICTED: acidic endochitinase-like               138   2e-36   
emb|CBI40448.3|  unnamed protein product                                137   2e-36   
ref|XP_009368700.1|  PREDICTED: hevamine-A-like                         137   2e-36   
emb|CDP10880.1|  unnamed protein product                                137   2e-36   
ref|XP_006490121.1|  PREDICTED: acidic endochitinase-like               138   2e-36   
gb|ABN03967.1|  acidic chitinase                                        135   2e-36   Gossypium hirsutum [American cotton]
gb|ACM45715.1|  class III chitinase                                     138   2e-36   Pyrus pyrifolia [sha li]
ref|XP_008376664.1|  PREDICTED: hevamine-A-like                         137   2e-36   
gb|AAG25709.1|AF309514_1  class III acidic chitinase                    137   2e-36   Malus domestica [apple tree]
ref|XP_009341134.1|  PREDICTED: hevamine-A-like                         137   2e-36   
emb|CDP09309.1|  unnamed protein product                                137   2e-36   
ref|XP_009345618.1|  PREDICTED: hevamine-A-like                         137   3e-36   
ref|XP_002530928.1|  hevamine-A precursor, putative                     137   3e-36   Ricinus communis
ref|XP_011084476.1|  PREDICTED: acidic endochitinase SE2-like           137   3e-36   
ref|XP_007218751.1|  hypothetical protein PRUPE_ppa009328mg             138   3e-36   
dbj|BAA22266.1|  basic class III chitinase OsChib3b                     135   3e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008343773.1|  PREDICTED: acidic endochitinase-like               138   3e-36   
ref|XP_002279182.1|  PREDICTED: acidic endochitinase                    136   3e-36   Vitis vinifera
ref|XP_011001947.1|  PREDICTED: acidic endochitinase-like               137   3e-36   
gb|AFM77009.1|  pathogenesis related protein 3                          136   3e-36   
ref|XP_002301383.1|  chitinase family protein                           135   4e-36   Populus trichocarpa [western balsam poplar]
gb|AFM77006.1|  pathogenesis related protein 3                          137   4e-36   
ref|XP_009375572.1|  PREDICTED: acidic endochitinase SE2-like           138   4e-36   
ref|XP_010277995.1|  PREDICTED: acidic endochitinase-like               137   4e-36   
ref|NP_001044872.1|  Os01g0860500                                       135   4e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008380409.1|  PREDICTED: acidic endochitinase-like               137   4e-36   
ref|XP_010934768.1|  PREDICTED: acidic endochitinase-like               137   4e-36   
gb|AAQ07267.1|  acidic chitinase                                        132   4e-36   Ficus pumila var. awkeotsang [jelly fig]
gb|KHN02009.1|  Acidic endochitinase SE2                                137   5e-36   
ref|XP_008347250.1|  PREDICTED: acidic endochitinase-like               137   5e-36   
ref|XP_003518754.1|  PREDICTED: hevamine-A-like                         137   5e-36   
gb|AAF64474.1|AF241266_1  chitinase 1                                   133   5e-36   Cucumis melo [Oriental melon]
ref|XP_008437557.1|  PREDICTED: acidic endochitinase                    133   5e-36   
gb|AAC37394.1|  ORF 1                                                   133   6e-36   Cucumis sativus [cucumbers]
ref|XP_011023258.1|  PREDICTED: hevamine-A-like                         134   6e-36   
emb|CDP10876.1|  unnamed protein product                                137   6e-36   
ref|XP_002511934.1|  hevamine-A precursor, putative                     136   6e-36   Ricinus communis
ref|XP_004145978.1|  PREDICTED: acidic endochitinase-like               133   6e-36   
gb|AFM77008.1|  pathogenesis related protein 3                          135   6e-36   
gb|EAZ14223.1|  hypothetical protein OsJ_04148                          134   6e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007133288.1|  hypothetical protein PHAVU_011G167300g             137   7e-36   
ref|XP_002264903.1|  PREDICTED: acidic endochitinase-like               134   7e-36   Vitis vinifera
gb|EMT30610.1|  Acidic endochitinase                                    135   8e-36   
gb|KCW71549.1|  hypothetical protein EUGRSUZ_E00091                     134   8e-36   
gb|EAY76569.1|  hypothetical protein OsI_04515                          134   8e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_004303559.1|  PREDICTED: hevamine-A-like                         135   8e-36   
ref|XP_007021467.1|  Hevamine-A precursor                               136   8e-36   
ref|XP_006376616.1|  hypothetical protein POPTR_0012s01160g             136   9e-36   
emb|CBI22573.3|  unnamed protein product                                134   9e-36   
ref|XP_006387203.1|  chitinase family protein                           136   9e-36   
ref|XP_011024687.1|  PREDICTED: hevamine-A-like                         136   1e-35   
ref|XP_009603970.1|  PREDICTED: acidic endochitinase-like               135   1e-35   
ref|XP_008376668.1|  PREDICTED: hevamine-A-like                         134   1e-35   
gb|EMT30611.1|  Acidic endochitinase                                    135   1e-35   
ref|XP_009368701.1|  PREDICTED: hevamine-A-like                         134   1e-35   
dbj|BAK68869.1|  class III chitinase                                    132   1e-35   
ref|XP_002301782.1|  chitinase family protein                           136   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_002513612.1|  hevamine-A precursor, putative                     136   1e-35   Ricinus communis
gb|ADG56718.1|  chitinase                                               131   1e-35   
ref|XP_004169800.1|  PREDICTED: LOW QUALITY PROTEIN: acidic endoc...    131   1e-35   
gb|AFM77007.1|  pathogenesis related protein 3                          134   2e-35   
ref|XP_004145913.1|  PREDICTED: acidic endochitinase-like               131   2e-35   
ref|XP_008234893.1|  PREDICTED: hevamine-A-like                         135   2e-35   
gb|AAQ21404.1|  class III chitinase                                     135   2e-35   Medicago truncatula
ref|XP_004155888.1|  PREDICTED: acidic endochitinase-like               136   2e-35   
ref|XP_004133839.1|  PREDICTED: acidic endochitinase-like               135   2e-35   
ref|XP_004306710.1|  PREDICTED: basic endochitinase-like                134   2e-35   
ref|XP_010092887.1|  Acidic endochitinase                               133   2e-35   
ref|XP_008437558.1|  PREDICTED: acidic endochitinase-like               131   2e-35   
ref|XP_011093688.1|  PREDICTED: acidic endochitinase-like               134   2e-35   
emb|CDP09311.1|  unnamed protein product                                133   2e-35   
ref|XP_011010623.1|  PREDICTED: acidic endochitinase-like               134   2e-35   
pdb|4TOQ|A  Chain A, Crystal Structure Of Class Iii Chitinase Fro...    132   2e-35   
ref|XP_006374316.1|  chitinase family protein                           134   2e-35   
ref|XP_010103971.1|  Acidic endochitinase                               137   2e-35   
gb|ABL74451.1|  class III chitinase                                     135   2e-35   Casuarina glauca
ref|XP_008357049.1|  PREDICTED: LOW QUALITY PROTEIN: acidic endoc...    135   3e-35   
emb|CAC14016.1|  chitinase                                              132   3e-35   Vitis vinifera
ref|XP_002461854.1|  hypothetical protein SORBIDRAFT_02g009360          134   3e-35   Sorghum bicolor [broomcorn]
ref|XP_006339646.1|  PREDICTED: hevamine-A-like                         132   3e-35   
emb|CAN64487.1|  hypothetical protein VITISV_035040                     132   3e-35   Vitis vinifera
ref|XP_002461855.1|  hypothetical protein SORBIDRAFT_02g009370          134   3e-35   Sorghum bicolor [broomcorn]
emb|CDP10878.1|  unnamed protein product                                134   3e-35   
ref|XP_006374315.1|  chitinase family protein                           132   3e-35   
dbj|BAC11885.1|  acidic endochitinase                                   135   3e-35   Arabidopsis halleri subsp. gemmifera
ref|XP_010911007.1|  PREDICTED: hevamine-A-like                         135   3e-35   
dbj|BAC11884.1|  acidic chitinase                                       135   3e-35   Arabidopsis halleri subsp. gemmifera
dbj|BAC11891.1|  acidic endochitinase                                   135   3e-35   Arabidopsis halleri subsp. gemmifera
gb|KDP22190.1|  hypothetical protein JCGZ_26021                         131   4e-35   
dbj|BAC11888.1|  acidic endochitinase                                   135   4e-35   Arabidopsis halleri subsp. gemmifera
dbj|BAC11890.1|  acidic endochitinase                                   135   4e-35   Arabidopsis halleri subsp. gemmifera
ref|XP_006657618.1|  PREDICTED: acidic endochitinase-like               135   4e-35   
dbj|BAA21877.1|  acidic endochitinase                                   135   4e-35   Arabidopsis kamchatica subsp. kawasakiana
gb|EMT07092.1|  Acidic endochitinase                                    134   4e-35   
gb|AIM62181.1|  acidic class III chitinase                              130   4e-35   
sp|P36908.1|CHIA_CICAR  RecName: Full=Acidic endochitinase; Flags...    129   5e-35   Cicer arietinum [garbanzo]
ref|XP_010265871.1|  PREDICTED: acidic endochitinase-like               134   5e-35   
ref|XP_008652265.1|  PREDICTED: acidic endochitinase-like               134   5e-35   
ref|XP_008652266.1|  PREDICTED: acidic endochitinase-like               134   5e-35   
ref|XP_004231197.2|  PREDICTED: chitinase 1-like                        132   5e-35   
ref|XP_006374314.1|  Chain A family protein                             133   6e-35   
gb|EMS53956.1|  Acidic endochitinase                                    133   6e-35   
dbj|BAC55717.1|  putative class III acidic chitinase                    134   6e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010035192.1|  PREDICTED: hevamine-A-like                         131   6e-35   
sp|P23472.2|CHLY_HEVBR  RecName: Full=Hevamine-A; Includes: RecNa...    131   7e-35   Hevea brasiliensis [jebe]
gb|KGN49899.1|  hypothetical protein Csa_5G139770                       133   7e-35   
emb|CAA09110.1|  chitinase                                              131   7e-35   Hevea brasiliensis [jebe]
ref|XP_009352076.1|  PREDICTED: acidic endochitinase SE2-like           134   7e-35   
tpg|DAA60279.1|  TPA: hypothetical protein ZEAMMB73_388877              133   7e-35   
ref|XP_006339645.1|  PREDICTED: hevamine-A-like                         131   7e-35   
ref|XP_006832884.1|  hypothetical protein AMTR_s00095p00105100          132   8e-35   
dbj|BAC11889.1|  acidic endochitinase                                   134   8e-35   Arabidopsis halleri subsp. gemmifera
emb|CDM82745.1|  unnamed protein product                                134   8e-35   
ref|XP_011010622.1|  PREDICTED: hevamine-A-like                         132   8e-35   
ref|XP_008652267.1|  PREDICTED: acidic endochitinase-like               133   8e-35   
gb|AEZ67305.1|  chitinase 6                                             132   8e-35   
ref|XP_009357257.1|  PREDICTED: basic endochitinase-like                131   9e-35   
dbj|BAJ89542.1|  predicted protein                                      132   9e-35   
pdb|1HVQ|A  Chain A, Crystal Structures Of Hevamine, A Plant Defe...    130   9e-35   
gb|ACU31855.1|  acidic endochitinase                                    134   9e-35   Nepenthes mirabilis
gb|ACU31851.1|  acidic endochitinase                                    134   9e-35   Nepenthes ventricosa
dbj|BAG38685.1|  chitinase A                                            131   9e-35   Ananas comosus
ref|XP_010251575.1|  PREDICTED: hevamine-A-like                         130   1e-34   
gb|KCW71545.1|  hypothetical protein EUGRSUZ_E00086                     134   1e-34   
emb|CDP16516.1|  unnamed protein product                                132   1e-34   
emb|CDX80411.1|  BnaC07g30330D                                          128   1e-34   
ref|XP_010421218.1|  PREDICTED: acidic endochitinase-like               133   1e-34   
gb|ABF82271.1|  class III chitinase                                     131   1e-34   Panax ginseng [Chinese ginseng]
ref|XP_003551968.1|  PREDICTED: hevamine-A-like                         133   1e-34   
ref|XP_003516317.1|  PREDICTED: hevamine-A-like                         133   1e-34   
ref|XP_007038907.1|  Acidic endochitinase                               132   1e-34   
ref|XP_008382584.1|  PREDICTED: acidic endochitinase-like               133   1e-34   
gb|ACU31853.1|  acidic endochitinase                                    133   1e-34   Nepenthes singalana
ref|XP_004145916.1|  PREDICTED: acidic endochitinase-like               128   1e-34   
ref|XP_003557305.1|  PREDICTED: acidic endochitinase                    131   1e-34   
gb|AFK26309.1|  chitinase 3                                             133   1e-34   
emb|CDY19852.1|  BnaA09g05050D                                          133   1e-34   
gb|ADR82196.1|  hevamine                                                131   1e-34   
ref|XP_010454699.1|  PREDICTED: acidic endochitinase isoform X2         133   1e-34   
ref|XP_003540115.1|  PREDICTED: acidic endochitinase-like               131   1e-34   
ref|XP_011005445.1|  PREDICTED: hevamine-A-like                         133   1e-34   
dbj|BAA21875.1|  acidic endochitinase                                   133   1e-34   Arabidopsis halleri subsp. gemmifera
emb|CDP05113.1|  unnamed protein product                                133   1e-34   
ref|XP_009141891.1|  PREDICTED: acidic endochitinase                    132   1e-34   
gb|AFK26308.1|  chitinase 3                                             133   1e-34   
ref|XP_010454698.1|  PREDICTED: acidic endochitinase isoform X1         132   2e-34   
ref|XP_008437976.1|  PREDICTED: acidic endochitinase-like               132   2e-34   
ref|XP_006422092.1|  hypothetical protein CICLE_v10005522mg             132   2e-34   
ref|XP_002276365.2|  PREDICTED: chitinase 1-like                        129   2e-34   Vitis vinifera
gb|KHN46436.1|  Acidic endochitinase                                    132   2e-34   
ref|XP_009393386.1|  PREDICTED: acidic endochitinase-like               133   2e-34   
ref|XP_007011079.1|  Acidic endochitinase                               133   2e-34   
emb|CDX87145.1|  BnaC09g04600D                                          132   2e-34   
pdb|2GSJ|A  Chain A, Cdna Cloning And 1.75a Crystal Structure Det...    130   2e-34   
ref|XP_003556139.1|  PREDICTED: hevamine-A-like                         133   2e-34   
gb|ACU21310.1|  unknown                                                 132   2e-34   Glycine max [soybeans]
emb|CDP00697.1|  unnamed protein product                                130   2e-34   
ref|XP_010035190.1|  PREDICTED: hevamine-A-like                         131   2e-34   
ref|XP_002461856.1|  hypothetical protein SORBIDRAFT_02g009380          131   2e-34   Sorghum bicolor [broomcorn]
ref|XP_006376615.1|  hypothetical protein POPTR_0012s01150g             131   2e-34   
gb|ADP68561.1|  class 3 chitinase                                       130   2e-34   
dbj|BAC11881.1|  acidic endochitinase                                   131   2e-34   Olimarabidopsis pumila
dbj|BAA21870.1|  acidic endochitinase                                   132   3e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA21874.1|  acidic endochitinase                                   132   3e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA21860.1|  acidic endochitinase                                   132   3e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA21873.1|  acidic endochitinase                                   132   3e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA21869.1|  acidic endochitinase                                   132   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009338801.1|  PREDICTED: acidic endochitinase-like               132   3e-34   
ref|XP_002533316.1|  hevamine-A precursor, putative                     130   3e-34   Ricinus communis
dbj|BAA21867.1|  acidic endochitinase                                   132   3e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA21865.1|  acidic endochitinase                                   132   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197797.1|  chitinase A                                           132   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320164.2|  chitinase family protein                           131   3e-34   Populus trichocarpa [western balsam poplar]
ref|XP_009375570.1|  PREDICTED: acidic endochitinase SE2-like           132   3e-34   
gb|EMT30347.1|  Acidic endochitinase                                    131   3e-34   
ref|XP_011037250.1|  PREDICTED: hevamine-A-like                         131   3e-34   
ref|XP_002266583.1|  PREDICTED: acidic endochitinase                    128   3e-34   Vitis vinifera
gb|AAA32768.1|  acidic endochitinase                                    131   3e-34   Arabidopsis thaliana [mouse-ear cress]
gb|ACU31856.1|  acidic endochitinase                                    132   3e-34   Nepenthes rafflesiana
dbj|BAC11882.1|  acidic endochitinase                                   131   4e-34   Olimarabidopsis cabulica
gb|KDP44396.1|  hypothetical protein JCGZ_20076                         129   4e-34   
dbj|BAC11880.1|  acidic endochitinase                                   131   4e-34   Crucihimalaya himalaica
gb|KGN49896.1|  hypothetical protein Csa_5G139740                       127   4e-34   
ref|XP_004490140.1|  PREDICTED: acidic endochitinase-like               130   4e-34   
ref|XP_009150936.1|  PREDICTED: acidic endochitinase                    127   4e-34   
gb|EAZ03535.1|  hypothetical protein OsI_25670                          132   4e-34   Oryza sativa Indica Group [Indian rice]
dbj|BAK23248.1|  chitinase                                              130   4e-34   
dbj|BAK02328.1|  predicted protein                                      132   4e-34   
ref|XP_010097886.1|  hypothetical protein L484_011486                   127   4e-34   
gb|KDP28548.1|  hypothetical protein JCGZ_14319                         129   5e-34   
emb|CAA61280.1|  acidic chitinase class 3                               130   5e-34   Vigna unguiculata
dbj|BAA21872.1|  acidic endochitinase                                   131   5e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC11883.1|  acidic endochitinase                                   132   5e-34   Crucihimalaya wallichii
ref|XP_007157427.1|  hypothetical protein PHAVU_002G069300g             132   5e-34   
ref|XP_010058127.1|  PREDICTED: acidic endochitinase-like               133   5e-34   
ref|XP_011001950.1|  PREDICTED: hevamine-A-like                         129   5e-34   
ref|XP_007051193.1|  Acidic endochitinase                               129   6e-34   
tpg|DAA56721.1|  TPA: hevamine-A                                        127   6e-34   
dbj|BAM28610.1|  class III chitinase                                    131   6e-34   
ref|XP_006394666.1|  hypothetical protein EUTSA_v10004675mg             130   6e-34   
ref|XP_002874168.1|  acidic endochitinase                               130   6e-34   
pdb|1KR1|A  Chain A, Hevamine Mutant D125aE127A IN COMPLEX WITH T...    131   6e-34   
dbj|BAA21863.1|  acidic endochitinase                                   132   6e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC11879.1|  acidic endochitinase                                   130   7e-34   Arabidopsis lyrata subsp. petraea
pdb|1KQY|A  Chain A, Hevamine Mutant D125aE127AY183F IN COMPLEX W...    131   7e-34   
gb|ABF74624.1|  acid chitinase                                          131   7e-34   Nepenthes rafflesiana
ref|XP_010493540.1|  PREDICTED: acidic endochitinase-like               130   7e-34   
gb|ACU31858.1|  acidic endochitinase                                    131   7e-34   Nepenthes ampullaria
pdb|1KR0|A  Chain A, Hevamine Mutant D125aY183F IN COMPLEX WITH T...    130   7e-34   
gb|ACU31852.1|  acidic endochitinase                                    131   8e-34   Nepenthes thorelii
ref|XP_003592152.1|  Chitinase                                          130   8e-34   
ref|XP_006288262.1|  hypothetical protein CARUB_v10001507mg             131   8e-34   
ref|XP_008798675.1|  PREDICTED: acidic endochitinase-like               131   8e-34   
emb|CAO78600.1|  endochitinase and N-acetylglucosamine-binding he...    130   8e-34   Parkia platycephala
gb|AES62403.2|  chitinase                                               130   9e-34   
emb|CAA61279.1|  basic chitinase class 3                                127   9e-34   Vigna unguiculata
gb|AFK34674.1|  unknown                                                 128   9e-34   
ref|XP_010025523.1|  PREDICTED: acidic endochitinase-like               127   1e-33   
gb|KCW62224.1|  hypothetical protein EUGRSUZ_H04884                     127   1e-33   
gb|AFK47835.1|  unknown                                                 130   1e-33   
gb|KDP28547.1|  hypothetical protein JCGZ_14318                         127   1e-33   
ref|XP_002973674.1|  hypothetical protein SELMODRAFT_232123             130   1e-33   
ref|XP_007143514.1|  hypothetical protein PHAVU_007G077800g             130   1e-33   
dbj|BAA21876.1|  acidic endochitinase                                   130   1e-33   Turritis glabra
dbj|BAA01948.1|  acidic chitinase                                       130   1e-33   Vigna angularis [azuki bean]
ref|XP_004169802.1|  PREDICTED: acidic endochitinase-like               127   1e-33   
ref|XP_007153597.1|  hypothetical protein PHAVU_003G049100g             130   1e-33   
sp|P29024.1|CHIA_PHAAN  RecName: Full=Acidic endochitinase; Flags...    130   1e-33   
ref|XP_006444927.1|  hypothetical protein CICLE_v10024434mg             128   1e-33   
ref|XP_011093117.1|  PREDICTED: hevamine-A-like                         130   1e-33   
ref|XP_007152092.1|  hypothetical protein PHAVU_004G101500g             130   1e-33   
gb|AFK40655.1|  unknown                                                 130   1e-33   
emb|CAM82810.1|  pathogenesis-related protein 8                         127   2e-33   
ref|NP_001105541.1|  chitinase chem5 precursor                          130   2e-33   
ref|XP_004308053.1|  PREDICTED: acidic endochitinase-like               127   2e-33   
gb|KFK27694.1|  hypothetical protein AALP_AA8G416300                    130   2e-33   
ref|XP_008791958.1|  PREDICTED: hevamine-A-like                         127   2e-33   
ref|XP_006644469.1|  PREDICTED: acidic endochitinase-like               130   2e-33   
ref|XP_002975729.1|  hypothetical protein SELMODRAFT_232562             130   2e-33   
ref|XP_004496499.1|  PREDICTED: acidic endochitinase-like               130   2e-33   
ref|XP_003592155.1|  Acidic endochitinase                               129   2e-33   
ref|XP_002513611.1|  Acidic endochitinase SE2 precursor, putative       129   2e-33   
gb|AAQ21405.1|  putative class III chitinase                            130   2e-33   
ref|XP_008233425.1|  PREDICTED: acidic endochitinase-like               125   2e-33   
ref|NP_001266396.1|  PRm 3 precursor                                    130   2e-33   
emb|CDM85085.1|  unnamed protein product                                130   2e-33   
ref|XP_010550536.1|  PREDICTED: acidic endochitinase isoform X1         128   2e-33   
ref|XP_003628367.1|  Acidic endochitinase                               130   2e-33   
ref|XP_007218745.1|  hypothetical protein PRUPE_ppa009248mg             127   3e-33   
gb|ADM45273.1|  tamarinin                                               130   3e-33   
ref|XP_003626525.1|  Acidic endochitinase                               122   3e-33   
ref|XP_010035193.1|  PREDICTED: hevamine-A-like                         127   3e-33   
gb|EYU25180.1|  hypothetical protein MIMGU_mgv1a022607mg                127   3e-33   
ref|XP_008678348.1|  PREDICTED: probable receptor-like protein ki...    134   3e-33   
ref|XP_009616178.1|  PREDICTED: basic endochitinase-like                127   3e-33   
gb|KHN16990.1|  Acidic endochitinase                                    129   4e-33   
gb|KHN46434.1|  Acidic endochitinase                                    126   4e-33   
gb|AFY08286.1|  class III chitinase                                     124   4e-33   
ref|XP_003536440.1|  PREDICTED: hevamine-A-like                         129   4e-33   
gb|AES82743.2|  glycoside hydrolase family 18 protein                   122   4e-33   
gb|ADF47473.1|  class III chitinase                                     124   4e-33   
ref|NP_001236709.1|  Chitinase III-A precursor                          128   4e-33   
ref|XP_003564668.1|  PREDICTED: hevamine-A-like                         129   4e-33   
gb|KHN47273.1|  Acidic endochitinase                                    128   4e-33   
dbj|BAB92957.1|  chitinase                                              127   5e-33   
ref|XP_010918161.1|  PREDICTED: hevamine-A-like                         125   5e-33   
gb|KCW46485.1|  hypothetical protein EUGRSUZ_K00313                     127   5e-33   
gb|AAB34670.1|  chitinase-B, PLC-B                                      127   5e-33   
ref|XP_007219121.1|  hypothetical protein PRUPE_ppa015812mg             123   6e-33   
ref|NP_001043772.1|  Os01g0660200                                       128   6e-33   
ref|XP_011076066.1|  PREDICTED: hevamine-A                              128   6e-33   
gb|EYU32188.1|  hypothetical protein MIMGU_mgv1a021044mg                128   7e-33   
ref|XP_008343775.1|  PREDICTED: acidic endochitinase SE2-like           128   7e-33   
ref|XP_004496498.1|  PREDICTED: hevamine-A-like                         127   7e-33   
gb|KHN09877.1|  Basic endochitinase                                     129   7e-33   
dbj|BAA77676.1|  acidic chitinase                                       126   8e-33   
ref|XP_003548130.1|  PREDICTED: acidic endochitinase-like               126   8e-33   
ref|XP_003613997.1|  Class III acidic chitinase                         128   9e-33   
ref|XP_006584176.1|  PREDICTED: acidic endochitinase-like               128   9e-33   
emb|CDX88072.1|  BnaA06g26630D                                          122   9e-33   
ref|XP_009368705.1|  PREDICTED: hevamine-A-like                         125   1e-32   
gb|ACU24254.1|  unknown                                                 126   1e-32   
gb|AAD22114.1|  chitinase                                               124   1e-32   
ref|XP_008776738.1|  PREDICTED: acidic endochitinase-like               127   1e-32   
ref|XP_003592157.1|  Acidic endochitinase                               125   1e-32   
ref|XP_010678465.1|  PREDICTED: basic endochitinase-like                128   1e-32   
gb|EAZ12973.1|  hypothetical protein OsJ_02893                          127   1e-32   
ref|XP_008343776.1|  PREDICTED: acidic endochitinase SE2-like           128   1e-32   
ref|XP_006339651.1|  PREDICTED: acidic endochitinase-like               124   1e-32   
ref|XP_004511214.1|  PREDICTED: acidic endochitinase-like               127   1e-32   
ref|XP_010248214.1|  PREDICTED: acidic endochitinase-like               125   1e-32   
sp|P36910.1|CHIE_BETVU  RecName: Full=Acidic endochitinase SE2; F...    128   1e-32   
ref|NP_001241202.1|  uncharacterized protein LOC100810929 precursor     124   2e-32   
ref|XP_006366640.1|  PREDICTED: acidic endochitinase-like               127   2e-32   
ref|XP_002456669.1|  hypothetical protein SORBIDRAFT_03g040560          128   2e-32   
ref|XP_004234212.1|  PREDICTED: acidic endochitinase                    127   2e-32   
gb|ACU21507.1|  unknown                                                 125   2e-32   
ref|XP_010671341.1|  PREDICTED: acidic endochitinase SE2                127   2e-32   
ref|XP_007219423.1|  hypothetical protein PRUPE_ppa021993mg             124   2e-32   
ref|XP_002511935.1|  hevamine-A precursor, putative                     125   2e-32   
ref|XP_006579699.1|  PREDICTED: basic endochitinase-like                127   2e-32   
ref|XP_004987226.1|  PREDICTED: hevamine-A-like                         123   2e-32   
ref|XP_009606707.1|  PREDICTED: hevamine-A                              127   2e-32   
ref|XP_003551966.1|  PREDICTED: hevamine-A-like                         127   2e-32   
ref|XP_007147255.1|  hypothetical protein PHAVU_006G109000g             124   2e-32   
gb|AGX26690.1|  chitinase                                               126   2e-32   
gb|AFK35577.1|  unknown                                                 127   3e-32   
ref|XP_008234804.1|  PREDICTED: hevamine-A-like                         124   3e-32   
ref|XP_009788613.1|  PREDICTED: basic endochitinase                     127   3e-32   
ref|XP_010671560.1|  PREDICTED: hevamine-A-like                         119   3e-32   
gb|ABC47924.1|  pathogenesis-related protein 8                          127   3e-32   
ref|XP_002466041.1|  hypothetical protein SORBIDRAFT_01g050530          124   3e-32   
gb|AFQ23972.1|  pathogenesis related protein 8                          126   4e-32   
gb|AAD53006.1|AF082284_1  chitinase                                     126   4e-32   
ref|XP_004306711.1|  PREDICTED: basic endochitinase-like                125   4e-32   
ref|XP_011037358.1|  PREDICTED: basic endochitinase-like                125   4e-32   
ref|XP_002975555.1|  hypothetical protein SELMODRAFT_15256              126   5e-32   
ref|XP_002973524.1|  hypothetical protein SELMODRAFT_15257              126   5e-32   
gb|AAO47731.1|  acidic class III chitinase                              124   6e-32   
ref|XP_008798676.1|  PREDICTED: acidic endochitinase-like               126   7e-32   
ref|XP_008232937.1|  PREDICTED: acidic endochitinase-like               121   7e-32   
ref|XP_004229964.1|  PREDICTED: acidic endochitinase-like               120   8e-32   
ref|XP_008674798.1|  PREDICTED: acidic endochitinase-like               126   8e-32   
ref|XP_003553867.2|  PREDICTED: basic endochitinase-like                126   9e-32   
emb|CBI34870.3|  unnamed protein product                                125   9e-32   
gb|EYU34846.1|  hypothetical protein MIMGU_mgv1a0110491mg               122   1e-31   
ref|XP_010232172.1|  PREDICTED: cysteine-rich receptor-like prote...    117   1e-31   
ref|XP_009778174.1|  PREDICTED: hevamine-A                              124   1e-31   
ref|XP_007038895.1|  Acidic endochitinase                               125   1e-31   
ref|XP_010092886.1|  Acidic endochitinase                               121   1e-31   
ref|XP_002458804.1|  hypothetical protein SORBIDRAFT_03g040570          125   1e-31   
ref|XP_002456670.1|  hypothetical protein SORBIDRAFT_03g040580          125   2e-31   
ref|XP_002461857.1|  hypothetical protein SORBIDRAFT_02g009390          124   2e-31   
ref|XP_009368707.1|  PREDICTED: hevamine-A-like                         120   2e-31   
ref|XP_008439318.1|  PREDICTED: hevamine-A-like                         123   2e-31   
emb|CAB65476.2|  chitinase                                              124   2e-31   
emb|CAB66334.1|  acidic endochitinase                                   121   2e-31   
ref|XP_002320839.1|  chitinase family protein                           123   2e-31   
ref|XP_007038902.1|  Acidic endochitinase                               124   3e-31   
ref|XP_008376672.1|  PREDICTED: hevamine-A                              120   3e-31   
ref|XP_007219825.1|  hypothetical protein PRUPE_ppa026927mg             122   3e-31   
ref|NP_001150942.1|  hevamine-A precursor                               117   4e-31   
gb|AAD56239.1|AF184884_1  class III chitinase                           122   4e-31   
dbj|BAC78593.1|  chitinase                                              124   4e-31   
ref|XP_004308027.1|  PREDICTED: acidic endochitinase-like               115   4e-31   
ref|XP_003597766.1|  Acidic endochitinase                               125   5e-31   
gb|AAN37390.1|AF435027_1  class III chitinase                           124   5e-31   
gb|AAN37389.1|AF435026_1  class III chitinase                           124   5e-31   
ref|XP_002456083.1|  hypothetical protein SORBIDRAFT_03g030100          124   5e-31   
ref|NP_001043912.1|  Os01g0687400                                       124   5e-31   
ref|XP_002279661.1|  PREDICTED: acidic endochitinase                    121   6e-31   
ref|XP_002320838.2|  chitinase family protein                           124   6e-31   
gb|AAN37392.1|AF435029_1  class III chitinase                           123   7e-31   
gb|AES68017.2|  chitinase                                               124   7e-31   
dbj|BAC77768.1|  chitinase                                              119   7e-31   
gb|AAD11423.1|  chitinase                                               120   8e-31   
gb|AAD27874.1|AF137070_1  class III chitinase                           121   9e-31   
ref|XP_002992798.1|  hypothetical protein SELMODRAFT_236614             123   1e-30   
ref|XP_003564666.1|  PREDICTED: acidic endochitinase-like               123   1e-30   
ref|XP_009757784.1|  PREDICTED: cysteine-rich receptor-like prote...    119   1e-30   
ref|XP_009757785.1|  PREDICTED: G-type lectin S-receptor-like ser...    119   1e-30   
ref|XP_003567286.1|  PREDICTED: acidic endochitinase-like               122   1e-30   
ref|XP_011037346.1|  PREDICTED: basic endochitinase-like                122   1e-30   
gb|EMS65443.1|  Acidic endochitinase                                    122   1e-30   
ref|XP_004970658.1|  PREDICTED: acidic endochitinase-like               122   1e-30   
ref|XP_010042741.1|  PREDICTED: hevamine-A-like                         119   1e-30   
ref|XP_003520860.2|  PREDICTED: acidic endochitinase-like               119   2e-30   
ref|XP_009764571.1|  PREDICTED: hevamine-A-like                         118   2e-30   
gb|KHN35349.1|  Basic endochitinase                                     118   2e-30   
emb|CAN61462.1|  hypothetical protein VITISV_038584                     115   2e-30   
gb|EEE55216.1|  hypothetical protein OsJ_03081                          114   2e-30   
gb|EMT24293.1|  Acidic endochitinase                                    120   2e-30   
ref|XP_009414573.1|  PREDICTED: hevamine-A-like                         118   2e-30   
ref|NP_001044871.1|  Os01g0860400                                       122   3e-30   
ref|XP_007011082.1|  Acidic endochitinase                               121   3e-30   
ref|XP_010924795.1|  PREDICTED: hevamine-A-like                         116   3e-30   
ref|XP_006644559.1|  PREDICTED: acidic endochitinase-like               121   3e-30   
ref|XP_007153596.1|  hypothetical protein PHAVU_003G049000g             122   3e-30   
ref|XP_002987491.1|  hypothetical protein SELMODRAFT_126203             122   3e-30   
ref|XP_009415161.1|  PREDICTED: acidic endochitinase SE2-like           122   3e-30   
ref|XP_010671916.1|  PREDICTED: acidic endochitinase-like               116   4e-30   
emb|CDM84662.1|  unnamed protein product                                121   4e-30   
ref|XP_008674797.1|  PREDICTED: acidic endochitinase-like               121   4e-30   
ref|XP_002456671.1|  hypothetical protein SORBIDRAFT_03g040590          121   4e-30   
gb|EAY76568.1|  hypothetical protein OsI_04514                          121   5e-30   
gb|EEC71310.1|  hypothetical protein OsI_03342                          114   6e-30   
ref|XP_004970659.1|  PREDICTED: acidic endochitinase-like               121   6e-30   
ref|NP_001043931.1|  Os01g0691000                                       114   6e-30   
ref|XP_009415162.1|  PREDICTED: acidic endochitinase SE2-like           119   7e-30   
ref|XP_006597152.1|  PREDICTED: G-type lectin S-receptor-like ser...    120   8e-30   
emb|CDM82941.1|  unnamed protein product                                115   8e-30   
ref|XP_009591356.1|  PREDICTED: hevamine-A-like                         115   9e-30   
gb|EMT14960.1|  Acidic endochitinase                                    114   1e-29   
ref|XP_007038903.1|  Acidic endochitinase                               112   1e-29   
gb|EYU40152.1|  hypothetical protein MIMGU_mgv1a013181mg                118   1e-29   
gb|EMT26264.1|  Acidic endochitinase                                    119   2e-29   
emb|CAN80146.1|  hypothetical protein VITISV_035383                     117   3e-29   
ref|XP_009414570.1|  PREDICTED: hevamine-A-like isoform X1              112   3e-29   
gb|EPS58589.1|  hypothetical protein M569_16224                         117   3e-29   
emb|CDM84668.1|  unnamed protein product                                119   3e-29   
ref|XP_008439319.1|  PREDICTED: hevamine-A-like                         119   3e-29   
ref|XP_009414569.1|  PREDICTED: hevamine-A-like                         112   4e-29   
gb|ABW75911.1|  class III chitinase                                     114   4e-29   
ref|XP_002272963.2|  PREDICTED: acidic endochitinase-like               117   4e-29   
gb|EMS55185.1|  Acidic endochitinase SE2                                118   4e-29   
ref|XP_007038901.1|  Acidic endochitinase                               114   5e-29   
gb|EMS63840.1|  Acidic endochitinase                                    118   7e-29   
ref|XP_006645798.1|  PREDICTED: hevamine-A-like                         112   7e-29   
gb|EMT24291.1|  Acidic endochitinase                                    115   1e-28   
ref|XP_003569375.1|  PREDICTED: acidic endochitinase-like               111   1e-28   
ref|XP_003626478.1|  Class III acidic chitinase                         108   2e-28   
ref|XP_007150622.1|  hypothetical protein PHAVU_005G167700g             110   2e-28   
ref|XP_011037238.1|  PREDICTED: hevamine-A-like                         108   2e-28   
gb|AES82696.2|  class III chitinase                                     108   2e-28   
ref|XP_003567011.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   2e-28   
emb|CDM84667.1|  unnamed protein product                                116   2e-28   
gb|KHN17388.1|  Acidic endochitinase                                    115   2e-28   
gb|KDP22189.1|  hypothetical protein JCGZ_26020                         110   2e-28   
ref|XP_010671561.1|  PREDICTED: acidic endochitinase-like               110   3e-28   
ref|XP_004969590.1|  PREDICTED: acidic endochitinase-like               117   3e-28   
emb|CDM85086.1|  unnamed protein product                                115   3e-28   
gb|AIZ04027.1|  chitinase III                                           115   5e-28   
emb|CAA76203.1|  class III chitinase                                    110   5e-28   
ref|XP_004972104.1|  PREDICTED: acidic endochitinase-like               110   6e-28   
ref|XP_007051664.1|  Chitinase A                                        111   6e-28   
gb|KEH19750.1|  chitinase                                               110   7e-28   
gb|EMT07587.1|  Acidic endochitinase                                    114   7e-28   
gb|EMT01057.1|  Acidic endochitinase SE2                                114   8e-28   
gb|AFV30205.1|  putative class III chitinase                            115   9e-28   
ref|XP_002320833.1|  chitinase family protein                           107   1e-27   
ref|XP_008674796.1|  PREDICTED: acidic endochitinase-like               115   1e-27   
emb|CDM84666.1|  unnamed protein product                                114   2e-27   
emb|CDM84665.1|  unnamed protein product                                113   2e-27   
emb|CDP22251.1|  unnamed protein product                                110   2e-27   
gb|ABO26878.1|  chitinase                                               114   2e-27   
ref|XP_010671918.1|  PREDICTED: acidic endochitinase-like               107   2e-27   
emb|CDP17853.1|  unnamed protein product                                105   2e-27   
dbj|BAB19777.1|  putative class III chitinase                           107   3e-27   
ref|NP_001042831.1|  Os01g0303100                                       107   3e-27   
gb|EAZ11585.1|  hypothetical protein OsJ_01449                          107   3e-27   
ref|XP_004970660.1|  PREDICTED: acidic endochitinase-like               114   3e-27   
emb|CAJ43737.1|  class III chitinase                                    104   4e-27   
dbj|BAK08346.1|  predicted protein                                      108   4e-27   
ref|XP_011084475.1|  PREDICTED: acidic endochitinase SE2-like           107   5e-27   
ref|XP_008775913.1|  PREDICTED: acidic endochitinase-like               108   6e-27   
gb|EMT24292.1|  Acidic endochitinase SE2                                111   7e-27   
emb|CDM84663.1|  unnamed protein product                                111   8e-27   
ref|XP_009414574.1|  PREDICTED: hevamine-A-like                         105   1e-26   



>gb|AFK31317.1| acidic class III chitinase [Citrullus colocynthis]
Length=292

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG+G TPVLNLAGHC+P +N C FLSDEI  CKS+GIKVLLS+GGG G Y LS  
Sbjct  56   AFLSSFGNGQTPVLNLAGHCNPDNNGCAFLSDEINSCKSQGIKVLLSIGGGAGSYSLSST  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR+VA +LW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  DDARDVANFLWNNFLGGQSSSRPLGDAVLDGIDF  149



>ref|XP_008809712.1| PREDICTED: acidic endochitinase-like [Phoenix dactylifera]
Length=297

 Score =   145 bits (365),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (80%), Gaps = 3/104 (3%)
 Frame = -1

Query  312  RHQLLRDRKHAFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGG  133
            R+Q +     AFL+TFG+G TP +NLAGHCDP+SN C  LS EI+ C+S+GIKV+LS+GG
Sbjct  50   RYQFVN---VAFLSTFGNGQTPAINLAGHCDPSSNGCTGLSSEIKACQSQGIKVMLSIGG  106

Query  132  GVGDYYLSFRDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            G G YYL+  DDA+ VA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  107  GAGSYYLASSDDAKQVADYLWNNFLGGQSSSRPLGDAVLDGIDF  150



>gb|ABA26457.1| acidic class III chitinase [Citrullus lanatus]
Length=291

 Score =   144 bits (362),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG+G TPVLNLAGHC+P +N C FLSDEI  CKS GIKVLLS+GGG G Y LS  
Sbjct  56   AFLSSFGNGQTPVLNLAGHCNPDNNGCAFLSDEINSCKSLGIKVLLSIGGGAGSYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR+VA +LW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  EDARDVANFLWNNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 42.7 bits (99),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGSLASTCATGNYKFVNI  55



>ref|XP_003592154.1| Chitinase [Medicago truncatula]
 gb|AES62405.1| chitinase [Medicago truncatula]
Length=296

 Score =   142 bits (358),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G TP LNLAGHCDPASN C   S EI+ C+SKGIKVLLSLGGG G Y LS  
Sbjct  56   AFLSTFGNGQTPTLNLAGHCDPASNGCTKFSSEIQTCQSKGIKVLLSLGGGAGSYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  116  DDATQVANYLWNNFLGGTSSSRPLGDAVLDGIDF  149


 Score = 42.7 bits (99),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IA+YWGQNG EGSL   C+TN Y+ VN+
Sbjct  28   IAVYWGQNGNEGSLADACNTNNYQFVNI  55



>ref|XP_008809724.1| PREDICTED: acidic endochitinase-like [Phoenix dactylifera]
Length=325

 Score =   143 bits (361),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G TP +NLAGHCDP+SN C  LS EI+ C+S+GIKV+LS+GGG G YYL+  
Sbjct  57   AFLSTFGNGQTPAINLAGHCDPSSNGCTGLSSEIKACQSQGIKVMLSIGGGAGSYYLASS  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  117  DDAKQVADYLWNNFLGGQSSSRPLGDAVLDGIDF  150


 Score = 41.6 bits (96),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y+ VN+
Sbjct  29   IAIYWGQNGNEGTLADTCATGRYQFVNV  56



>gb|KDO37563.1| hypothetical protein CISIN_1g044801mg, partial [Citrus sinensis]
Length=238

 Score =   140 bits (354),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+  TP +NLAGHCDP +N C  LS+EI+ C+ +GIKVLLS+GG  G Y LS  
Sbjct  57   AFLTTFGNSQTPQINLAGHCDPTNNGCAGLSNEIKTCQGQGIKVLLSIGGASGSYSLSSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VAQYLWDNFLGGQS+SRPLGD  LDGIDF
Sbjct  117  DDARQVAQYLWDNFLGGQSSSRPLGDAVLDGIDF  150



>ref|XP_007219529.1| hypothetical protein PRUPE_ppa022614mg [Prunus persica]
 gb|EMJ20728.1| hypothetical protein PRUPE_ppa022614mg [Prunus persica]
Length=298

 Score =   139 bits (350),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP +N C  LS +I+ C++KG+KV+LS+GGG G YYL+ +
Sbjct  56   AFLPTFGNGQTPMINLAGHCDPYTNGCTGLSSDIKSCQAKGVKVILSIGGGAGSYYLTSK  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  116  EDARQVATYLWNNFLGGSSSSRPLGDAVLDGIDF  149


 Score = 44.7 bits (104),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L++TC T  YE VN+
Sbjct  28   IAIYWGQNGNEGTLEETCATGNYEFVNL  55



>ref|XP_008232959.1| PREDICTED: hevamine-A-like [Prunus mume]
Length=298

 Score =   139 bits (349),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP +N C  LS +I+ C++KG+KV+LS+GGG G YYL+ +
Sbjct  56   AFLPTFGNGQTPMINLAGHCDPYTNGCTGLSSDIKSCQAKGVKVILSIGGGAGSYYLTSK  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  116  EDARQVATYLWNNFLGGSSSSRPLGDAVLDGIDF  149


 Score = 44.7 bits (104),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L++TC T  YE VN+
Sbjct  28   IAIYWGQNGNEGTLEETCATGNYEFVNL  55



>ref|XP_004240090.1| PREDICTED: acidic endochitinase [Solanum lycopersicum]
Length=292

 Score =   142 bits (357),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TPVLNLAGHC+P+   C  LS++IR C+S+GIKV+LSLGGGVG Y LS  
Sbjct  54   AFLVVFGNGQTPVLNLAGHCNPSVGGCTRLSNDIRTCQSRGIKVMLSLGGGVGSYSLSSA  113

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDARNVA YLW+N+LGGQS SRPLGD  LDGIDF
Sbjct  114  DDARNVANYLWNNYLGGQSTSRPLGDAILDGIDF  147



>sp|P29060.1|CHIA_TOBAC RecName: Full=Acidic endochitinase; Flags: Precursor [Nicotiana 
tabacum]
 emb|CAA77656.1| acidic chitinase III [Nicotiana tabacum]
Length=291

 Score =   138 bits (348),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP +  C  LS++IR C+++GIKV+LSLGGG G Y+LS  
Sbjct  53   AFLVVFGNGQNPVLNLAGHCDPNAGACTGLSNDIRACQNQGIKVMLSLGGGAGSYFLSSA  112

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDARNVA YLW+N+LGGQS +RPLGD  LDGIDF
Sbjct  113  DDARNVANYLWNNYLGGQSNTRPLGDAVLDGIDF  146


 Score = 44.7 bits (104),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            DI IYWGQNG EGSL  TC TN Y IVN+
Sbjct  24   DIVIYWGQNGNEGSLADTCATNNYAIVNI  52



>emb|CAB43737.2| chitinase [Trifolium repens]
Length=298

 Score =   139 bits (349),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G TP LNLAGHC+PA+N C   S +I+ C++KG+K+LLSLGGG G Y LS  
Sbjct  56   AFLSTFGNGQTPPLNLAGHCNPAANGCAIFSSQIQACQAKGVKILLSLGGGAGSYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA YLWDNFLGG S+SRPLGD  LDGIDF
Sbjct  116  DDATQVANYLWDNFLGGTSSSRPLGDAVLDGIDF  149


 Score = 43.9 bits (102),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IA+YWGQNG EGSL+  C+TN Y+ VN+
Sbjct  28   IAVYWGQNGGEGSLEDACNTNNYQFVNI  55



>gb|AAL01886.1|AF404590_1 chitinase 3-like protein precursor [Trichosanthes kirilowii]
Length=292

 Score =   140 bits (352),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG G TPVLNLAGHC+P++N C FLS +I+ C+S+GIKVLLS+GGG G Y LS  
Sbjct  56   AFLSSFGSGRTPVLNLAGHCNPSNNGCAFLSSQIKACQSRGIKVLLSIGGGAGSYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA ++W+NFLGG+S+SRPLGD  LDG+DF
Sbjct  116  DDARQVANFIWNNFLGGRSSSRPLGDAVLDGVDF  149


 Score = 42.7 bits (99),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGSLSFTCSTGNYQFVNI  55



>ref|XP_009616180.1| PREDICTED: acidic endochitinase [Nicotiana tomentosiformis]
Length=291

 Score =   138 bits (347),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP +  C  LS++IR C+++GIKV+LS+GGG G Y+LS  
Sbjct  53   AFLVVFGNGQNPVLNLAGHCDPNAGACTGLSNDIRACQNQGIKVMLSIGGGAGSYFLSSA  112

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDARNVA YLW+N+LGGQS +RPLGD  LDGIDF
Sbjct  113  DDARNVANYLWNNYLGGQSNTRPLGDAVLDGIDF  146


 Score = 44.7 bits (104),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            DI IYWGQNG EGSL  TC TN Y IVN+
Sbjct  24   DIVIYWGQNGNEGSLADTCATNNYAIVNI  52



>ref|XP_006832883.1| hypothetical protein AMTR_s00095p00104690 [Amborella trichopoda]
 gb|ERM98161.1| hypothetical protein AMTR_s00095p00104690 [Amborella trichopoda]
Length=302

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP +NLAGHCDP SN C  LSD+IR C+ +G+KVLLS+GGG G YYL+  
Sbjct  60   AFLATFGNGQTPQINLAGHCDPYSNGCTGLSDDIRSCQKQGVKVLLSIGGGAGSYYLASS  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA+YLW+N+LGGQS+SRPLGD  LDGIDF
Sbjct  120  DDAKQVARYLWNNYLGGQSSSRPLGDAVLDGIDF  153



>ref|XP_008232971.1| PREDICTED: LOW QUALITY PROTEIN: hevamine-A-like [Prunus mume]
Length=299

 Score =   138 bits (347),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP +N C  LS  I+ C++KG+KV+LS+GGG G YYL+ +
Sbjct  57   AFLPTFGNGQTPMINLAGHCDPITNGCTGLSSNIKSCQAKGVKVILSIGGGAGSYYLTSK  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG S SRPLGD  LDGIDF
Sbjct  117  EDARQVATYLWNNFLGGSSTSRPLGDAVLDGIDF  150


 Score = 44.7 bits (104),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L++TC T  YE VN+
Sbjct  29   IAIYWGQNGNEGTLEETCATGNYEFVNL  56



>ref|XP_008380389.1| PREDICTED: acidic endochitinase-like [Malus domestica]
Length=297

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+  TPVLNLAGHCDPAS  C  LS +IR C+SK IKVLLS+GG  G Y L+  
Sbjct  57   AFLTTFGNNQTPVLNLAGHCDPASGTCTGLSADIRTCQSKNIKVLLSIGGAAGSYSLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  117  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  150



>ref|XP_006421660.1| hypothetical protein CICLE_v10005491mg [Citrus clementina]
 gb|ESR34900.1| hypothetical protein CICLE_v10005491mg [Citrus clementina]
Length=308

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+  TP +NLAGHCDP +N C  LS+EI+ C+ +GIKVLLS+GG  G Y LS  
Sbjct  69   AFLTTFGNSQTPQINLAGHCDPTNNGCAGLSNEIKTCQGQGIKVLLSIGGASGSYSLSSA  128

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VAQYLWDNFLGGQS+SRPLGD  LDGIDF
Sbjct  129  DDARQVAQYLWDNFLGGQSSSRPLGDAVLDGIDF  162



>ref|XP_008380421.1| PREDICTED: acidic endochitinase-like [Malus domestica]
 ref|XP_008343774.1| PREDICTED: acidic endochitinase-like [Malus domestica]
 ref|XP_008362796.1| PREDICTED: acidic endochitinase-like [Malus domestica]
Length=314

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+  TPVLNLAGHCDP S  C  LS +IR C+SK IKVLLS+GGG G Y L+  
Sbjct  74   AFLTTFGNNQTPVLNLAGHCDPPSGTCTGLSADIRTCQSKNIKVLLSIGGGAGSYSLTSA  133

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  134  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  167



>ref|XP_008234803.1| PREDICTED: acidic endochitinase-like [Prunus mume]
Length=334

 Score =   140 bits (352),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TPVLNLAGHCDP++N C  LS +I+ C++K IKVLLS+GG VG Y L+  
Sbjct  101  AFLTTFGNGQTPVLNLAGHCDPSTNGCTGLSTDIKACQAKNIKVLLSIGGAVGSYSLTSA  160

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+N+LGGQ++SRPLGD  LDGIDF
Sbjct  161  DDARQVADYLWNNYLGGQASSRPLGDAVLDGIDF  194


 Score = 41.6 bits (96),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC+T  Y+ VN+
Sbjct  73   IAIYWGQNGNEGTLADTCNTGNYQFVNI  100



>ref|XP_009375613.1| PREDICTED: uncharacterized protein LOC103964407 [Pyrus x bretschneideri]
Length=1352

 Score =   138 bits (348),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282   AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
             AFLTTFG+  TPVLNLAGHCDPAS  C  LS +I+ C+SK IKVLLS+GG  G Y L+  
Sbjct  1000  AFLTTFGNNQTPVLNLAGHCDPASGTCTGLSADIKTCQSKNIKVLLSIGGASGSYSLTSA  1059

Query  102   DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  1060  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  1093


 Score = 42.7 bits (99),  Expect(2) = 4e-37, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L   C++  Y+ VN+
Sbjct  972  IAIYWGQNGNEGTLADACNSGNYQFVNI  999



>gb|KCW71548.1| hypothetical protein EUGRSUZ_E00090 [Eucalyptus grandis]
Length=296

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP++N+AGHCDP+S  C  LS EI+ C+++G+KV+LS+GGGVG YYL   
Sbjct  56   AFLNVFGNGQTPMINVAGHCDPSSGGCTGLSSEIKSCQARGVKVMLSIGGGVGSYYLPSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLWDNFLGGQS+SRPLGD  LDGIDF
Sbjct  116  EDARYVATYLWDNFLGGQSSSRPLGDAVLDGIDF  149



>ref|XP_006645058.1| PREDICTED: hevamine-A-like [Oryza brachyantha]
Length=304

 Score =   138 bits (347),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG G TPVLNLAGHCDPASN C  +  +I+ C+S GIKV+LS+GGGVG+Y LS R
Sbjct  59   AFLPVFGKGQTPVLNLAGHCDPASNGCTGVGADIKSCQSLGIKVMLSIGGGVGNYGLSSR  118

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+N+LGG S SRPLGD  +DGIDF
Sbjct  119  DDARQVAAYLWNNYLGGTSPSRPLGDAVMDGIDF  152


 Score = 43.1 bits (100),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC T  Y+ VN+
Sbjct  31   IAIYWGQNGNEGTLAQTCATGNYKFVNV  58



>ref|XP_010924796.1| PREDICTED: acidic endochitinase-like [Elaeis guineensis]
Length=293

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TPVLNLAGHCDP++  C  LS +I+ C+S+G+KVLLSLGG  G Y LS  
Sbjct  51   AFLTTFGNGQTPVLNLAGHCDPSAGTCTSLSSDIQSCQSQGVKVLLSLGGASGSYSLSSA  110

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA++VA YLWDNFLGG S+SRPLGD  LDGIDF
Sbjct  111  DDAQSVANYLWDNFLGGSSSSRPLGDAVLDGIDF  144



>ref|XP_004955980.1| PREDICTED: acidic endochitinase-like [Setaria italica]
Length=297

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP S  C  LS +I+ C+S G+KV+LS+GGG G YYLS  
Sbjct  56   AFLAAFGNGQPPVLNLAGHCDPTSGGCTSLSADIKSCQSNGVKVMLSIGGGAGSYYLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+NVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  DDAKNVATYLWNNFLGGQSSSRPLGDAVLDGIDF  149



>ref|XP_004306720.1| PREDICTED: acidic endochitinase-like [Fragaria vesca subsp. vesca]
Length=297

 Score =   139 bits (349),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP +N C  LS +I+ C++KG+KV+LS+GGG G YYL+ +
Sbjct  56   AFLPTFGNGQTPMINLAGHCDPYTNGCTGLSSDIKSCQAKGVKVILSIGGGAGSYYLTSK  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  116  EDARQVATYLWNNFLGGTSSSRPLGDAVLDGIDF  149


 Score = 42.4 bits (98),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L++TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLEETCATGNYDYVNL  55



>ref|XP_010910507.1| PREDICTED: acidic endochitinase-like, partial [Elaeis guineensis]
Length=166

 Score =   136 bits (342),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TPVLNLAGHCDP++  CK LS +I+ C+S+G+KVLLSLGG  G Y LS  
Sbjct  52   AFLTTFGNGQTPVLNLAGHCDPSAGTCKGLSSDIKSCQSRGVKVLLSLGGASGSYSLSSA  111

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA++VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  112  ADAQSVANYLWNNFLGGSSSSRPLGAAVLDGIDF  145



>ref|XP_002279205.1| PREDICTED: acidic endochitinase-like [Vitis vinifera]
Length=298

 Score =   139 bits (349),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G TP++NLAGHCDP SN C  LS +I  C++KGIKV+LSLGG  G YYL+  
Sbjct  56   AFLSTFGNGQTPMINLAGHCDPYSNGCTSLSSDINSCQAKGIKVMLSLGGAAGSYYLASS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLWDNFLGG+S+SRPLG+  LDGIDF
Sbjct  116  EDARQVAAYLWDNFLGGKSSSRPLGEAVLDGIDF  149


 Score = 42.0 bits (97),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLAETCGTGNYDFVNI  55



>ref|XP_002456672.1| hypothetical protein SORBIDRAFT_03g040600 [Sorghum bicolor]
 gb|EES01792.1| hypothetical protein SORBIDRAFT_03g040600 [Sorghum bicolor]
Length=303

 Score =   137 bits (346),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG G TPVLNLAGHCDPASN C  +  +I  C+  GIKVLLS+GGGVG Y LS R
Sbjct  61   AFLPTFGKGQTPVLNLAGHCDPASNGCTGVGADIIACQRMGIKVLLSIGGGVGSYGLSSR  120

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+N+LGG+S SRPLGD  LDGIDF
Sbjct  121  DDARTVAAYLWNNYLGGRSKSRPLGDAVLDGIDF  154


 Score = 43.1 bits (100),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC T  Y+ VN+
Sbjct  33   IAIYWGQNGNEGTLAQTCATGNYKFVNV  60



>dbj|BAC65326.1| chitinase III [Vitis vinifera]
Length=297

 Score =   137 bits (346),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PASN C  +S  IR C+++GIKV+LS+GGGVG Y LS  
Sbjct  56   AFLNKFGNGQTPEINLAGHCNPASNGCTSVSTGIRNCQNRGIKVMLSIGGGVGSYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+NVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  NDAQNVANYLWNNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 43.1 bits (100),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC+T  Y  VN+
Sbjct  28   IAIYWGQNGNEGTLTQTCNTGKYSYVNI  55



>ref|XP_008813710.1| PREDICTED: hevamine-A-like [Phoenix dactylifera]
Length=283

 Score =   135 bits (341),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G  P++NLAGHCDP +N C  LSD+IR C+S+GIKV+LS+GGG G YYL+  
Sbjct  42   AFLPTFGNGQNPMINLAGHCDPYTNGCTRLSDDIRSCQSRGIKVMLSIGGGAGSYYLASS  101

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  102  EDAKKVATYLWNNFLGGTSSSRPLGSAVLDGIDF  135


 Score = 44.7 bits (104),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC+T  Y+ VNM
Sbjct  14   IAIYWGQNGNEGSLADTCETGNYKFVNM  41



>emb|CBI22574.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   137 bits (345),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PASN C  +S  IR C+++GIKV+LS+GGGVG Y LS  
Sbjct  70   AFLNKFGNGQTPEINLAGHCNPASNGCTSVSTGIRNCQNRGIKVMLSIGGGVGSYSLSSS  129

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+NVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  130  NDAQNVANYLWNNFLGGQSSSRPLGDAVLDGIDF  163


 Score = 43.1 bits (100),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC+T  Y  VN+
Sbjct  42   IAIYWGQNGNEGTLTQTCNTGKYSYVNI  69



>ref|XP_006837296.1| hypothetical protein AMTR_s00111p00033060 [Amborella trichopoda]
 gb|ERN00150.1| hypothetical protein AMTR_s00111p00033060 [Amborella trichopoda]
Length=298

 Score =   139 bits (350),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP +NLAGHCDP SN C  LSD+IR C+  G+KV+LS+GGG G YYLS  
Sbjct  56   AFLCTFGNGLTPQINLAGHCDPYSNGCTGLSDDIRSCQESGVKVMLSIGGGAGSYYLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA  VAQYLWDNFLGG S+SRPLGD  LDGIDF
Sbjct  116  EDASQVAQYLWDNFLGGTSSSRPLGDAVLDGIDF  149



>ref|XP_006345574.1| PREDICTED: acidic endochitinase-like [Solanum tuberosum]
Length=292

 Score =   138 bits (348),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TPVLNLAGHC+P+   C  LS++IR C+S+GIKV+LSLGGGVG Y LS  
Sbjct  54   AFLVVFGNGQTPVLNLAGHCNPSVGGCTGLSNDIRACQSRGIKVMLSLGGGVGSYSLSSA  113

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DARNVA YLW+N+LGGQS SRPLGD  LDGIDF
Sbjct  114  VDARNVANYLWNNYLGGQSTSRPLGDAILDGIDF  147


 Score = 41.6 bits (96),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I IYWGQNG EGSL  TC +N Y IVN+
Sbjct  26   IVIYWGQNGNEGSLASTCASNNYAIVNI  53



>ref|XP_008791482.1| PREDICTED: hevamine-A-like [Phoenix dactylifera]
Length=293

 Score =   139 bits (350),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TPVLNLAGHCDP++  C  L+ +I+ C+S+G+KV LSLGG  G Y LS  
Sbjct  51   AFLTTFGNGQTPVLNLAGHCDPSAGTCTSLTSDIQSCQSQGVKVFLSLGGASGSYSLSST  110

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+NVAQYLWDNFLGG S+SRPLG   LDGIDF
Sbjct  111  DDAQNVAQYLWDNFLGGSSSSRPLGAAVLDGIDF  144



>ref|XP_004970661.1| PREDICTED: hevamine-A-like [Setaria italica]
Length=299

 Score =   134 bits (338),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG G TPVLNLAGHC+PA+N C  +  +I+ C+S+GIKV LS+GGGVG Y LS  
Sbjct  56   AFLPTFGKGQTPVLNLAGHCNPATNGCTGVGADIKSCQSRGIKVFLSIGGGVGSYGLSSP  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DAR VA+YLWDN+LGG S SRPLGD  LDGIDF
Sbjct  116  ADARKVAKYLWDNYLGGNSKSRPLGDAVLDGIDF  149


 Score = 45.4 bits (106),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            DIAIYWGQNG EG+L QTC T  Y+ VN+
Sbjct  27   DIAIYWGQNGNEGTLAQTCATGNYKFVNV  55



>ref|XP_010915157.1| PREDICTED: acidic endochitinase-like [Elaeis guineensis]
Length=294

 Score =   137 bits (345),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G  P +NLAGHCDP SN C FLS +I+ C+ +G+KV+LS+GGG G Y L+  
Sbjct  51   AFLSTFGNGQNPTINLAGHCDPTSNGCAFLSSQIQACQGQGLKVMLSIGGGAGSYSLASS  110

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA YLW+NFLGGQS SRPLGD  LDGIDF
Sbjct  111  DDAKQVADYLWNNFLGGQSPSRPLGDAVLDGIDF  144


 Score = 42.7 bits (99),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  Y+ VN+
Sbjct  23   IAIYWGQNGNEGSLADTCATGRYKFVNV  50



>ref|XP_006847601.1| hypothetical protein AMTR_s00014p00238430 [Amborella trichopoda]
 gb|ERN09182.1| hypothetical protein AMTR_s00014p00238430 [Amborella trichopoda]
Length=312

 Score =   139 bits (349),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG G TP +NLAGHCDP S  C   SD+I+ C+S+G+KV+LS+GGG G Y L   
Sbjct  76   AFLSTFGRGQTPQINLAGHCDPPSGNCAGFSDQIKSCQSQGVKVMLSIGGGAGSYGLDSA  135

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDARNVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  136  DDARNVADYLWNNFLGGQSSSRPLGDAVLDGIDF  169


 Score = 41.2 bits (95),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
             IAIYWGQNG EGSL+ TC T  +  VN+
Sbjct  47   SIAIYWGQNGNEGSLEDTCSTRNFAYVNI  75



>ref|XP_009375569.1| PREDICTED: acidic endochitinase SE2-like [Pyrus x bretschneideri]
Length=298

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+  TPVLNLAGHCDPAS  C  LS +I+ C+SK IKVLLS+GG  G Y L+  
Sbjct  57   AFLTTFGNNQTPVLNLAGHCDPASGTCTGLSADIKTCQSKNIKVLLSIGGASGSYSLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  117  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  150



>gb|AAS79333.1| endochitinase class III PR3 [Malus domestica]
Length=195

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+   PVLNLAGHCDP S+ C  LS +IR C+S+ IKVLLS+GG VG Y L+  
Sbjct  32   AFLTTFGNNQAPVLNLAGHCDPISSTCTGLSVDIRACQSQNIKVLLSIGGAVGSYNLTSA  91

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  92   DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  125



>ref|XP_010055072.1| PREDICTED: chitinase 1-like [Eucalyptus grandis]
Length=597

 Score =   140 bits (353),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP++N+AGHCDP+S  C  LS EI+ C+++G+KV+LS+GGGVG YYL   
Sbjct  357  AFLNVFGNGQTPMINVAGHCDPSSGGCTGLSSEIKSCQARGVKVMLSIGGGVGSYYLPSA  416

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLWDNFLGGQS+SRPLGD  LDGIDF
Sbjct  417  EDARYVATYLWDNFLGGQSSSRPLGDAVLDGIDF  450


 Score = 39.3 bits (90),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L + C +  Y+ VN+
Sbjct  329  IAIYWGQNGNEGTLAEACASGNYKFVNL  356


 Score =   134 bits (337),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PV+NLAGHCDP S  C  LS +I+ C++ G+KV+LS+GG  G YYL+  
Sbjct  56   AFLVVFGNGQAPVVNLAGHCDPPSGGCTGLSSDIKSCQAGGVKVMLSIGGSAGSYYLASA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA YLWDNFLGGQS+SRPLGD  LDGIDF
Sbjct  116  DDAKQVATYLWDNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 42.4 bits (98),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            +IA+YWGQNG EGSL  TC +  Y IVN+
Sbjct  27   EIAVYWGQNGGEGSLADTCASGNYNIVNL  55



>ref|XP_008347023.1| PREDICTED: hevamine-A-like [Malus domestica]
Length=298

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP +N C  LS +I+ C+SKGIKV+LS+GGG G YYL+ +
Sbjct  57   AFLPTFGNGQTPMINLAGHCDPYTNGCTGLSSDIKSCQSKGIKVILSIGGGAGSYYLTSK  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG S+SRPLG  +LDGIDF
Sbjct  117  EDARQVATYLWNNFLGGTSSSRPLGAAALDGIDF  150



>ref|XP_007051676.1| Hevamine-A precursor [Theobroma cacao]
 gb|EOX95833.1| Hevamine-A precursor [Theobroma cacao]
Length=525

 Score =   138 bits (347),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP SN C  LS +I+ C+ KGIKV+LS+GGG G YYLS  
Sbjct  354  AFLATFGNGQTPMINLAGHCDPYSNGCTGLSSDIKSCQEKGIKVILSIGGGAGSYYLSSA  413

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  414  EDAKQVATYLWNNFLGGKSSSRPLGDAVLDGIDF  447


 Score = 41.6 bits (96),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  326  IAIYWGQNGNEGTLAETCATGNYDFVNV  353


 Score =   109 bits (272),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  P+L+L GHCDP+ N C  LS +I+ C++KGIKV+LS+GGG G Y L+  
Sbjct  57   AFLPKFGNGRRPMLDLGGHCDPSGNGCTGLSSDIKLCQAKGIKVMLSIGGGAGFYSLASS  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGG+S +       LDGIDF
Sbjct  117  DDARQVATYLWNNFLGGRSPT-----PVLDGIDF  145


 Score = 38.1 bits (87),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQN  EG+L +TC    Y+ VN+
Sbjct  29   IAIYWGQNDEEGTLAETCAAGKYDFVNV  56



>ref|XP_008780850.1| PREDICTED: acidic endochitinase-like, partial [Phoenix dactylifera]
Length=183

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G  P++NLAGHCDP +N C  LSD+IR C+S+G+KV+LS+GGG G YYL+  
Sbjct  40   AFLPTFGNGQNPMINLAGHCDPYTNGCTSLSDDIRSCQSRGVKVMLSIGGGAGSYYLASS  99

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  100  EDAKQVATYLWNNFLGGSSSSRPLGSAVLDGIDF  133



>ref|XP_006832973.1| hypothetical protein AMTR_s00095p00172710 [Amborella trichopoda]
 gb|ERM98251.1| hypothetical protein AMTR_s00095p00172710 [Amborella trichopoda]
Length=302

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G  P +NLAGHCDP SN C  LSD+IR C+ +G+KVLLS+GGG G YYL+  
Sbjct  60   AFLATFGNGQIPQINLAGHCDPYSNGCTGLSDDIRSCQKQGVKVLLSIGGGAGSYYLASS  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA+YLW+N+LGGQS+SRPLGD  LDG+DF
Sbjct  120  DDAKQVARYLWNNYLGGQSSSRPLGDAVLDGVDF  153



>dbj|BAA08708.1| chitinase [Psophocarpus tetragonolobus]
Length=298

 Score =   135 bits (339),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG G TP LNLAGHCDP+SN C   S EI+ C+++GIKVLLSLGG  G Y L+  
Sbjct  56   AFLSTFGSGQTPQLNLAGHCDPSSNGCTGFSSEIQTCQNRGIKVLLSLGGSAGTYSLNSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  +A YLWDNFLGGQS SRPLGD  LDG+DF
Sbjct  116  DDATQLANYLWDNFLGGQSGSRPLGDAVLDGVDF  149


 Score = 44.3 bits (103),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IA+YWGQNG EGSL  TC+T  YE VN+
Sbjct  28   IAVYWGQNGGEGSLADTCNTGNYEFVNI  55



>ref|XP_007219784.1| hypothetical protein PRUPE_ppa024550mg [Prunus persica]
 gb|EMJ20983.1| hypothetical protein PRUPE_ppa024550mg [Prunus persica]
Length=299

 Score =   138 bits (348),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG+G TPV+NLAGHCDP++N+C  LS +I+ C++KGIKV+LS+GGG G Y L+  
Sbjct  57   AFLSSFGNGQTPVINLAGHCDPSTNECTKLSPQIKSCQAKGIKVILSIGGGAGSYSLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  117  DDARQVATYLWNNFLGGHSSSRPLGAAVLDGIDF  150


 Score = 40.8 bits (94),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC +  Y+ VN+
Sbjct  29   IAIYWGQNGNEGTLAETCASGNYQFVNI  56



>ref|XP_009352075.1| PREDICTED: acidic endochitinase-like [Pyrus x bretschneideri]
Length=299

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+  TPVLNLAGHCDPAS  C  LS +IR C+SK IKVLLS+GG  G Y L+  
Sbjct  57   AFLITFGNNQTPVLNLAGHCDPASGTCTGLSADIRTCQSKNIKVLLSIGGASGSYSLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  117  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  150



>ref|XP_009352115.1| PREDICTED: acidic endochitinase SE2-like [Pyrus x bretschneideri]
Length=276

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+   PVLNLAGHCDP+S+ C  LS +IR C+S+ IKVLLS+GG VG Y L+  
Sbjct  57   AFLTTFGNNQAPVLNLAGHCDPSSSTCTGLSVDIRACQSQNIKVLLSIGGAVGSYNLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  117  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  150



>ref|NP_001268048.1| acidic endochitinase precursor [Vitis vinifera]
 sp|P51614.1|CHIT3_VITVI RecName: Full=Acidic endochitinase; Flags: Precursor [Vitis vinifera]
 emb|CAA92207.1| acidic chitinase [Vitis vinifera]
Length=301

 Score =   136 bits (342),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PASN C  +S  IR C+++GIKV+LS+GGG G Y LS  
Sbjct  56   AFLNKFGNGQTPEINLAGHCNPASNGCTSVSTGIRNCQNRGIKVMLSIGGGAGSYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+NVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  NDAQNVANYLWNNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 43.1 bits (100),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC+T  Y  VN+
Sbjct  28   IAIYWGQNGNEGTLTQTCNTGKYSYVNI  55



>gb|ACH54087.1| class III chitinase [Vitis vinifera]
Length=297

 Score =   135 bits (341),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PASN C  +S  IR C+++GIKV+LS+GGG G Y LS  
Sbjct  56   AFLNKFGNGQTPEINLAGHCNPASNGCTSVSTGIRNCQNRGIKVMLSIGGGAGSYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+NVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  NDAQNVANYLWNNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 43.1 bits (100),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC+T  Y  VN+
Sbjct  28   IAIYWGQNGNEGTLTQTCNTGKYSYVNI  55



>ref|XP_010911581.1| PREDICTED: hevamine-A-like [Elaeis guineensis]
Length=298

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TPVLNLAGHCDP++  C  LS +I+ C+S+G+KV LSLGG VG Y LS  
Sbjct  51   AFLTTFGNGQTPVLNLAGHCDPSAGTCTSLSSDIQSCQSQGVKVFLSLGGAVGSYSLSSA  110

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA++VA YLWDNFLGG S+SRPLGD  LDGIDF
Sbjct  111  EDAQSVANYLWDNFLGGSSSSRPLGDAVLDGIDF  144



>ref|XP_007219586.1| hypothetical protein PRUPE_ppa023419mg [Prunus persica]
 gb|EMJ20785.1| hypothetical protein PRUPE_ppa023419mg [Prunus persica]
Length=299

 Score =   134 bits (337),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP +N C  LS +I+ C++KG+KV+LS+GGG G YYL+ +
Sbjct  56   AFLPTFGNGQTPMINLAGHCDPYTNGCTGLSSDIKSCQAKGVKVILSIGGGAGSYYLTSK  115

Query  102  DDARNVAQYLWDNFLGGQSA-SRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG S+ SRPLGD  LDGIDF
Sbjct  116  EDARQVATYLWNNFLGGSSSTSRPLGDAVLDGIDF  150


 Score = 44.7 bits (104),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L++TC T  YE VN+
Sbjct  28   IAIYWGQNGNEGTLEETCATGNYEFVNL  55



>ref|XP_010251576.1| PREDICTED: acidic endochitinase-like [Nelumbo nucifera]
Length=298

 Score =   138 bits (347),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+P +  CK +S+ IR C+S+GIKV+LSLGGG+G Y LS  
Sbjct  56   AFLNKFGNGQTPEINLAGHCNPFTGGCKRVSNGIRNCQSQGIKVMLSLGGGIGSYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA+YLW+NFLGGQSASRPLGD  LDGIDF
Sbjct  116  DDARQVAEYLWNNFLGGQSASRPLGDAVLDGIDF  149


 Score = 40.8 bits (94),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y  VN+
Sbjct  28   IAIYWGQNGNEGTLTETCATGRYAYVNI  55



>emb|CBI40448.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   137 bits (344),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G TP++NLAGHCDP SN C  LS +I  C++KGIKV+LS+GGG G YYL+ +
Sbjct  253  AFLSTFGNGQTPMINLAGHCDPYSNGCTSLSSDINSCQAKGIKVILSIGGGAGSYYLTSK  312

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA  VA YLW+NFLGGQS+SRPLG   LDGIDF
Sbjct  313  EDAGQVATYLWNNFLGGQSSSRPLGPAVLDGIDF  346


 Score = 42.0 bits (97),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  225  IAIYWGQNGNEGTLAETCGTGNYDFVNI  252


 Score = 79.7 bits (195),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGV  127
            AFL+TFG+G TP++NLAGHCDP SN C  LS EI+ C+++GIKV+LSLGGGV
Sbjct  56   AFLSTFGNGRTPMINLAGHCDPYSNGCTDLSTEIKSCQARGIKVMLSLGGGV  107


 Score = 42.4 bits (98),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLAETCATGNYDFVNL  55



>ref|XP_009368700.1| PREDICTED: hevamine-A-like [Pyrus x bretschneideri]
Length=299

 Score =   137 bits (346),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TP +NLAGHCDP +++C  LS EI+ C++KGIKV+LS+GG  G Y L+  
Sbjct  57   AFLTTFGNGQTPAINLAGHCDPTTDECTKLSPEIKSCQAKGIKVILSIGGASGSYSLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGGQS+SRPLG   LDGIDF
Sbjct  117  DDARQVATYLWNNFLGGQSSSRPLGAAVLDGIDF  150


 Score = 40.8 bits (94),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC +  Y+ VN+
Sbjct  29   IAIYWGQNGNEGTLAETCASGNYQFVNV  56



>emb|CDP10880.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP LNLAGHCDP+S  CK LSD IR C+ +GIKV+LS+GG +G Y LS  
Sbjct  52   AFLPTFGNGRTPKLNLAGHCDPSSGGCKKLSDSIRQCQRRGIKVMLSIGGHIGSYSLSSA  111

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG+S SRPLGD  LDGIDF
Sbjct  112  NDARQVADYLWNNFLGGKSKSRPLGDAVLDGIDF  145



>ref|XP_006490121.1| PREDICTED: acidic endochitinase-like [Citrus sinensis]
Length=308

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G TP +NLAGHCDP +N C  LS+EI+ C+ +GIKVLLS+GG  G Y LS  
Sbjct  69   AFLSTFGNGQTPQINLAGHCDPTNNGCAGLSNEIKTCQGQGIKVLLSIGGASGSYSLSSA  128

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VAQ+LWD+FLGGQS+SRPLGD  LDGIDF
Sbjct  129  DDARQVAQFLWDHFLGGQSSSRPLGDAVLDGIDF  162



>gb|ABN03967.1| acidic chitinase [Gossypium hirsutum]
Length=298

 Score =   135 bits (340),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -1

Query  279  FLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFRD  100
            FL TFG+G TP LNLAGHC+PASN C  LS EI+ C+++GIKV+LSLGGG G Y L+ ++
Sbjct  58   FLNTFGNGATPGLNLAGHCNPASNGCTSLSGEIKSCQNQGIKVMLSLGGGAGSYSLASQE  117

Query  99   DARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DA++VA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  118  DAKSVADYLWNNFLGGTSSSRPLGDAVLDGIDF  150


 Score = 43.1 bits (100),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            DIAIYWGQNG EG+L  TC T  Y+ VN+
Sbjct  28   DIAIYWGQNGNEGTLSDTCATGRYKYVNI  56



>gb|ACM45715.1| class III chitinase [Pyrus pyrifolia]
 gb|AIL82438.1| chitinase ppl-1 [Pyrus x bretschneideri]
Length=298

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+  TPVLNLAGHCDPAS  C  LS +IR C+SK IKVLLS+GG  G Y L+  
Sbjct  57   AFLITFGNNQTPVLNLAGHCDPASGTCTGLSADIRTCQSKNIKVLLSIGGASGSYSLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  117  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  150



>ref|XP_008376664.1| PREDICTED: hevamine-A-like [Malus domestica]
Length=299

 Score =   137 bits (346),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TP +NLAGHCDP + +C  LS EI+ C++KGIKV+LS+GG  G Y L+  
Sbjct  57   AFLTTFGNGQTPAINLAGHCDPTTEECTKLSPEIKSCQAKGIKVILSIGGASGSYSLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGGQS+SRPLG   LDGIDF
Sbjct  117  DDARQVATYLWNNFLGGQSSSRPLGAAVLDGIDF  150


 Score = 40.8 bits (94),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC +  Y+ VN+
Sbjct  29   IAIYWGQNGNEGTLAETCASGNYQFVNV  56



>gb|AAG25709.1|AF309514_1 class III acidic chitinase [Malus domestica]
Length=299

 Score =   137 bits (346),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TP +NLAGHCDP + +C  LS EI+ C++KGIKV+LS+GG  G Y L+  
Sbjct  57   AFLTTFGNGQTPAINLAGHCDPTTEECTKLSPEIKSCQAKGIKVILSIGGASGSYSLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGGQS+SRPLG   LDGIDF
Sbjct  117  DDARQVATYLWNNFLGGQSSSRPLGAAVLDGIDF  150


 Score = 40.8 bits (94),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC +  Y+ VN+
Sbjct  29   IAIYWGQNGNEGTLAETCASGNYQFVNV  56



>ref|XP_009341134.1| PREDICTED: hevamine-A-like [Pyrus x bretschneideri]
Length=298

 Score =   137 bits (346),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP +N C  LS +I+ C+SKGIKV+LS+GGG G YYL+ +
Sbjct  57   AFLPTFGNGQTPMINLAGHCDPYTNGCTGLSSDIKSCQSKGIKVILSIGGGAGSYYLTSK  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  117  EDARQVATYLWNNFLGGTSSSRPLGAAVLDGIDF  150


 Score = 40.8 bits (94),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIV  288
            IAIYWGQNG EG+L++TC T  YE V
Sbjct  29   IAIYWGQNGNEGTLEETCATGNYEYV  54



>emb|CDP09309.1| unnamed protein product [Coffea canephora]
Length=265

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP LNLAGHCDP+ N C  LS +I+ C++KG+KV+LS+GGG G YYL+  
Sbjct  56   AFLCTFGNGQTPQLNLAGHCDPSVNGCTGLSSDIKSCQAKGVKVILSIGGGAGSYYLASA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+N+LGGQS+SRPLGD  LDG+DF
Sbjct  116  EDARQVATYLWNNYLGGQSSSRPLGDAVLDGVDF  149



>ref|XP_009345618.1| PREDICTED: hevamine-A-like [Pyrus x bretschneideri]
 ref|XP_009345626.1| PREDICTED: hevamine-A-like [Pyrus x bretschneideri]
Length=298

 Score =   137 bits (346),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP +N C  LS +I+ C+SKGIKV+LS+GGG G YYL+ +
Sbjct  57   AFLPTFGNGQTPMINLAGHCDPYTNGCTGLSSDIKSCQSKGIKVILSIGGGAGSYYLTSK  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  117  EDARQVATYLWNNFLGGTSSSRPLGAAVLDGIDF  150


 Score = 40.8 bits (94),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIV  288
            IAIYWGQNG EG+L++TC T  YE V
Sbjct  29   IAIYWGQNGNEGTLEETCATGNYEYV  54



>ref|XP_002530928.1| hevamine-A precursor, putative [Ricinus communis]
 gb|EEF31443.1| hevamine-A precursor, putative [Ricinus communis]
Length=298

 Score =   137 bits (345),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP SN C  LS +I+ C++KGIKV+LS+GGG G YYL+  
Sbjct  56   AFLPTFGNGQTPMINLAGHCDPYSNGCTGLSSDIKSCQAKGIKVMLSIGGGAGSYYLASA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  116  EDARQVATYLWNNFLGGNSSSRPLGPAVLDGIDF  149


 Score = 41.2 bits (95),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y  VN+
Sbjct  28   IAIYWGQNGNEGTLAETCATGNYAFVNI  55



>ref|XP_011084476.1| PREDICTED: acidic endochitinase SE2-like [Sesamum indicum]
Length=292

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG G TPVLNLAGHCDP S  C  +S++IR C+S+GIK+LLSLGG  G Y LS  
Sbjct  55   AFLTTFGSGQTPVLNLAGHCDPPSGTCTGISNDIRTCQSRGIKILLSLGGATGSYSLSSP  114

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+ FLGG S+SRPLGD  LDGIDF
Sbjct  115  DDARQVADYLWNTFLGGSSSSRPLGDAVLDGIDF  148



>ref|XP_007218751.1| hypothetical protein PRUPE_ppa009328mg [Prunus persica]
 gb|EMJ19950.1| hypothetical protein PRUPE_ppa009328mg [Prunus persica]
Length=297

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G TPVLNLA HCDP++N C  LS +I+ C++K IKVLLS+GGG G Y L+  
Sbjct  60   AFLSTFGNGQTPVLNLAAHCDPSTNGCTSLSTDIKACQAKNIKVLLSIGGGAGSYSLTSA  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGGQ+ SRPLGD  LDGIDF
Sbjct  120  DDARQVADYLWNNFLGGQANSRPLGDAVLDGIDF  153



>dbj|BAA22266.1| basic class III chitinase OsChib3b [Oryza sativa Japonica Group]
Length=305

 Score =   135 bits (340),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG G TPVLNLAGHCDPASN C  +  +I+ C+S GIKV+ S+GGGVG+Y LS R
Sbjct  60   AFLPVFGKGQTPVLNLAGHCDPASNGCTGVGADIKSCQSLGIKVMFSIGGGVGNYGLSSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA YLW+N+LGG S SRPLGD  +DGIDF
Sbjct  120  DDAKQVAAYLWNNYLGGTSPSRPLGDAVMDGIDF  153


 Score = 43.1 bits (100),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIV  288
            DIAIYWGQNG EG+L QTC T  Y  V
Sbjct  31   DIAIYWGQNGNEGTLAQTCATGNYRFV  57



>ref|XP_008343773.1| PREDICTED: acidic endochitinase-like [Malus domestica]
Length=316

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+  TPVLNLAGHCDP S  C  LS +IR C+SK IKVLLS+GG  G Y L+  
Sbjct  74   AFLTTFGNNQTPVLNLAGHCDPXSGTCTGLSADIRTCQSKNIKVLLSIGGXAGSYSLTSA  133

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  134  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  167



>ref|XP_002279182.1| PREDICTED: acidic endochitinase [Vitis vinifera]
Length=298

 Score =   136 bits (342),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G TP++NLAGHCDP SN C  LS +I  C++KGIKV+LS+GGG G YYL+ +
Sbjct  56   AFLSTFGNGQTPMINLAGHCDPYSNGCTGLSSDINSCQAKGIKVILSIGGGAGSYYLTSK  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA  VA YLW+NFLGGQS+SRPLG   LDGIDF
Sbjct  116  EDAGQVATYLWNNFLGGQSSSRPLGPAVLDGIDF  149


 Score = 42.0 bits (97),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLAETCGTGNYDFVNI  55



>ref|XP_011001947.1| PREDICTED: acidic endochitinase-like [Populus euphratica]
Length=294

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G TPVLNLAGHC+P++N C  LS +I+ C+ KGIKVLLS+GG  G Y LS  
Sbjct  56   AFLSTFGNGQTPVLNLAGHCNPSANTCTGLSADIKACQGKGIKVLLSIGGASGTYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQS+SRPLGD  LDG+DF
Sbjct  116  DDARRVANYIWNNFLGGQSSSRPLGDAILDGVDF  149



>gb|AFM77009.1| pathogenesis related protein 3, partial [Malus domestica]
Length=243

 Score =   136 bits (342),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+   PVLNLAGHCDPAS  C  LS +IR C+SK IKVLLS+GG  G Y L+  
Sbjct  27   AFLMTFGNNQAPVLNLAGHCDPASGTCTGLSADIRTCQSKNIKVLLSIGGAAGSYSLTSA  86

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  87   DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  120



>ref|XP_002301383.1| chitinase family protein [Populus trichocarpa]
 gb|EEE80656.1| chitinase family protein [Populus trichocarpa]
Length=298

 Score =   135 bits (339),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G TP++NLAGHCDP SN C  LS EI+ C++KG+KV+LS+GG  G YYL+  
Sbjct  56   AFLSTFGNGQTPMINLAGHCDPYSNGCTGLSSEIKSCQAKGVKVMLSIGGAAGSYYLASS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG ++SRPLG   LDG+DF
Sbjct  116  EDARQVAVYLWNNFLGGNTSSRPLGPAVLDGVDF  149


 Score = 42.7 bits (99),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  YE VN+
Sbjct  28   IAIYWGQNGNEGTLAETCATGNYEYVNL  55



>gb|AFM77006.1| pathogenesis related protein 3, partial [Cydonia oblonga]
Length=305

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+   PVLNLAGHCDPAS  C  LS +IR C+SK IKVLLS+GG  G Y L+  
Sbjct  36   AFLTTFGNNQAPVLNLAGHCDPASGTCTGLSADIRACQSKNIKVLLSIGGASGSYSLTSA  95

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  96   DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  129



>ref|XP_009375572.1| PREDICTED: acidic endochitinase SE2-like [Pyrus x bretschneideri]
Length=315

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+  TPVLNLAGHCDPAS  C  LS +I+ C+S+ IKVLLS+GG  G Y L+  
Sbjct  74   AFLTTFGNNQTPVLNLAGHCDPASGTCTGLSADIKTCQSQNIKVLLSIGGASGSYSLTSA  133

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  134  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  167



>ref|XP_010277995.1| PREDICTED: acidic endochitinase-like [Nelumbo nucifera]
Length=290

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP LNLAGHC+P+ N C  LS++IR C+S+GIKVLLSLGGGVG Y L+  
Sbjct  53   AFLVTFGNGQTPQLNLAGHCNPSINGCTGLSNDIRACQSRGIKVLLSLGGGVGSYTLTSP  112

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGGQS SRPLG   LDGIDF
Sbjct  113  EDARKVANYLWNNFLGGQSNSRPLGGAVLDGIDF  146



>ref|NP_001044872.1| Os01g0860500 [Oryza sativa Japonica Group]
 dbj|BAA23809.1| chitinase [Oryza sativa Japonica Group]
 dbj|BAD82025.1| chitinase [Oryza sativa Japonica Group]
 dbj|BAD82632.1| chitinase [Oryza sativa Japonica Group]
 dbj|BAF06786.1| Os01g0860500 [Oryza sativa Japonica Group]
 dbj|BAG96431.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93972.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86823.1| unnamed protein product [Oryza sativa Japonica Group]
Length=305

 Score =   135 bits (339),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG G TPVLNLAGHCDPASN C  +  +I+ C+S GIKV+ S+GGGVG+Y LS R
Sbjct  60   AFLPVFGKGQTPVLNLAGHCDPASNGCTGVGADIKSCQSLGIKVMFSIGGGVGNYGLSSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA YLW+N+LGG S SRPLGD  +DGIDF
Sbjct  120  DDAKQVAAYLWNNYLGGTSPSRPLGDAVMDGIDF  153


 Score = 42.7 bits (99),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIV  288
            DIAIYWGQNG EG+L QTC T  Y  V
Sbjct  31   DIAIYWGQNGNEGTLAQTCATGNYRFV  57



>ref|XP_008380409.1| PREDICTED: acidic endochitinase-like [Malus domestica]
Length=299

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+  TPVLNLAGHCDP+S  C  LS +IR C+SK IKVLLS+GG  G Y L+  
Sbjct  57   AFLXTFGNNQTPVLNLAGHCDPSSGTCTGLSADIRTCQSKNIKVLLSIGGAAGSYSLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  117  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  150



>ref|XP_010934768.1| PREDICTED: acidic endochitinase-like [Elaeis guineensis]
Length=309

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TPVLNLAGHCDP++  C  LS +I+ C+S+ +KVLLSLGGG G+Y LS  
Sbjct  51   AFLTTFGNGQTPVLNLAGHCDPSAGGCTSLSSDIQSCQSQEVKVLLSLGGGSGNYSLSSA  110

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA++VA YLWDN+LGG S+SRPLGD  LDGIDF
Sbjct  111  DDAQSVANYLWDNYLGGSSSSRPLGDAVLDGIDF  144



>gb|AAQ07267.1| acidic chitinase [Ficus pumila var. awkeotsang]
Length=292

 Score =   132 bits (333),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PA   C  +SD IR C+S+GIKV+LS+GGG+G Y LS  
Sbjct  50   AFLNIFGNGQTPQINLAGHCNPALKTCTVISDGIRSCQSRGIKVMLSIGGGIGRYSLSSA  109

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGG+S SRPLGD  LDGIDF
Sbjct  110  MDAKNVADYLWNNFLGGKSLSRPLGDAVLDGIDF  143


 Score = 45.1 bits (105),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC T  Y IVN+
Sbjct  22   IAIYWGQNGNEGTLSQTCATGKYSIVNI  49



>gb|KHN02009.1| Acidic endochitinase SE2 [Glycine soja]
Length=296

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 80/108 (74%), Gaps = 5/108 (5%)
 Frame = -1

Query  324  TTNLRHQLLRDRKHAFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLL  145
            T N  + +L     AFL TFG+G TP++NLAGHCDP SN+C  LS +I+ C++KGIKVLL
Sbjct  46   TGNYEYAIL-----AFLPTFGNGQTPMINLAGHCDPYSNECTKLSSDIKSCQAKGIKVLL  100

Query  144  SLGGGVGDYYLSFRDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            SLGGG G Y+L+   DAR VA YLW+NFLGG S SRPLG   LDGIDF
Sbjct  101  SLGGGAGSYFLASPQDARQVATYLWNNFLGGSSPSRPLGPAVLDGIDF  148



>ref|XP_008347250.1| PREDICTED: acidic endochitinase-like [Malus domestica]
Length=297

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+   PVLNLAGHCDP S+ C  LS +IR C+S+ IKVLLS+GG VG Y L+  
Sbjct  57   AFLTTFGNNQAPVLNLAGHCDPISSTCTGLSVDIRACQSQNIKVLLSIGGAVGSYNLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  117  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  150



>ref|XP_003518754.1| PREDICTED: hevamine-A-like [Glycine max]
Length=296

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 80/108 (74%), Gaps = 5/108 (5%)
 Frame = -1

Query  324  TTNLRHQLLRDRKHAFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLL  145
            T N  + +L     AFL TFG+G TP++NLAGHCDP SN+C  LS +I+ C++KGIKVLL
Sbjct  46   TGNYEYAIL-----AFLPTFGNGQTPMINLAGHCDPYSNECTKLSSDIKSCQAKGIKVLL  100

Query  144  SLGGGVGDYYLSFRDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            SLGGG G Y+L+   DAR VA YLW+NFLGG S SRPLG   LDGIDF
Sbjct  101  SLGGGAGSYFLASPQDARQVATYLWNNFLGGSSPSRPLGPAVLDGIDF  148



>gb|AAF64474.1|AF241266_1 chitinase 1 [Cucumis melo]
Length=292

 Score =   133 bits (334),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG G TPVLNLAGHC+P +N C FLSDEI  C+S+ +KVLLS+GGG G Y LS  
Sbjct  56   AFLSSFGSGQTPVLNLAGHCNPDNNGCAFLSDEINSCQSQNVKVLLSIGGGAGSYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA +LW+++LGGQS SRPLG   L+GIDF
Sbjct  116  DDARQVANFLWNSYLGGQSDSRPLGAAVLNGIDF  149


 Score = 44.3 bits (103),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  YE VN+
Sbjct  28   IAIYWGQNGNEGSLASTCATGNYEFVNI  55



>ref|XP_008437557.1| PREDICTED: acidic endochitinase [Cucumis melo]
Length=292

 Score =   133 bits (334),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG G TPVLNLAGHC+P +N C FLSDEI  C+S+ +KVLLS+GGG G Y LS  
Sbjct  56   AFLSSFGSGQTPVLNLAGHCNPDNNGCAFLSDEINSCQSQNVKVLLSIGGGAGSYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA +LW+++LGGQS SRPLG   L+GIDF
Sbjct  116  DDARQVANFLWNSYLGGQSDSRPLGAAVLNGIDF  149


 Score = 44.3 bits (103),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  YE VN+
Sbjct  28   IAIYWGQNGNEGSLASTCATGNYEFVNI  55



>gb|AAC37394.1| ORF 1 [Cucumis sativus]
Length=323

 Score =   133 bits (334),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG G TPVLNLAGHC+P +N C F+SDEI  C+S+ +KVLLS+GGGVG Y LS  
Sbjct  57   AFLSSFGSGQTPVLNLAGHCNPDNNGCAFVSDEINSCQSQNVKVLLSIGGGVGRYSLSSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            ++A+ VA +LW+N+LGGQS SRPLGD  LDG+DF
Sbjct  117  NNAKQVAGFLWNNYLGGQSDSRPLGDAVLDGVDF  150


 Score = 44.3 bits (103),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  YE VN+
Sbjct  29   IAIYWGQNGNEGSLASTCATGNYEFVNI  56



>ref|XP_011023258.1| PREDICTED: hevamine-A-like [Populus euphratica]
Length=298

 Score =   134 bits (338),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G TP++NLAGHCDP SN C  LS EI+ C++KG+KV+LS+GG  G YYL+  
Sbjct  56   AFLSTFGNGQTPMINLAGHCDPYSNGCTGLSSEIKSCQAKGVKVMLSIGGAAGSYYLASS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG ++SRPLG   LDG+DF
Sbjct  116  EDARQVAVYLWNNFLGGYTSSRPLGPAVLDGVDF  149


 Score = 42.7 bits (99),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  YE VN+
Sbjct  28   IAIYWGQNGNEGTLAETCATGNYEYVNL  55



>emb|CDP10876.1| unnamed protein product [Coffea canephora]
Length=301

 Score =   137 bits (345),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -1

Query  303  LLRDRKHAFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVG  124
            L R    AFL TFG+G TP LNLAGHC+P+S  CK LS+ IR C+S+GIKV+LS+GGG G
Sbjct  50   LYRVVNIAFLPTFGNGQTPKLNLAGHCEPSSGDCKKLSENIRQCQSQGIKVMLSIGGGNG  109

Query  123  DYYLSFRDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             Y LS  +DA+ VA YLW+NFLGG+S SRPLGD  LDGIDF
Sbjct  110  SYSLSSANDAKQVADYLWNNFLGGKSNSRPLGDAVLDGIDF  150



>ref|XP_002511934.1| hevamine-A precursor, putative [Ricinus communis]
 gb|EEF50603.1| hevamine-A precursor, putative [Ricinus communis]
Length=298

 Score =   136 bits (342),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG G TP++NLAGHCDP SN C  LS EI  C++KG+KVLLS+GGGV  Y LS  
Sbjct  56   AFLSTFGGGRTPMINLAGHCDPYSNGCTNLSSEIISCQAKGVKVLLSIGGGVVSYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGGQS+SRPLG   LDGIDF
Sbjct  116  DDARQVATYLWNNFLGGQSSSRPLGPAVLDGIDF  149


 Score = 41.2 bits (95),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLAETCATGNYKYVNL  55



>ref|XP_004145978.1| PREDICTED: acidic endochitinase-like [Cucumis sativus]
Length=323

 Score =   133 bits (334),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG G TPVLNLAGHC+P +N C F+SDEI  C+S+ +KVLLS+GGGVG Y LS  
Sbjct  57   AFLSSFGSGQTPVLNLAGHCNPDNNGCAFVSDEINSCQSQNVKVLLSIGGGVGRYSLSSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            ++A+ VA +LW+N+LGGQS SRPLGD  LDG+DF
Sbjct  117  NNAKQVAGFLWNNYLGGQSDSRPLGDAVLDGVDF  150


 Score = 44.3 bits (103),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  YE VN+
Sbjct  29   IAIYWGQNGNEGSLASTCATGNYEFVNI  56



>gb|AFM77008.1| pathogenesis related protein 3, partial [Pyrus communis]
Length=252

 Score =   135 bits (341),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            A+L+TFG+  TPVLNLAGHCDPAS  C  LS +IR C+S+ IKVLLS+GG  G Y L+  
Sbjct  12   AYLSTFGNNQTPVLNLAGHCDPASGTCTGLSADIRTCQSQNIKVLLSIGGASGSYSLTSA  71

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  72   DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  105



>gb|EAZ14223.1| hypothetical protein OsJ_04148 [Oryza sativa Japonica Group]
Length=296

 Score =   134 bits (338),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG G TPVLNLAGHCDPASN C  +  +I+ C+S GIKV+ S+GGGVG+Y LS R
Sbjct  51   AFLPVFGKGQTPVLNLAGHCDPASNGCTGVGADIKSCQSLGIKVMFSIGGGVGNYGLSSR  110

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA YLW+N+LGG S SRPLGD  +DGIDF
Sbjct  111  DDAKQVAAYLWNNYLGGTSPSRPLGDAVMDGIDF  144


 Score = 42.7 bits (99),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIV  288
            DIAIYWGQNG EG+L QTC T  Y  V
Sbjct  22   DIAIYWGQNGNEGTLAQTCATGNYRFV  48



>ref|XP_007133288.1| hypothetical protein PHAVU_011G167300g [Phaseolus vulgaris]
 gb|ESW05282.1| hypothetical protein PHAVU_011G167300g [Phaseolus vulgaris]
Length=297

 Score =   137 bits (344),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG G TP LNLAGHCDP++N C   SD+I+ C+SKGIKVLLSLGG  G Y LS  
Sbjct  60   AFLSTFGGGQTPQLNLAGHCDPSTNGCTQFSDQIKACQSKGIKVLLSLGGASGSYSLSSA  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA ++W+NFLGGQS+SRPLGD  LDG+DF
Sbjct  120  DDATQVANFIWNNFLGGQSSSRPLGDAVLDGVDF  153



>ref|XP_002264903.1| PREDICTED: acidic endochitinase-like [Vitis vinifera]
Length=297

 Score =   134 bits (336),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHCD ASN C  +S +I  C+S+G+KV+LS+GG +G Y LS  
Sbjct  56   AFLNKFGNGQTPEINLAGHCDSASNGCTSVSTDISNCQSQGVKVMLSIGGAIGSYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+NVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  DDAQNVANYLWNNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 43.1 bits (100),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC+T  Y  VN+
Sbjct  28   IAIYWGQNGNEGTLTQTCNTGKYSYVNI  55



>gb|EMT30610.1| Acidic endochitinase [Aegilops tauschii]
Length=298

 Score =   135 bits (340),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP ++ C  LS +I+ C+S+G+KV+LS+GGG G YYLS  
Sbjct  57   AFLAAFGNGQPPVLNLAGHCDPTNSGCAKLSSDIKSCQSRGVKVILSIGGGAGSYYLSST  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  117  QDAKNVATYLWNNFLGGKSSSRPLGDAVLDGIDF  150


 Score = 41.6 bits (96),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L +TC T  Y+ VN+
Sbjct  29   ISIYWGQNGGEGTLAETCATGNYKFVNL  56



>gb|KCW71549.1| hypothetical protein EUGRSUZ_E00091 [Eucalyptus grandis]
Length=297

 Score =   134 bits (338),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PV+NLAGHCDP S  C  LS +I+ C++ G+KV+LS+GG  G YYL+  
Sbjct  56   AFLVVFGNGQAPVVNLAGHCDPPSGGCTGLSSDIKSCQAGGVKVMLSIGGSAGSYYLASA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA YLWDNFLGGQS+SRPLGD  LDGIDF
Sbjct  116  DDAKQVATYLWDNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 42.4 bits (98),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            +IA+YWGQNG EGSL  TC +  Y IVN+
Sbjct  27   EIAVYWGQNGGEGSLADTCASGNYNIVNL  55



>gb|EAY76569.1| hypothetical protein OsI_04515 [Oryza sativa Indica Group]
Length=296

 Score =   134 bits (337),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG G TPVLNLAGHCDPASN C  +  +I+ C+S GIKV+ S+GGGVG+Y LS R
Sbjct  51   AFLPVFGKGQTPVLNLAGHCDPASNGCTGVGADIKSCQSLGIKVMFSIGGGVGNYGLSSR  110

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA YLW+N+LGG S SRPLGD  +DGIDF
Sbjct  111  DDAKQVAAYLWNNYLGGTSPSRPLGDAVMDGIDF  144


 Score = 42.4 bits (98),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIV  288
            DIAIYWGQNG EG+L QTC T  Y  V
Sbjct  22   DIAIYWGQNGNEGTLAQTCATGNYRFV  48



>ref|XP_004303559.1| PREDICTED: hevamine-A-like [Fragaria vesca subsp. vesca]
Length=295

 Score =   135 bits (340),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG+G TP +NLAGHCDP++++C  LS +I+ C++KGIKV+LS+GG  G Y L+  
Sbjct  53   AFLSSFGNGQTPTINLAGHCDPSTDECTKLSPDIKSCQAKGIKVILSIGGASGSYSLASS  112

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGGQS+SRPLGD  LDG+DF
Sbjct  113  DDARQVATYLWNNFLGGQSSSRPLGDAVLDGVDF  146


 Score = 41.6 bits (96),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC +  Y+ VN+
Sbjct  25   IAIYWGQNGNEGTLAETCGSGNYQFVNL  52



>ref|XP_007021467.1| Hevamine-A precursor [Theobroma cacao]
 gb|EOY12992.1| Hevamine-A precursor [Theobroma cacao]
Length=298

 Score =   136 bits (343),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G T ++NLAGHCDP SN C  L  +I+ C++KGIKV+LSLGGG G YYL+  
Sbjct  56   AFLPTFGNGQTAMINLAGHCDPYSNGCTSLGSDIKSCQAKGIKVMLSLGGGAGSYYLASS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DAR VA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  KDARQVATYLWNNFLGGQSSSRPLGDAVLDGIDF  149



>ref|XP_006376616.1| hypothetical protein POPTR_0012s01160g [Populus trichocarpa]
 gb|ERP54413.1| hypothetical protein POPTR_0012s01160g [Populus trichocarpa]
Length=294

 Score =   136 bits (342),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+ FG+G TPVLNLAGHC+P++N C  LS +I+ C+ KGIKVLLS+GG  G Y LS  
Sbjct  56   AFLSAFGNGQTPVLNLAGHCNPSANTCTGLSADIKACQGKGIKVLLSIGGASGAYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQS+SRPLGD  LDG+DF
Sbjct  116  DDARQVASYIWNNFLGGQSSSRPLGDAILDGVDF  149


 Score = 40.4 bits (93),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC++  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLAATCNSGNYQFVNV  55



>emb|CBI22573.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   134 bits (336),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHCD ASN C  +S +I  C+S+G+KV+LS+GG +G Y LS  
Sbjct  56   AFLNKFGNGQTPEINLAGHCDSASNGCTSVSTDISNCQSQGVKVMLSIGGAIGSYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+NVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  DDAQNVANYLWNNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 43.1 bits (100),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC+T  Y  VN+
Sbjct  28   IAIYWGQNGNEGTLTQTCNTGKYSYVNI  55



>ref|XP_006387203.1| chitinase family protein [Populus trichocarpa]
 gb|ERP46117.1| chitinase family protein [Populus trichocarpa]
Length=294

 Score =   136 bits (342),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+ FG+G TPVLNLAGHC+P++N C  LS +I+ C+ KGIKVLLS+GG  G Y LS  
Sbjct  56   AFLSAFGNGQTPVLNLAGHCNPSANTCTGLSADIKACQGKGIKVLLSIGGASGAYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQS+SRPLGD  LDG+DF
Sbjct  116  DDARQVASYIWNNFLGGQSSSRPLGDAILDGVDF  149


 Score = 40.4 bits (93),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC++  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLAATCNSGNYQFVNV  55



>ref|XP_011024687.1| PREDICTED: hevamine-A-like [Populus euphratica]
Length=295

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP SN C  LS +I+ C++KGIKV+LS+GGG G YYL+ +
Sbjct  54   AFLPTFGNGQTPMINLAGHCDPYSNGCIKLSPDIKSCQAKGIKVMLSIGGGAGSYYLTSK  113

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  114  EDAKQVATYLWNNFLGGHSSSRPLGPAVLDGIDF  147



>ref|XP_009603970.1| PREDICTED: acidic endochitinase-like [Nicotiana tomentosiformis]
Length=298

 Score =   135 bits (340),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G  P +NLAGHCDP+  +C  LS +I+ C+SKGIKV+LS+GGG G YYLS  
Sbjct  56   AFLATFGNGQQPTINLAGHCDPSLGECTKLSSDIKSCQSKGIKVILSIGGGAGFYYLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGG+S++RPLG+  LDGIDF
Sbjct  116  DDAREVATYLWNNFLGGESSNRPLGNAVLDGIDF  149


 Score = 41.2 bits (95),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQN  EG+L +TC T  YEIVN+
Sbjct  28   ISIYWGQNANEGTLAETCATGNYEIVNI  55



>ref|XP_008376668.1| PREDICTED: hevamine-A-like [Malus domestica]
Length=298

 Score =   134 bits (336),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TP +NLAGHCDP +++C  LS EIR C++KGIKV+LS+GG  G Y L+  
Sbjct  56   AFLTTFGNGRTPAINLAGHCDPTTDECTKLSPEIRSCQAKGIKVILSIGGASGSYSLTSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DAR VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  116  ADARQVATYLWNNFLGGHSSSRPLGAAVLDGIDF  149


 Score = 42.0 bits (97),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLAETCATGNYQFVNV  55



>gb|EMT30611.1| Acidic endochitinase [Aegilops tauschii]
Length=298

 Score =   135 bits (340),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+ FG+G  PVLNLAGHCDP +  C  LS +I+ C+S+G+KV+LS+GGG G YYLS  
Sbjct  57   AFLSAFGNGQPPVLNLAGHCDPTNGGCASLSSDIKSCQSRGVKVILSIGGGAGGYYLSST  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  117  QDAKNVATYLWNNFLGGKSSSRPLGDAVLDGIDF  150


 Score = 40.8 bits (94),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L +TC T  Y+ VN+
Sbjct  29   ISIYWGQNGGEGTLAETCATGNYKFVNI  56



>ref|XP_009368701.1| PREDICTED: hevamine-A-like [Pyrus x bretschneideri]
Length=298

 Score =   134 bits (336),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TP +NLAGHCDP +++C  LS EIR C++KGIKV+LS+GG  G Y L+  
Sbjct  56   AFLTTFGNGRTPAINLAGHCDPTTDECTKLSPEIRSCQAKGIKVILSIGGASGSYSLTSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DAR VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  116  ADARQVATYLWNNFLGGHSSSRPLGAAVLDGIDF  149


 Score = 42.0 bits (97),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLAETCATGNYQFVNV  55



>dbj|BAK68869.1| class III chitinase [Punica granatum]
Length=299

 Score =   132 bits (332),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            +F+TTFG+   PV+NLAGHCDPA+  C  LSDEIR C+ K IKVL+S+GGG GDY L   
Sbjct  57   SFVTTFGNFRAPVVNLAGHCDPAAGTCTGLSDEIRSCQGKDIKVLMSIGGGAGDYSLVSE  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA N A YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  117  ADADNFADYLWNNFLGGQSSSRPLGDAVLDGIDF  150


 Score = 43.5 bits (101),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIV  288
            DIAIYWGQNG EG+L  TCDT  Y  V
Sbjct  28   DIAIYWGQNGGEGTLASTCDTGRYAYV  54



>ref|XP_002301782.1| chitinase family protein [Populus trichocarpa]
 gb|EEE81055.1| chitinase family protein [Populus trichocarpa]
Length=295

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP SN C  LS +I+ C+ KGIKV+LS+GGG G YYL+ +
Sbjct  54   AFLPTFGNGQTPMINLAGHCDPYSNGCTKLSPDIKSCQVKGIKVMLSIGGGAGSYYLTSK  113

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  114  EDAKQVANYLWNNFLGGNSSSRPLGPAVLDGIDF  147



>ref|XP_002513612.1| hevamine-A precursor, putative [Ricinus communis]
 gb|EEF49015.1| hevamine-A precursor, putative [Ricinus communis]
Length=297

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PA+N C  +S+ I+ C+ +GIKVLLSLGGG+G Y L+ +
Sbjct  55   AFLNKFGNGQTPEINLAGHCNPATNGCTIISNGIKSCQKRGIKVLLSLGGGIGSYTLASQ  114

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGG+S+SRPLGD +LDGIDF
Sbjct  115  ADAKNVADYLWNNFLGGKSSSRPLGDAALDGIDF  148



>gb|ADG56718.1| chitinase [Cucumis sativus]
 gb|KGN49898.1| Chitinase [Cucumis sativus]
Length=292

 Score =   131 bits (330),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG G  PVLNLAGHC+P +N C FLSDEI  CKS+ +KVLLS+GGG G Y LS  
Sbjct  56   AFLSSFGSGQAPVLNLAGHCNPDNNGCAFLSDEINSCKSQNVKVLLSIGGGAGSYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA ++W+++LGGQS SRPLG   LDG+DF
Sbjct  116  DDAKQVANFIWNSYLGGQSDSRPLGAAVLDGVDF  149


 Score = 44.3 bits (103),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  YE VN+
Sbjct  28   IAIYWGQNGNEGSLASTCATGNYEFVNI  55



>ref|XP_004169800.1| PREDICTED: LOW QUALITY PROTEIN: acidic endochitinase-like [Cucumis 
sativus]
 sp|P17541.1|CHIA_CUCSA RecName: Full=Acidic endochitinase; Flags: Precursor [Cucumis 
sativus]
 gb|AAA33120.1| chitinase [Cucumis sativus]
 gb|AAC37395.1| chitinase [Cucumis sativus]
Length=292

 Score =   131 bits (330),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG G  PVLNLAGHC+P +N C FLSDEI  CKS+ +KVLLS+GGG G Y LS  
Sbjct  56   AFLSSFGSGQAPVLNLAGHCNPDNNGCAFLSDEINSCKSQNVKVLLSIGGGAGSYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA ++W+++LGGQS SRPLG   LDG+DF
Sbjct  116  DDAKQVANFIWNSYLGGQSDSRPLGAAVLDGVDF  149


 Score = 44.3 bits (103),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  YE VN+
Sbjct  28   IAIYWGQNGNEGSLASTCATGNYEFVNI  55



>gb|AFM77007.1| pathogenesis related protein 3, partial [Cydonia oblonga]
Length=253

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+   PVLNLAGHCDPAS  C  LS +IR C+S+ IKVLLS+GG  G Y L+  
Sbjct  12   AFLTTFGNNQAPVLNLAGHCDPASGTCTGLSADIRACQSQNIKVLLSIGGASGSYNLTSA  71

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQS SRPLGD  LDG+DF
Sbjct  72   DDARQVADYIWNNFLGGQSTSRPLGDAVLDGVDF  105



>ref|XP_004145913.1| PREDICTED: acidic endochitinase-like [Cucumis sativus]
Length=316

 Score =   131 bits (330),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG G  PVLNLAGHC+P +N C FLSDEI  CKS+ +KVLLS+GGG G Y LS  
Sbjct  56   AFLSSFGSGQAPVLNLAGHCNPDNNGCAFLSDEINSCKSQNVKVLLSIGGGAGSYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA ++W+++LGGQS SRPLG   LDG+DF
Sbjct  116  DDAKQVANFIWNSYLGGQSDSRPLGAAVLDGVDF  149


 Score = 44.3 bits (103),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  YE VN+
Sbjct  28   IAIYWGQNGNEGSLASTCATGNYEFVNI  55



>ref|XP_008234893.1| PREDICTED: hevamine-A-like [Prunus mume]
Length=299

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG+G TPV+NLAGHCDP++++C  LS +I+ C++KGIKV+LS+GGG G Y L+  
Sbjct  57   AFLSSFGNGQTPVINLAGHCDPSTDECTKLSPQIKSCQAKGIKVILSIGGGAGSYSLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  117  DDARQVATYLWNNFLGGHSSSRPLGAAVLDGIDF  150



>gb|AAQ21404.1| class III chitinase [Medicago truncatula]
 gb|KEH17283.1| chitinase [Medicago truncatula]
Length=298

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG G TP++NLAGHCDP SN+C  LS +I+ C++KGIKVLLSLGGG G Y ++  
Sbjct  58   AFLPTFGDGQTPMINLAGHCDPYSNECTGLSSDIKSCQAKGIKVLLSLGGGAGSYSIAST  117

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA++VA YLW+NFLGGQS+SRPLG   LDGIDF
Sbjct  118  QDAKSVATYLWNNFLGGQSSSRPLGPAVLDGIDF  151



>ref|XP_004155888.1| PREDICTED: acidic endochitinase-like [Cucumis sativus]
Length=312

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHCDP SN C  LS EI+ C++KGIKV+LS+GGG G Y+LS  
Sbjct  70   AFLAVFGNGQTPQLNLAGHCDPFSNGCIRLSSEIKSCQAKGIKVILSIGGGAGSYFLSSD  129

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+N+LGG SASRPLG+  LDG+DF
Sbjct  130  DDARKVALYLWNNYLGGHSASRPLGNAVLDGVDF  163



>ref|XP_004133839.1| PREDICTED: acidic endochitinase-like [Cucumis sativus]
 gb|KGN56471.1| hypothetical protein Csa_3G120500 [Cucumis sativus]
Length=296

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHCDP SN C  LS EI+ C++KGIKV+LS+GGG G Y+LS  
Sbjct  54   AFLAVFGNGQTPQLNLAGHCDPFSNGCIRLSSEIKSCQAKGIKVILSIGGGAGSYFLSSD  113

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+N+LGG SASRPLG+  LDG+DF
Sbjct  114  DDARKVALYLWNNYLGGHSASRPLGNAVLDGVDF  147



>ref|XP_004306710.1| PREDICTED: basic endochitinase-like [Fragaria vesca subsp. vesca]
Length=300

 Score =   134 bits (337),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+ FG+G TP++NLA HCDPASN C+  S+E+R C+++GIKVLLS+GG  G Y LS  
Sbjct  60   AFLSQFGNGQTPLINLADHCDPASNGCQRFSNEVRNCQNQGIKVLLSIGGAGGSYTLSDE  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQS SRPLGD  LDG+DF
Sbjct  120  DDARRVADYIWNNFLGGQSNSRPLGDAVLDGVDF  153


 Score = 41.2 bits (95),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I +YWGQNG EG+L  TC +  YEIVN+
Sbjct  32   IVVYWGQNGGEGTLTDTCASGRYEIVNI  59



>ref|XP_010092887.1| Acidic endochitinase [Morus notabilis]
 gb|EXB52705.1| Acidic endochitinase [Morus notabilis]
Length=298

 Score =   133 bits (335),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLA HCDP +N C  LS +I+ C++KG+KVLLSLGGG G Y L+  
Sbjct  56   AFLPTFGNGQTPMINLADHCDPYTNGCTGLSSDIKSCQAKGVKVLLSLGGGAGSYSLASS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  116  EDARQVATYLWNNFLGGSSSSRPLGDAVLDGIDF  149


 Score = 42.0 bits (97),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L++TC T+ Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLEETCATDNYDYVNI  55



>ref|XP_008437558.1| PREDICTED: acidic endochitinase-like [Cucumis melo]
Length=294

 Score =   131 bits (329),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQ-CKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSF  106
            AFL++FG G TPVLNLAGHC+P +N  C FLS +I+ C+S+GIKVLLS+GGG G Y LS 
Sbjct  57   AFLSSFGSGRTPVLNLAGHCNPNNNNGCTFLSSQIKSCQSRGIKVLLSIGGGAGSYSLSS  116

Query  105  RDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             +DAR VA ++W+N+LGGQS SRPLG+  L+G+DF
Sbjct  117  ANDARQVANHIWNNYLGGQSNSRPLGNAVLNGVDF  151


 Score = 44.3 bits (103),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  Y+IVN+
Sbjct  29   IAIYWGQNGNEGSLASTCATGNYQIVNI  56



>ref|XP_011093688.1| PREDICTED: acidic endochitinase-like [Sesamum indicum]
Length=297

 Score =   134 bits (337),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP  N C  LS +I  C++KG+KV+LS+GG  G YYL+  
Sbjct  57   AFLATFGNGQTPMINLAGHCDPTVNGCTGLSSDINSCQAKGVKVMLSIGGAAGSYYLAST  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DAR VA YLWDNFLGG+S+SRPLG+  LDGIDF
Sbjct  117  QDARQVATYLWDNFLGGKSSSRPLGNAVLDGIDF  150


 Score = 41.2 bits (95),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L +TC T  Y+ VN+
Sbjct  29   ISIYWGQNGNEGTLAETCATGNYDFVNL  56



>emb|CDP09311.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   133 bits (334),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHCDP+ N C  L  EI+ C++KGIKV+LS+GGG G YYL+  
Sbjct  56   AFLCVFGNGQTPQLNLAGHCDPSVNGCTGLGSEIKSCQAKGIKVMLSIGGGAGSYYLASA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA +LW+N+LGG S+SRPLGD  LDGIDF
Sbjct  116  EDARQVATHLWNNYLGGHSSSRPLGDAVLDGIDF  149


 Score = 42.4 bits (98),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLSETCATGNYKFVNL  55



>ref|XP_011010623.1| PREDICTED: acidic endochitinase-like [Populus euphratica]
Length=294

 Score =   134 bits (336),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG+G +PVLNLAGHCDP +  C  +S++IR C+++GIKVLLS+GGG G Y LS  
Sbjct  56   AFLSSFGNGQSPVLNLAGHCDPNAGTCTGISNDIRSCQNQGIKVLLSIGGGAGSYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA Y+W+NFLGGQS+SRPLGD  LDG+DF
Sbjct  116  DDAGQVANYIWNNFLGGQSSSRPLGDAILDGVDF  149


 Score = 41.6 bits (96),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC++  Y+ VN+
Sbjct  28   IAIYWGQNGNEGSLADTCNSGNYQFVNV  55



>pdb|4TOQ|A Chain A, Crystal Structure Of Class Iii Chitinase From Pomegranate 
Provides The Insight Into Its Metal Storage Capacity
 pdb|4TOQ|B Chain B, Crystal Structure Of Class Iii Chitinase From Pomegranate 
Provides The Insight Into Its Metal Storage Capacity
 pdb|4TOQ|C Chain C, Crystal Structure Of Class Iii Chitinase From Pomegranate 
Provides The Insight Into Its Metal Storage Capacity
 pdb|4TOQ|D Chain D, Crystal Structure Of Class Iii Chitinase From Pomegranate 
Provides The Insight Into Its Metal Storage Capacity
Length=273

 Score =   132 bits (331),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            +F+TTFG+   PV+NLAGHCDPA+  C  LSDEIR C+ K IKVL+S+GGG GDY L   
Sbjct  31   SFVTTFGNFRAPVVNLAGHCDPAAGTCTGLSDEIRSCQGKDIKVLMSIGGGAGDYSLVSE  90

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA N A YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  91   ADADNFADYLWNNFLGGQSSSRPLGDAVLDGIDF  124


 Score = 43.1 bits (100),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIV  288
            DIAIYWGQNG EG+L  TCDT  Y  V
Sbjct  2    DIAIYWGQNGGEGTLASTCDTGRYAYV  28



>ref|XP_006374316.1| chitinase family protein [Populus trichocarpa]
 gb|ERP52113.1| chitinase family protein [Populus trichocarpa]
Length=294

 Score =   134 bits (337),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG+G +PVLNLAGHCDP++  C  +S++IR C+++GIKVLLS+GGG G Y LS  
Sbjct  56   AFLSSFGNGQSPVLNLAGHCDPSAGTCTGISNDIRSCQNQGIKVLLSIGGGAGGYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA Y+W+NFLGGQS+SRPLGD  LDG+DF
Sbjct  116  DDAGQVANYIWNNFLGGQSSSRPLGDAILDGVDF  149


 Score = 41.2 bits (95),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQ+G EGSL  TC+T  Y+ VN+
Sbjct  28   IAIYWGQDGNEGSLADTCNTGNYQFVNV  55



>ref|XP_010103971.1| Acidic endochitinase [Morus notabilis]
 gb|EXB97674.1| Acidic endochitinase [Morus notabilis]
Length=508

 Score =   137 bits (346),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG G TP LNLAGHCDP +N C  LS++++ C+SKGIKV+LS+GGGVG Y LS  
Sbjct  270  AFLNTFGSGQTPSLNLAGHCDPTTNGCTRLSNDVKACQSKGIKVMLSIGGGVGSYNLSSA  329

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR +A YLW+NFLGGQS SRPLGD  LDGIDF
Sbjct  330  EDARVIADYLWNNFLGGQSDSRPLGDAVLDGIDF  363


 Score = 37.4 bits (85),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I +YWGQ+G EGSL  TC T  Y +VN+
Sbjct  242  IIVYWGQSGNEGSLADTCATGNYGVVNI  269



>gb|ABL74451.1| class III chitinase [Casuarina glauca]
Length=298

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG G TP++NLAGHCDP SN C  LS +I+ C++KGIKV+LSLGGG G YYLS  
Sbjct  56   AFLPTFGDGQTPMVNLAGHCDPCSNGCISLSSDIKSCQAKGIKVMLSLGGGAGSYYLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+ VA YLW+NFLGGQS+SRP G   LDGIDF
Sbjct  116  KDAKQVATYLWNNFLGGQSSSRPFGPVILDGIDF  149



>ref|XP_008357049.1| PREDICTED: LOW QUALITY PROTEIN: acidic endochitinase-like [Malus 
domestica]
Length=296

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+   PVLNLAGHCDP S  CK LS +IR C+SK IKVLLS+GG  G Y L+  
Sbjct  57   AFLTTFGNNQPPVLNLAGHCDPGST-CKGLSSDIRACQSKNIKVLLSIGGAAGSYSLTSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  116  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  149



>emb|CAC14016.1| chitinase [Vitis vinifera]
Length=297

 Score =   132 bits (332),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHCD ASN C  +S +I  C+S+G+KV+LS+GG +G Y LS  
Sbjct  56   AFLNKFGNGQTPEINLAGHCDSASNGCTSVSTDISNCQSQGVKVMLSIGGAIGSYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+NVA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  116  DDAQNVANYLWNNFLGGRSSSRPLGDAVLDGIDF  149


 Score = 43.1 bits (100),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC+T  Y  VN+
Sbjct  28   IAIYWGQNGNEGTLTQTCNTGKYSYVNI  55



>ref|XP_002461854.1| hypothetical protein SORBIDRAFT_02g009360 [Sorghum bicolor]
 gb|EER98375.1| hypothetical protein SORBIDRAFT_02g009360 [Sorghum bicolor]
Length=297

 Score =   134 bits (338),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP+S  C  LSD+I+ C+S G+KV+LS+GG  G YYL+  
Sbjct  56   AFLVAFGNGQQPVLNLAGHCDPSSGGCTSLSDDIKSCQSNGVKVMLSIGGASGSYYLTSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+ VA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  ADAKTVATYLWNNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 40.4 bits (93),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L  TC T  Y+ VN+
Sbjct  28   ISIYWGQNGGEGTLADTCATGNYKFVNL  55



>ref|XP_006339646.1| PREDICTED: hevamine-A-like [Solanum tuberosum]
Length=298

 Score =   132 bits (332),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G  P+++L+GHC+P   +C  LS +I+ C++KGIKV+LS+GGG G YYL+  
Sbjct  56   AFLPTFGNGQQPMIDLSGHCNPNVGECTKLSTDIKSCQAKGIKVMLSIGGGAGSYYLASA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGGQS +RPLGD  LDGIDF
Sbjct  116  DDAREVATYLWNNFLGGQSTTRPLGDAVLDGIDF  149


 Score = 42.7 bits (99),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y++VN+
Sbjct  28   IAIYWGQNGGEGTLAETCATKNYDLVNI  55



>emb|CAN64487.1| hypothetical protein VITISV_035040 [Vitis vinifera]
Length=297

 Score =   132 bits (331),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHCD ASN C  +S +I  C+S+G+KV+LS+GG +G Y LS  
Sbjct  56   AFLNKFGNGQTPEINLAGHCDSASNGCTSVSTDISNCQSQGVKVMLSIGGAIGSYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+NVA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  116  DDAQNVANYLWNNFLGGRSSSRPLGDAVLDGIDF  149


 Score = 43.1 bits (100),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC+T  Y  VN+
Sbjct  28   IAIYWGQNGNEGTLTQTCNTGKYSYVNI  55



>ref|XP_002461855.1| hypothetical protein SORBIDRAFT_02g009370 [Sorghum bicolor]
 gb|EER98376.1| hypothetical protein SORBIDRAFT_02g009370 [Sorghum bicolor]
Length=297

 Score =   134 bits (338),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP+S  C  LSD+I+ C+S G+KV+LS+GG  G YYL+  
Sbjct  56   AFLVAFGNGQQPVLNLAGHCDPSSGGCTSLSDDIKSCQSNGVKVMLSIGGASGSYYLTSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+ VA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  ADAKTVATYLWNNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 40.4 bits (93),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L  TC T  Y+ VN+
Sbjct  28   ISIYWGQNGGEGTLADTCATGNYKFVNL  55



>emb|CDP10878.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP LNLAGHC+P+S  C+ LS+ IR C+++GIKV+LS+GGG G Y LS  
Sbjct  56   AFLPTFGNGQTPKLNLAGHCNPSSGGCQKLSNSIRQCQNQGIKVMLSIGGGAGSYSLSSD  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG+S SRPLGD  LDGIDF
Sbjct  116  NDARQVANYLWNNFLGGKSNSRPLGDAVLDGIDF  149



>ref|XP_006374315.1| chitinase family protein [Populus trichocarpa]
 gb|ERP52112.1| chitinase family protein [Populus trichocarpa]
Length=294

 Score =   132 bits (332),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG+G +PVLNLAGHCDP++  C  +S++I  C+++GIKVLLS+GGG G Y LS  
Sbjct  56   AFLSSFGNGQSPVLNLAGHCDPSAGTCTGISNDITSCQNQGIKVLLSIGGGAGSYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA Y+W+NFLGGQS+SRPLGD  LDG+DF
Sbjct  116  DDAGQVANYIWNNFLGGQSSSRPLGDAILDGVDF  149


 Score = 42.7 bits (99),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC+T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGSLADTCNTGNYQFVNV  55



>dbj|BAC11885.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
Length=302

 Score =   135 bits (339),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++YC+S+GIKV+LSLGGG+G+Y +  +
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKYCQSRGIKVMLSLGGGIGNYSIGSK  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVVADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>ref|XP_010911007.1| PREDICTED: hevamine-A-like [Elaeis guineensis]
Length=294

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGG-GVGDYYLSF  106
            AFLTTFG+G TPVLNLAGHCDPA+  C  L+ +I+ C+S+G+ VLLSLGG   G Y LS 
Sbjct  51   AFLTTFGNGQTPVLNLAGHCDPATGTCTGLTSDIQSCQSQGVMVLLSLGGDSAGSYSLSS  110

Query  105  RDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DDA+NVA YLWDNFLGG S+SRPLGD  LDGIDF
Sbjct  111  ADDAQNVANYLWDNFLGGSSSSRPLGDAVLDGIDF  145



>dbj|BAC11884.1| acidic chitinase [Arabidopsis halleri subsp. gemmifera]
 dbj|BAC11886.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
 dbj|BAC11887.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
 dbj|BAC11892.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
 dbj|BAC11894.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
 dbj|BAC11895.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
 dbj|BAC11896.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
 dbj|BAC11897.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
Length=302

 Score =   135 bits (339),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++YC+S+GIKV+LSLGGG+G+Y +  +
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKYCQSRGIKVMLSLGGGIGNYSIGSK  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVVADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>dbj|BAC11891.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
Length=302

 Score =   135 bits (339),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++YC+S+GIKV+LSLGGG+G+Y +  +
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKYCQSRGIKVMLSLGGGIGNYSIGSK  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVVADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>gb|KDP22190.1| hypothetical protein JCGZ_26021 [Jatropha curcas]
 gb|KDP22192.1| hypothetical protein JCGZ_26023 [Jatropha curcas]
Length=297

 Score =   131 bits (330),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PA+  C  +S+ I+ C+ +GIKV LSLGGGVG Y L+ +
Sbjct  55   AFLYKFGNGQTPEINLAGHCNPATGGCTIVSNGIKSCQKRGIKVFLSLGGGVGSYTLASQ  114

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DARNVA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  115  ADARNVADYLWNNFLGGKSSSRPLGDAILDGIDF  148


 Score = 43.1 bits (100),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L+QTC T  Y  VN+
Sbjct  27   IAIYWGQNGNEGTLEQTCATGKYSYVNI  54



>dbj|BAC11888.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
Length=302

 Score =   135 bits (339),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++YC+S+GIKV+LSLGGG+G+Y +  +
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKYCQSRGIKVMLSLGGGIGNYSIGSK  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVVADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>dbj|BAC11890.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
 dbj|BAC11893.1| acidic chitinase [Arabidopsis halleri subsp. gemmifera]
Length=302

 Score =   135 bits (339),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++YC+S+GIKV+LSLGGG+G+Y +  +
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKYCQSRGIKVMLSLGGGIGNYSIGSK  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVVADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>ref|XP_006657618.1| PREDICTED: acidic endochitinase-like [Oryza brachyantha]
Length=297

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP +  C   S  I+ C+S+G+KV+LS+GGG G YYLS  
Sbjct  56   AFLAAFGNGQPPVLNLAGHCDPTNGGCASQSSGIKSCQSRGVKVMLSIGGGAGSYYLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+NVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  EDAKNVATYLWNNFLGGQSSSRPLGDAVLDGIDF  149



>dbj|BAA21877.1| acidic endochitinase [Arabidopsis lyrata subsp. kawasakiana]
Length=302

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++YC+S+GIKV+LSLGGG+G+Y +  +
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKYCQSRGIKVMLSLGGGIGNYSIGSK  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVVADYLWNNFLGGKSSSRPLGDAVLDGIDF  153



>gb|EMT07092.1| Acidic endochitinase [Aegilops tauschii]
Length=281

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            +FL+TFG+G TP LNLAGHCDP S  C   S +I  C+S G+KVLLSLGGG G Y LS  
Sbjct  38   SFLSTFGNGQTPALNLAGHCDPLSGNCNVFSSDITTCQSNGVKVLLSLGGGAGSYGLSST  97

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA++VA YLWDNFLGG ++SRPLGD +LDGIDF
Sbjct  98   EDAQSVATYLWDNFLGGSASSRPLGDAALDGIDF  131



>gb|AIM62181.1| acidic class III chitinase [Cucurbita maxima]
Length=292

 Score =   130 bits (326),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG G  PVLNLAGHC+P +N C FLSDEI  CKS+ +KVLLS+GGG G Y LS  
Sbjct  56   AFLSSFGSGQAPVLNLAGHCNPDNNGCAFLSDEINSCKSQNVKVLLSIGGGAGSYSLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA ++W+++LGGQS SRPLG   L+G+DF
Sbjct  116  DDAKQVANFIWNSYLGGQSDSRPLGAAVLNGVDF  149


 Score = 44.3 bits (103),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  YE VN+
Sbjct  28   IAIYWGQNGNEGSLASTCATGNYEFVNI  55



>sp|P36908.1|CHIA_CICAR RecName: Full=Acidic endochitinase; Flags: Precursor [Cicer arietinum]
 emb|CAA49998.1| chitinase [Cicer arietinum]
Length=293

 Score =   129 bits (325),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G  P +NLAGHCDP++N C   S EI+ C++KGIKVLLSLGGG G Y L+  
Sbjct  54   AFLSTFGNGQNPQINLAGHCDPSTNGCTKFSPEIQACQAKGIKVLLSLGGGAGSYSLNSA  113

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            ++A  +A YLW+NFLGG S SRPLGD  LDGIDF
Sbjct  114  EEATTLANYLWNNFLGGTSTSRPLGDAVLDGIDF  147


 Score = 44.7 bits (104),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IA+YWGQNG EGSLQ  C+TN Y+ VN+
Sbjct  26   IAVYWGQNGNEGSLQDACNTNNYQFVNI  53



>ref|XP_010265871.1| PREDICTED: acidic endochitinase-like [Nelumbo nucifera]
Length=291

 Score =   134 bits (337),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHCDP SN C  LS +I+ C+S GIKVLLSLGG  G Y LS  
Sbjct  54   AFLVAFGNGQTPQLNLAGHCDPXSNGCTGLSSDIKACQSXGIKVLLSLGGSAGGYSLSSA  113

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA YLW+NFLGGQS SRPLGD  LDGIDF
Sbjct  114  DDAQQVANYLWNNFLGGQSDSRPLGDAVLDGIDF  147


 Score = 40.0 bits (92),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVN  285
            IA+YWGQ+G EGSL  TC T  Y+ VN
Sbjct  26   IAVYWGQDGGEGSLADTCATGNYQFVN  52



>ref|XP_008652265.1| PREDICTED: acidic endochitinase-like [Zea mays]
 tpg|DAA60277.1| TPA: hypothetical protein ZEAMMB73_010674 [Zea mays]
Length=297

 Score =   134 bits (336),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP +  C  LS +I+ C+S G+KV+LS+GGG G YYLS  
Sbjct  56   AFLAAFGNGQPPVLNLAGHCDPTNGGCASLSGDIKSCQSSGVKVMLSIGGGAGSYYLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA++VA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  ADAKDVATYLWNNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 40.4 bits (93),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L  TC T  Y  VN+
Sbjct  28   ISIYWGQNGGEGTLADTCATGNYRFVNL  55



>ref|XP_008652266.1| PREDICTED: acidic endochitinase-like [Zea mays]
 tpg|DAA60278.1| TPA: hypothetical protein ZEAMMB73_694947 [Zea mays]
Length=297

 Score =   134 bits (336),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP +  C  LS +I+ C+S G+KV+LS+GGG G YYLS  
Sbjct  56   AFLAAFGNGQPPVLNLAGHCDPTNGGCASLSGDIKSCQSSGVKVMLSIGGGAGSYYLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA++VA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  ADAKDVATYLWNNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 40.4 bits (93),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L  TC T  Y  VN+
Sbjct  28   ISIYWGQNGGEGTLADTCATGNYRFVNL  55



>ref|XP_004231197.2| PREDICTED: chitinase 1-like [Solanum lycopersicum]
Length=601

 Score =   132 bits (331),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G  P+++L+GHC+P   +C  LS +I+ C++KGIKV+LS+GGG G YYL+  
Sbjct  359  AFLPTFGNGQQPMIDLSGHCNPNVGECTKLSTDIKSCQAKGIKVILSIGGGAGSYYLASA  418

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGGQS +RPLGD  LDGIDF
Sbjct  419  DDAREVANYLWNNFLGGQSTTRPLGDAVLDGIDF  452


 Score = 42.0 bits (97),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  331  IAIYWGQNGGEGTLAETCATKNYDFVNI  358


 Score =   132 bits (331),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G  P+++L+GHC+P   +C  LS +I+ C++KGIKV+LS+GGG G YYL+  
Sbjct  56   AFLPTFGNGQQPMIDLSGHCNPNVGECTKLSTDIKSCQAKGIKVILSIGGGAGSYYLASA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGGQS +RPLGD  LDGIDF
Sbjct  116  DDAREVATYLWNNFLGGQSTTRPLGDAVLDGIDF  149


 Score = 42.0 bits (97),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  28   IAIYWGQNGGEGTLAETCATKNYDFVNI  55



>ref|XP_006374314.1| Chain A family protein [Populus trichocarpa]
 gb|ERP52111.1| Chain A family protein [Populus trichocarpa]
Length=296

 Score =   133 bits (334),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PA+  C  +S  I+ C+ +GIKVLLSLGGG+G+Y L+ +
Sbjct  57   AFLNKFGNGQTPEMNLAGHCNPANGGCTIVSGGIKSCQQQGIKVLLSLGGGIGNYSLASK  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  117  GDAKNVADYLWNNFLGGQSSSRPLGDAVLDGIDF  150


 Score = 40.8 bits (94),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L QTC T  Y  VN+
Sbjct  29   ISIYWGQNGNEGTLAQTCATGRYAYVNI  56



>gb|EMS53956.1| Acidic endochitinase [Triticum urartu]
Length=246

 Score =   133 bits (334),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            +FL+TFG+G TP +NLAGHCDP S  C   S +I  C+S G+KVLLSLGGG G Y LS  
Sbjct  56   SFLSTFGNGQTPAINLAGHCDPLSGNCNVFSSDITTCQSNGVKVLLSLGGGAGSYGLSST  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA++VA YLWDNFLGG S+SRPLGD  LDGIDF
Sbjct  116  EDAQSVATYLWDNFLGGSSSSRPLGDAVLDGIDF  149



>dbj|BAC55717.1| putative class III acidic chitinase [Oryza sativa Japonica Group]
 dbj|BAD31627.1| putative class III acidic chitinase [Oryza sativa Japonica Group]
 gb|EAZ39452.1| hypothetical protein OsJ_23883 [Oryza sativa Japonica Group]
Length=297

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PV NLAGHCDP +  C   S +I+ C+S+G+K++LS+GGG G YYLS  
Sbjct  56   AFLAAFGNGQPPVFNLAGHCDPTNGGCASQSSDIKSCQSRGVKIMLSIGGGAGSYYLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+NVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  EDAKNVATYLWNNFLGGQSSSRPLGDAVLDGIDF  149



>ref|XP_010035192.1| PREDICTED: hevamine-A-like [Eucalyptus grandis]
 gb|KCW46484.1| hypothetical protein EUGRSUZ_K00311 [Eucalyptus grandis]
Length=301

 Score =   131 bits (329),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG G TP +NLAGHCDP S  C  +S+ IR C+++GIKV+LSLGGG G Y L+ R
Sbjct  59   AFLNKFGGGQTPQINLAGHCDPTSGGCIRISNGIRSCQNRGIKVMLSLGGGDGSYTLTSR  118

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DARNVA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  119  ADARNVANYLWNNFLGGTSSSRPLGDAVLDGIDF  152


 Score = 42.7 bits (99),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG+EG+L  TC T  Y  VN+
Sbjct  31   IAIYWGQNGHEGTLTSTCATGKYAYVNL  58



>sp|P23472.2|CHLY_HEVBR RecName: Full=Hevamine-A; Includes: RecName: Full=Chitinase; 
Includes: RecName: Full=Lysozyme; Flags: Precursor [Hevea brasiliensis]
 emb|CAA07608.1| chitinase [Hevea brasiliensis]
Length=311

 Score =   131 bits (329),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PA+  C  +S+ IR C+ +GIKV+LSLGGG+G Y L+ +
Sbjct  57   AFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQ  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  117  ADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDF  150


 Score = 42.7 bits (99),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC T  Y  VN+
Sbjct  29   IAIYWGQNGNEGTLTQTCSTRKYSYVNI  56



>gb|KGN49899.1| hypothetical protein Csa_5G139770 [Cucumis sativus]
Length=323

 Score =   133 bits (334),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG G TPVLNLAGHC+P +N C F+SDEI  C+S+ +KVLLS+GGGVG Y LS  
Sbjct  57   AFLSSFGSGQTPVLNLAGHCNPDNNGCAFVSDEINSCQSQNVKVLLSIGGGVGRYSLSSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            ++A+ VA +LW+N+LGGQS SRPLGD  LDG+DF
Sbjct  117  NNAKQVAGFLWNNYLGGQSDSRPLGDAVLDGVDF  150


 Score = 40.8 bits (94),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAI WGQNG EGSL  TC T  YE VN+
Sbjct  29   IAICWGQNGNEGSLASTCATGNYEFVNI  56



>emb|CAA09110.1| chitinase [Hevea brasiliensis]
 gb|ABI32402.2| chitinase [Hevea brasiliensis]
Length=311

 Score =   131 bits (329),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PA+  C  +S+ IR C+ +GIKV+LSLGGG+G Y L+ +
Sbjct  57   AFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQ  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  117  ADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDF  150


 Score = 42.7 bits (99),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC T  Y  VN+
Sbjct  29   IAIYWGQNGNEGTLTQTCSTRKYSYVNI  56



>ref|XP_009352076.1| PREDICTED: acidic endochitinase SE2-like [Pyrus x bretschneideri]
Length=313

 Score =   134 bits (336),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+   P+LNLAGHCDP S  CK LS +IR C+S+ IKVLLS+GG  G Y L+  
Sbjct  72   AFLITFGNNQVPLLNLAGHCDPPSGTCKGLSADIRTCQSQNIKVLLSIGGASGSYTLTSA  131

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  132  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  165


 Score = 39.7 bits (91),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L + C++  Y+ VN+
Sbjct  44   IAIYWGQNGNEGTLAEACNSGNYQFVNI  71



>tpg|DAA60279.1| TPA: hypothetical protein ZEAMMB73_388877, partial [Zea mays]
Length=307

 Score =   133 bits (335),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP +  C  LS +I+ C+S G+KV+LS+GGG G YYLS  
Sbjct  56   AFLAAFGNGQPPVLNLAGHCDPTNGGCASLSGDIKSCQSSGVKVMLSIGGGAGSYYLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA++VA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  ADAKDVATYLWNNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 40.0 bits (92),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L  TC T  Y  VN+
Sbjct  28   ISIYWGQNGGEGTLADTCATGNYRFVNL  55



>ref|XP_006339645.1| PREDICTED: hevamine-A-like [Solanum tuberosum]
Length=298

 Score =   131 bits (330),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G  P+++L+GHC+P   +C  LS +I+ C++KGIKV+LS+GGG G YYL+  
Sbjct  56   AFLPTFGNGQQPMIDLSGHCNPNVGECTKLSTDIQSCQAKGIKVILSIGGGAGSYYLASA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGGQS +RPLGD  LDGIDF
Sbjct  116  DDARQVATYLWNNFLGGQSTTRPLGDAVLDGIDF  149


 Score = 42.0 bits (97),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  28   IAIYWGQNGGEGTLAETCATRNYDFVNI  55



>ref|XP_006832884.1| hypothetical protein AMTR_s00095p00105100 [Amborella trichopoda]
 gb|ERM98162.1| hypothetical protein AMTR_s00095p00105100 [Amborella trichopoda]
Length=302

 Score =   132 bits (333),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL +FG+G TP +NLAGHCDP SN C  LSD+IR C+ +G+KVLLS+GGG G Y L+  
Sbjct  60   AFLASFGNGQTPQINLAGHCDPYSNGCTGLSDDIRSCQRQGVKVLLSIGGGAGSYSLASS  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA YLW+N+LGG ++SRPLGD  LDG+DF
Sbjct  120  DDAKQVASYLWNNYLGGHASSRPLGDAVLDGVDF  153


 Score = 40.8 bits (94),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
             IAIYWGQNG EG+L +TC T+ Y  VN+
Sbjct  31   SIAIYWGQNGNEGTLAETCATSNYGFVNI  59



>dbj|BAC11889.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
Length=302

 Score =   134 bits (336),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++YC+S+GIKV+LSLGGG+G+Y +  +
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKYCQSRGIKVMLSLGGGIGNYSIGSK  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +D++ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDSKVVADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>emb|CDM82745.1| unnamed protein product [Triticum aestivum]
 emb|CDM83571.1| unnamed protein product [Triticum aestivum]
Length=299

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            +FL+TFG+G TP LNLAGHCDP S  C   S +I  C+S G+KVLLSLGGG G Y LS  
Sbjct  56   SFLSTFGNGQTPALNLAGHCDPLSGNCNVFSSDITTCQSNGVKVLLSLGGGAGSYGLSST  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA++VA YLWDNFLGG S+SRPLGD  LDGIDF
Sbjct  116  EDAQSVATYLWDNFLGGSSSSRPLGDAVLDGIDF  149



>ref|XP_011010622.1| PREDICTED: hevamine-A-like [Populus euphratica]
Length=296

 Score =   132 bits (333),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PA+  C  +S  I+ C+ +GIKVLLSLGGG+G+Y L+ +
Sbjct  57   AFLNKFGNGQTPEMNLAGHCNPANGGCTIVSGGIKSCQQQGIKVLLSLGGGIGNYTLASK  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW NFLGGQS+SRPLGD  LDGIDF
Sbjct  117  GDAKNVADYLWKNFLGGQSSSRPLGDAVLDGIDF  150


 Score = 40.8 bits (94),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L QTC T  Y  VN+
Sbjct  29   ISIYWGQNGNEGTLAQTCATGRYAYVNI  56



>ref|XP_008652267.1| PREDICTED: acidic endochitinase-like [Zea mays]
Length=297

 Score =   133 bits (335),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP +  C  LS +I+ C+S G+KV+LS+GGG G YYLS  
Sbjct  56   AFLAAFGNGQPPVLNLAGHCDPTNGGCASLSGDIKSCQSSGVKVMLSIGGGAGSYYLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA++VA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  ADAKDVATYLWNNFLGGQSSSRPLGDAVLDGIDF  149


 Score = 40.0 bits (92),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L  TC T  Y  VN+
Sbjct  28   ISIYWGQNGGEGTLADTCATGNYRFVNL  55



>gb|AEZ67305.1| chitinase 6 [Populus x canadensis]
Length=303

 Score =   132 bits (333),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PA+  CK +S  I+ C+ +GIKVLLSLGG +G+Y L+ +
Sbjct  61   AFLYKFGNGQTPEMNLAGHCNPANGGCKIVSSGIKSCQQQGIKVLLSLGGSIGNYTLASK  120

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  121  DDARGVADYLWNNFLGGRSSSRPLGDAVLDGIDF  154


 Score = 40.8 bits (94),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L QTC T  Y  VN+
Sbjct  33   ISIYWGQNGNEGTLAQTCATGRYAYVNI  60



>ref|XP_009357257.1| PREDICTED: basic endochitinase-like [Pyrus x bretschneideri]
Length=344

 Score =   131 bits (330),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+ FG+G TP +NLAGHC PASN C+ +S +IR C+++GIKVLLS+GG  G Y LS  
Sbjct  103  AFLSQFGNGQTPQINLAGHCVPASNGCQKMSIDIRNCQNQGIKVLLSIGGSRGSYTLSSA  162

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQS SRPLGD  LDG+DF
Sbjct  163  DDARRVADYIWNNFLGGQSNSRPLGDAVLDGVDF  196


 Score = 42.0 bits (97),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I +YWGQNG EG+L  TC+T  Y IVN+
Sbjct  75   IVVYWGQNGGEGTLTATCNTGRYRIVNI  102



>dbj|BAJ89542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=295

 Score =   132 bits (331),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPA-SNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSF  106
            AFL TFG G  P+LNLAGHCDPA S  C F+  +++ C+S+GIKVLLS+GGGVG Y LS 
Sbjct  46   AFLFTFGRGQKPLLNLAGHCDPATSGSCTFVGADVKSCQSRGIKVLLSIGGGVGSYGLSS  105

Query  105  RDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DDA+ VA+YLW+N+LGG SASRPLGD  LDG+DF
Sbjct  106  ADDAKEVAKYLWENYLGGTSASRPLGDAVLDGVDF  140


 Score = 41.6 bits (96),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L Q C T  Y+ VN+
Sbjct  18   IAIYWGQNGNEGTLAQACATGNYKFVNV  45



>pdb|1HVQ|A Chain A, Crystal Structures Of Hevamine, A Plant Defence Protein 
With Chitinase And Lysozyme Activity, And Its Complex With 
An Inhibitor
 pdb|1LLO|A Chain A, Hevamine A (A Plant EndochitinaseLYSOZYME) COMPLEXED 
WITH Allosamidin
 pdb|2HVM|A Chain A, Hevamine A At 1.8 Angstrom Resolution
 gb|AAB19633.1| hevamine, partial [Hevea brasiliensis]
Length=273

 Score =   130 bits (328),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PA+  C  +S+ IR C+ +GIKV+LSLGGG+G Y L+ +
Sbjct  31   AFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQ  90

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  91   ADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDF  124


 Score = 42.4 bits (98),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC T  Y  VN+
Sbjct  3    IAIYWGQNGNEGTLTQTCSTRKYSYVNI  30



>gb|ACU31855.1| acidic endochitinase [Nepenthes mirabilis]
Length=292

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 79/108 (73%), Gaps = 5/108 (5%)
 Frame = -1

Query  324  TTNLRHQLLRDRKHAFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLL  145
            T N ++ LL     +FLTTFG+G TPVLNLAGHCDP+SN C  LS +I  C+++GIKVLL
Sbjct  48   TGNYQYVLL-----SFLTTFGNGQTPVLNLAGHCDPSSNGCTGLSTDITSCQNQGIKVLL  102

Query  144  SLGGGVGDYYLSFRDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            SLGG  G Y L   DDA  VA YLW+N+LGGQS SRPLG   LDGIDF
Sbjct  103  SLGGASGSYSLVSTDDANQVAAYLWNNYLGGQSDSRPLGSAVLDGIDF  150



>gb|ACU31851.1| acidic endochitinase [Nepenthes ventricosa]
Length=292

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 79/108 (73%), Gaps = 5/108 (5%)
 Frame = -1

Query  324  TTNLRHQLLRDRKHAFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLL  145
            T N ++ LL     +FLTTFG+G TPVLNLAGHCDP+SN C  LS +I  C+++GIKVLL
Sbjct  48   TGNYQYVLL-----SFLTTFGNGQTPVLNLAGHCDPSSNGCTGLSTDITSCQNQGIKVLL  102

Query  144  SLGGGVGDYYLSFRDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            SLGG  G Y L   DDA  VA YLW+N+LGGQS SRPLG   LDGIDF
Sbjct  103  SLGGASGSYSLVSTDDANQVAAYLWNNYLGGQSDSRPLGSAVLDGIDF  150



>dbj|BAG38685.1| chitinase A [Ananas comosus]
Length=293

 Score =   131 bits (330),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TPVLNLAGHCDP+S  C  L+ +I+ C+S G+KVLLSLGG  G Y LS  
Sbjct  56   AFLTTFGNGQTPVLNLAGHCDPSSGGCTGLTSDIQSCQSSGVKVLLSLGGASGSYSLSST  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA++VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  116  ADAQSVADYLWNNFLGGSSSSRPLGSAVLDGIDF  149


 Score = 41.6 bits (96),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
             IA+YWGQNG EG+L   C T YY  VN+
Sbjct  27   SIAVYWGQNGNEGTLASACATGYYAYVNL  55



>ref|XP_010251575.1| PREDICTED: hevamine-A-like [Nelumbo nucifera]
Length=302

 Score =   130 bits (328),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  P LNLAGHC+PA+  C  L+++I+YC+SKGIKVLLS+GGG+G Y L   
Sbjct  60   AFLNKFGNGQKPELNLAGHCNPATGGCVGLTEDIKYCQSKGIKVLLSIGGGIGTYTLKSA  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGG+S++RPLG   LDGIDF
Sbjct  120  QDAKNVADYLWNNFLGGRSSTRPLGPAVLDGIDF  153


 Score = 42.4 bits (98),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IA+YWGQ+G EG+L+QTC T  Y  VN+
Sbjct  32   IAVYWGQSGKEGTLKQTCATGKYAYVNL  59



>gb|KCW71545.1| hypothetical protein EUGRSUZ_E00086, partial [Eucalyptus grandis]
Length=293

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP++  C  LS EI+ C+++G+KV+LS+GGG G YYL+  
Sbjct  56   AFLCVFGNGQAPVLNLAGHCDPSNGGCTSLSSEIKSCQARGVKVILSIGGGAGSYYLASA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  116  EDAKQVATYLWNNFLGGHSSSRPLGDAVLDGIDF  149



>emb|CDP16516.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   132 bits (332),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG G TPVLNLAGHC+P +  C  LSDEI+ C+++ IKVLLSLGGG G Y L+  
Sbjct  57   AFLSTFGGGRTPVLNLAGHCNPDAGTCTSLSDEIKACQNQNIKVLLSLGGGAGSYGLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA YLW+ FLGGQS SRPLGD  LDGIDF
Sbjct  117  DDAGQVANYLWNTFLGGQSGSRPLGDAVLDGIDF  150


 Score = 40.8 bits (94),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IA+YWGQNG EGSL  TC +  Y+ VN+
Sbjct  29   IAVYWGQNGGEGSLADTCASGNYQFVNV  56



>emb|CDX80411.1| BnaC07g30330D [Brassica napus]
Length=301

 Score =   128 bits (322),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+ +GIKV+LSLGG +G+Y +  R
Sbjct  59   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGAQVKTCQRRGIKVMLSLGGAIGNYSIGSR  118

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S++RPLGD  LDGIDF
Sbjct  119  EDAKMVADYLWNNFLGGKSSARPLGDAVLDGIDF  152


 Score = 44.7 bits (104),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG+EGSL  TC T  Y  VN+
Sbjct  31   IAIYWGQNGFEGSLSATCATGRYAYVNI  58



>ref|XP_010421218.1| PREDICTED: acidic endochitinase-like [Camelina sativa]
Length=302

 Score =   133 bits (335),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C  +  +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTRIGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA+YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVVAKYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>gb|ABF82271.1| class III chitinase [Panax ginseng]
Length=298

 Score =   131 bits (329),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+G TP+LNLAGHCDP SN C  LS +I+ C+++GIKV+LS+GG  G Y L   
Sbjct  56   AFLTTFGNGQTPMLNLAGHCDPTSNGCTGLSSDIKSCQAQGIKVILSIGGASGSYSLVSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DAR VA Y+W+NFLGG SA+RPLG+  LDG+DF
Sbjct  116  ADAREVATYIWNNFLGGNSATRPLGNAVLDGVDF  149


 Score = 42.0 bits (97),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L +TC T  YE VN+
Sbjct  28   ISIYWGQNGGEGTLAETCATGNYEYVNL  55



>ref|XP_003551968.1| PREDICTED: hevamine-A-like [Glycine max]
 gb|KHN17387.1| Acidic endochitinase [Glycine soja]
Length=295

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP SN C  LS +I+ C++KGIKVLLSLGGG G Y ++  
Sbjct  56   AFLPTFGNGQTPMINLAGHCDPYSNGCTGLSSDIKSCQAKGIKVLLSLGGGAGSYSIAST  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA  VA YLW+NFLGGQS+SRPLG   LDGIDF
Sbjct  116  QDASQVATYLWNNFLGGQSSSRPLGPAVLDGIDF  149



>ref|XP_003516317.1| PREDICTED: hevamine-A-like [Glycine max]
 gb|KHN39714.1| Hevamine-A [Glycine soja]
Length=296

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 78/108 (72%), Gaps = 5/108 (5%)
 Frame = -1

Query  324  TTNLRHQLLRDRKHAFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLL  145
            T N  + +L     AFL TFG+G TP++NLAGHCDP SN C  LS +I+ C++KGIKVLL
Sbjct  46   TGNYEYAIL-----AFLPTFGNGQTPMINLAGHCDPYSNGCTKLSSDIKSCQAKGIKVLL  100

Query  144  SLGGGVGDYYLSFRDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            SLGGG G Y L+   DAR VA YLW+NFLGG S SRPLG   LDGIDF
Sbjct  101  SLGGGAGSYSLASPQDARQVATYLWNNFLGGSSPSRPLGPAVLDGIDF  148



>ref|XP_007038907.1| Acidic endochitinase [Theobroma cacao]
 gb|EOY23408.1| Acidic endochitinase [Theobroma cacao]
Length=261

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PASN C  +S  IR C+++GIKV+LS+GGGVG Y L+ +
Sbjct  58   AFLNKFGNGRTPEINLAGHCNPASNGCTAVSSGIRSCQARGIKVMLSIGGGVGSYSLASQ  117

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  118  ADAKNVADYLWNNFLGGTSSSRPLGDAVLDGIDF  151



>ref|XP_008382584.1| PREDICTED: acidic endochitinase-like [Malus domestica]
Length=297

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+   P LNLAGHCDP S+ C  LS +IR C+S+ IKVLLS+GG VG Y L+  
Sbjct  57   AFLXTFGNNQXPXLNLAGHCDPXSSTCTGLSXDIRACQSQNIKVLLSIGGAVGSYNLTSA  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  117  DDARQVADYIWNNFLGGQSASRPLGDAVLDGVDF  150



>gb|ACU31853.1| acidic endochitinase [Nepenthes singalana]
 gb|ACU31857.1| acidic endochitinase [Nepenthes gracilis]
Length=292

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            +FLTTFG+G TPVLNLAGHCDP+SN C  LS +I  CK++GIKVLLSLGG  G Y L   
Sbjct  57   SFLTTFGNGQTPVLNLAGHCDPSSNGCTGLSTDITSCKNQGIKVLLSLGGASGSYTLVST  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA YLW+N+LGGQS SRPLG   LDGIDF
Sbjct  117  DDANQVAAYLWNNYLGGQSDSRPLGSAVLDGIDF  150



>ref|XP_004145916.1| PREDICTED: acidic endochitinase-like [Cucumis sativus]
 ref|XP_004169799.1| PREDICTED: acidic endochitinase-like [Cucumis sativus]
 gb|KGN49895.1| hypothetical protein Csa_5G139730 [Cucumis sativus]
Length=295

 Score =   128 bits (322),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQ-CKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSF  106
            AFL+TFG G TPVLNLAGHC+P +N  C FLS +I+ C+S+GIKVLLS+GGG G Y LS 
Sbjct  58   AFLSTFGSGRTPVLNLAGHCNPNNNNGCAFLSSQIKSCQSRGIKVLLSIGGGAGSYSLSS  117

Query  105  RDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             +DA+ VA ++W+N+LGG+S SRP G+  L+G+DF
Sbjct  118  ANDAKQVANFIWNNYLGGRSNSRPFGNAVLNGVDF  152


 Score = 44.7 bits (104),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  Y+IVN+
Sbjct  30   IAIYWGQNGNEGSLASTCATGNYKIVNI  57



>ref|XP_003557305.1| PREDICTED: acidic endochitinase [Brachypodium distachyon]
Length=297

 Score =   131 bits (330),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP++  C+  S +I+ C+S+G+KV+LS+GGG G YYLS  
Sbjct  56   AFLAAFGNGQPPVLNLAGHCDPSNGGCESQSADIKLCQSRGVKVMLSIGGGAGSYYLSSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA++VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  116  ADAKDVATYLWNNFLGGKSSSRPLGDAILDGIDF  149


 Score = 41.2 bits (95),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EGSL  TC T  Y+ VN+
Sbjct  28   ISIYWGQNGGEGSLAATCATGNYKFVNI  55



>gb|AFK26309.1| chitinase 3 [Aegiceras corniculatum]
Length=294

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -1

Query  279  FLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFRD  100
            FLTTFG+G +PVLNLAGHC+PA+  C  +S++IR C+ +GIKVLLSLGG  G Y LS  D
Sbjct  58   FLTTFGNGQSPVLNLAGHCNPAAGTCTGISNDIRACQGQGIKVLLSLGGATGSYSLSSAD  117

Query  99   DARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DA+ VA YLW+N+LGG S SRPLGD  LDGIDF
Sbjct  118  DAKQVANYLWNNYLGGSSGSRPLGDAVLDGIDF  150



>emb|CDY19852.1| BnaA09g05050D [Brassica napus]
Length=301

 Score =   133 bits (334),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  59   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  118

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  119  EDAKVVANYLWNNFLGGKSSSRPLGDAVLDGIDF  152


 Score = 39.7 bits (91),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  31   IAIYWGQNGNEGNLSSTCATGRYAYVNV  58



>gb|ADR82196.1| hevamine [Hevea brasiliensis]
Length=208

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PA+  C  +S+ IR C+ +GIKV+LSLGGG+G Y L+ +
Sbjct  31   AFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQ  90

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW NFLGG+S+SRPLGD  LDGIDF
Sbjct  91   ADAKNVADYLWSNFLGGKSSSRPLGDAVLDGIDF  124



>ref|XP_010454699.1| PREDICTED: acidic endochitinase isoform X2 [Camelina sativa]
Length=302

 Score =   133 bits (334),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C  +  +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTRIGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVVANYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>ref|XP_003540115.1| PREDICTED: acidic endochitinase-like [Glycine max]
Length=298

 Score =   131 bits (329),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG+G TP LNLAGHC+P++N C   SDEI+ C+ KGIKVLLSLGG  G Y L   
Sbjct  58   AFLSTFGNGQTPQLNLAGHCEPSTNGCTKFSDEIKACQGKGIKVLLSLGGASGSYSLGSA  117

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            ++A  +A +LW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  118  EEATQLATFLWNNFLGGQSSSRPLGDAVLDGIDF  151


 Score = 41.2 bits (95),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL   C+T  Y+ VN+
Sbjct  30   IAIYWGQNGNEGSLADACNTGNYQFVNI  57



>ref|XP_011005445.1| PREDICTED: hevamine-A-like [Populus euphratica]
Length=296

 Score =   133 bits (334),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PA+  C  +S  I+ C+ +GIKVLLSLGGG+G+Y L+ +
Sbjct  57   AFLNKFGNGQTPEMNLAGHCNPANGGCTIVSGGIKSCQQQGIKVLLSLGGGIGNYTLASK  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  117  GDAKNVADYLWNNFLGGQSSSRPLGDAVLDGIDF  150


 Score = 39.3 bits (90),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L QTC T  Y  V++
Sbjct  29   ISIYWGQNGNEGTLAQTCATGRYAYVSI  56



>dbj|BAA21875.1| acidic endochitinase [Arabidopsis halleri subsp. gemmifera]
Length=302

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++YC+S+GIK +LSLGGG+G+Y +  +
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKYCQSRGIKAMLSLGGGIGNYSIGSK  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVVADYLWNNFLGGKSSSRPLGDAVLDGIDF  153



>emb|CDP05113.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   133 bits (334),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG G TPVLNLAGHCDP S  C  LS EI+ C+++ IKVLLSLGG +G+Y L+  
Sbjct  58   AFLTTFGGGKTPVLNLAGHCDPPSGTCASLSAEIKACQNRNIKVLLSLGGQIGNYGLTSA  117

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA YLW+ FLGGQS SRPLGD  LDGIDF
Sbjct  118  DDAGQVANYLWNTFLGGQSGSRPLGDAVLDGIDF  151


 Score = 39.3 bits (90),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IA+YWGQ+G EGSL  TC +  Y+ VN+
Sbjct  30   IAVYWGQHGDEGSLADTCASGNYQFVNL  57



>ref|XP_009141891.1| PREDICTED: acidic endochitinase [Brassica rapa]
Length=301

 Score =   132 bits (333),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  59   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  118

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  119  EDAKVVANYLWNNFLGGKSSSRPLGDAVLDGIDF  152


 Score = 39.7 bits (91),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  31   IAIYWGQNGNEGNLSSTCATGRYAYVNV  58



>gb|AFK26308.1| chitinase 3 [Avicennia marina]
Length=302

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -1

Query  279  FLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFRD  100
            FLTTFG+G +PVLNLAGHC+PA+  C  +S++IR C+ +GIKVLLSLGG  G Y LS  D
Sbjct  66   FLTTFGNGQSPVLNLAGHCNPAAGTCTGISNDIRACQGQGIKVLLSLGGATGSYSLSSAD  125

Query  99   DARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DA+ VA YLW+N+LGG S SRPLGD  LDGIDF
Sbjct  126  DAKQVANYLWNNYLGGSSGSRPLGDAVLDGIDF  158



>ref|XP_010454698.1| PREDICTED: acidic endochitinase isoform X1 [Camelina sativa]
Length=302

 Score =   132 bits (333),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C  +  +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTRIGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVVANYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>ref|XP_008437976.1| PREDICTED: acidic endochitinase-like [Cucumis melo]
Length=296

 Score =   132 bits (332),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHCDP SN C  +S +I+ C++KGIKV+LS+GGGVG Y+LS  
Sbjct  54   AFLAVFGNGQTPQINLAGHCDPFSNGCIHVSSDIKSCQAKGIKVILSIGGGVGSYFLSSD  113

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+N+LGG S SRPLG+  LDG+DF
Sbjct  114  DDARKVALYLWNNYLGGNSGSRPLGNAVLDGVDF  147


 Score = 40.0 bits (92),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIV  288
            IAIYWGQNG EG+L  TC T  Y+IV
Sbjct  26   IAIYWGQNGNEGTLADTCATGNYQIV  51



>ref|XP_006422092.1| hypothetical protein CICLE_v10005522mg [Citrus clementina]
 ref|XP_006490595.1| PREDICTED: hevamine-A-like [Citrus sinensis]
 gb|ESR35332.1| hypothetical protein CICLE_v10005522mg [Citrus clementina]
 gb|KDO56164.1| hypothetical protein CISIN_1g043511mg [Citrus sinensis]
Length=300

 Score =   132 bits (331),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PA+  C+ +SD I+ C+S+GIKV+LSLGGGVG Y L+  
Sbjct  58   AFLNKFGNGQTPEINLAGHCNPAAGGCRVVSDAIKSCQSRGIKVMLSLGGGVGSYSLASV  117

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  118  ADAKNVADYLWNNFLGGTSSSRPLGAAVLDGIDF  151


 Score = 40.4 bits (93),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  30   IAIYWGQNGNEGTLTSTCATGKYAYVNI  57



>ref|XP_002276365.2| PREDICTED: chitinase 1-like [Vitis vinifera]
Length=597

 Score =   129 bits (325),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+  TP LNLAGHCDP S+ C +LSD+I+ C+ +GIKVLLS+GG  G Y L   
Sbjct  358  AFLVVFGNNQTPQLNLAGHCDPTSSGCTWLSDDIKACQDQGIKVLLSIGGASGSYTLISA  417

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NF GGQS+SRPLGD  LDGIDF
Sbjct  418  EDAREVANYLWNNFFGGQSSSRPLGDAVLDGIDF  451


 Score = 42.7 bits (99),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I +YWGQNG EGSL  TC + YY IVN+
Sbjct  330  ITVYWGQNGNEGSLADTCSSGYYGIVNI  357


 Score =   123 bits (308),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQ-CKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSF  106
            AFL+ FG+G TP +NLAGHCDP S + C+ +S+ I+ C+ +GIKV+LS+GGG G Y L+ 
Sbjct  55   AFLSAFGNGQTPKINLAGHCDPNSAKGCRRVSNGIKNCQGQGIKVMLSIGGGDGSYTLTS  114

Query  105  RDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DDAR VA Y+W+NFLGG S+SRPLGD  LDGIDF
Sbjct  115  DDDARTVADYIWNNFLGGWSSSRPLGDAVLDGIDF  149


 Score = 37.0 bits (84),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            +IA+YWGQ+  EG+L +TC+T  Y  VN+
Sbjct  26   EIAVYWGQDEQEGTLTKTCNTRKYAYVNI  54



>gb|KHN46436.1| Acidic endochitinase [Glycine soja]
Length=274

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+P +N C   S EI+ C+SKGIKVLLS+GGG+G Y L+  
Sbjct  58   AFLNKFGNGKTPEMNLAGHCNPTTNSCTKFSSEIKDCQSKGIKVLLSIGGGIGSYTLASV  117

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DARNV+ +LW+ FLGG+S+SRPLGD  LDGIDF
Sbjct  118  EDARNVSTFLWNTFLGGKSSSRPLGDAVLDGIDF  151



>ref|XP_009393386.1| PREDICTED: acidic endochitinase-like [Musa acuminata subsp. malaccensis]
Length=299

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP SN C  LS +I  C+  GIKVLLS+GGGVG YYLS R
Sbjct  57   AFLPTFGNGQTPMINLAGHCDPYSNGCTGLSRDIAACQRAGIKVLLSIGGGVGSYYLSSR  116

Query  102  DDARNVAQYLWDNFLGGQSAS-RPLGDESLDGIDF  1
            +DAR VA Y+W NFLGG S+S RPLGD  LDG+DF
Sbjct  117  EDARRVATYIWSNFLGGSSSSPRPLGDVVLDGVDF  151



>ref|XP_007011079.1| Acidic endochitinase [Theobroma cacao]
 gb|EOY19889.1| Acidic endochitinase [Theobroma cacao]
Length=305

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 89/141 (63%), Gaps = 14/141 (10%)
 Frame = -1

Query  396  FLA*HLSRGRYRDILGPKWV*GQPTTNLRHQLLRDR---------KHAFLTTFGHGTTPV  244
            F+A  LS+  Y  ++   W  GQ   NL    L++            AFL  FG G TP 
Sbjct  14   FVAAALSKTSYATVISTYW--GQ---NLYEGTLKEACDTGIYDIINLAFLNVFGGGQTPS  68

Query  243  LNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFRDDARNVAQYLWDN  64
            LNLAGHCDP S  C    ++I YC+  GIK+LLSLGG  G+YYLS +DDA++VA YLW+ 
Sbjct  69   LNLAGHCDPPSGTCVIFGEQITYCQGLGIKILLSLGGAAGNYYLSSQDDAQSVADYLWNT  128

Query  63   FLGGQSASRPLGDESLDGIDF  1
            FLGG++++ PLGD +LDGIDF
Sbjct  129  FLGGRTSAGPLGDATLDGIDF  149



>emb|CDX87145.1| BnaC09g04600D [Brassica napus]
Length=301

 Score =   132 bits (333),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  59   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  118

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  119  EDAKVVANYLWNNFLGGKSSSRPLGDAVLDGIDF  152


 Score = 39.7 bits (91),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  31   IAIYWGQNGNEGNLSSTCATGRYAYVNV  58



>pdb|2GSJ|A Chain A, Cdna Cloning And 1.75a Crystal Structure Determination 
Of Ppl2, A Novel Chimerolectin From Parkia Platycephala Seeds 
Exhibiting Endochitinolytic Activity
Length=271

 Score =   130 bits (328),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+ FG G  P +NLAGHCDPA+N C+ +SD IR C+ +GIKV+LS+GGG G Y LS  
Sbjct  31   AFLSQFGGGRRPQINLAGHCDPANNGCRTVSDGIRACQRRGIKVMLSIGGGAGSYSLSSV  90

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DAR+VA Y+W+NFLGG+S+SRPLGD  LDG+DF
Sbjct  91   QDARSVADYIWNNFLGGRSSSRPLGDAVLDGVDF  124


 Score = 41.6 bits (96),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I +YWGQNG EG+L  TC++  Y+IVN+
Sbjct  3    IVVYWGQNGGEGTLTSTCESGLYQIVNI  30



>ref|XP_003556139.1| PREDICTED: hevamine-A-like [Glycine max]
Length=301

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+P +N C   S EI+ C+SKGIKVLLS+GGG+G Y L+  
Sbjct  58   AFLNKFGNGKTPEMNLAGHCNPTTNSCTKFSSEIKDCQSKGIKVLLSIGGGIGSYTLASV  117

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DARNV+ +LW+ FLGG+S+SRPLGD  LDGIDF
Sbjct  118  EDARNVSTFLWNTFLGGKSSSRPLGDAVLDGIDF  151



>gb|ACU21310.1| unknown [Glycine max]
Length=251

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG G TP +NLAGHC+P +N C   S EI+ C+SKGIKVLLS+GGG+G Y L+  
Sbjct  58   AFLNKFGSGKTPEMNLAGHCNPTTNSCTKFSSEIKDCQSKGIKVLLSIGGGIGSYTLASV  117

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DARNV+ +LW+ FLGG+S+SRPLGD  LDGIDF
Sbjct  118  EDARNVSTFLWNTFLGGKSSSRPLGDAVLDGIDF  151



>emb|CDP00697.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   130 bits (327),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG G TP++NLAGHCDP SN C  LS +I+ C++KGIKVLLS+GGGV  Y L   
Sbjct  57   AFLSTFGGGRTPMINLAGHCDPYSNACVGLSADIKACQAKGIKVLLSIGGGVVSYSLDSS  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DAR VA YLW+NFLGG S++RPLGD  LDGIDF
Sbjct  117  GDARQVATYLWNNFLGGHSSTRPLGDAVLDGIDF  150


 Score = 42.0 bits (97),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC +  Y IVN+
Sbjct  29   IAIYWGQNGNEGTLAETCASGNYHIVNL  56



>ref|XP_010035190.1| PREDICTED: hevamine-A-like [Eucalyptus grandis]
 gb|KCW46483.1| hypothetical protein EUGRSUZ_K00308 [Eucalyptus grandis]
Length=301

 Score =   131 bits (330),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG G TP +NLAGHCDP S  C   S+ IR C+++GIKV+LSLGGGVG Y L+ +
Sbjct  59   AFLYKFGGGQTPQINLAGHCDPTSGGCTSTSNGIRSCQNQGIKVMLSLGGGVGSYSLASQ  118

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DARNVA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  119  ADARNVANYLWNNFLGGTSSSRPLGDAVLDGIDF  152


 Score = 40.8 bits (94),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  31   IAIYWGQNGNEGTLASTCATGKYAYVNL  58



>ref|XP_002461856.1| hypothetical protein SORBIDRAFT_02g009380 [Sorghum bicolor]
 gb|EER98377.1| hypothetical protein SORBIDRAFT_02g009380 [Sorghum bicolor]
Length=297

 Score =   131 bits (329),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP LNLAGHCDP S  C   SD+I+ C+S G+KV+LS+GG  G YYL+  
Sbjct  56   AFLVTFGNGQTPELNLAGHCDPTSGGCASQSDDIKSCQSNGVKVMLSIGGASGSYYLTSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+ VA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  116  ADAKTVATYLWNNFLGGHSSSRPLGDAVLDGIDF  149


 Score = 40.8 bits (94),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L  TC +  Y+IVN+
Sbjct  28   ISIYWGQNGGEGTLADTCASGNYKIVNL  55



>ref|XP_006376615.1| hypothetical protein POPTR_0012s01150g [Populus trichocarpa]
 gb|ERP54412.1| hypothetical protein POPTR_0012s01150g [Populus trichocarpa]
Length=303

 Score =   131 bits (329),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  P +NLAGHC+PA+  CK +S  I+ C+ +GIKVLLSLGG +G+Y L+ +
Sbjct  61   AFLNKFGNGQPPEMNLAGHCNPANGGCKIVSSGIKSCQQQGIKVLLSLGGSIGNYTLASK  120

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  121  DDARGVADYLWNNFLGGRSSSRPLGDAVLDGIDF  154


 Score = 40.8 bits (94),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L QTC T  Y  VN+
Sbjct  33   ISIYWGQNGNEGTLAQTCATGRYAYVNI  60



>gb|ADP68561.1| class 3 chitinase [Hippophae rhamnoides]
Length=297

 Score =   130 bits (327),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+PAS  C  +S  I  C+++GIKV+LS+GGGVG+Y LS  
Sbjct  56   AFLNKFGNGQTPEINLAGHCNPASKGCTSVSTGIGNCQNRGIKVMLSIGGGVGNYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+NVA YLW+ FLGGQS+SRPLGD  LDGIDF
Sbjct  116  NDAQNVANYLWNTFLGGQSSSRPLGDAVLDGIDF  149


 Score = 41.6 bits (96),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC+T  Y   N+
Sbjct  28   IAIYWGQNGNEGTLTQTCNTGKYSYANI  55



>dbj|BAC11881.1| acidic endochitinase [Olimarabidopsis pumila]
Length=295

 Score =   131 bits (330),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTRFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVVADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 40.4 bits (93),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNL  59



>dbj|BAA21870.1| acidic endochitinase [Arabidopsis thaliana]
Length=302

 Score =   132 bits (331),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ +A YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVIADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 40.0 bits (92),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>dbj|BAA21874.1| acidic endochitinase [Arabidopsis thaliana]
Length=302

 Score =   132 bits (331),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ +A YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVIADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>dbj|BAA21860.1| acidic endochitinase [Arabidopsis thaliana]
Length=302

 Score =   132 bits (331),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ +A YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVIADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>dbj|BAA21873.1| acidic endochitinase [Arabidopsis thaliana]
Length=302

 Score =   132 bits (331),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ +A YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVIADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>dbj|BAA21869.1| acidic endochitinase [Arabidopsis thaliana]
Length=302

 Score =   132 bits (331),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ +A YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVIADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>ref|XP_009338801.1| PREDICTED: acidic endochitinase-like [Pyrus x bretschneideri]
Length=301

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 84/133 (63%), Gaps = 0/133 (0%)
 Frame = -1

Query  399  PFLA*HLSRGRYRDILGPKWV*GQPTTNLRHQLLRDRKHAFLTTFGHGTTPVLNLAGHCD  220
            PFL      GR     G     G  T        R    AFL+ FG+G TP +NLAGHCD
Sbjct  21   PFLVSRSFAGRIVVYWGQNRGEGTLTATCNTGRYRIVNIAFLSQFGNGQTPQINLAGHCD  80

Query  219  PASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFRDDARNVAQYLWDNFLGGQSAS  40
            PASN C+ +S  IR C+++GIKVLLS+GG +G Y L   DDAR VA Y+W+NFLGGQS S
Sbjct  81   PASNGCQKVSTGIRNCQNQGIKVLLSIGGSLGSYTLPSADDARGVADYIWNNFLGGQSNS  140

Query  39   RPLGDESLDGIDF  1
            RPLGD  LDG+DF
Sbjct  141  RPLGDAVLDGVDF  153



>ref|XP_002533316.1| hevamine-A precursor, putative [Ricinus communis]
 gb|EEF29073.1| hevamine-A precursor, putative [Ricinus communis]
Length=298

 Score =   130 bits (326),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG+G TP++NLAGHCDP SN C  LS +I  C+SKGIKV+LS+GGG G Y L+  
Sbjct  56   AFLSSFGNGQTPMINLAGHCDPYSNGCIGLSSDIESCQSKGIKVILSIGGGAGGYSLASA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW+NFL G S+SRPLG   LDGIDF
Sbjct  116  DDARQVATYLWNNFLDGTSSSRPLGPAVLDGIDF  149


 Score = 41.6 bits (96),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLAETCATGNYDFVNI  55



>dbj|BAA21867.1| acidic endochitinase [Arabidopsis thaliana]
Length=302

 Score =   132 bits (331),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ +A YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVIADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>dbj|BAA21865.1| acidic endochitinase [Arabidopsis thaliana]
Length=302

 Score =   132 bits (331),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ +A YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVIADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>ref|NP_197797.1| chitinase A [Arabidopsis thaliana]
 sp|P19172.2|CHIA_ARATH RecName: Full=Acidic endochitinase; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAA21861.1| acidic endochitinase [Arabidopsis thaliana]
 dbj|BAA21862.1| acidic endochitinase [Arabidopsis thaliana]
 dbj|BAA21864.1| acidic endochitinase [Arabidopsis thaliana]
 dbj|BAA21866.1| acidic endochitinase [Arabidopsis thaliana]
 dbj|BAA21868.1| acidic endochitinase [Arabidopsis thaliana]
 dbj|BAA21871.1| acidic endochitinase [Arabidopsis thaliana]
 dbj|BAB08732.1| acidic endochitinase [Arabidopsis thaliana]
 gb|AAW49295.1| At5g24090 [Arabidopsis thaliana]
 gb|AAX49380.1| At5g24090 [Arabidopsis thaliana]
 gb|AED93255.1| chitinase A [Arabidopsis thaliana]
Length=302

 Score =   132 bits (331),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ +A YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVIADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>ref|XP_002320164.2| chitinase family protein [Populus trichocarpa]
 gb|EEE98479.2| chitinase family protein [Populus trichocarpa]
Length=298

 Score =   131 bits (329),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP SN C  LS +I+ C+++G+KV+LS+GG  G Y L+  
Sbjct  56   AFLVTFGNGQTPMINLAGHCDPYSNGCTSLSSDIKSCQAQGVKVMLSIGGASGSYSLASS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  116  EDARQVATYLWNNFLGGHSSSRPLGSAVLDGIDF  149


 Score = 40.4 bits (93),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLADTCATGNYQYVNL  55



>ref|XP_009375570.1| PREDICTED: acidic endochitinase SE2-like [Pyrus x bretschneideri]
Length=343

 Score =   132 bits (332),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFLTTFG+   PVLNLAGHC+P S  C  LS +IR C+SK IKVLLS+GG  G Y L+  
Sbjct  74   AFLTTFGNNKAPVLNLAGHCNPTSGNCTGLSADIRTCQSKNIKVLLSIGGAAGSYNLTSA  133

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA Y+W+NFLGGQSASRPLGD  LDG+DF
Sbjct  134  DDAGQVADYIWNNFLGGQSASRPLGDAVLDGVDF  167


 Score = 39.3 bits (90),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L   C++  Y+ VN+
Sbjct  46   IAIYWGQNGNEGTLADACNSGNYQFVNI  73



>gb|EMT30347.1| Acidic endochitinase [Aegilops tauschii]
Length=297

 Score =   131 bits (330),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG+G  PVLNLAGHC P +  C  LS +I+ C+S G+KV+LS+GGG G YYLS  
Sbjct  56   AFLSSFGNGQPPVLNLAGHCVPTNGGCASLSSDIKSCQSNGVKVMLSIGGGAGGYYLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  116  QDAKNVATYLWNNFLGGTSSSRPLGDAVLDGIDF  149


 Score = 40.0 bits (92),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L  TC T  Y+ VN+
Sbjct  28   ISIYWGQNGGEGTLAATCATGNYKFVNI  55



>ref|XP_011037250.1| PREDICTED: hevamine-A-like [Populus euphratica]
Length=298

 Score =   131 bits (329),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP SN C  LS +I+ C+++G+KV+LS+GG  G Y L+  
Sbjct  56   AFLVTFGNGQTPMINLAGHCDPYSNGCTSLSSDIKSCQAQGVKVMLSIGGASGSYSLASS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  116  EDARQVATYLWNNFLGGHSSSRPLGSAVLDGIDF  149


 Score = 40.4 bits (93),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLADTCATGNYQYVNL  55



>ref|XP_002266583.1| PREDICTED: acidic endochitinase [Vitis vinifera]
 emb|CAN79285.1| hypothetical protein VITISV_027099 [Vitis vinifera]
Length=297

 Score =   128 bits (322),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP +NLAGHC+ ASN C  +S+ IR C+++G KV+LS+GGGVG+Y LS  
Sbjct  56   AFLNKFGNGRTPAINLAGHCNSASNGCTSVSNGIRNCQNRGTKVMLSIGGGVGNYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+ VA YLW+NFLGG+S+SRPLGD  LDG+DF
Sbjct  116  YDAQKVANYLWNNFLGGKSSSRPLGDAVLDGVDF  149


 Score = 43.1 bits (100),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC+T  Y  VN+
Sbjct  28   IAIYWGQNGNEGTLTQTCNTGKYSYVNI  55



>gb|AAA32768.1| acidic endochitinase [Arabidopsis thaliana]
 prf||1710349B acidic chitinase
Length=302

 Score =   131 bits (330),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ +A YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVIADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>gb|ACU31856.1| acidic endochitinase [Nepenthes rafflesiana]
Length=292

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            +FLTTFG+G TPVLNLAGHCDP+SN C  LS +I  C+++GIKVLLSLGG  G Y L   
Sbjct  57   SFLTTFGNGQTPVLNLAGHCDPSSNGCTGLSTDITSCQNQGIKVLLSLGGASGSYSLVST  116

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA YLW+N+LGGQS SRPLG   LDGIDF
Sbjct  117  DDASQVATYLWNNYLGGQSDSRPLGSAVLDGIDF  150



>dbj|BAC11882.1| acidic endochitinase [Olimarabidopsis cabulica]
Length=302

 Score =   131 bits (330),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTRFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  EDAKVVADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>gb|KDP44396.1| hypothetical protein JCGZ_20076 [Jatropha curcas]
Length=296

 Score =   129 bits (325),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP ++L+GHCDP SN C  LS +I+ C++KGIKV+LS+GGG G YYL+  
Sbjct  54   AFLPTFGNGQTPRIDLSGHCDPYSNGCTGLSSDIKSCQAKGIKVMLSIGGGAGSYYLAST  113

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+ VA YLW+NFLGG S+SRPLG   LDGIDF
Sbjct  114  QDAKQVAAYLWNNFLGGYSSSRPLGPAVLDGIDF  147


 Score = 41.6 bits (96),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  26   IAIYWGQNGNEGTLAETCATGNYDFVNI  53



>dbj|BAC11880.1| acidic endochitinase [Crucihimalaya himalaica]
Length=295

 Score =   131 bits (330),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  KDAKVVANYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 39.7 bits (91),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLPATCATGRYAYVNV  59



>gb|KGN49896.1| hypothetical protein Csa_5G139740 [Cucumis sativus]
Length=298

 Score =   127 bits (319),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG G TPVLNLAGHC+P +N C  LS+EI  C+S+ +KVLLS+GGG G Y L   
Sbjct  56   AFLSSFGGGQTPVLNLAGHCNPDNNGCTILSNEINSCQSQNVKVLLSIGGGTGSYSLYSA  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA+ VA ++W+++LGGQS SRPLGD  LDG+DF
Sbjct  116  DDAKEVANFIWNSYLGGQSDSRPLGDAVLDGVDF  149


 Score = 43.9 bits (102),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EGSL  TC T  YE VN+
Sbjct  28   IAIYWGQNGNEGSLASTCATGNYEFVNI  55



>ref|XP_004490140.1| PREDICTED: acidic endochitinase-like [Cicer arietinum]
Length=294

 Score =   130 bits (326),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL +FG+G  P++NLAGHCDP SN C  L+ +I+ C+SKGIKVLLS+GGG G Y LS  
Sbjct  55   AFLPSFGNGQKPMINLAGHCDPYSNACTKLTSDIKSCQSKGIKVLLSIGGGAGSYSLSSS  114

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+ VA YLW+NFLGG+S SRPLG   LDGIDF
Sbjct  115  HDAKQVATYLWNNFLGGRSPSRPLGPAVLDGIDF  148


 Score = 41.2 bits (95),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -2

Query  368  DIAIYWGQNGYEGSLQQTCDTNYYEIV  288
             IAIYWGQNG EG+L QTC T  YE V
Sbjct  26   SIAIYWGQNGNEGTLAQTCATGNYEYV  52



>ref|XP_009150936.1| PREDICTED: acidic endochitinase [Brassica rapa]
Length=301

 Score =   127 bits (319),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+ +GIKV+LSLGG +G+Y +  R
Sbjct  59   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGAQVKTCQLRGIKVMLSLGGAIGNYSIRSR  118

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG+S++RPLGD  LDGIDF
Sbjct  119  EDAKMVADYLWNNFLGGKSSARPLGDAVLDGIDF  152


 Score = 43.5 bits (101),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG+EGSL  TC T  Y  VN+
Sbjct  31   IAIYWGQNGFEGSLSSTCATVRYAYVNI  58



>gb|EAZ03535.1| hypothetical protein OsI_25670 [Oryza sativa Indica Group]
Length=297

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PV NLAGHC P +  C   S +I+ C+S+G+KV+LS+GGG G YYLS  
Sbjct  56   AFLAAFGNGQPPVFNLAGHCGPTNGGCASQSSDIKSCQSRGVKVMLSIGGGAGSYYLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+NVA YLW+NFLGGQS+SRPLGD  LDGIDF
Sbjct  116  EDAKNVATYLWNNFLGGQSSSRPLGDAVLDGIDF  149



>dbj|BAK23248.1| chitinase [Spinacia oleracea]
Length=234

 Score =   130 bits (328),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL++FG+G TPVLNLAGHCDPA+N C  LS +I+ C+  GIKVLLS+GGG G Y LS  
Sbjct  21   AFLSSFGNGQTPVLNLAGHCDPATN-CGSLSTDIKACQQAGIKVLLSIGGGAGGYSLSST  79

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA YLW+ +LGGQS SRPLGD  LDGIDF
Sbjct  80   DDANQVADYLWNTYLGGQSTSRPLGDAVLDGIDF  113



>dbj|BAK02328.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPA-SNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSF  106
            AFL TFG G  P+LNLAGHCDPA S  C F+  +++ C+S+GIKVLLS+GGGVG Y LS 
Sbjct  57   AFLFTFGRGQKPLLNLAGHCDPATSGSCTFVGADVKSCQSRGIKVLLSIGGGVGSYGLSS  116

Query  105  RDDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DDA+ VA+YLW+N+LGG SASRPLGD  LDG+DF
Sbjct  117  ADDAKEVAKYLWENYLGGTSASRPLGDAVLDGVDF  151



>ref|XP_010097886.1| hypothetical protein L484_011486 [Morus notabilis]
 gb|EXB72483.1| hypothetical protein L484_011486 [Morus notabilis]
Length=300

 Score =   127 bits (320),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP ++LAGHC PA   C  +SD IR C+S+GIKV+LS+GGG+G Y LS  
Sbjct  58   AFLNKFGNGQTPQIDLAGHCVPALKTCTVVSDGIRSCQSRGIKVMLSIGGGIGTYSLSST  117

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+NVA YLW+NFLGG+S SRPLGD  LDG+DF
Sbjct  118  VDAKNVADYLWNNFLGGKSFSRPLGDAVLDGVDF  151


 Score = 43.5 bits (101),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC T  Y  VN+
Sbjct  30   IAIYWGQNGNEGTLAQTCATGKYSFVNI  57



>gb|KDP28548.1| hypothetical protein JCGZ_14319 [Jatropha curcas]
Length=298

 Score =   129 bits (325),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+TFG G TP++NLAGHCDP SN C  LS +I+ C+++GI V+LS+GGGV  Y LS  
Sbjct  56   AFLSTFGGGRTPMINLAGHCDPYSNGCTKLSSDIKSCQARGINVMLSIGGGVVSYSLSSS  115

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DAR VA YLW NFLGG+S+SRPLG   LDGIDF
Sbjct  116  EDARQVATYLWKNFLGGKSSSRPLGPAVLDGIDF  149


 Score = 41.2 bits (95),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L +TC T  Y+ VN+
Sbjct  28   IAIYWGQNGNEGTLAETCATGNYKYVNL  55



>emb|CAA61280.1| acidic chitinase class 3 [Vigna unguiculata]
Length=250

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL+ FG G TP LNLAGHC+P+ N C   SD+I+ C+S+GIKVL SLGG  G Y LS  
Sbjct  29   AFLSAFGGGQTPQLNLAGHCNPSINNCNVFSDQIKGCQSRGIKVLPSLGGASGSYSLSSA  88

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA  VA Y+W+NFLGGQS+SRPLGD  LDG+DF
Sbjct  89   DDATQVANYIWNNFLGGQSSSRPLGDAVLDGVDF  122



>dbj|BAA21872.1| acidic endochitinase [Arabidopsis thaliana]
Length=302

 Score =   131 bits (329),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGRTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  KDAKVVADYLWNNFLGGKSSSRPLGDAVLDGIDF  153


 Score = 40.0 bits (92),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L  TC T  Y  VN+
Sbjct  32   IAIYWGQNGNEGNLSATCATGRYAYVNV  59



>dbj|BAC11883.1| acidic endochitinase [Crucihimalaya wallichii]
Length=295

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G TP LNLAGHC+PA+N C     +++ C+S+GIKV+LSLGGG+G+Y +  R
Sbjct  60   AFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSR  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DA+ VA YLW+NFLGG+S+SRPLGD  LDGIDF
Sbjct  120  KDAKVVANYLWNNFLGGKSSSRPLGDAVLDGIDF  153



>ref|XP_007157427.1| hypothetical protein PHAVU_002G069300g [Phaseolus vulgaris]
 gb|ESW29421.1| hypothetical protein PHAVU_002G069300g [Phaseolus vulgaris]
Length=296

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG+G TP++NLAGHCDP S+ C  LS +I+ C++KGIKVLLSLGGG G Y L+  
Sbjct  55   AFLPTFGNGQTPMINLAGHCDPYSDACTKLSSDIKSCQAKGIKVLLSLGGGAGSYSLASP  114

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
             DAR VA YLW+NFLGG S SRPLG   LDGIDF
Sbjct  115  QDARQVATYLWNNFLGGTSPSRPLGPAVLDGIDF  148



>ref|XP_010058127.1| PREDICTED: acidic endochitinase-like [Eucalyptus grandis]
Length=474

 Score =   133 bits (335),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  PVLNLAGHCDP++  C  LS EI+ C+++G+KV+LS+GGG G YYL+  
Sbjct  233  AFLCVFGNGQAPVLNLAGHCDPSNGGCTSLSSEIKSCQARGVKVILSIGGGAGSYYLASA  292

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            +DA+ VA YLW+NFLGG S+SRPLGD  LDGIDF
Sbjct  293  EDAKQVATYLWNNFLGGHSSSRPLGDAVLDGIDF  326


 Score = 37.0 bits (84),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L   C +  Y+ VN+
Sbjct  205  ISIYWGQNGNEGTLADACASGNYKFVNL  232



>ref|XP_011001950.1| PREDICTED: hevamine-A-like [Populus euphratica]
Length=303

 Score =   129 bits (325),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL  FG+G  P +NLAGHC+PA+  CK +S  I+ C+ +GIKVLLSLGG +G+Y L+ +
Sbjct  61   AFLNKFGNGQPPEMNLAGHCNPANGGCKIVSRGIKSCQQQGIKVLLSLGGSIGNYTLASK  120

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDAR VA YLW NFLGGQS+SRPLGD  LDG DF
Sbjct  121  DDARGVADYLWSNFLGGQSSSRPLGDAVLDGTDF  154


 Score = 40.8 bits (94),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            I+IYWGQNG EG+L QTC T  Y  VN+
Sbjct  33   ISIYWGQNGNEGTLAQTCATGRYAYVNI  60



>ref|XP_007051193.1| Acidic endochitinase [Theobroma cacao]
 gb|EOX95350.1| Acidic endochitinase [Theobroma cacao]
Length=309

 Score =   129 bits (323),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG G TP +NLAGHCDP+S  C    D+I YC+  GIKVLLSLGG  G+YYL+  
Sbjct  60   AFLNTFGDGQTPSMNLAGHCDPSSGTCVIFGDQISYCQDLGIKVLLSLGGAWGNYYLTST  119

Query  102  DDARNVAQYLWDNFLGGQSASRPLGDESLDGIDF  1
            DDA++VA YLW+ FLGG++++ PLGD +LDGIDF
Sbjct  120  DDAQSVADYLWNTFLGGRTSAGPLGDATLDGIDF  153


 Score = 42.0 bits (97),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIV  288
            I+ YWGQNG+EG+L++ CDT  Y+I+
Sbjct  32   ISTYWGQNGFEGTLKEACDTGTYKII  57



>tpg|DAA56721.1| TPA: hevamine-A [Zea mays]
Length=311

 Score =   127 bits (320),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -1

Query  282  AFLTTFGHGTTPVLNLAGHCDPASNQCKFLSDEIRYCKSKGIKVLLSLGGGVGDYYLSFR  103
            AFL TFG G TP LNLAGHCDPAS  C  +  +++ C+  G+KVLLS+GGGVG Y LS R
Sbjct  63   AFLPTFGRGQTPALNLAGHCDPASGGCTGVGADVKACQRMGVKVLLSIGGGVGSYGLSSR  122

Query  102  DDARNVAQYLWDNFL-GGQSASRPLGDESLDGIDF  1
             DAR+VA YLWDN+L GG S SRPLGD  LDG+DF
Sbjct  123  ADARSVAAYLWDNYLGGGGSESRPLGDAVLDGVDF  157


 Score = 43.1 bits (100),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  365  IAIYWGQNGYEGSLQQTCDTNYYEIVNM  282
            IAIYWGQNG EG+L QTC T  Y  VN+
Sbjct  35   IAIYWGQNGNEGTLAQTCATGNYRFVNV  62



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 532443275320