BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c43408_g1_i1 len=250 path=[228:0-249]

Length=250
                                                                      Score     E

ref|XP_009627242.1|  PREDICTED: uncharacterized protein LOC104117826    148   4e-40   
ref|XP_009765669.1|  PREDICTED: uncharacterized protein LOC104217192    148   4e-40   
ref|XP_006363936.1|  PREDICTED: uncharacterized protein LOC102580594    146   3e-39   
ref|XP_011087060.1|  PREDICTED: uncharacterized protein LOC105168623    138   2e-36   
gb|EYU28719.1|  hypothetical protein MIMGU_mgv1a017992mg                137   3e-36   
gb|EYU28720.1|  hypothetical protein MIMGU_mgv1a019168mg                135   2e-35   
ref|XP_011015276.1|  PREDICTED: uncharacterized protein LOC105118916    132   5e-34   
gb|EYU28721.1|  hypothetical protein MIMGU_mgv1a019021mg                130   9e-34   
emb|CDP21840.1|  unnamed protein product                                129   2e-33   
ref|XP_008390061.1|  PREDICTED: uncharacterized protein LOC103452339    129   4e-33   
ref|XP_010096357.1|  hypothetical protein L484_021105                   129   5e-33   
ref|XP_004298441.1|  PREDICTED: polyvinylalcohol dehydrogenase-like     128   7e-33   
ref|XP_006374054.1|  hypothetical protein POPTR_0016s14620g             127   2e-32   
ref|XP_010652333.1|  PREDICTED: uncharacterized protein LOC104879807    123   4e-31   
ref|XP_010066940.1|  PREDICTED: uncharacterized protein LOC104453970    123   5e-31   
ref|XP_006438637.1|  hypothetical protein CICLE_v10033589mg             122   7e-31   
ref|XP_010683398.1|  PREDICTED: uncharacterized protein LOC104898088    120   3e-30   
gb|KDP21213.1|  hypothetical protein JCGZ_21684                         119   4e-30   
ref|XP_010068791.1|  PREDICTED: uncharacterized protein LOC104455754    115   7e-30   
gb|KCW64985.1|  hypothetical protein EUGRSUZ_G02529                     117   2e-29   
ref|XP_010652339.1|  PREDICTED: uncharacterized protein LOC104879808    117   5e-29   
emb|CBI31999.3|  unnamed protein product                                117   5e-29   
ref|XP_007046194.1|  Uncharacterized protein TCM_011786                 115   1e-28   
gb|KCW64987.1|  hypothetical protein EUGRSUZ_G02531                     115   2e-28   
ref|XP_010068793.1|  PREDICTED: uncharacterized protein LOC104455756    115   2e-28   
ref|XP_010242400.1|  PREDICTED: uncharacterized protein LOC104586761    110   2e-26   
ref|XP_011098591.1|  PREDICTED: uncharacterized protein LOC105177224    110   2e-26   
ref|XP_007099708.1|  Quinohemoprotein ethanol dehydrogenase type-1      107   4e-25   
ref|XP_007224952.1|  hypothetical protein PRUPE_ppa021290mg             105   5e-25   
gb|EYU34100.1|  hypothetical protein MIMGU_mgv1a026159mg                104   3e-24   
ref|XP_010661033.1|  PREDICTED: uncharacterized protein LOC104881693    104   3e-24   
ref|XP_003621148.1|  Quinohaemoprotein ethanol dehydrogenase type-1     104   3e-24   
ref|XP_010661145.1|  PREDICTED: uncharacterized protein LOC100853307    103   4e-24   
emb|CBI22171.3|  unnamed protein product                                104   6e-24   
ref|XP_007099711.1|  Quinohemoprotein ethanol dehydrogenase type-1      105   6e-24   
ref|XP_010690063.1|  PREDICTED: uncharacterized protein LOC104903...    103   8e-24   
ref|XP_010690064.1|  PREDICTED: uncharacterized protein LOC104903...    103   9e-24   
gb|KHN13642.1|  Quinohemoprotein ethanol dehydrogenase type-1           102   1e-23   
ref|XP_006602902.1|  PREDICTED: uncharacterized protein LOC102669135    102   1e-23   
ref|XP_007216818.1|  hypothetical protein PRUPE_ppa022972mg             101   4e-23   
ref|XP_008230740.1|  PREDICTED: uncharacterized protein LOC103329981    101   5e-23   
ref|XP_009782555.1|  PREDICTED: uncharacterized protein LOC104231286    101   5e-23   
gb|KHN13640.1|  hypothetical protein glysoja_019327                   99.4    5e-23   
ref|XP_006602904.1|  PREDICTED: uncharacterized protein LOC102669536  99.4    6e-23   
ref|XP_009621315.1|  PREDICTED: uncharacterized protein LOC104112...    100   7e-23   
ref|XP_009621314.1|  PREDICTED: uncharacterized protein LOC104112...    101   7e-23   
ref|XP_007139592.1|  hypothetical protein PHAVU_008G042700g             100   9e-23   
ref|XP_004167481.1|  PREDICTED: polyvinylalcohol dehydrogenase-like   99.0    9e-23   
ref|XP_004304938.1|  PREDICTED: polyvinylalcohol dehydrogenase-like     100   1e-22   
gb|KDP45487.1|  hypothetical protein JCGZ_09736                         100   2e-22   
ref|XP_008379337.1|  PREDICTED: uncharacterized protein LOC103442334  99.8    2e-22   
ref|XP_006345832.1|  PREDICTED: uncharacterized protein LOC102598039  99.0    3e-22   
ref|XP_007139594.1|  hypothetical protein PHAVU_008G042900g           99.4    3e-22   
ref|XP_004147493.1|  PREDICTED: polyvinylalcohol dehydrogenase-like   99.0    4e-22   
ref|XP_006587758.1|  PREDICTED: uncharacterized protein LOC100791552  99.0    4e-22   
emb|CBI22172.3|  unnamed protein product                              99.8    7e-22   
gb|KHN11593.1|  Quinohemoprotein ethanol dehydrogenase type-1         98.2    1e-21   
ref|XP_008443424.1|  PREDICTED: uncharacterized protein LOC103487015  97.4    1e-21   
gb|EPS61948.1|  hypothetical protein M569_12846                       96.3    3e-21   
ref|XP_006602901.1|  PREDICTED: uncharacterized protein LOC102668...  95.9    3e-21   
gb|ABN08942.1|  Quinonprotein alcohol dehydrogenase-like              96.3    3e-21   Medicago truncatula
ref|XP_003621152.1|  Quinohaemoprotein ethanol dehydrogenase type-1   96.7    3e-21   
gb|KDO72515.1|  hypothetical protein CISIN_1g040693mg                 94.7    4e-21   
ref|XP_004489158.1|  PREDICTED: polyvinylalcohol dehydrogenase-like   95.5    6e-21   
ref|XP_008348222.1|  PREDICTED: uncharacterized protein LOC103411362  95.5    6e-21   
ref|XP_004304937.1|  PREDICTED: polyvinylalcohol dehydrogenase-like   95.5    7e-21   
ref|XP_007217415.1|  hypothetical protein PRUPE_ppa025769mg           95.5    7e-21   
ref|XP_006602900.1|  PREDICTED: uncharacterized protein LOC102668...  95.5    8e-21   
gb|KHN13644.1|  Quinohemoprotein ethanol dehydrogenase type-1         95.5    8e-21   
ref|XP_008230739.1|  PREDICTED: uncharacterized protein LOC103329980  95.1    9e-21   
ref|XP_007139593.1|  hypothetical protein PHAVU_008G042800g           94.4    2e-20   
ref|XP_004302347.1|  PREDICTED: polyvinylalcohol dehydrogenase-like   94.0    2e-20   
ref|XP_004489157.1|  PREDICTED: polyvinylalcohol dehydrogenase-like   92.8    7e-20   
emb|CDP02211.1|  unnamed protein product                              90.9    3e-19   
gb|KHN13638.1|  Quinohemoprotein ethanol dehydrogenase type-1         90.9    4e-19   
ref|XP_009347060.1|  PREDICTED: uncharacterized protein LOC103938746  90.9    4e-19   
ref|XP_008341556.1|  PREDICTED: uncharacterized protein LOC103404426  90.1    5e-19   
ref|XP_010661143.1|  PREDICTED: uncharacterized protein LOC104877332  89.7    6e-19   
ref|XP_010661142.1|  PREDICTED: uncharacterized protein LOC104877357  89.7    7e-19   
emb|CAN79118.1|  hypothetical protein VITISV_005773                   90.9    9e-19   Vitis vinifera
emb|CBI22175.3|  unnamed protein product                              88.2    3e-18   
ref|XP_010693329.1|  PREDICTED: uncharacterized protein LOC104906291  87.8    4e-18   
gb|KHN13641.1|  Quinohemoprotein ethanol dehydrogenase type-1         85.5    3e-17   
ref|XP_006602903.1|  PREDICTED: uncharacterized protein LOC102669266  84.7    4e-17   
ref|XP_007216718.1|  hypothetical protein PRUPE_ppa026320mg           84.0    8e-17   
ref|XP_007216879.1|  hypothetical protein PRUPE_ppa020987mg           82.0    1e-16   
ref|XP_008230741.1|  PREDICTED: uncharacterized protein LOC103329982  83.6    1e-16   
emb|CDP11594.1|  unnamed protein product                              81.6    6e-16   
gb|KDO82850.1|  hypothetical protein CISIN_1g039692mg                 80.5    1e-15   
ref|WP_039748847.1|  hypothetical protein                             77.8    1e-14   
ref|WP_026292022.1|  polyvinylalcohol dehydrogenase                   71.2    2e-12   
ref|WP_011687395.1|  pyrrolo-quinoline quinone                        70.9    3e-12   
gb|EQB44371.1|  hypothetical protein CGLO_16897                       68.9    2e-11   
gb|KHN13633.1|  hypothetical protein glysoja_019320                   67.8    2e-11   
ref|WP_014266931.1|  pyrrolo-quinoline quinone                        68.6    2e-11   
ref|XP_001691739.1|  predicted protein                                68.6    3e-11   Chlamydomonas reinhardtii
gb|EXX51333.1|  hypothetical protein RirG_262810                      67.8    4e-11   
ref|XP_007282941.1|  pyrrolo-quinoline quinone                        67.4    6e-11   
ref|WP_018521987.1|  MULTISPECIES: hypothetical protein               67.4    6e-11   
ref|XP_002960975.1|  hypothetical protein SELMODRAFT_437427           66.6    1e-10   
gb|KCW64984.1|  hypothetical protein EUGRSUZ_G02528                   63.9    1e-10   
ref|XP_006431100.1|  hypothetical protein CICLE_v10013418mg           65.9    2e-10   
ref|XP_001757145.1|  predicted protein                                65.5    3e-10   
ref|WP_030200207.1|  polyvinylalcohol dehydrogenase                   64.7    5e-10   
ref|XP_002967034.1|  hypothetical protein SELMODRAFT_408373           63.9    1e-09   
ref|XP_002984699.1|  hypothetical protein SELMODRAFT_423793           61.2    1e-09   
ref|WP_013491202.1|  pyrrolo-quinoline quinone repeat-containing ...  63.5    1e-09   
ref|WP_034801302.1|  hypothetical protein                             63.2    2e-09   
gb|ERZ95657.1|  hypothetical protein GLOINDRAFT_331141                62.8    2e-09   
gb|EXX76536.1|  hypothetical protein RirG_032350                      62.8    3e-09   
emb|CDI02935.1|  Pyrrolo-quinoline quinone repeat-containing protein  62.0    5e-09   
ref|XP_002972263.1|  hypothetical protein SELMODRAFT_441782           60.5    1e-08   
ref|XP_002984177.1|  hypothetical protein SELMODRAFT_445822           60.5    1e-08   
ref|XP_001696369.1|  predicted protein                                59.7    3e-08   Chlamydomonas reinhardtii
ref|WP_008922098.1|  Pyrrolo-quinoline quinone                        58.9    6e-08   
gb|KCW64982.1|  hypothetical protein EUGRSUZ_G02524                   57.4    9e-08   
ref|WP_020741593.1|  hypothetical protein                             58.2    1e-07   
gb|ELQ35660.1|  hypothetical protein OOU_Y34scaffold00696g2           57.8    1e-07   
ref|XP_004338620.1|  PQQ enzyme repeat domain containing protein      56.6    3e-07   
ref|XP_004346017.1|  protein kinase domain containing protein         56.6    4e-07   
emb|CBI22173.3|  unnamed protein product                              55.8    5e-07   
ref|YP_009001198.1|  pyrroloquinoline quinone-dependent DHase         55.5    9e-07   
emb|CAN66558.1|  hypothetical protein VITISV_001825                   55.1    9e-07   Vitis vinifera
ref|WP_012238034.1|  polyvinylalcohol dehydrogenase                   55.1    1e-06   
ref|WP_011113104.1|  probable polyvinylalcohol dehydrogenase          54.7    1e-06   
ref|WP_037663542.1|  hypothetical protein                             54.7    1e-06   
gb|ADN64238.1|  putative polyvinylalcohol dehydrogenase               54.7    1e-06   
ref|WP_036568982.1|  hypothetical protein                             54.7    2e-06   
ref|WP_035237051.1|  hypothetical protein                             53.5    4e-06   
ref|WP_028785649.1|  polyvinylalcohol dehydrogenase                   52.8    6e-06   
ref|XP_007917887.1|  putative quinohemoprotein ethanol dehydrogen...  52.4    9e-06   
ref|WP_030179207.1|  hypothetical protein                             50.8    1e-05   
ref|XP_002963347.1|  hypothetical protein SELMODRAFT_438505           52.4    1e-05   
ref|WP_010342314.1|  polyvinylalcohol dehydrogenase                   52.0    1e-05   
ref|WP_026144241.1|  polyvinylalcohol dehydrogenase                   52.0    1e-05   
ref|WP_026143236.1|  polyvinylalcohol dehydrogenase                   52.0    1e-05   
ref|XP_002974841.1|  hypothetical protein SELMODRAFT_442588           51.6    2e-05   
ref|XP_009219017.1|  hypothetical protein GGTG_02975                  51.2    2e-05   
gb|ESA13875.1|  hypothetical protein GLOINDRAFT_25571                 50.1    3e-05   
ref|WP_033412672.1|  polyvinylalcohol dehydrogenase                   50.4    4e-05   
ref|WP_003479338.1|  polyvinyl-alcohol dehydrogenase (acceptor)       50.4    5e-05   
gb|ELQ02887.1|  polyvinylalcohol dehydrogenase                        50.4    5e-05   
ref|WP_038239231.1|  polyvinylalcohol dehydrogenase                   50.4    5e-05   
ref|YP_008319572.1|  pqq-dependent dehydrogenase                      49.7    7e-05   
gb|KEQ80677.1|  hypothetical protein M438DRAFT_348612                 47.8    8e-05   
gb|EWT01720.1|  polyvinylalcohol dehydrogenase                        47.8    3e-04   
ref|WP_009583585.1|  exported putative alcohol dehydrogenase (acc...  48.1    3e-04   
ref|WP_034805109.1|  hypothetical protein                             47.8    3e-04   
gb|KGE50571.1|  polyvinylalcohol dehydrogenase                        47.8    3e-04   
ref|WP_014786651.1|  PQQ enzyme repeat-containing protein             47.8    3e-04   
ref|WP_020735240.1|  hypothetical protein                             46.6    8e-04   
ref|WP_011257274.1|  polyvinylalcohol dehydrogenase                   46.6    8e-04   
ref|XP_002974635.1|  hypothetical protein SELMODRAFT_442585           46.6    9e-04   
ref|WP_039007026.1|  polyvinylalcohol dehydrogenase                   46.6    9e-04   
ref|WP_024743774.1|  polyvinylalcohol dehydrogenase                   46.6    0.001   



>ref|XP_009627242.1| PREDICTED: uncharacterized protein LOC104117826 [Nicotiana tomentosiformis]
Length=532

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGG+LGGYSGAAIWGSSPA+DI RG+VYVGTGNLY AP EVLRCQAAQNNRT 
Sbjct  216  QTYTLPDNGGRLGGYSGAAIWGSSPAIDIARGFVYVGTGNLYLAPPEVLRCQAAQNNRTT  275

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            PPT PDQCFG DVHFNSI+A 
Sbjct  276  PPTNPDQCFGEDVHFNSILAF  296



>ref|XP_009765669.1| PREDICTED: uncharacterized protein LOC104217192 [Nicotiana sylvestris]
Length=532

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGG+LGGYSGAAIWGSSPA+DI RG+VYVGTGNLY AP EVLRCQAAQNNRT 
Sbjct  216  QTYTLPDNGGRLGGYSGAAIWGSSPAIDIARGFVYVGTGNLYLAPPEVLRCQAAQNNRTT  275

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            PPT PDQCFG DVHFNSI+A 
Sbjct  276  PPTNPDQCFGEDVHFNSILAF  296



>ref|XP_006363936.1| PREDICTED: uncharacterized protein LOC102580594 [Solanum tuberosum]
Length=530

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGG+LGGYSGAAIWGSSPA+DI RG VYVGTGNLY+AP EVL+CQAAQNNRT 
Sbjct  214  QTYTLPDNGGRLGGYSGAAIWGSSPAIDIARGHVYVGTGNLYSAPPEVLKCQAAQNNRTT  273

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            PPT PDQCFG D+HF+SI+AL
Sbjct  274  PPTVPDQCFGKDIHFDSILAL  294



>ref|XP_011087060.1| PREDICTED: uncharacterized protein LOC105168623 [Sesamum indicum]
Length=534

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGGKLGGYSGAAIWGSSP++D +RG VYVGTGNLY AP +VL+CQA QNN+T 
Sbjct  219  QTYTLPDNGGKLGGYSGAAIWGSSPSIDPIRGRVYVGTGNLYLAPADVLQCQARQNNQTT  278

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            PP+GPDQCFGPDVHF+S+++ 
Sbjct  279  PPSGPDQCFGPDVHFDSLLSF  299



>gb|EYU28719.1| hypothetical protein MIMGU_mgv1a017992mg, partial [Erythranthe 
guttata]
Length=507

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGGK+GGYSGAAIWGSSP++D +RG VYVGTGNLY AP EVLRCQA QNNRT 
Sbjct  188  QTYTLPDNGGKIGGYSGAAIWGSSPSIDTVRGRVYVGTGNLYLAPAEVLRCQARQNNRTT  247

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            PPT  DQCFG DVHF+S+M+ 
Sbjct  248  PPTSGDQCFGLDVHFDSLMSF  268



>gb|EYU28720.1| hypothetical protein MIMGU_mgv1a019168mg, partial [Erythranthe 
guttata]
Length=503

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGG++GGYSGAAIWGSSP++D +RG VYVGTGNLY AP EVL+CQA QNNRT 
Sbjct  188  QTYTLPDNGGQIGGYSGAAIWGSSPSIDTVRGRVYVGTGNLYLAPAEVLQCQARQNNRTT  247

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            PP+  DQCFGPDVHF+S+M+ 
Sbjct  248  PPSTGDQCFGPDVHFDSLMSF  268



>ref|XP_011015276.1| PREDICTED: uncharacterized protein LOC105118916 [Populus euphratica]
Length=677

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYTLPDN GKLGGYSGAAIWGSSPA+D+ R  VYVGTGNLY AP EV +CQ AQNN+T 
Sbjct  362  RTYTLPDNQGKLGGYSGAAIWGSSPAIDVTRRLVYVGTGNLYTAPREVTQCQEAQNNQTT  421

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P  PDQC GPD+HF+SI+A+
Sbjct  422  KPAQPDQCIGPDIHFDSILAI  442



>gb|EYU28721.1| hypothetical protein MIMGU_mgv1a019021mg [Erythranthe guttata]
Length=504

 Score =   130 bits (327),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGG++GGYSGAAIWGSSP++D +RG VYVGTGNLY  P EVL+CQA QNNRT 
Sbjct  189  QTYTLPDNGGQIGGYSGAAIWGSSPSIDTVRGRVYVGTGNLYLVPAEVLQCQARQNNRTT  248

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            PP+  DQCFG D+HF+S M+ 
Sbjct  249  PPSTDDQCFGADIHFDSFMSF  269



>emb|CDP21840.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYT+PDN GKLGGYSGAAIWGSSPA+DILRG VYVGTGNLY AP EVL CQ A NN+T 
Sbjct  220  QTYTIPDNCGKLGGYSGAAIWGSSPAIDILRGLVYVGTGNLYIAPAEVLACQRALNNQTT  279

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            PP    QC GPDVHF+SI+A 
Sbjct  280  PPINVSQCIGPDVHFDSIVAF  300



>ref|XP_008390061.1| PREDICTED: uncharacterized protein LOC103452339 [Malus domestica]
Length=612

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY LPDNGG LGGYSGAAIWGSSPA+DI R  VYV TGNLY AP EV  CQ  QNN+TG
Sbjct  217  RTYMLPDNGGSLGGYSGAAIWGSSPAIDISRRHVYVATGNLYTAPPEVTECQERQNNQTG  276

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PDQCFGPD++FNSI+AL
Sbjct  277  RPTQPDQCFGPDINFNSILAL  297



>ref|XP_010096357.1| hypothetical protein L484_021105 [Morus notabilis]
 gb|EXB63832.1| hypothetical protein L484_021105 [Morus notabilis]
Length=554

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGGK GGY+GAAIWGSSPA+D+ R  VYVGTG LY AP EVLRCQ  QNN+ G
Sbjct  238  QTYTLPDNGGKRGGYAGAAIWGSSPAIDVRRQHVYVGTGQLYTAPAEVLRCQEEQNNQPG  297

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PDQC GP++H+NSI+A 
Sbjct  298  KPTHPDQCIGPNIHYNSILAF  318



>ref|XP_004298441.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=543

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY LPDN G+L GYSGAA+WGSSP++D+LR  VYV TGNLY AP EV++CQ  QNN+TG
Sbjct  228  RTYMLPDNSGRLNGYSGAAVWGSSPSIDVLRRHVYVATGNLYTAPPEVIQCQEEQNNQTG  287

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PDQC GPD+HFNSI+AL
Sbjct  288  KPTQPDQCTGPDIHFNSILAL  308



>ref|XP_006374054.1| hypothetical protein POPTR_0016s14620g, partial [Populus trichocarpa]
 gb|ERP51851.1| hypothetical protein POPTR_0016s14620g, partial [Populus trichocarpa]
Length=501

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYTLPDN G+LGGYSGAAIWGSSPA+D+ R  V+VGTGNLY AP EV +CQ AQNN+T 
Sbjct  186  RTYTLPDNEGQLGGYSGAAIWGSSPAIDVTRRLVFVGTGNLYTAPPEVTQCQEAQNNQTT  245

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P  PDQC GPD+HF+SI+A+
Sbjct  246  KPAQPDQCIGPDIHFDSILAI  266



>ref|XP_010652333.1| PREDICTED: uncharacterized protein LOC104879807 [Vitis vinifera]
 emb|CBI31998.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYT+PDN GKLGGYSGAAIWGSSPA+D  R  VY+GTGNLYNAP EV +CQA +NN+T 
Sbjct  220  RTYTIPDNAGKLGGYSGAAIWGSSPAIDTKRNLVYIGTGNLYNAPTEVQQCQANRNNQT-  278

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
             P+ PDQC  PDVHF+SI+AL 
Sbjct  279  IPSQPDQCIAPDVHFDSILALE  300



>ref|XP_010066940.1| PREDICTED: uncharacterized protein LOC104453970 [Eucalyptus grandis]
 gb|KCW64986.1| hypothetical protein EUGRSUZ_G02530 [Eucalyptus grandis]
Length=534

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGG+LGGY+GA+IWGSSPA+D  R   Y  TGNLY AP +V  CQA QNN+T 
Sbjct  218  QTYTLPDNGGELGGYAGASIWGSSPAIDPKRRLAYAATGNLYTAPAKVQECQARQNNQTT  277

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
            PPT PDQC GPDV+FNSI+A  
Sbjct  278  PPTAPDQCIGPDVNFNSIIAFE  299



>ref|XP_006438637.1| hypothetical protein CICLE_v10033589mg, partial [Citrus clementina]
 gb|ESR51877.1| hypothetical protein CICLE_v10033589mg, partial [Citrus clementina]
Length=482

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY LPDNGGK GGYSGAA+WGSSPA+D++R  VY+GTGNLY AP EVL+CQ  QNN+T 
Sbjct  167  QTYMLPDNGGKRGGYSGAAVWGSSPAIDVIRRRVYIGTGNLYTAPAEVLQCQEKQNNQTT  226

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PDQC   D++ NSI+AL
Sbjct  227  KPTHPDQCISSDIYANSIVAL  247



>ref|XP_010683398.1| PREDICTED: uncharacterized protein LOC104898088 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGGKLGGYSGAAIWGSSPA+DI+R  VYVG+GN+Y AP +VL CQA QNN++ 
Sbjct  189  QTYTLPDNGGKLGGYSGAAIWGSSPAIDIIRNRVYVGSGNIYIAPPDVLECQAKQNNQS-  247

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
              T PDQC  PD HF+SI+A+
Sbjct  248  RATQPDQCTSPDAHFDSILAI  268



>gb|KDP21213.1| hypothetical protein JCGZ_21684 [Jatropha curcas]
Length=396

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY +PDNG KLGGYSGAAIWGSSP++D  R  VYV TGNLY  P  V +CQ AQNN+T 
Sbjct  221  RTYMVPDNGSKLGGYSGAAIWGSSPSIDTDRRLVYVATGNLYRVPSAVTKCQEAQNNQTT  280

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
             PT PD+C G DVHF+SI+AL+
Sbjct  281  KPTQPDKCVGSDVHFDSILALK  302



>ref|XP_010068791.1| PREDICTED: uncharacterized protein LOC104455754 [Eucalyptus grandis]
Length=199

 Score =   115 bits (288),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGG+L GY GA+IWGSSPA+D  R   Y  TGN Y  P +V  CQA QNN+T 
Sbjct  101  QTYTLPDNGGELRGYDGASIWGSSPAIDPKRRLAYAATGNHYTGPAKVRECQARQNNQTI  160

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
            PPT PDQC GPDV+FNSI+A  
Sbjct  161  PPTAPDQCIGPDVNFNSIIAFE  182



>gb|KCW64985.1| hypothetical protein EUGRSUZ_G02529 [Eucalyptus grandis]
Length=401

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGG+L GY GA IWGSSPA+D  R   YV TGN Y AP +V  CQA QNN+T 
Sbjct  154  QTYTLPDNGGELRGYDGACIWGSSPAIDPKRRLAYVATGNHYTAPAKVQECQARQNNQTI  213

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
            PPT PDQC GPDV+FNSI+A  
Sbjct  214  PPTAPDQCIGPDVNFNSIIAFE  235



>ref|XP_010652339.1| PREDICTED: uncharacterized protein LOC104879808 [Vitis vinifera]
Length=510

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY +PDNGG++GGYSGAA+WGSSPA+DI RG VY+GTGNLY+AP EVL CQA +NN+T 
Sbjct  195  RTYMIPDNGGQIGGYSGAALWGSSPAIDIKRGLVYIGTGNLYSAPAEVLECQARRNNQT-  253

Query  183  PPTGPDQCF-GPDVHFNSIMALR  248
             P+ PDQC   P+VHF+SI+AL 
Sbjct  254  TPSQPDQCVDDPNVHFDSILALE  276



>emb|CBI31999.3| unnamed protein product [Vitis vinifera]
Length=536

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY +PDNGG++GGYSGAA+WGSSPA+DI RG VY+GTGNLY+AP EVL CQA +NN+T 
Sbjct  221  RTYMIPDNGGQIGGYSGAALWGSSPAIDIKRGLVYIGTGNLYSAPAEVLECQARRNNQT-  279

Query  183  PPTGPDQCF-GPDVHFNSIMALR  248
             P+ PDQC   P+VHF+SI+AL 
Sbjct  280  TPSQPDQCVDDPNVHFDSILALE  302



>ref|XP_007046194.1| Uncharacterized protein TCM_011786 [Theobroma cacao]
 gb|EOY02026.1| Uncharacterized protein TCM_011786 [Theobroma cacao]
Length=437

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  15   LPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTG  194
            LPDNGG+ GGY+GAA+WGSSPA+D+ R  VYV TGNLY AP EVL+CQ  QNN+T  P+ 
Sbjct  124  LPDNGGRPGGYAGAAVWGSSPAIDVNRRLVYVATGNLYTAPAEVLKCQEQQNNQTAKPSH  183

Query  195  PDQCFGPDVHFNSIMAL  245
            PDQC GPD+++NSI+A+
Sbjct  184  PDQCIGPDINYNSILAI  200



>gb|KCW64987.1| hypothetical protein EUGRSUZ_G02531 [Eucalyptus grandis]
Length=484

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYT+PDNGGK GGYSGA+IWGSSPA+D  R  VYVGTG LY  P EV +CQ  QNN+T 
Sbjct  169  QTYTIPDNGGKRGGYSGASIWGSSPAIDPRRRLVYVGTGQLYTVPREVAQCQEKQNNQTT  228

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P+ PDQC G DV+F+SI+A 
Sbjct  229  KPSQPDQCIGRDVNFDSIIAF  249



>ref|XP_010068793.1| PREDICTED: uncharacterized protein LOC104455756 [Eucalyptus grandis]
Length=531

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYT+PDNGGK GGYSGA+IWGSSPA+D  R  VYVGTG LY  P EV +CQ  QNN+T 
Sbjct  216  QTYTIPDNGGKRGGYSGASIWGSSPAIDPRRRLVYVGTGQLYTVPREVAQCQEKQNNQTT  275

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P+ PDQC G DV+F+SI+A 
Sbjct  276  KPSQPDQCIGRDVNFDSIIAF  296



>ref|XP_010242400.1| PREDICTED: uncharacterized protein LOC104586761 [Nelumbo nucifera]
Length=534

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN GKLGGY+GAAIWGSSP++D+ R  +YVGTGNLY+AP  V  CQ  QNN+T 
Sbjct  221  QTFVLPDNQGKLGGYAGAAIWGSSPSIDVSRNLIYVGTGNLYSAPAHVTECQEKQNNQTF  280

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            P   PDQC  PD H NSI+A 
Sbjct  281  PAH-PDQCIEPDNHENSILAF  300



>ref|XP_011098591.1| PREDICTED: uncharacterized protein LOC105177224 [Sesamum indicum]
Length=512

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY +PDN GK GGY+GAA+WGSSP++D+ R  VY+ TGNLY+APE V  CQ  QNN+T 
Sbjct  204  QTYMIPDNNGKKGGYAGAALWGSSPSIDVGRNHVYIATGNLYSAPESVEECQERQNNQT-  262

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD C  PD+HF+S++AL
Sbjct  263  VPTHPDDCIEPDIHFDSMLAL  283



>ref|XP_007099708.1| Quinohemoprotein ethanol dehydrogenase type-1 [Theobroma cacao]
 gb|EOY20323.1| Quinohemoprotein ethanol dehydrogenase type-1 [Theobroma cacao]
Length=528

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY LPDN GK GGY+GAAIWGSSP++D+ R  VY+GTGNLY+AP+ V  CQ  QNN+T 
Sbjct  213  QTYMLPDNFGKRGGYAGAAIWGSSPSIDVRRNHVYIGTGNLYSAPKNVTDCQERQNNQTD  272

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD+C  P+   +SI+AL
Sbjct  273  IPTHPDECVEPENLSDSILAL  293



>ref|XP_007224952.1| hypothetical protein PRUPE_ppa021290mg, partial [Prunus persica]
 gb|EMJ26151.1| hypothetical protein PRUPE_ppa021290mg, partial [Prunus persica]
Length=396

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +3

Query  15   LPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTG  194
            L D   +LGGYSGAA+WGSSPA+DI R  VYV TG LY AP EV +CQ  QN + G PT 
Sbjct  138  LQDIRRRLGGYSGAAVWGSSPAIDISRRHVYVATGILYTAPPEVTKCQERQNKQRGKPTH  197

Query  195  PDQCFGPDVHFNSIMAL  245
            PDQC GPD++FNSI+AL
Sbjct  198  PDQCIGPDINFNSILAL  214



>gb|EYU34100.1| hypothetical protein MIMGU_mgv1a026159mg [Erythranthe guttata]
Length=501

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY LPDN    GGY+GAA+WGSSP++D +R  VY+ TGNLY+AP  V  CQ  QNN+T 
Sbjct  191  QTYMLPDNQRTTGGYAGAALWGSSPSIDAVRNHVYIATGNLYSAPPSVEECQERQNNQT-  249

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT P++C GP++HF+S++AL
Sbjct  250  VPTNPEECVGPEIHFDSVLAL  270



>ref|XP_010661033.1| PREDICTED: uncharacterized protein LOC104881693, partial [Vitis 
vinifera]
Length=528

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+TLPDN GK G Y+GAAIWGSSP++D+ R  VYV TGNLY+AP  +  CQ  QNN+T 
Sbjct  215  QTFTLPDNHGKRGEYAGAAIWGSSPSIDVRRNLVYVATGNLYSAPLNIRECQEQQNNQTA  274

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
             PT  DQC  PD H NSI+A  
Sbjct  275  -PTQTDQCIEPDNHSNSILAFE  295



>ref|XP_003621148.1| Quinohaemoprotein ethanol dehydrogenase type-1 [Medicago truncatula]
 gb|AES77366.1| polyvinylalcohol dehydrogenase-like protein [Medicago truncatula]
Length=528

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY LPDN GK+G Y+GAAIWGSSP++D+ R  VY+ TGNLY+AP+ VL CQ  QNN+T 
Sbjct  214  KTYMLPDNNGKIGAYAGAAIWGSSPSIDVYRKHVYIATGNLYSAPKNVLECQERQNNQT-  272

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P   D+C  P+ H NSI+AL
Sbjct  273  TPIEQDKCVEPENHSNSILAL  293



>ref|XP_010661145.1| PREDICTED: uncharacterized protein LOC100853307 [Vitis vinifera]
Length=476

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+TLPDN G+ G Y+G AIWGSSP++D+ R  VYV TGNLY+AP  +  CQ  QNN+T 
Sbjct  233  QTFTLPDNHGERGEYAGGAIWGSSPSIDVRRNLVYVATGNLYSAPLSIRECQEQQNNQT-  291

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PDQC  PD H NSI+A+
Sbjct  292  VPTQPDQCIEPDNHSNSILAI  312



>emb|CBI22171.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+TLPDN GK G Y+GAAIWGSSP++D+ R  VYV TGNLY+AP  +  CQ  QNN+T 
Sbjct  252  QTFTLPDNHGKRGEYAGAAIWGSSPSIDVRRNLVYVATGNLYSAPLNIRECQEQQNNQTA  311

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
             PT  DQC  PD H NSI+A  
Sbjct  312  -PTQTDQCIEPDNHSNSILAFE  332



>ref|XP_007099711.1| Quinohemoprotein ethanol dehydrogenase type-1 [Theobroma cacao]
 gb|EOY20326.1| Quinohemoprotein ethanol dehydrogenase type-1 [Theobroma cacao]
Length=770

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+TLP+N G+ G Y+G AIWGSSP++DI R  VY+GTGNLY+AP  + +CQ A+NN+T 
Sbjct  456  QTFTLPENFGQKGEYAGGAIWGSSPSIDITRNLVYIGTGNLYSAPLRIRQCQEAENNQT-  514

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD+C  P+ H NSI+AL
Sbjct  515  VPTSPDKCIEPENHSNSILAL  535



>ref|XP_010690063.1| PREDICTED: uncharacterized protein LOC104903677 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=529

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY LPDN GK G Y+GAAIWGSSP++D+ R  VY+ TGNLY+APE +  CQ  +NN+T 
Sbjct  226  QTYMLPDNKGKQGEYAGAAIWGSSPSIDVSRNLVYIATGNLYSAPERIETCQERENNQT-  284

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
             PT P++C   D H NSI+AL 
Sbjct  285  TPTHPEECIEADNHENSILALE  306



>ref|XP_010690064.1| PREDICTED: uncharacterized protein LOC104903677 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=528

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY LPDN GK G Y+GAAIWGSSP++D+ R  VY+ TGNLY+APE +  CQ  +NN+T 
Sbjct  225  QTYMLPDNKGKQGEYAGAAIWGSSPSIDVSRNLVYIATGNLYSAPERIETCQERENNQT-  283

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
             PT P++C   D H NSI+AL 
Sbjct  284  TPTHPEECIEADNHENSILALE  305



>gb|KHN13642.1| Quinohemoprotein ethanol dehydrogenase type-1 [Glycine soja]
Length=533

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY LPDN  + G Y+GAAIWGSSP++D+ R  VY+ TGNLY+AP  +L+C+  QNNRT 
Sbjct  221  RTYMLPDNNNRRGEYAGAAIWGSSPSIDVKRNHVYIATGNLYSAPLHILQCRERQNNRT-  279

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD+C  P+ H NSI+AL
Sbjct  280  EPTQPDECIEPENHSNSILAL  300



>ref|XP_006602902.1| PREDICTED: uncharacterized protein LOC102669135 [Glycine max]
Length=540

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY LPDN  + G Y+GAAIWGSSP++D+ R  VY+ TGNLY+AP  +L+C+  QNNRT 
Sbjct  228  RTYMLPDNNNRRGEYAGAAIWGSSPSIDVKRNHVYIATGNLYSAPLHILQCRERQNNRT-  286

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD+C  P+ H NSI+AL
Sbjct  287  EPTQPDECIEPENHSNSILAL  307



>ref|XP_007216818.1| hypothetical protein PRUPE_ppa022972mg [Prunus persica]
 gb|EMJ18017.1| hypothetical protein PRUPE_ppa022972mg [Prunus persica]
Length=547

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN  K G YSGAAIWGSSP++D+ R  VY+GTGNLY+ PE V +CQ  Q N + 
Sbjct  234  QTFVLPDNHQKRGLYSGAAIWGSSPSIDVHRRHVYIGTGNLYSVPENVTQCQENQTNNST  293

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD C  P+ H NSI+AL
Sbjct  294  IPTHPDACVEPENHGNSILAL  314



>ref|XP_008230740.1| PREDICTED: uncharacterized protein LOC103329981 [Prunus mume]
Length=538

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN  K G YSGAAIWGSSP++D+ R  VY+ TGNLY+ PE V++CQ  Q N + 
Sbjct  225  QTFVLPDNHQKRGLYSGAAIWGSSPSIDVHRRQVYIATGNLYSVPENVIQCQENQTNNST  284

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD C  P+ H NSI+AL
Sbjct  285  IPTHPDACVEPENHGNSILAL  305



>ref|XP_009782555.1| PREDICTED: uncharacterized protein LOC104231286 [Nicotiana sylvestris]
Length=555

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 63/84 (75%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQN--NR  176
            +T+ LPDNGGKLG Y+GAA+WGSSP++DI R  VY+ TGNLY+ P+ +  CQ  QN  N+
Sbjct  236  KTFLLPDNGGKLGEYAGAAVWGSSPSIDIWRNHVYIATGNLYSVPKHIEDCQKEQNKQNQ  295

Query  177  TGP-PTGPDQCFGPDVHFNSIMAL  245
            T P PT PD+C  P+ H +SI+AL
Sbjct  296  TNPDPTRPDKCIEPENHSDSILAL  319



>gb|KHN13640.1| hypothetical protein glysoja_019327 [Glycine soja]
Length=310

 Score = 99.4 bits (246),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +3

Query  15   LPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTG  194
            LPDN  + G Y+GAAIWGSSP++D+ R  VY+GTGNLY+AP  + +C+  QNNRT  PT 
Sbjct  2    LPDNNNRRGEYAGAAIWGSSPSIDVKRNHVYIGTGNLYSAPLHIRQCRERQNNRT-EPTQ  60

Query  195  PDQCFGPDVHFNSIMAL  245
            PD+C  PD H NSI+AL
Sbjct  61   PDECIEPDNHSNSILAL  77



>ref|XP_006602904.1| PREDICTED: uncharacterized protein LOC102669536 [Glycine max]
Length=314

 Score = 99.4 bits (246),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +3

Query  15   LPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTG  194
            LPDN  + G Y+GAAIWGSSP++D+ R  VY+GTGNLY+AP  + +C+  QNNRT  PT 
Sbjct  2    LPDNNNRRGEYAGAAIWGSSPSIDVKRNHVYIGTGNLYSAPLHIRQCRERQNNRT-EPTQ  60

Query  195  PDQCFGPDVHFNSIMAL  245
            PD+C  PD H NSI+AL
Sbjct  61   PDECIEPDNHSNSILAL  77



>ref|XP_009621315.1| PREDICTED: uncharacterized protein LOC104112969 isoform X2 [Nicotiana 
tomentosiformis]
Length=541

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 63/84 (75%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQN--NR  176
            +T+ LPDNGGKLG Y+GAA+WGSSP++DI R  VY+ TGNLY+ P+ +  CQ  QN  N+
Sbjct  222  KTFLLPDNGGKLGKYAGAAVWGSSPSIDIRRNHVYIATGNLYSVPKHIEECQKEQNQQNQ  281

Query  177  TGP-PTGPDQCFGPDVHFNSIMAL  245
            T P PT PD+C  P+ H +S++AL
Sbjct  282  TNPDPTRPDKCIEPENHSDSMLAL  305



>ref|XP_009621314.1| PREDICTED: uncharacterized protein LOC104112969 isoform X1 [Nicotiana 
tomentosiformis]
Length=555

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 63/84 (75%), Gaps = 3/84 (4%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQN--NR  176
            +T+ LPDNGGKLG Y+GAA+WGSSP++DI R  VY+ TGNLY+ P+ +  CQ  QN  N+
Sbjct  236  KTFLLPDNGGKLGKYAGAAVWGSSPSIDIRRNHVYIATGNLYSVPKHIEECQKEQNQQNQ  295

Query  177  TGP-PTGPDQCFGPDVHFNSIMAL  245
            T P PT PD+C  P+ H +S++AL
Sbjct  296  TNPDPTRPDKCIEPENHSDSMLAL  319



>ref|XP_007139592.1| hypothetical protein PHAVU_008G042700g [Phaseolus vulgaris]
 gb|ESW11586.1| hypothetical protein PHAVU_008G042700g [Phaseolus vulgaris]
Length=542

 Score =   100 bits (250),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN GK G Y+GAAIWGSSP++D  R  +Y+ TGNLY+AP  +L CQ  +NN T 
Sbjct  229  QTFMLPDNNGKKGEYAGAAIWGSSPSIDASRNHIYIATGNLYSAPLNILECQERENNAT-  287

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PDQC  PD H +S +AL
Sbjct  288  QPTHPDQCVEPDNHSDSFLAL  308



>ref|XP_004167481.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Cucumis sativus]
Length=362

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN G    YSGAAIWGSSP++D LR  VY+ TGNLY+AP  +  CQ  QNN+T 
Sbjct  43   QTFMLPDNHGDTEQYSGAAIWGSSPSIDPLRNLVYIATGNLYSAPLRIRECQERQNNQT-  101

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD+C  P+ H NSI+AL
Sbjct  102  EPTLPDKCIEPENHSNSILAL  122



>ref|XP_004304938.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=523

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY LPDN GK G Y+GAAIWGSSP++D+ R  VY+ T NLY+AP  ++ CQ  +NN+T 
Sbjct  210  QTYMLPDNFGKFGEYAGAAIWGSSPSIDVKRNLVYIATSNLYSAPSHIIECQERENNQT-  268

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P+ PD C  PD H  SI+AL
Sbjct  269  IPSQPDACIEPDNHSESIVAL  289



>gb|KDP45487.1| hypothetical protein JCGZ_09736 [Jatropha curcas]
Length=553

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY LPDN  K G YSGAA+WGSSP++D  R  V++ TGNLY+ P+ V  CQ  +NN T 
Sbjct  236  KTYMLPDNFNKTGNYSGAAVWGSSPSIDKHRNLVFIATGNLYSVPQHVRECQEKENNAT-  294

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT  DQC GPD+H  SI+AL
Sbjct  295  KPTHLDQCLGPDIHSESILAL  315



>ref|XP_008379337.1| PREDICTED: uncharacterized protein LOC103442334 [Malus domestica]
Length=538

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T+ LPDN G+LG YSGAAIWGSSP++D+ R  VY+ TGN+Y+ PE V +CQ  QNN T 
Sbjct  232  KTFMLPDNHGQLGSYSGAAIWGSSPSIDVHRKHVYIATGNVYSVPENVSQCQENQNNST-  290

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD C  PD   NSI+AL
Sbjct  291  LPTHPDACVEPDNRGNSILAL  311



>ref|XP_006345832.1| PREDICTED: uncharacterized protein LOC102598039 [Solanum tuberosum]
Length=487

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T+ LP+NGGK+GGYSGAA+WGSSP++D  R  VY+ TGNLY+ P+ +  CQ  QN +  
Sbjct  171  KTFMLPENGGKIGGYSGAAVWGSSPSIDSRRNHVYIATGNLYSVPKRIEDCQKEQNQQNH  230

Query  183  P-PTGPDQCFGPDVHFNSIMAL  245
              PT PD+C  P+ H +SIMAL
Sbjct  231  TDPTQPDKCIEPENHSDSIMAL  252



>ref|XP_007139594.1| hypothetical protein PHAVU_008G042900g, partial [Phaseolus vulgaris]
 gb|ESW11588.1| hypothetical protein PHAVU_008G042900g, partial [Phaseolus vulgaris]
Length=547

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T+ LPDN    G Y+GAAIWGSSP++D+ R  VY+ TGNLY+AP E+L+CQ  Q+N+T 
Sbjct  234  KTFVLPDNNNTRGKYAGAAIWGSSPSIDVHRNHVYIATGNLYSAPLEILQCQEKQDNQT-  292

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P  PD+C  P+ H NSI+AL
Sbjct  293  KPAQPDECVEPENHSNSILAL  313



>ref|XP_004147493.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Cucumis sativus]
 gb|KGN59583.1| hypothetical protein Csa_3G827260 [Cucumis sativus]
Length=538

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN G    YSGAAIWGSSP++D LR  VY+ TGNLY+AP  +  CQ  QNN+T 
Sbjct  219  QTFMLPDNHGDTEQYSGAAIWGSSPSIDPLRNLVYIATGNLYSAPLRIRECQERQNNQT-  277

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD+C  P+ H NSI+AL
Sbjct  278  EPTLPDKCIEPENHSNSILAL  298



>ref|XP_006587758.1| PREDICTED: uncharacterized protein LOC100791552 [Glycine max]
Length=541

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN G+ G Y+GAA+WGSSP++D  R  +Y+ TGNLY+AP ++L CQ  +NN T 
Sbjct  228  QTFMLPDNHGQRGEYAGAAVWGSSPSIDASRNHIYIATGNLYSAPLDILECQERENNVT-  286

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD+C  PD H +SI+AL
Sbjct  287  QPTHPDECVEPDNHSDSILAL  307



>emb|CBI22172.3| unnamed protein product [Vitis vinifera]
Length=1752

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  3     QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
             QTY LPDN G+ G Y+G AIWGSSP++ +LR +VY+ TGNLY+AP  +  CQ  QNN+T 
Sbjct  1439  QTYVLPDNHGEKGEYAGGAIWGSSPSIGVLRNFVYIATGNLYSAPLNIRECQEQQNNQT-  1497

Query  183   PPTGPDQCFGPDVHFNSIMAL  245
              PT PD C  PD H NSI+A 
Sbjct  1498  VPTQPDPCIEPDNHSNSILAF  1518


 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+TLPDN G+ G Y+GAAIWGSSP++D+ R  VYV TGNLY+AP  +  CQ  QNN+T 
Sbjct  359  QTFTLPDNHGERGEYAGAAIWGSSPSIDVQRNLVYVATGNLYSAPLNIQECQEQQNNQT-  417

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PDQC  PD H NSI+A 
Sbjct  418  VPTQPDQCIEPDNHSNSILAF  438


 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+TLPDN G+ G Y+GAAIWGSSP++D+ R  VYV TGNLY+AP  +  CQ  QNN+T 
Sbjct  889  QTFTLPDNHGERGEYAGAAIWGSSPSIDVQRNLVYVATGNLYSAPLNIQECQEQQNNQT-  947

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PDQC  PD H NSI+A 
Sbjct  948  VPTQPDQCIEPDNHSNSILAF  968



>gb|KHN11593.1| Quinohemoprotein ethanol dehydrogenase type-1 [Glycine soja]
Length=629

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN G+ G Y+GAA+WGSSP++D  R  +Y+ TGNLY+AP ++L CQ  +NN T 
Sbjct  173  QTFMLPDNHGQRGEYAGAAVWGSSPSIDASRNHIYIATGNLYSAPLDILECQERENNVT-  231

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD+C  PD H +SI+AL
Sbjct  232  QPTHPDECVEPDNHSDSILAL  252



>ref|XP_008443424.1| PREDICTED: uncharacterized protein LOC103487015 [Cucumis melo]
Length=531

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN G    YSGAAIWGSSP++D +R  VY+ TGNLY+AP  +  CQ  QNN+T 
Sbjct  218  QTFMLPDNHGDTQQYSGAAIWGSSPSIDPVRNLVYIATGNLYSAPLRIRECQERQNNQT-  276

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD+C  P+ H NSI+AL
Sbjct  277  DPTLPDKCIEPENHSNSILAL  297



>gb|EPS61948.1| hypothetical protein M569_12846, partial [Genlisea aurea]
Length=491

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYTLPDNGG +GGY+GAAIWGSSP +DI RG +Y  TGNLY+AP  V+ C+  Q ++  
Sbjct  190  QTYTLPDNGGNMGGYAGAAIWGSSPPIDINRGVIYAATGNLYSAPASVVNCE-VQTSQAQ  248

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
              T PD C   +++FNS +A 
Sbjct  249  NATNPDSCVPSNIYFNSFIAF  269



>ref|XP_006602901.1| PREDICTED: uncharacterized protein LOC102668917 isoform X2 [Glycine 
max]
Length=483

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYTLPDN    G Y+GAAIWGSSP++D+ R  VY+GTGNLY+AP  + +C+  Q N+T 
Sbjct  229  RTYTLPDNKNTKGEYAGAAIWGSSPSIDVERNLVYIGTGNLYSAPLRIQQCRERQLNQTQ  288

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT  D+C  PD H NSI+AL
Sbjct  289  -PTQQDECVEPDNHSNSILAL  308



>gb|ABN08942.1| Quinonprotein alcohol dehydrogenase-like [Medicago truncatula]
Length=539

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRT-  179
            +TY LPDN GK G YSG AIWGSSP +D  R  +Y+ TGNLY+AP  + +CQ  +NN+  
Sbjct  224  KTYMLPDNNGKRGEYSGGAIWGSSPPIDASRNHIYIATGNLYSAPLHIRQCQDEENNKNL  283

Query  180  GPPTGPDQCFGPDVHFNSIMAL  245
              PT PDQC  P+ H NSI+AL
Sbjct  284  TRPTQPDQCVEPENHSNSILAL  305



>ref|XP_003621152.1| Quinohaemoprotein ethanol dehydrogenase type-1 [Medicago truncatula]
 gb|AES77370.1| polyvinylalcohol dehydrogenase-like protein [Medicago truncatula]
Length=569

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRT-  179
            +TY LPDN GK G YSG AIWGSSP +D  R  +Y+ TGNLY+AP  + +CQ  +NN+  
Sbjct  224  KTYMLPDNNGKRGEYSGGAIWGSSPPIDASRNHIYIATGNLYSAPLHIRQCQDEENNKNL  283

Query  180  GPPTGPDQCFGPDVHFNSIMAL  245
              PT PDQC  P+ H NSI+AL
Sbjct  284  TRPTQPDQCVEPENHSNSILAL  305



>gb|KDO72515.1| hypothetical protein CISIN_1g040693mg, partial [Citrus sinensis]
Length=382

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN GKL  Y+GAAIWGSSP++D +R  VY+ TGNLY+ P  + +CQ   N  T 
Sbjct  70   QTFMLPDNFGKLNEYAGAAIWGSSPSIDPIRNHVYIATGNLYSVPLHIRQCQEENNQTT-  128

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD+C  P+ H NS++AL
Sbjct  129  -PTSPDKCIEPENHSNSLLAL  148



>ref|XP_004489158.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Cicer arietinum]
Length=531

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY LP+N GK G Y+GAAIWGSSP++D+ R  +Y+ TGNLY+AP  +L+CQ  QNN T 
Sbjct  217  KTYMLPNNNGKKGEYAGAAIWGSSPSIDVYRNHIYIATGNLYSAPLNILQCQERQNNET-  275

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P   D+C   + H NSI+AL
Sbjct  276  TPIKQDKCVEQENHSNSILAL  296



>ref|XP_008348222.1| PREDICTED: uncharacterized protein LOC103411362 [Malus domestica]
Length=538

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T+ LPDN G+LG YSGAAIWGSSP++D+ R  VY+ TGN+Y+ PE V + Q  QNN T 
Sbjct  232  KTFMLPDNHGQLGSYSGAAIWGSSPSIDVHRKHVYIATGNVYSVPENVSQXQENQNNST-  290

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD C  PD   NSI+AL
Sbjct  291  LPTHPDACVEPDNRGNSILAL  311



>ref|XP_004304937.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=536

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN G LG YSGAAIWGSSP++D+LR  VY+ TGN Y+ PE V +CQ  QNN T 
Sbjct  230  QTFMLPDNHGNLGQYSGAAIWGSSPSIDVLRKHVYIATGNTYSVPENVSQCQENQNNST-  288

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT    C  P  H NSI+AL
Sbjct  289  VPTRSYACVEPQNHGNSILAL  309



>ref|XP_007217415.1| hypothetical protein PRUPE_ppa025769mg, partial [Prunus persica]
 gb|EMJ18614.1| hypothetical protein PRUPE_ppa025769mg, partial [Prunus persica]
Length=510

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN GK G Y+GAAIWGSSP++D+ R  V++ T NLY+AP  ++ CQ  +NN+T 
Sbjct  218  QTFMLPDNFGKFGEYAGAAIWGSSPSIDVPRNLVFIATSNLYSAPPRIIECQEKENNQT-  276

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P+ P+ C  PD H  SI+AL
Sbjct  277  VPSHPEACIEPDNHSESIVAL  297



>ref|XP_006602900.1| PREDICTED: uncharacterized protein LOC102668917 isoform X1 [Glycine 
max]
Length=544

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYTLPDN    G Y+GAAIWGSSP++D+ R  VY+GTGNLY+AP  + +C+  Q N+T 
Sbjct  229  RTYTLPDNKNTKGEYAGAAIWGSSPSIDVERNLVYIGTGNLYSAPLRIQQCRERQLNQT-  287

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT  D+C  PD H NSI+AL
Sbjct  288  QPTQQDECVEPDNHSNSILAL  308



>gb|KHN13644.1| Quinohemoprotein ethanol dehydrogenase type-1 [Glycine soja]
Length=544

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYTLPDN    G Y+GAAIWGSSP++D+ R  VY+GTGNLY+AP  + +C+  Q N+T 
Sbjct  229  RTYTLPDNKNTKGEYAGAAIWGSSPSIDVERNLVYIGTGNLYSAPLRIQQCRERQLNQT-  287

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT  D+C  PD H NSI+AL
Sbjct  288  QPTQQDECVEPDNHSNSILAL  308



>ref|XP_008230739.1| PREDICTED: uncharacterized protein LOC103329980 [Prunus mume]
Length=544

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN GK G Y+GAAIWGSSP++D+ R  V++ T NLY+AP  ++ CQ  +NN+T 
Sbjct  231  QTFMLPDNFGKFGEYAGAAIWGSSPSIDVPRNLVFIATSNLYSAPPRIIECQEKENNQT-  289

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P+ P+ C  PD H  SI+AL
Sbjct  290  VPSHPEACIEPDNHSESIVAL  310



>ref|XP_007139593.1| hypothetical protein PHAVU_008G042800g [Phaseolus vulgaris]
 gb|ESW11587.1| hypothetical protein PHAVU_008G042800g [Phaseolus vulgaris]
Length=542

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY +PDN  K G Y+GAAIWGSSP++D  R  VY+GTGNLY+AP  +  C+  Q NRT 
Sbjct  227  RTYMIPDNNNKKGEYAGAAIWGSSPSIDEKRKHVYIGTGNLYSAPSHISLCRERQINRT-  285

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
              T PD+C  PD H NSI+AL
Sbjct  286  QHTQPDECVEPDNHSNSILAL  306



>ref|XP_004302347.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=546

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 56/83 (67%), Gaps = 2/83 (2%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY LPDN GKLG YSGAAIWGSSP++D+ R  VY+ TGN Y+ PE + +CQ  Q N T 
Sbjct  230  QTYMLPDNHGKLGQYSGAAIWGSSPSIDVHRRHVYIATGNTYSVPEYISQCQENQLNTTN  289

Query  183  P--PTGPDQCFGPDVHFNSIMAL  245
               PT  D C  P  H NSI+AL
Sbjct  290  SSVPTHSDACVEPVNHGNSILAL  312



>ref|XP_004489157.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Cicer arietinum]
Length=536

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY LP+N G    YSGAAIWGSSP++D LR  VY+ TGNLY+ P  + +CQ  +NN+T 
Sbjct  222  QTYMLPNNNGNKSEYSGAAIWGSSPSIDPLRNLVYIATGNLYSVPLRISQCQEKENNQT-  280

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P+  D+C  PD H +SI+AL
Sbjct  281  IPSHLDECIDPDNHSDSILAL  301



>emb|CDP02211.1| unnamed protein product [Coffea canephora]
Length=545

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T+TLPDN G+ G Y+G AIWGSS  +D  R  VY+ TGNLY+AP+ +  CQ   NN+T 
Sbjct  239  KTFTLPDNHGQRGDYAGGAIWGSSAPIDASRNHVYIATGNLYSAPQRIQDCQERLNNQT-  297

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT P++C  PD H +S+MAL
Sbjct  298  TPTNPEECIEPDNHSDSMMAL  318



>gb|KHN13638.1| Quinohemoprotein ethanol dehydrogenase type-1 [Glycine soja]
Length=552

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY LPDN  + G Y+GA+IWGSSP++D+ R  VY  TGNLY+AP  + +C+  Q NRT 
Sbjct  236  KTYMLPDNNNRTGEYAGASIWGSSPSIDVERNHVYTATGNLYSAPLRIRQCRERQINRTQ  295

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            P    D+C  PD H +S++AL
Sbjct  296  PTQPGDECVEPDNHSDSMLAL  316



>ref|XP_009347060.1| PREDICTED: uncharacterized protein LOC103938746 [Pyrus x bretschneideri]
Length=543

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN GK   Y+GAAIWGSSP++D+ R  V+V T NLY+AP  ++ CQ  +NN+T 
Sbjct  230  QTFMLPDNFGKFNEYAGAAIWGSSPSIDVPRNLVFVATSNLYSAPPRIIECQEKENNQT-  288

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P+ P+ C  P+ H  S++AL
Sbjct  289  VPSHPEACIEPENHSESMVAL  309



>ref|XP_008341556.1| PREDICTED: uncharacterized protein LOC103404426 [Malus domestica]
Length=543

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+ LPDN GK   Y+GAAIWGSSP++D+ R  V+V T NLY+AP  ++ CQ  +NN+T 
Sbjct  230  QTFMLPDNFGKFNEYAGAAIWGSSPSIDVPRNLVFVATSNLYSAPPRIIECQEKENNQT-  288

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P+ P+ C  P+ H  S++AL
Sbjct  289  LPSHPEACIEPENHSESMVAL  309



>ref|XP_010661143.1| PREDICTED: uncharacterized protein LOC104877332, partial [Vitis 
vinifera]
Length=500

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+TLPDN G+ G Y+GAAIWGSSP++D+ R  VYV TGNLY+AP  +  CQ  QNN+T 
Sbjct  187  QTFTLPDNHGERGEYAGAAIWGSSPSIDVQRNLVYVATGNLYSAPLNIQECQEQQNNQT-  245

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PDQC  PD H NSI+A 
Sbjct  246  VPTQPDQCIEPDNHSNSILAF  266



>ref|XP_010661142.1| PREDICTED: uncharacterized protein LOC104877357 [Vitis vinifera]
Length=519

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+TLPDN G+ G Y+GAAIWGSSP++D+ R  VYV TGNLY+AP  +  CQ  QNN+T 
Sbjct  206  QTFTLPDNHGERGEYAGAAIWGSSPSIDVQRNLVYVATGNLYSAPLNIQECQEQQNNQT-  264

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PDQC  PD H NSI+A 
Sbjct  265  VPTQPDQCIEPDNHSNSILAF  285



>emb|CAN79118.1| hypothetical protein VITISV_005773 [Vitis vinifera]
Length=1368

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  48    SGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDVHF  227
             +GAAIWGSSP++D+ R  VYV TGNLY+AP  +  CQ  QNN+T  PT PDQC  PD H 
Sbjct  1201  AGAAIWGSSPSIDVRRNLVYVATGNLYSAPLSIRECQEQQNNQT-VPTQPDQCIEPDNHS  1259

Query  228   NSIMAL  245
             NSI+A+
Sbjct  1260  NSILAI  1265



>emb|CBI22175.3| unnamed protein product [Vitis vinifera]
Length=535

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +3

Query  33   KLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFG  212
            K  G +GAAIWGSSP++D+ R  VYV TGNLY+AP  +  CQ  QNN+T  PT PDQC  
Sbjct  302  KANGIAGAAIWGSSPSIDVRRNLVYVATGNLYSAPLSIRECQEQQNNQT-VPTQPDQCIE  360

Query  213  PDVHFNSIMAL  245
            PD H NSI+A+
Sbjct  361  PDNHSNSILAI  371



>ref|XP_010693329.1| PREDICTED: uncharacterized protein LOC104906291 [Beta vulgaris 
subsp. vulgaris]
Length=541

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY LPDN  + G Y+GAAIWGSSP +D+ R  +Y+ TGNLY+AP+ +  C   +NN+T 
Sbjct  221  QTYMLPDNHQQRGEYAGAAIWGSSPPIDVSRNLIYIATGNLYSAPQRIRDCSERENNQTF  280

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
             PT    C  P+ H NS +AL 
Sbjct  281  -PTNTSLCVEPENHSNSFLALE  301



>gb|KHN13641.1| Quinohemoprotein ethanol dehydrogenase type-1 [Glycine soja]
Length=532

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T+ LPDN    G Y+GA++WGSSP++D+ R  VYV TGNLY+AP  + +C+  Q N T 
Sbjct  217  KTFMLPDNNNTRGEYAGASVWGSSPSIDVKRNHVYVATGNLYSAPLRIRQCRERQINGT-  275

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD C  P+ H +S++AL
Sbjct  276  EPTQPDACVEPENHSDSMLAL  296



>ref|XP_006602903.1| PREDICTED: uncharacterized protein LOC102669266 [Glycine max]
Length=532

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T+ LPDN    G Y+GA++WGSSP++D+ R  VY+ TGNLY+AP  + +C+  Q N T 
Sbjct  217  KTFMLPDNNNTRGEYAGASVWGSSPSIDVKRNHVYIATGNLYSAPLRIRQCRERQINGT-  275

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PD C  P+ H +S++AL
Sbjct  276  EPTQPDACVEPENHSDSMLAL  296



>ref|XP_007216718.1| hypothetical protein PRUPE_ppa026320mg [Prunus persica]
 gb|EMJ17917.1| hypothetical protein PRUPE_ppa026320mg [Prunus persica]
Length=538

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEV-LRCQAAQNNRT  179
            QT+ LPDN G LG YSGAAIWGSSP++D+ R  VY+ TGN+Y+ PE V    +   NN +
Sbjct  230  QTFMLPDNHGNLGNYSGAAIWGSSPSIDVHRKHVYIATGNVYSVPENVSQCQENQNNNNS  289

Query  180  GPPTGPDQCFGPDVHFNSIMAL  245
              P  PD C  P+ H NSI+AL
Sbjct  290  TLPIHPDACVEPENHGNSILAL  311



>ref|XP_007216879.1| hypothetical protein PRUPE_ppa020987mg [Prunus persica]
 gb|EMJ18078.1| hypothetical protein PRUPE_ppa020987mg [Prunus persica]
Length=345

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEV-LRCQAAQNNRT  179
            QT+ L DN GKLG YSG AIWGSSP++D+ R  VY+ TGN+Y+ PE V    +   NN +
Sbjct  82   QTFVLLDNHGKLGQYSGPAIWGSSPSIDVHRKHVYIATGNIYSVPENVSQCQENQNNNNS  141

Query  180  GPPTGPDQCFGPDVHFNSIMAL  245
              PT PD C  P  H NSI+AL
Sbjct  142  TLPTHPDACVEPQNHGNSILAL  163



>ref|XP_008230741.1| PREDICTED: uncharacterized protein LOC103329982 [Prunus mume]
Length=538

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEV-LRCQAAQNNRT  179
            QT+ LPDN G LG YSGAAIWGSSP++D  R  VY+ TGN+Y+ PE V    +   NN +
Sbjct  230  QTFMLPDNHGNLGNYSGAAIWGSSPSIDAHRKHVYIATGNVYSVPENVSQCQENQNNNNS  289

Query  180  GPPTGPDQCFGPDVHFNSIMAL  245
              PT PD C  P  H NSI+AL
Sbjct  290  TIPTHPDACVEPQNHGNSILAL  311



>emb|CDP11594.1| unnamed protein product [Coffea canephora]
Length=541

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T+TLPDN G  G Y+GAA+WGSSP++D  R  VY+ TGNLY+AP  + +CQ  + N   
Sbjct  232  KTFTLPDNHGNRGEYAGAAVWGSSPSIDAPRNHVYIATGNLYSAPRRIRKCQ-ERLNNQT  290

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT P++C  PD H NSIMAL
Sbjct  291  NPTNPNECIEPDNHSNSIMAL  311



>gb|KDO82850.1| hypothetical protein CISIN_1g039692mg, partial [Citrus sinensis]
Length=417

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 50/81 (62%), Gaps = 20/81 (25%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY LPDNGGK GGYSGAA+WGSSPA+D++R                    +  QNN+T 
Sbjct  167  QTYMLPDNGGKRGGYSGAAVWGSSPAIDVIR--------------------RQKQNNQTT  206

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT PDQC   D++ NSI+AL
Sbjct  207  KPTHPDQCISSDIYANSIVAL  227



>ref|WP_039748847.1| hypothetical protein, partial [Hassallia byssoidea]
Length=511

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYT+PDNGG  GGYSGA++WGS+PA+D  R  VY+ TGN  + P+    C A  ++ T 
Sbjct  199  KTYTVPDNGGLPGGYSGASVWGSTPAIDPKRNSVYIATGNNNDVPQTAKDCIANLSSPT-  257

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P+   QC  P+ H ++IMAL
Sbjct  258  -PSDESQCLDPNNHVDAIMAL  277



>ref|WP_026292022.1| polyvinylalcohol dehydrogenase [Marinobacterium rhizophilum]
Length=517

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 9/81 (11%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY  P       GY+G A+WGSSPA+D  RG VY+ TGN Y+ P++VL C AA     G
Sbjct  213  KTYMAPQ------GYTGNAVWGSSPAIDTRRGQVYIATGNNYSVPDDVLDCVAAAG---G  263

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P     C   D HF+SI+AL
Sbjct  264  DPVAKSACLPADNHFDSILAL  284



>ref|WP_011687395.1| pyrrolo-quinoline quinone [Candidatus Solibacter usitatus]
 ref|YP_826945.1| pyrrolo-quinoline quinone [Candidatus Solibacter usitatus Ellin6076]
 gb|ABJ86660.1| Pyrrolo-quinoline quinone [Candidatus Solibacter usitatus Ellin6076]
Length=513

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 47/81 (58%), Gaps = 6/81 (7%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT+T+PDN G+  GYSG AIW   PA+D+ RG +Y GTGN Y  P+EV  C A       
Sbjct  215  QTFTVPDNHGRTDGYSGNAIW-QPPAIDLARGLLYTGTGNNYEVPDEVKACLATATMAEQ  273

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            P      CF    +F+S MAL
Sbjct  274  P-----SCFSSQDYFDSAMAL  289



>gb|EQB44371.1| hypothetical protein CGLO_16897 [Colletotrichum gloeosporioides 
Cg-14]
Length=543

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +3

Query  45   YSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDVH  224
            +SGA++WGSSP VD  RG VY+ TGN ++ P+E+  CQ A N      T PD C  PD++
Sbjct  237  FSGASVWGSSPVVDTSRGSVYIATGNTHSVPDEIAACQLASNQNG--TTFPDPCLPPDIY  294

Query  225  FNSIMAL  245
              S++AL
Sbjct  295  QESVLAL  301



>gb|KHN13633.1| hypothetical protein glysoja_019320 [Glycine soja]
Length=354

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLR  152
            QTYT+PDN G+ G YSGAA+WGSSP +D  R  +Y+ TGNLY AP ++L 
Sbjct  150  QTYTIPDNHGEKGEYSGAAVWGSSPPIDASRNHIYIATGNLYTAPLDILE  199



>ref|WP_014266931.1| pyrrolo-quinoline quinone [Granulicella mallensis]
 ref|YP_005059089.1| pyrrolo-quinoline quinone repeat-containing protein [Granulicella 
mallensis MP5ACTX8]
 gb|AEU38059.1| Pyrrolo-quinoline quinone repeat-containing protein [Granulicella 
mallensis MP5ACTX8]
Length=538

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYT+PDNGG   GYSG AIW   PA+D+ RG +YVGTG+ Y  P+ + +C+    +   
Sbjct  234  KTYTVPDNGGTTDGYSGGAIW-QQPAIDVARGSIYVGTGDNYTVPDAIEQCETEHLSDGD  292

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
              +    C  P+ H +S+MA 
Sbjct  293  TSS----CTPPNDHLDSVMAF  309



>ref|XP_001691739.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP04847.1| predicted protein [Chlamydomonas reinhardtii]
Length=1141

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            Q +T P+NGG + G+SG A+WGS+PA+D  RG VYV TGN Y APEEVL C     N T 
Sbjct  235  QFFTAPENGG-VPGWSGNAVWGSAPAIDEARGRVYVATGNQYVAPEEVLECLEDPANDT-  292

Query  183  PPTGPDQCFG-PDVHFNSIMAL  245
             P     C   P   FNS+++L
Sbjct  293  -PAKKGACVDVPGNWFNSVLSL  313


 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 6/79 (8%)
 Frame = +3

Query  9    YTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPP  188
            YT PD    + G+SG A+WGS+PA+D  RGWVYV TGN Y AP++VL C  +  +     
Sbjct  818  YTAPD----VKGWSGNAVWGSAPAIDEARGWVYVATGNQYTAPQDVLDCLESSASNEAKL  873

Query  189  TGPDQCFGPDVHFNSIMAL  245
                +  G    FNSI+A+
Sbjct  874  ACVSKEEGN--WFNSILAI  890



>gb|EXX51333.1| hypothetical protein RirG_262810 [Rhizophagus irregularis DAOM 
197198w]
Length=529

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T+ LPDN G+   YSG A+WGS+PA+D +   VY+ TGN Y  P  V  C A   N   
Sbjct  220  KTFMLPDNNGRSDLYSGNAVWGSAPAIDPVNKLVYIATGNNYETPSYVADCVANATNSVD  279

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
                  +C  P+ HF++I+AL 
Sbjct  280  MM----KCHDPNNHFDAILALN  297



>ref|XP_007282941.1| pyrrolo-quinoline quinone [Colletotrichum gloeosporioides Nara 
gc5]
 gb|ELA27985.1| pyrrolo-quinoline quinone [Colletotrichum gloeosporioides Nara 
gc5]
Length=548

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +3

Query  45   YSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDVH  224
            +SGA++WGSSP VD +R  VY+ TGN ++ P+EV  CQ A N        PD C  PD++
Sbjct  243  FSGASVWGSSPVVDTIRNCVYIATGNTHSVPDEVAACQLASNQNG--TVLPDPCLPPDIY  300

Query  225  FNSIMAL  245
              S++AL
Sbjct  301  QESVLAL  307



>ref|WP_018521987.1| MULTISPECIES: hypothetical protein [Streptomyces]
Length=531

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 8/81 (10%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            + +T PDNGGK GGYSG A+WG +PA+D     VY  TGN Y  P+EV  CQ A      
Sbjct  222  RQFTTPDNGGKTGGYSGVAVWG-TPALDPSTNTVYFTTGNNYTVPKEVSDCQTAGGT---  277

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
                P QC+  D + ++++AL
Sbjct  278  ----PAQCYQEDNYVDTVLAL  294



>ref|XP_002960975.1| hypothetical protein SELMODRAFT_437427 [Selaginella moellendorffii]
 gb|EFJ38514.1| hypothetical protein SELMODRAFT_437427 [Selaginella moellendorffii]
Length=504

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T  LPDN G+ G YSGAAIWGSSP++D  RG VY+ TGNLY  P  V  C  A  NRTG
Sbjct  202  KTGMLPDNHGQNGLYSGAAIWGSSPSIDEERGLVYIATGNLYTVPASVQACLDA--NRTG  259



>gb|KCW64984.1| hypothetical protein EUGRSUZ_G02528 [Eucalyptus grandis]
Length=204

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +3

Query  9    YTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPP  188
            YT+PD   K GGYSGA+  GSSPA D  R  +YV   NLY     V +CQ  QNN+T  P
Sbjct  45   YTIPDEDSKRGGYSGASQCGSSPATDPRRRLLYVANNNLYTVSPWVAQCQEKQNNQTKKP  104

Query  189  TGP  197
            + P
Sbjct  105  SQP  107



>ref|XP_006431100.1| hypothetical protein CICLE_v10013418mg, partial [Citrus clementina]
 gb|ESR44340.1| hypothetical protein CICLE_v10013418mg, partial [Citrus clementina]
Length=502

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 46/77 (60%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYN--APEEVLRCQAAQNNR  176
            QT+ LPDN GKL  Y+GAAIWGSSP++D +R  VY+ TGNLY+   PE       A +  
Sbjct  198  QTFMLPDNFGKLNEYAGAAIWGSSPSIDPIRNHVYIATGNLYSCIEPENHSNSLLALDLD  257

Query  177  TGPPTGPDQCFGPDVHF  227
            TG      Q  G DV F
Sbjct  258  TGKFVWYKQLGGYDVWF  274



>ref|XP_001757145.1| predicted protein [Physcomitrella patens]
 gb|EDQ78004.1| predicted protein [Physcomitrella patens]
Length=616

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +3

Query  18   PDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGP  197
            PDNGGK G YSG AIW S P +D  R  VY+ TGN Y+AP +V  C+         PT  
Sbjct  295  PDNGGKPGLYSGNAIWASGPPIDTTRRLVYIATGNSYSAPPDVEECRTQNPANVTNPTLE  354

Query  198  DQCFGPDVHFNSIMAL  245
            D C     +  SI+A+
Sbjct  355  DPCVAEGDYVTSIVAI  370



>ref|WP_030200207.1| polyvinylalcohol dehydrogenase [Corynebacterium variabile]
Length=519

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  45   YSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDVH  224
            Y G A+WGSSPAVD  RG +Y+ TGN Y+ P+ VL C  A    T        C  PD H
Sbjct  231  YPGTAVWGSSPAVDAKRGSLYIATGNNYDVPDTVLACITAAGTDTAAQAA---CLPPDDH  287

Query  225  FNSIMAL  245
            F+SI+AL
Sbjct  288  FDSIVAL  294



>ref|XP_002967034.1| hypothetical protein SELMODRAFT_408373 [Selaginella moellendorffii]
 gb|EFJ31633.1| hypothetical protein SELMODRAFT_408373 [Selaginella moellendorffii]
Length=503

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T  LPDN G+   YSGAAIWGSSP++D  RG VY+ TGNLY  P  +  C  A  NRTG
Sbjct  201  KTGMLPDNHGQNELYSGAAIWGSSPSIDEKRGLVYIATGNLYTVPASIQACLDA--NRTG  258



>ref|XP_002984699.1| hypothetical protein SELMODRAFT_423793 [Selaginella moellendorffii]
 gb|EFJ14344.1| hypothetical protein SELMODRAFT_423793 [Selaginella moellendorffii]
Length=146

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 11/82 (13%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQ-NNRT  179
            +T  LP+  G    ++GAA+WGSSP ++  R  +Y+ TGNLY AP EV  C+AA+  N T
Sbjct  55   RTSMLPEGSG----FTGAAVWGSSPPIEKRRRLIYIATGNLYTAPREVEECEAARATNTT  110

Query  180  GPPTGPDQCFGPDVHFNSIMAL  245
            G    PD  F    H  S++AL
Sbjct  111  G--RNPDDPF----HHESVVAL  126



>ref|WP_013491202.1| pyrrolo-quinoline quinone repeat-containing protein [Intrasporangium 
calvum]
 ref|YP_004097607.1| pyrrolo-quinoline quinone repeat-containing protein [Intrasporangium 
calvum DSM 43043]
 gb|ADU46880.1| Pyrrolo-quinoline quinone repeat-containing protein [Intrasporangium 
calvum DSM 43043]
Length=520

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 9/81 (11%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY  P++      + G A+WGSSPAVD  RG VY+ TGN Y+ P++VL C AA      
Sbjct  221  KTYMTPED------FPGVAVWGSSPAVDPKRGTVYIATGNNYDVPQDVLDCVAAAGTD--  272

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P     C  P+  F+SI+AL
Sbjct  273  -PVAQRACLPPEDLFDSIVAL  292



>ref|WP_034801302.1| hypothetical protein [Intrasporangium oryzae]
 gb|EWT03181.1| polyvinylalcohol dehydrogenase [Intrasporangium oryzae NRRL B-24470]
Length=522

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 13/80 (16%)
 Frame = +3

Query  6    TYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGP  185
            TYT+P+      GYSG A+WGS+PA+D   G VY+ TGN Y+ P  V +CQ    +    
Sbjct  228  TYTVPE------GYSGGAVWGSTPAIDAKTGAVYITTGNNYSVPPAVKQCQLDGGS----  277

Query  186  PTGPDQCFGPDVHFNSIMAL  245
               P QC  P  H +++MAL
Sbjct  278  ---PAQCLDPSDHVDAVMAL  294



>gb|ERZ95657.1| hypothetical protein GLOINDRAFT_331141 [Rhizophagus irregularis 
DAOM 181602]
Length=537

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T+ +PDN G+   YSG A+WGS+PA+D ++  VY+ TGN Y  PE V  C    N  T 
Sbjct  221  RTFMVPDNYGRPDLYSGNAVWGSAPAIDPIKKLVYIATGNNYEIPENVTNC--ITNATT-  277

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P     C  P+   ++I+AL
Sbjct  278  -PEQKSACHDPNNFLDAILAL  297



>gb|EXX76536.1| hypothetical protein RirG_032350 [Rhizophagus irregularis DAOM 
197198w]
Length=532

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +T+ +PDN G+   YSG A+WGS+PA+D ++  VY+ TGN Y  PE V  C    N  T 
Sbjct  221  RTFMVPDNYGRPDLYSGNAVWGSAPAIDPIKKLVYIATGNNYEIPENVTNC--ITNATT-  277

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P     C  P+   ++I+AL
Sbjct  278  -PEQKSACHDPNNFLDAILAL  297



>emb|CDI02935.1| Pyrrolo-quinoline quinone repeat-containing protein [Candidatus 
Competibacter denitrificans Run_A_D11]
Length=548

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = +3

Query  42   GYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDV  221
            GYSG AIWGS+  +D  R  +YV TGN Y  PE V +C A      G P     C  PD 
Sbjct  237  GYSGGAIWGSTAVLDAARRSLYVTTGNNYTVPEAVRQCVAGAQ---GSPQAQRACIAPDN  293

Query  222  HFNSIMAL  245
            HF+S++AL
Sbjct  294  HFDSVVAL  301



>ref|XP_002972263.1| hypothetical protein SELMODRAFT_441782 [Selaginella moellendorffii]
 gb|EFJ26349.1| hypothetical protein SELMODRAFT_441782 [Selaginella moellendorffii]
Length=494

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 11/80 (14%)
 Frame = +3

Query  6    TYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGP  185
            TY +P +      Y+G  +WGSSPA+D  RG VY+ TG++++ P EV +CQ A  N +  
Sbjct  187  TYMVPRDSQ----YTGVPVWGSSPALDERRGLVYIATGSVFSVPSEVRQCQQATGNSS--  240

Query  186  PTGPDQCFGPDVHFNSIMAL  245
                  C  P V +NS++A+
Sbjct  241  -----SCIVPSVCYNSVVAV  255



>ref|XP_002984177.1| hypothetical protein SELMODRAFT_445822 [Selaginella moellendorffii]
 gb|EFJ14687.1| hypothetical protein SELMODRAFT_445822 [Selaginella moellendorffii]
Length=494

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 11/80 (14%)
 Frame = +3

Query  6    TYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGP  185
            TY +P +      Y+G  +WGSSPA+D  RG VY+ TG++++ P EV +CQ A  N +  
Sbjct  187  TYMVPRDSQ----YTGVPVWGSSPALDERRGLVYISTGSVFSVPSEVRQCQQATGNSS--  240

Query  186  PTGPDQCFGPDVHFNSIMAL  245
                  C  P V +NS++A+
Sbjct  241  -----SCIVPSVCYNSVVAV  255



>ref|XP_001696369.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP08346.1| predicted protein [Chlamydomonas reinhardtii]
Length=544

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 5/82 (6%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            Q +T PDNGGK+ G+SG A+WGS+P +   +G V V TGN Y+ P +V +C  A      
Sbjct  182  QFHTAPDNGGKVDGWSGNAVWGSAPTIVEKQGLVVVATGNTYSVPADVEQCLDAATT---  238

Query  183  PPTGPDQCFG-PDVHFNSIMAL  245
             P    +C   P   FNS++ +
Sbjct  239  -PVEKGKCVQVPGNWFNSVLGI  259



>ref|WP_008922098.1| Pyrrolo-quinoline quinone [Burkholderia sp. H160]
 gb|EDZ99568.1| Pyrrolo-quinoline quinone [Burkholderia sp. H160]
Length=524

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 13/81 (16%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTYT+P       GY G ++WGS+ AVD+ R  V++ +GN +  P+ VL C     N  G
Sbjct  217  QTYTMPK------GYYGGSVWGSTGAVDVQRNTVFMASGNNWAVPQAVLDCL----NSGG  266

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             PT    C  P+ HF+S++AL
Sbjct  267  APTA---CIDPNDHFDSVLAL  284



>gb|KCW64982.1| hypothetical protein EUGRSUZ_G02524 [Eucalyptus grandis]
Length=341

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  123  LYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDVHFNSIMALR  248
            LY A  E   CQ  QNN+T PPT PDQC GP+V+FNSI+A  
Sbjct  92   LYTALPEAEECQERQNNQTTPPTEPDQCIGPNVNFNSIIAFE  133



>ref|WP_020741593.1| hypothetical protein [Sorangium cellulosum]
 ref|YP_008156103.1| hypothetical protein SCE1572_48810 [Sorangium cellulosum So0157-2]
 gb|AGP41707.1| hypothetical protein SCE1572_48810 [Sorangium cellulosum So0157-2]
Length=514

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 42/81 (52%), Gaps = 9/81 (11%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY +P       GYSG A+W  +PA+D+ R  +YV TGN Y  P  V  C  A  +   
Sbjct  215  QTYVVP------AGYSGGAVWAGAPAIDVGRRALYVTTGNNYTVPPSVASCAEAAGDD--  266

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P   + C   D H ++I+AL
Sbjct  267  -PLAAEACLAADDHIDAIVAL  286



>gb|ELQ35660.1| hypothetical protein OOU_Y34scaffold00696g2 [Magnaporthe oryzae 
Y34]
 gb|ELQ64482.1| hypothetical protein OOW_P131scaffold00611g4 [Magnaporthe oryzae 
P131]
Length=603

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = +3

Query  45   YSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPP---TGPDQCFGP  215
            +SGAA+WGS P++D +R  V+VGTG LY+ P E   CQ    N T      TG D C   
Sbjct  274  FSGAAVWGSQPSIDPIRRQVFVGTGQLYSLPPEFEECQRQTANVTVIRQGLTGHDPCLPR  333

Query  216  DVHFNSIMAL  245
              + NSI+AL
Sbjct  334  TAYQNSILAL  343



>ref|XP_004338620.1| PQQ enzyme repeat domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR16607.1| PQQ enzyme repeat domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=555

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 45/83 (54%), Gaps = 14/83 (17%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QTY  P N      YSGA +WGSSP+VD   G VYVGTGN Y    ++  C+       G
Sbjct  223  QTYMTPAN------YSGAPVWGSSPSVDDQLGLVYVGTGNNYRETADIRACR-----EQG  271

Query  183  PPTGPDQCF-GPDVHFNSIMALR  248
             P  P QC   P  H +SI+A+R
Sbjct  272  TP--PGQCLVNPHNHVDSIVAMR  292



>ref|XP_004346017.1| protein kinase domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR21473.1| protein kinase domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=819

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 44/81 (54%), Gaps = 11/81 (14%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYTLP       GY GA +WG +P++DI RG VYV TGNLY  P     C  A+ +  G
Sbjct  505  KTYTLP------AGYVGAGVWGPAPSIDIQRGQVYVATGNLYLNP----LCH-ARMDALG  553

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
                 D C   + H  S++AL
Sbjct  554  AHFDQDPCLPVEAHAGSVLAL  574



>emb|CBI22173.3| unnamed protein product [Vitis vinifera]
Length=469

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGT  116
            QT+TLPDN G+ G Y+GAAIWGSSP++D+ R  VYV T
Sbjct  200  QTFTLPDNHGERGEYAGAAIWGSSPSIDVRRNLVYVAT  237



>ref|YP_009001198.1| pyrroloquinoline quinone-dependent DHase [Pithovirus sibericum]
 gb|AHH01863.1| pyrroloquinoline quinone-dependent DHase [Pithovirus sibericum]
Length=515

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 43/81 (53%), Gaps = 3/81 (4%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            QT T+P      G YSGAA+WGSS + D  R  V  GTGN Y  P+ V  C+  + N + 
Sbjct  209  QTRTIPVELTGPGKYSGAAVWGSSSSFDDKR--VCFGTGNPYTVPDNVTACEYVRANSSR  266

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            P   P  C    V F+S+M L
Sbjct  267  PDLMP-SCLDERVIFDSMMCL  286



>emb|CAN66558.1| hypothetical protein VITISV_001825 [Vitis vinifera]
Length=510

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 40/82 (49%), Gaps = 33/82 (40%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYT+PDN GKLG                                 EV +CQA +NN+T 
Sbjct  220  RTYTIPDNAGKLGA--------------------------------EVQQCQANRNNQT-  246

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
             P+ PDQC  PDVHF+SI+AL 
Sbjct  247  IPSQPDQCIAPDVHFDSILALE  268



>ref|WP_012238034.1| polyvinylalcohol dehydrogenase [Sorangium cellulosum]
 ref|YP_001616046.1| polyvinylalcohol dehydrogenase [Sorangium cellulosum So ce56]
 emb|CAN95566.1| putative polyvinylalcohol dehydrogenase [Sorangium cellulosum 
So ce56]
Length=516

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 9/81 (11%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            + YT+P       GY+G A+WG +P++D+ R  +YV TGN Y  P  V  C  A  +   
Sbjct  217  KRYTVP------AGYTGGAVWGGAPSLDLKRRTLYVTTGNNYTVPPSVSACVEAAGDD--  268

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
             P   + C  PD + ++++AL
Sbjct  269  -PVAAEACLAPDDYIDAVLAL  288



>ref|WP_011113104.1| probable polyvinylalcohol dehydrogenase [Streptomyces rochei]
 ref|NP_851445.1| probable polyvinylalcohol dehydrogenase [Streptomyces rochei]
 dbj|BAC76481.1| probable polyvinylalcohol dehydrogenase [Streptomyces rochei]
Length=543

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 15/81 (19%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYT+P+      GY+GA++WGS P VD   G V+VGTGN Y +P  V  C   +     
Sbjct  243  KTYTIPE------GYTGASVWGSQPVVDHKTGLVFVGTGNNYTSPPGV--CLNPKQTDCT  294

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            PP         D HF+S++AL
Sbjct  295  PP-------AEDDHFDSVLAL  308



>ref|WP_037663542.1| hypothetical protein, partial [Streptomyces griseofuscus]
Length=484

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 15/81 (19%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYT+P+      GY+GA++WGS P VD   G V+VGTGN Y +P  V  C   +     
Sbjct  184  KTYTIPE------GYTGASVWGSQPVVDHKTGLVFVGTGNNYTSPPGV--CLNPKQTDCT  235

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            PP         D HF+S++AL
Sbjct  236  PP-------AEDDHFDSVLAL  249



>gb|ADN64238.1| putative polyvinylalcohol dehydrogenase [Streptomyces rochei 
subsp. volubilis]
Length=543

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 15/81 (19%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYT+P+      GY+GA++WGS P VD   G V+VGTGN Y +P  V  C   +     
Sbjct  243  KTYTIPE------GYTGASVWGSQPVVDHKTGLVFVGTGNNYTSPPGV--CLNPKQTDCT  294

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            PP         D HF+S++AL
Sbjct  295  PP-------AEDDHFDSVLAL  308



>ref|WP_036568982.1| hypothetical protein [Nocardioides sp. URHA0032]
Length=538

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 11/82 (13%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYT+P       GY+G A+WGS+   D  RG+VY  TGN Y  P +          RT 
Sbjct  234  KTYTVPT------GYNGGAVWGSTIVPDPARGFVYATTGNNYFTPTDPDYTSCIDAGRT-  286

Query  183  PPTGPDQCFGPDVHFNSIMALR  248
                 +QC  PD H +S+MALR
Sbjct  287  ----QEQCNSPDDHVDSVMALR  304



>ref|WP_035237051.1| hypothetical protein [Acidobacteriaceae bacterium URHE0068]
Length=538

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 10/81 (12%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYT+P+      GY+G A+WGS+  VD  RG +YV TGN Y+ P +V  C      R  
Sbjct  236  KTYTVPE------GYTGGAVWGSNFVVDAARGSLYVSTGNNYSVPSDVSSCLINAKTR--  287

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
              +    C  P  + +S++AL
Sbjct  288  --SEQIACIDPTDYVDSVLAL  306



>ref|WP_028785649.1| polyvinylalcohol dehydrogenase [Terracoccus sp. 273MFTsu3.1]
Length=518

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 40/68 (59%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   GYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDV  221
            GY G A+WGSSP++D  RG VY+ TGN Y+ P+  L C AA  +          C   D 
Sbjct  227  GYPGNAVWGSSPSIDTKRGSVYIATGNNYDVPDATLDCVAAAASD----AAKRACLPADD  282

Query  222  HFNSIMAL  245
            +F+SI++L
Sbjct  283  YFDSILSL  290



>ref|XP_007917887.1| putative quinohemoprotein ethanol dehydrogenase type-1 protein 
[Togninia minima UCRPA7]
 gb|EON97355.1| putative quinohemoprotein ethanol dehydrogenase type-1 protein 
[Togninia minima UCRPA7]
Length=609

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +3

Query  45   YSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTG--PDQCFGPD  218
            +SG+AIWGS PA+D +R  V++ TGN Y  P+   +CQ A  N T    G   D C   +
Sbjct  273  FSGSAIWGSQPAIDPIRNQVFIATGNTYQLPDAFEQCQNATANITVIQQGLTTDPCLPRN  332

Query  219  VHFNSIMA  242
            V   +++A
Sbjct  333  VFQEAVLA  340



>ref|WP_030179207.1| hypothetical protein [Streptomyces violaceorubidus]
Length=247

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 15/81 (19%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            ++YT+P+      G +G A+WGS+PAVD  RG VYVGTGN Y+ P+ V  C+A +     
Sbjct  161  KSYTVPE------GSTGGAVWGSNPAVDEKRGLVYVGTGNNYSVPDGV--CKAPEETGCE  212

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
            P         P  H ++++AL
Sbjct  213  P-------ADPANHQDAVVAL  226



>ref|XP_002963347.1| hypothetical protein SELMODRAFT_438505, partial [Selaginella 
moellendorffii]
 gb|EFJ35218.1| hypothetical protein SELMODRAFT_438505, partial [Selaginella 
moellendorffii]
Length=679

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 11/81 (14%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TY +P+N      + G  +WGSSP++D  RG  ++GTGNLY  P +V  C     N + 
Sbjct  358  RTYMVPENSS----FYGVTVWGSSPSIDPKRGLAFIGTGNLYQIPSDVQDCLNRNANSS-  412

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
                   C+ P V  ++++A+
Sbjct  413  ------DCYPPGVCDDAVVAV  427



>ref|WP_010342314.1| polyvinylalcohol dehydrogenase [Xanthomonas sacchari]
Length=557

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   GYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDV  221
            GY+GA++WG+  A+D LR  VY  TGN Y+ P EV  C     N  G  T    C  PD 
Sbjct  250  GYTGASVWGT-LAIDPLRQRVYATTGNNYSVPTEVASC---VKNANGDKTAQLACMAPDN  305

Query  222  HFNSIMAL  245
            + +S++AL
Sbjct  306  YVDSVLAL  313



>ref|WP_026144241.1| polyvinylalcohol dehydrogenase [Xanthomonas sp. SHU199]
 gb|AJC45440.1| polyvinylalcohol dehydrogenase [Xanthomonas sacchari]
Length=558

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   GYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDV  221
            GY+GA++WG+  A+D LR  VY  TGN Y+ P EV  C     N  G  T    C  PD 
Sbjct  250  GYTGASVWGT-LAIDPLRQRVYATTGNNYSVPTEVASC---VKNANGDKTAQLACMAPDN  305

Query  222  HFNSIMAL  245
            + +S++AL
Sbjct  306  YVDSVLAL  313



>ref|WP_026143236.1| polyvinylalcohol dehydrogenase [Xanthomonas sp. SHU308]
Length=558

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   GYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDV  221
            GY+GA++WG+  A+D LR  VY  TGN Y+ P EV  C     N  G  T    C  PD 
Sbjct  250  GYTGASVWGT-LAIDPLRQRVYATTGNNYSVPTEVASC---VKNANGDKTAQLACMAPDN  305

Query  222  HFNSIMAL  245
            + +S++AL
Sbjct  306  YVDSVLAL  313



>ref|XP_002974841.1| hypothetical protein SELMODRAFT_442588 [Selaginella moellendorffii]
 gb|EFJ24361.1| hypothetical protein SELMODRAFT_442588 [Selaginella moellendorffii]
Length=606

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 42/89 (47%), Gaps = 23/89 (26%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQ--------  158
            +T  +P+N G    + G ++WGSSP+VD  RG V++GTGNLY  P +V  C         
Sbjct  322  RTDMVPENSG----FYGVSVWGSSPSVDPKRGLVFIGTGNLYQIPSDVQDCLNRNANSSD  377

Query  159  -----------AAQNNRTGPPTGPDQCFG  212
                        A N    P  GPD  FG
Sbjct  378  CYPRGVCDDTVVAVNMADAPEPGPDYDFG  406



>ref|XP_009219017.1| hypothetical protein GGTG_02975 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT77872.1| hypothetical protein GGTG_02975 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=568

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 42/81 (52%), Gaps = 3/81 (4%)
 Frame = +3

Query  12   TLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPP-  188
            TLP          GAA+WGS P++D +R  V+ G+GNLYN P + + C     N +    
Sbjct  248  TLPHTSPANADLGGAAVWGSQPSIDPIRKQVFFGSGNLYNIPPDFVDCVRQTANISIIEQ  307

Query  189  --TGPDQCFGPDVHFNSIMAL  245
               G D C   + + +SIMA+
Sbjct  308  GLVGRDPCLPIETYQDSIMAV  328



>gb|ESA13875.1| hypothetical protein GLOINDRAFT_25571 [Rhizophagus irregularis 
DAOM 181602]
Length=263

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNA  134
            +T+ LPDN G+   YSG A+WGS+PA+D +   VY+ TGN Y  
Sbjct  220  KTFMLPDNNGRSDLYSGNAVWGSAPAIDPVNKLVYIATGNNYEV  263



>ref|WP_033412672.1| polyvinylalcohol dehydrogenase, partial [Segetibacter koreensis]
Length=528

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 37/53 (70%), Gaps = 4/53 (8%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQA  161
            +TY LP+  GK  G++G A+WGS+P VD+ R  +++ TGN Y  P+ +L C+A
Sbjct  208  KTYMLPE--GK--GFAGNAVWGSTPVVDMKRNSLFITTGNNYKVPQAILDCRA  256



>ref|WP_003479338.1| polyvinyl-alcohol dehydrogenase (acceptor) [Xanthomonas translucens]
 emb|CCP41255.1| polyvinyl-alcohol dehydrogenase (acceptor) [Xanthomonas translucens 
pv. translucens DSM 18974]
Length=577

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   GYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDV  221
            GY+GAA+WG+  A+D  R  VY  TGN Y+ P +V RC     N  G  T    C  PD 
Sbjct  268  GYTGAAVWGT-LALDPQRQRVYATTGNNYSVPLDVARC---VKNANGDKTAQLACLAPDN  323

Query  222  HFNSIMAL  245
            + +S++AL
Sbjct  324  YVDSVLAL  331



>gb|ELQ02887.1| polyvinylalcohol dehydrogenase [Xanthomonas translucens DAR61454]
Length=556

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   GYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDV  221
            GY+GAA+WG+  A+D  R  VY  TGN Y+ P +V RC     N  G  T    C  PD 
Sbjct  247  GYTGAAVWGT-LALDPQRQRVYATTGNNYSVPLDVARC---VKNANGDKTAQLACLAPDN  302

Query  222  HFNSIMAL  245
            + +S++AL
Sbjct  303  YVDSVLAL  310



>ref|WP_038239231.1| polyvinylalcohol dehydrogenase [Xanthomonas translucens]
Length=577

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   GYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDV  221
            GY+GAA+WG+  A+D  R  VY  TGN Y+ P +V RC     N  G  T    C  PD 
Sbjct  268  GYTGAAVWGT-LALDPQRQRVYATTGNNYSVPLDVARC---VKNANGDKTAQLACLAPDN  323

Query  222  HFNSIMAL  245
            + +S++AL
Sbjct  324  YVDSVLAL  331



>ref|YP_008319572.1| pqq-dependent dehydrogenase [Pandoravirus dulcis]
 gb|AGO82903.1| pqq-dependent dehydrogenase [Pandoravirus dulcis]
Length=573

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 13/82 (16%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            +TYT P       GY+GAAIWGSSP+VD+    VYV TGN Y  P +V  C  A      
Sbjct  245  KTYTTPV------GYAGAAIWGSSPSVDLDARAVYVATGNNYKVPADVQACVDAHEGDA-  297

Query  183  PPTGPDQCFG-PDVHFNSIMAL  245
                  QC   PD    +++AL
Sbjct  298  -----SQCASDPDNLAEAVIAL  314



>gb|KEQ80677.1| hypothetical protein M438DRAFT_348612 [Aureobasidium pullulans 
EXF-150]
Length=199

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 37/73 (51%), Gaps = 2/73 (3%)
 Frame = +3

Query  27   GGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQC  206
            G  L G+SG AIWGS P++D  R  V+V TGN+Y+ P E   C    +      T    C
Sbjct  5    GSTLPGWSGNAIWGSQPSIDEARSQVFVATGNVYSVPPEYESCLTDTDANV--TTTNSTC  62

Query  207  FGPDVHFNSIMAL  245
                V   +I+AL
Sbjct  63   LPEGVLQEAIIAL  75



>gb|EWT01720.1| polyvinylalcohol dehydrogenase [Intrasporangium oryzae NRRL B-24470]
Length=521

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 10/81 (12%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
             T T+PD      GY+G ++WGS+PAVD  RG +Y+ TGN Y+ P     C ++  +   
Sbjct  216  STDTVPD------GYTGGSVWGSAPAVDFKRGSLYISTGNNYSIPASATACLSSAPDDVA  269

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
                   C      F++I++L
Sbjct  270  RA----ACIPASDMFDAIVSL  286



>ref|WP_009583585.1| exported putative alcohol dehydrogenase (acceptor) [Xanthomonas 
translucens]
 gb|EKU25904.1| exported putative alcohol dehydrogenase (acceptor) [Xanthomonas 
translucens pv. graminis ART-Xtg29]
Length=577

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (56%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   GYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDV  221
            GY+GAA+WG + A+D  R  VY  TGN Y+ P +V  C     N  G  T    C  PD 
Sbjct  268  GYTGAAVWG-TLALDPQRQRVYATTGNNYSVPLDVASC---VKNANGDKTAQLACLAPDN  323

Query  222  HFNSIMAL  245
            + +S++AL
Sbjct  324  YVDSVLAL  331



>ref|WP_034805109.1| hypothetical protein, partial [Intrasporangium oryzae]
Length=495

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 10/81 (12%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
             T T+PD      GY+G ++WGS+PAVD  RG +Y+ TGN Y+ P     C ++  +   
Sbjct  210  STDTVPD------GYTGGSVWGSAPAVDFKRGSLYISTGNNYSIPASATACLSSAPDDVA  263

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
                   C      F++I++L
Sbjct  264  RA----ACIPASDMFDAIVSL  280



>gb|KGE50571.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. vasculorum]
Length=576

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 10/84 (12%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQA-AQNNRT  179
            Q YT P+      GY+GA++WG   A+D +   +Y GTGN YN P++V  C + A++ R 
Sbjct  247  QFYTAPE------GYTGASVWGQV-AIDPINRRLYFGTGNNYNIPQDVGNCISNARSYRG  299

Query  180  GPPTGPDQ--CFGPDVHFNSIMAL  245
               T  D+  C  PD + +S+++L
Sbjct  300  SELTVQDELNCMAPDNYVDSVVSL  323



>ref|WP_014786651.1| PQQ enzyme repeat-containing protein [Terriglobus roseus]
 ref|YP_006422724.1| PQQ enzyme repeat-containing protein [Terriglobus roseus DSM 
18391]
 gb|AFL89389.1| PQQ enzyme repeat-containing protein [Terriglobus roseus DSM 
18391]
Length=514

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEV  146
            QTY  PDN G+   YSGAAIW S PA+D+ R  ++  TGN Y+ P  V
Sbjct  215  QTYMTPDNNGQPNQYSGAAIW-SPPAIDVGRNLLFTTTGNNYSVPSSV  261



>ref|WP_020735240.1| hypothetical protein [Sorangium cellulosum]
 ref|YP_008149714.1| hypothetical protein SCE1572_16470 [Sorangium cellulosum So0157-2]
 gb|AGP35952.1| hypothetical protein SCE1572_16470 [Sorangium cellulosum So0157-2]
Length=516

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 9/81 (11%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            Q Y +P       G++G A+WG +PA+D+ R  +YV TGN Y  P  V  C  A  +   
Sbjct  217  QRYLVP------AGFTGGAVWGGAPAIDLGRRTLYVATGNNYTVPPAVSACVEAAGDDA-  269

Query  183  PPTGPDQCFGPDVHFNSIMAL  245
                 + C   D + ++++AL
Sbjct  270  --LAVEACLPADNYIDAVLAL  288



>ref|WP_011257274.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae]
 ref|YP_198968.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae pv. oryzae 
KACC 10331]
 gb|AAW73583.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae pv. oryzae 
KACC 10331]
Length=509

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 48/84 (57%), Gaps = 10/84 (12%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            Q Y +P+      GY+GA++WG   A+D +   +Y GTGN YN P++V  C + + +  G
Sbjct  172  QFYNVPE------GYTGASVWGQV-AIDPINRRLYFGTGNNYNIPQDVGNCISNERSYRG  224

Query  183  PP-TGPDQ--CFGPDVHFNSIMAL  245
               T  D+  C  PD + +S+++L
Sbjct  225  SELTVQDELNCMAPDNYVDSVISL  248



>ref|XP_002974635.1| hypothetical protein SELMODRAFT_442585, partial [Selaginella 
moellendorffii]
 gb|EFJ24155.1| hypothetical protein SELMODRAFT_442585, partial [Selaginella 
moellendorffii]
Length=552

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 4/51 (8%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRC  155
            +T  +P+N      + G  +WGSSP++D  RG  ++GTGNLY  P +V  C
Sbjct  204  RTSMVPENSS----FYGVTVWGSSPSIDPKRGLAFIGTGNLYQIPSDVQDC  250



>ref|WP_039007026.1| polyvinylalcohol dehydrogenase [Xanthomonas translucens]
Length=577

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 37/68 (54%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   GYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTGPPTGPDQCFGPDV  221
            GY+GA++WG+  A+D  R  VY  TGN Y+ P  V  C     N  G  T    C  PD 
Sbjct  268  GYTGASVWGT-LAIDPQRQRVYATTGNNYSVPLNVASC---VKNANGDTTAQLACLAPDD  323

Query  222  HFNSIMAL  245
            + +S++AL
Sbjct  324  YVDSVLAL  331



>ref|WP_024743774.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae]
Length=576

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 48/84 (57%), Gaps = 10/84 (12%)
 Frame = +3

Query  3    QTYTLPDNGGKLGGYSGAAIWGSSPAVDILRGWVYVGTGNLYNAPEEVLRCQAAQNNRTG  182
            Q Y +P+      GY+GA++WG   A+D +   +Y GTGN YN P++V  C + + +  G
Sbjct  247  QFYNVPE------GYTGASVWGQV-AIDPINRRLYFGTGNNYNIPQDVGNCISNERSYRG  299

Query  183  PP-TGPDQ--CFGPDVHFNSIMAL  245
               T  D+  C  PD + +S+++L
Sbjct  300  SELTVQDELNCMAPDNYVDSVISL  323



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510865472736