BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c43226_g1_i1 len=616 path=[594:0-615]

Length=616
                                                                      Score     E

ref|XP_009772637.1|  PREDICTED: uncharacterized protein LOC104222986    129   7e-34   
ref|XP_009627030.1|  PREDICTED: uncharacterized protein LOC104117662    129   9e-34   
gb|KDO37239.1|  hypothetical protein CISIN_1g046358mg                 63.2    1e-09   
gb|KFK41232.1|  hypothetical protein AALP_AA2G103000                  60.8    1e-08   
ref|XP_006368028.1|  PREDICTED: repetitive proline-rich cell wall...  62.4    3e-08   
ref|XP_006415855.1|  hypothetical protein EUTSA_v10009029mg           54.7    2e-06   
ref|XP_010559232.1|  PREDICTED: uncharacterized protein LOC104827706  53.9    3e-06   
gb|KFK44532.1|  hypothetical protein AALP_AA1G268800                  53.9    3e-06   
emb|CDX81499.1|  BnaC02g18030D                                        53.1    8e-06   
ref|XP_009127614.1|  PREDICTED: uncharacterized protein LOC103852459  52.4    1e-05   
gb|EYU35669.1|  hypothetical protein MIMGU_mgv1a015417mg              52.0    2e-05   
ref|XP_010559233.1|  PREDICTED: phylloplanin-like                     51.2    3e-05   
ref|XP_006836618.1|  hypothetical protein AMTR_s00131p00117350        50.4    6e-05   
ref|XP_010326642.1|  PREDICTED: uncharacterized protein LOC104649359  50.4    2e-04   
ref|XP_006304617.1|  hypothetical protein CARUB_v10011696mg           49.3    2e-04   
gb|EYU35668.1|  hypothetical protein MIMGU_mgv1a015413mg              49.3    2e-04   
ref|XP_006289387.1|  hypothetical protein CARUB_v10002883mg           48.5    4e-04   



>ref|XP_009772637.1| PREDICTED: uncharacterized protein LOC104222986 [Nicotiana sylvestris]
Length=154

 Score =   129 bits (324),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = +3

Query  81   ANGVTINGQTVAGLWVRGVVACSTTGNLPGRGLAGVNVTIVCNGARTEALAQILTDVNGV  260
            A+GV INGQ V GL VRG++ CS TGN PG G+AGVNV I CNG  T +L Q+LTD NG 
Sbjct  24   AHGVLINGQNVIGLRVRGLLVCSATGNPPGPGIAGVNVKISCNGGST-SLVQVLTDANGY  82

Query  261  FNAILTALDGIAFDQSPTPCQAIVHTPIVGCDLLARPGLLRAVVTVAANlvqtvlglvat  440
            F  I+TALDGI FDQ+ TPCQ I+ TPI  C LLA  G LRA +T+   L+QT+LGLVA 
Sbjct  83   FQTIITALDGILFDQTTTPCQVIIDTPIASCSLLASTGTLRAPITLVGTLIQTLLGLVAD  142

Query  441  ttlgaFQFVPI  473
             T GAF  VPI
Sbjct  143  ATCGAFHLVPI  153



>ref|XP_009627030.1| PREDICTED: uncharacterized protein LOC104117662 [Nicotiana tomentosiformis]
Length=154

 Score =   129 bits (324),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = +3

Query  81   ANGVTINGQTVAGLWVRGVVACSTTGNLPGRGLAGVNVTIVCNGARTEALAQILTDVNGV  260
            A+GV INGQ V GL VRG++ CS TGN PG G+AGVNV I CNG  T +L Q+LTD NG 
Sbjct  24   AHGVLINGQNVIGLRVRGLLVCSATGNPPGPGIAGVNVKISCNGGST-SLVQVLTDANGY  82

Query  261  FNAILTALDGIAFDQSPTPCQAIVHTPIVGCDLLARPGLLRAVVTVAANlvqtvlglvat  440
            F  I+TALDGI FDQ+ TPCQ I+ TPI  C LLA  G LRA +T+   L+QT+LGLVA 
Sbjct  83   FQTIITALDGILFDQTTTPCQVIIDTPIASCSLLASTGTLRAPITLVGTLIQTLLGLVAD  142

Query  441  ttlgaFQFVPI  473
             T GAF  VPI
Sbjct  143  ATCGAFHLVPI  153



>gb|KDO37239.1| hypothetical protein CISIN_1g046358mg, partial [Citrus sinensis]
Length=116

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 7/92 (8%)
 Frame = +3

Query  126  VRGVVACSTTGN-LPG---RGLAGVNVTIVCNGARTEALAQILTDVNGVFNAILTALDGI  293
            + G V C+ +GN LPG    G+AG+NV + CNG  T+ +AQ LT+  G F+  L  LDG+
Sbjct  2    ITGTVFCTVSGNPLPGVSSPGIAGINVGVRCNGGTTD-IAQALTNSAGFFSVALNLLDGL  60

Query  294  AFDQSPTPCQAIVHTPIVGCDLLARPGLLRAV  389
             FD  P+ C   +  P+ GC LL   G L+AV
Sbjct  61   LFD--PSHCVVYIKLPVAGCALLPPTGSLQAV  90



>gb|KFK41232.1| hypothetical protein AALP_AA2G103000 [Arabis alpina]
Length=150

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 5/108 (5%)
 Frame = +3

Query  84   NGVTINGQTVAGLWVRGVVACSTTGNLPGRG--LAGVNVTIVCNGARTEALAQILTDVNG  257
            +G+ +NG  +  + + GV+ CS  GNL G    L+G  V +VC GART+ L Q++T+  G
Sbjct  23   HGLILNGLRIGSIKINGVLYCSFDGNLHGNSPPLSGAVVELVCAGARTD-LGQVVTNPAG  81

Query  258  VFNAILTALDGIAFDQSPTPCQAIVHTPIVGCDLLARPGLLRAVVTVA  401
            VF  ++  LD + FD  P+ C A ++ PI  C ++   G L A + +A
Sbjct  82   VFVILVKLLDTVLFD--PSICFARLNLPIATCAVIPPDGALTASLILA  127



>ref|XP_006368028.1| PREDICTED: repetitive proline-rich cell wall protein 2-like [Solanum 
tuberosum]
Length=415

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 58/99 (59%), Gaps = 4/99 (4%)
 Frame = +3

Query  114  AGLWVRGVVACSTTGNLPGRGLAGVNVTIVCNGARTEALAQILTDVNGVFNAILTALDGI  293
            A + +RGVV+CST+GN PG G+ GVNV I+C       LAQ++T+V G+ N  L+    I
Sbjct  296  ANITIRGVVSCSTSGNAPGPGIGGVNVAIICG---NTTLAQVITNVEGLINVTLSTNTNI  352

Query  294  AFDQSPT-PCQAIVHTPIVGCDLLARPGLLRAVVTVAAN  407
             F  + T  C A    PIV C +L   G+L+A + +  N
Sbjct  353  LFGNTSTLSCVARAALPIVNCTVLPTSGILQAPLMLVGN  391



>ref|XP_006415855.1| hypothetical protein EUTSA_v10009029mg [Eutrema salsugineum]
 gb|ESQ34208.1| hypothetical protein EUTSA_v10009029mg [Eutrema salsugineum]
Length=146

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (55%), Gaps = 3/102 (3%)
 Frame = +3

Query  81   ANGVTINGQTVAGLWVRGVVACSTTGNLPGRGLAGVNVTIVCNGARTEALAQILTDVNGV  260
            ++G+TING  +  L + GV+ C+   N     ++G  V++ C G+ T  LAQ +T+  G 
Sbjct  21   SHGLTINGIRIGTLEIDGVLRCTLNANTNAPPISGQTVSLRCAGSNTN-LAQAVTNPAGA  79

Query  261  FNAILTALDGIAFDQSPTPCQAIVHTPIVGCDLLARPGLLRA  386
            F  +L  +D +AFD  P+ C   V+ P+  C +    G+L A
Sbjct  80   FRVVLNIVDTLAFD--PSFCAIQVNLPVATCSVFPPDGVLTA  119



>ref|XP_010559232.1| PREDICTED: uncharacterized protein LOC104827706 [Tarenaya hassleriana]
Length=149

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 58/106 (55%), Gaps = 5/106 (5%)
 Frame = +3

Query  81   ANGVTINGQTVAGLWVRGVVACSTTGNLPGRG--LAGVNVTIVCNGARTEALAQILTDVN  254
            ++ +TING  +A + V G++ C+ +GNL G G  ++G    + C GA T  LAQ +T+  
Sbjct  21   SHALTINGIQIATVNVTGLLTCALSGNLVGNGPPVSGAIAVLSCGGANTN-LAQAITNPA  79

Query  255  GVFNAILTALDGIAFDQSPTPCQAIVHTPIVGCDLLARPGLLRAVV  392
            GVF  IL  LD   FD  P+ C   V+ P+  C +    G L + +
Sbjct  80   GVFTVILRILDTTIFD--PSRCFIRVNLPVATCSVFPPNGALTSAI  123



>gb|KFK44532.1| hypothetical protein AALP_AA1G268800 [Arabis alpina]
Length=146

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 58/108 (54%), Gaps = 3/108 (3%)
 Frame = +3

Query  81   ANGVTINGQTVAGLWVRGVVACSTTGNLPGRGLAGVNVTIVCNGARTEALAQILTDVNGV  260
            ++G+ +NG  +  + +RGV+ C+   NL    ++   V I C G+ T  L Q +TD+ G 
Sbjct  21   SHGLYLNGLRIGTISIRGVLHCTLNANLNAPPVSAQTVFIKCAGSSTN-LGQAVTDITGA  79

Query  261  FNAILTALDGIAFDQSPTPCQAIVHTPIVGCDLLARPGLLRAVVTVAA  404
            +  ++  +D + FD S   C+ +V  P+  C +    G+L A +++ +
Sbjct  80   YTVVIRVVDTLVFDAS--SCRVVVVLPVATCAVFPPDGVLTASISLVS  125



>emb|CDX81499.1| BnaC02g18030D [Brassica napus]
Length=150

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = +3

Query  84   NGVTINGQTVAGLWVRGVVACSTTGNLPGRG--LAGVNVTIVCNGARTEALAQILTDVNG  257
            +G+ +NG  +  + V GV+ CS  GNL G    L+G  V + C G++T  L Q LT+  G
Sbjct  23   HGLLLNGLQIGAVRVNGVLFCSLDGNLRGNSPPLSGAIVQLSCAGSQTN-LGQALTNPAG  81

Query  258  VFNAILTALDGIAFDQSPTPCQAIVHTPIVGCDLLARPGLLRAVVTV  398
             F  ++  LD I FD  P+ C   V+ P+  C +    G L A + +
Sbjct  82   AFVVLVRILDTILFD--PSSCFVRVNLPVATCSVFPPDGALTASINL  126



>ref|XP_009127614.1| PREDICTED: uncharacterized protein LOC103852459 [Brassica rapa]
 emb|CDY12700.1| BnaA02g13680D [Brassica napus]
Length=150

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 55/106 (52%), Gaps = 5/106 (5%)
 Frame = +3

Query  87   GVTINGQTVAGLWVRGVVACSTTGNLPGRG--LAGVNVTIVCNGARTEALAQILTDVNGV  260
            G+ +NG  +  + V GV+ CS  GNL G    L+G  V + C G++T  L Q LT+  G 
Sbjct  24   GLLLNGLQIGAVRVNGVLFCSLDGNLRGNSPPLSGAIVQLSCAGSQTN-LGQALTNPAGA  82

Query  261  FNAILTALDGIAFDQSPTPCQAIVHTPIVGCDLLARPGLLRAVVTV  398
            F  ++  LD I FD  P+ C   V+ P+  C +    G L A + +
Sbjct  83   FVVLVRILDTILFD--PSSCFVRVNLPVATCSVFPPDGALTASINL  126



>gb|EYU35669.1| hypothetical protein MIMGU_mgv1a015417mg [Erythranthe guttata]
Length=158

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 5/100 (5%)
 Frame = +3

Query  108  TVAGLWVRGVVACSTTGNLPGRGLAGVNVTIVCN--GARTEALAQILTDVNGVFNAILTA  281
            TV GL V G + C+ T N PG+G+AGV V++ C   G     L   +T+VNG FN  + A
Sbjct  32   TVRGLTVNGSLCCTPTANCPGQGVAGVPVSLNCTIVGVGARVLGSGITNVNGSFNITVPA  91

Query  282  LDGIAFDQSPTPCQAIVHTPI--VGCDLL-ARPGLLRAVV  392
            + G+       PC   V  P+  V C +L A  G+L A V
Sbjct  92   ITGLILGLPMLPCVVTVQLPLSPVVCPVLNATTGILAATV  131



>ref|XP_010559233.1| PREDICTED: phylloplanin-like [Tarenaya hassleriana]
Length=150

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 56/107 (52%), Gaps = 6/107 (6%)
 Frame = +3

Query  84   NGVTINGQTVAGLWVRGVVACSTTGNLPGRG--LAGVNVTIVCNGARTEALAQILTDVNG  257
            +G+ +NG  +  + + G++ CS  GNL      L G  V++ C G RTE L Q LTD  G
Sbjct  24   HGLKLNGLEIGSVRINGLLYCSVNGNLIRNSAPLPGALVSLSC-GGRTE-LGQALTDPAG  81

Query  258  VFNAILTALDGIAFDQSPTPCQAIVHTPIVGCDLLARPGLLRAVVTV  398
             F  ++  LD I FD  P+ C   V+ P   C +    G+L A +++
Sbjct  82   AFTVVVKLLDTILFD--PSRCFINVNLPGADCSVFPPDGVLTASLSL  126



>ref|XP_006836618.1| hypothetical protein AMTR_s00131p00117350 [Amborella trichopoda]
 gb|ERM99471.1| hypothetical protein AMTR_s00131p00117350 [Amborella trichopoda]
Length=145

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 51/105 (49%), Gaps = 5/105 (5%)
 Frame = +3

Query  90   VTINGQTVAGLWVRGVVACSTTGNL-PG-RGLAGVNVTIVCNGARTEALAQILTDVNGVF  263
            + +NG T+    + G + CS +GN  PG  G+    V +VC GA    +  + T  NG +
Sbjct  25   LKVNGITITTGHIDGFLYCSKSGNQEPGASGIPRTPVEVVC-GAANATITSVFTQPNGAY  83

Query  264  NAILTALDGIAFDQSPTPCQAIVHTPIVGCDLLARPGLLRAVVTV  398
                  LD   FD  P+ C   ++ PIV C LL   G+LR  + V
Sbjct  84   VFTFNLLDTALFD--PSTCYIKINLPIVSCTLLPTSGILRGPIVV  126



>ref|XP_010326642.1| PREDICTED: uncharacterized protein LOC104649359 [Solanum lycopersicum]
Length=203

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 6/96 (6%)
 Frame = +3

Query  120  LWVRGVVACSTTGNLPGRGLAGVNVTIVCNGARTEALAQILTDVNGVFNAILTALDGIAF  299
            + + G+++CS  G  PG G++GVNV+I+C  +    +AQ +T+  G+F+  L     I  
Sbjct  86   ITIAGILSCSLPGTAPGPGISGVNVSIICGNST---IAQAVTNSQGIFSVSLNTNTSILS  142

Query  300  DQSPTPCQAIVHTPIVGCDLLARPGLLRAVVTVAAN  407
              +   C A V  PI GC L    G L+A + +  N
Sbjct  143  GNT---CIARVGLPIAGCTLFPISGALQAPIMIIGN  175



>ref|XP_006304617.1| hypothetical protein CARUB_v10011696mg [Capsella rubella]
 gb|EOA37515.1| hypothetical protein CARUB_v10011696mg [Capsella rubella]
Length=145

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 55/107 (51%), Gaps = 3/107 (3%)
 Frame = +3

Query  72   AHDANGVTINGQTVAGLWVRGVVACSTTGNLPGRGLAGVNVTIVCNGARTEALAQILTDV  251
            A  ++G+ I+G  +  + +RGV+ C+ TG+L    ++   + + CNG R   + Q++T+ 
Sbjct  18   ASLSHGLLISGLQIQTIEIRGVLRCTLTGDLNAPPVSAATLFVTCNG-RETTIPQVVTNP  76

Query  252  NGVFNAILTALDGIAFDQSPTPCQAIVHTPIVGCDLLARPGLLRAVV  392
             G F  ++  L    F+  P+ C+  V  P+  C +    G L + V
Sbjct  77   AGTFAILVNILATSLFN--PSDCRVTVRLPVATCSVFPPDGFLTSTV  121



>gb|EYU35668.1| hypothetical protein MIMGU_mgv1a015413mg [Erythranthe guttata]
Length=158

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 7/105 (7%)
 Frame = +3

Query  99   NGQ--TVAGLWVRGVVACSTTGNLPGRGLAGVNVTIVCN--GARTEALAQILTDVNGVFN  266
            NGQ  T+ GL V G + C+ + N PG+G++G+ V++ C   G     L   +T+VNG FN
Sbjct  27   NGQVVTLRGLTVNGSLCCTPSANCPGQGVSGIPVSLNCTIVGVGARVLGSGITNVNGSFN  86

Query  267  AILTALDGIAFDQSPTPCQAIVHTPI--VGCDLL-ARPGLLRAVV  392
              + A+ G+       PC   V  P+  V C ++ A  G+L A V
Sbjct  87   ITVPAITGLILGLPMLPCVVTVQLPLSPVVCPVINATTGILAATV  131



>ref|XP_006289387.1| hypothetical protein CARUB_v10002883mg [Capsella rubella]
 gb|EOA22285.1| hypothetical protein CARUB_v10002883mg [Capsella rubella]
Length=151

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 3/87 (3%)
 Frame = +3

Query  126  VRGVVACSTTGNLPGRGLAGVNVTIVCNGARTEALAQILTDVNGVFNAILTALDGIAFDQ  305
            +RG V CS TG+     ++   V +VC G+ T  LAQ LTD NG F  +L AL  +    
Sbjct  40   IRGDVTCSLTGDPNAPPVSNAKVLLVCAGSSTP-LAQALTDTNGTFVFVLNALKAVLI--  96

Query  306  SPTPCQAIVHTPIVGCDLLARPGLLRA  386
             P  C  +V+ P   C+L    G+L A
Sbjct  97   RPDICGVVVNLPAGTCELYPPDGILTA  123



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 807801807960