BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c43109_g1_i1 len=337 path=[1:0-336]

Length=337
                                                                      Score     E

ref|XP_003628979.1|  Defensin                                         48.9    2e-05   
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            47.8    9e-05   
gb|KHN06998.1|  Defensin-like protein                                 47.0    1e-04   
ref|XP_003629332.1|  Defensin                                         46.6    1e-04   
gb|ACN93800.1|  defensin precursor                                    44.3    8e-04   Vigna unguiculata



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +3

Query  3    ILFLMLLCSTEIGPTISAEAK--QVRCIGKKRWCLSDKHCNSMCRADGLCSGRCSELKQC  176
             +F +LL +TE+GP + AEA+  +      K  C+SD +C S+C+ +G   G C   +Q 
Sbjct  12   FVFFLLLVATEMGPIMVAEARTCETPSNNFKGLCVSDTNCASVCQTEGFPGGHCEGFRQR  71

Query  177  CCSTEP  194
            C  T+P
Sbjct  72   CFCTKP  77



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +3

Query  3    ILFLMLLCSTEIGPTISAEAK--QVRCIGKKRWCLSDKHCNSMCRADGLCSGRCSEL-KQ  173
             + L+LL +TE+GPT+ AEA+  + +    K  CLSD +C S+CR +G   G C    ++
Sbjct  12   FVLLLLLIATEMGPTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSRR  71

Query  174  CCCSTE  191
            C C+ E
Sbjct  72   CFCTKE  77



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +3

Query  3    ILFLMLLCSTEIGPTISAEAK--QVRCIGKKRWCLSDKHCNSMCRADGLCSGRCSEL-KQ  173
             + L+LL +TE+GPT+ AEA+  + +    K  CLSD +C S+CR +G   G C    ++
Sbjct  12   FVLLLLLIATEMGPTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSRR  71

Query  174  CCCSTE  191
            C C+ E
Sbjct  72   CFCTKE  77



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 6/68 (9%)
 Frame = +3

Query  3    ILFLMLLCSTEIGPTISAEAKQVRCIGK----KRWCLSDKHCNSMCRADGLCSGRCSELK  170
             LFL++L +TE+G  +  EA+  +C+ +    K  CLSD++C ++C  +G   GRC   +
Sbjct  12   FLFLLVLVATEMGSIMVVEAR--KCLSQSHSFKGLCLSDQNCATVCLTEGFTDGRCRGFR  69

Query  171  QCCCSTEP  194
            Q C  ++P
Sbjct  70   QRCFCSKP  77



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +3

Query  3    ILFLMLLCSTEIGPTISAEAK--QVRCIGKKRWCLSDKHCNSMCRADGLCSGRCSELKQC  176
             +FL+LL +TE+GPT+ AEA+  + +    K  C+SD +C S+CR +    G C   ++ 
Sbjct  12   FVFLLLLVATEMGPTMVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRRR  71

Query  177  C  179
            C
Sbjct  72   C  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 528301920064