BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c43022_g1_i1 len=718 path=[1:0-717]

Length=718
                                                                      Score     E

ref|XP_006354592.1|  PREDICTED: putative acyl-activating enzyme 1...    312   7e-96   
ref|XP_006354591.1|  PREDICTED: putative acyl-activating enzyme 1...    311   7e-95   
ref|XP_009764905.1|  PREDICTED: putative acyl-activating enzyme 1...    310   2e-94   
ref|XP_006354589.1|  PREDICTED: putative acyl-activating enzyme 1...    311   2e-94   
ref|XP_009764904.1|  PREDICTED: putative acyl-activating enzyme 1...    310   3e-94   
ref|XP_009764903.1|  PREDICTED: putative acyl-activating enzyme 1...    310   5e-94   
ref|XP_009764902.1|  PREDICTED: putative acyl-activating enzyme 1...    310   5e-94   
ref|XP_009764901.1|  PREDICTED: putative acyl-activating enzyme 1...    310   5e-94   
ref|XP_010323230.1|  PREDICTED: putative acyl-activating enzyme 1...    303   2e-92   
ref|XP_009608911.1|  PREDICTED: putative acyl-activating enzyme 1...    304   2e-92   
ref|XP_009608910.1|  PREDICTED: putative acyl-activating enzyme 1...    304   4e-92   
ref|XP_009608905.1|  PREDICTED: putative acyl-activating enzyme 1...    304   8e-92   
ref|XP_009608907.1|  PREDICTED: putative acyl-activating enzyme 1...    304   8e-92   
ref|XP_009608909.1|  PREDICTED: putative acyl-activating enzyme 1...    304   9e-92   
ref|XP_010323220.1|  PREDICTED: putative acyl-activating enzyme 1...    302   1e-91   
ref|XP_010323214.1|  PREDICTED: putative acyl-activating enzyme 1...    302   1e-91   
ref|XP_010323225.1|  PREDICTED: putative acyl-activating enzyme 1...    301   2e-91   
ref|XP_010323208.1|  PREDICTED: putative acyl-activating enzyme 1...    302   2e-91   
ref|XP_010323201.1|  PREDICTED: putative acyl-activating enzyme 1...    302   3e-91   
ref|XP_010323205.1|  PREDICTED: putative acyl-activating enzyme 1...    302   4e-91   
ref|XP_010323192.1|  PREDICTED: putative acyl-activating enzyme 1...    302   4e-91   
ref|XP_010323195.1|  PREDICTED: putative acyl-activating enzyme 1...    302   4e-91   
ref|XP_011093430.1|  PREDICTED: putative acyl-activating enzyme 19      300   2e-90   
ref|XP_010661305.1|  PREDICTED: putative acyl-activating enzyme 1...    299   5e-90   
ref|XP_002265371.1|  PREDICTED: putative acyl-activating enzyme 1...    299   5e-90   Vitis vinifera
emb|CAN59828.1|  hypothetical protein VITISV_014234                     266   5e-85   Vitis vinifera
gb|EYU24460.1|  hypothetical protein MIMGU_mgv1a0196452mg               278   2e-84   
ref|XP_010679069.1|  PREDICTED: putative acyl-activating enzyme 19      270   9e-80   
ref|XP_006354590.1|  PREDICTED: putative acyl-activating enzyme 1...    269   2e-79   
emb|CDP09317.1|  unnamed protein product                                268   3e-79   
gb|KCW76684.1|  hypothetical protein EUGRSUZ_D01046                     264   3e-78   
ref|XP_008232133.1|  PREDICTED: putative acyl-activating enzyme 19      266   3e-78   
ref|XP_007029808.1|  AMP-dependent synthetase and ligase family p...    262   3e-78   
ref|XP_007220064.1|  hypothetical protein PRUPE_ppa025823mg             264   5e-78   
ref|XP_010661306.1|  PREDICTED: putative acyl-activating enzyme 1...    263   2e-77   
ref|XP_010052601.1|  PREDICTED: putative acyl-activating enzyme 19      263   2e-77   
gb|KDO42619.1|  hypothetical protein CISIN_1g0026152mg                  259   6e-77   
ref|XP_007029807.1|  AMP-dependent synthetase and ligase family p...    261   1e-76   
gb|KDO42618.1|  hypothetical protein CISIN_1g0026152mg                  259   1e-76   
gb|EYU42289.1|  hypothetical protein MIMGU_mgv1a0007031mg               253   2e-76   
ref|XP_006484719.1|  PREDICTED: putative acyl-activating enzyme 1...    260   2e-76   
ref|XP_009361407.1|  PREDICTED: putative acyl-activating enzyme 1...    260   3e-76   
ref|XP_009361406.1|  PREDICTED: putative acyl-activating enzyme 1...    260   3e-76   
gb|AET02133.2|  AMP-dependent synthetase and ligase family protein      256   9e-75   
ref|XP_010556078.1|  PREDICTED: LOW QUALITY PROTEIN: putative acy...    253   2e-74   
ref|XP_010556089.1|  PREDICTED: putative acyl-activating enzyme 19      251   7e-74   
ref|XP_002325887.2|  hypothetical protein POPTR_0019s06060g             252   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_008457169.1|  PREDICTED: putative acyl-activating enzyme 1...    251   5e-73   
ref|XP_004510927.1|  PREDICTED: putative acyl-activating enzyme 1...    251   5e-73   
ref|XP_008457170.1|  PREDICTED: putative acyl-activating enzyme 1...    250   5e-73   
ref|XP_008457168.1|  PREDICTED: putative acyl-activating enzyme 1...    251   7e-73   
ref|XP_008457167.1|  PREDICTED: putative acyl-activating enzyme 1...    251   8e-73   
ref|XP_004138998.1|  PREDICTED: putative acyl-activating enzyme 1...    250   1e-72   
gb|EPS71901.1|  hypothetical protein M569_02857                         243   3e-72   
gb|KDP39582.1|  hypothetical protein JCGZ_02602                         244   4e-72   
emb|CDY65676.1|  BnaCnng48170D                                          247   1e-71   
ref|XP_011012746.1|  PREDICTED: putative acyl-activating enzyme 1...    246   1e-71   
ref|XP_011012745.1|  PREDICTED: putative acyl-activating enzyme 1...    246   2e-71   
ref|XP_011012743.1|  PREDICTED: putative acyl-activating enzyme 1...    246   6e-71   
ref|XP_004307155.1|  PREDICTED: putative acyl-activating enzyme 1...    244   9e-71   
ref|XP_010097707.1|  Putative acyl-activating enzyme 19                 243   2e-70   
ref|XP_010942743.1|  PREDICTED: putative acyl-activating enzyme 19      242   8e-70   
ref|XP_002870455.1|  hypothetical protein ARALYDRAFT_330218             240   3e-69   
ref|NP_198442.2|  AMP-dependent synthetase and ligase family protein    239   4e-69   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA97455.1|  unnamed protein product                                240   5e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268208.1|  PREDICTED: putative acyl-activating enzyme 1...    239   6e-69   
ref|XP_010268210.1|  PREDICTED: putative acyl-activating enzyme 1...    239   7e-69   
ref|XP_010268211.1|  PREDICTED: putative acyl-activating enzyme 1...    238   7e-69   
ref|XP_003627657.1|  Acetyl-coenzyme A synthetase                       239   9e-69   
gb|AAM20623.1|  unknown protein                                         238   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29611.1|  hypothetical protein AALP_AA7G156500                    238   1e-68   
ref|XP_010268207.1|  PREDICTED: putative acyl-activating enzyme 1...    238   2e-68   
ref|XP_010268206.1|  PREDICTED: putative acyl-activating enzyme 1...    238   2e-68   
ref|XP_007134908.1|  hypothetical protein PHAVU_010G085900g             235   1e-67   
ref|XP_010435476.1|  PREDICTED: putative acyl-activating enzyme 19      236   1e-67   
ref|XP_008775823.1|  PREDICTED: putative acyl-activating enzyme 1...    236   1e-67   
emb|CDY41755.1|  BnaA08g07100D                                          235   2e-67   
ref|XP_006283033.1|  hypothetical protein CARUB_v10004025mg             235   2e-67   
ref|XP_009108010.1|  PREDICTED: putative acyl-activating enzyme 19      235   2e-67   
gb|KHN04088.1|  Putative acyl-activating enzyme 19                      233   1e-66   
ref|XP_006395926.1|  hypothetical protein EUTSA_v10003545mg             233   2e-66   
ref|XP_006576398.1|  PREDICTED: putative acyl-activating enzyme 1...    227   6e-65   
ref|XP_006576397.1|  PREDICTED: putative acyl-activating enzyme 1...    227   8e-65   
ref|XP_006576396.1|  PREDICTED: putative acyl-activating enzyme 1...    227   2e-64   
ref|XP_009415280.1|  PREDICTED: putative acyl-activating enzyme 1...    226   4e-64   
ref|XP_002524008.1|  AMP dependent ligase, putative                     226   4e-64   Ricinus communis
ref|XP_006576395.1|  PREDICTED: putative acyl-activating enzyme 1...    226   5e-64   
emb|CAN82109.1|  hypothetical protein VITISV_002742                     212   5e-64   Vitis vinifera
ref|XP_009415272.1|  PREDICTED: putative acyl-activating enzyme 1...    226   6e-64   
ref|XP_009415264.1|  PREDICTED: putative acyl-activating enzyme 1...    226   7e-64   
dbj|BAK03819.1|  predicted protein                                      223   8e-64   
dbj|BAK03714.1|  predicted protein                                      223   1e-63   
gb|EMT03524.1|  Acyl-CoA synthetase family member 4                     222   9e-63   
ref|NP_001056587.2|  Os06g0111600                                       218   1e-61   Oryza sativa Japonica Group [Japonica rice]
gb|EEE64969.1|  hypothetical protein OsJ_19865                          218   3e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561146.1|  PREDICTED: putative acyl-activating enzyme 19      217   1e-60   
gb|EEC83401.1|  hypothetical protein OsI_28845                          216   1e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_004966593.1|  PREDICTED: putative acyl-activating enzyme 1...    216   2e-60   
gb|EMS56380.1|  Acyl-CoA synthetase family member 4                     214   7e-60   
gb|AFW86153.1|  hypothetical protein ZEAMMB73_432269                    212   2e-59   
gb|AFW86152.1|  hypothetical protein ZEAMMB73_432269                    212   2e-59   
ref|XP_008659375.1|  PREDICTED: putative acyl-activating enzyme 19      212   6e-59   
gb|AFW86151.1|  hypothetical protein ZEAMMB73_432269                    211   7e-59   
ref|XP_006655708.1|  PREDICTED: putative acyl-activating enzyme 1...    210   8e-59   
ref|XP_011012744.1|  PREDICTED: putative acyl-activating enzyme 1...    211   8e-59   
gb|EMT29437.1|  Acyl-CoA synthetase family member 4                     208   1e-57   
ref|XP_002437697.1|  hypothetical protein SORBIDRAFT_10g001030          207   2e-57   Sorghum bicolor [broomcorn]
ref|XP_008775824.1|  PREDICTED: putative acyl-activating enzyme 1...    199   2e-55   
gb|KGN61419.1|  hypothetical protein Csa_2G120130                       194   2e-54   
ref|XP_006854069.1|  hypothetical protein AMTR_s00048p00109480          197   7e-54   
ref|XP_002975786.1|  hypothetical protein SELMODRAFT_103915             158   4e-40   
ref|XP_002973737.1|  hypothetical protein SELMODRAFT_149203             157   1e-39   
ref|XP_006437382.1|  hypothetical protein CICLE_v100305621mg            144   7e-36   
ref|XP_001763026.1|  predicted protein                                  138   3e-33   
ref|WP_007358387.1|  MULTISPECIES: multifunctional peptide synthe...    136   2e-32   
ref|WP_016862252.1|  hypothetical protein                               131   1e-30   
ref|WP_038341182.1|  hypothetical protein                               127   1e-30   
ref|WP_017308737.1|  hypothetical protein                               130   3e-30   
gb|AIE12107.1|  putative NRPS/PKS hybrid synthase module E2C            129   5e-30   
ref|WP_027841528.1|  non-ribosomal peptide synthetase                   129   7e-30   
ref|WP_007358381.1|  MULTISPECIES: non-ribosomal peptide synthase...    129   8e-30   
gb|AEQ38168.1|  AnaC                                                    125   1e-29   
ref|WP_036709312.1|  peptide synthetase                                 124   3e-29   
ref|WP_017332089.1|  hypothetical protein                               127   3e-29   
ref|WP_024094051.1|  putative non-ribosomal peptide ligase domain...    126   5e-29   
ref|WP_017249069.1|  peptide synthetase                                 125   7e-29   
gb|AHZ46177.1|  NRPS                                                    125   8e-29   
ref|WP_020955897.1|  bmyC protein                                       126   8e-29   
ref|WP_007727245.1|  peptide synthetase                                 125   1e-28   
ref|WP_012704165.1|  amino acid adenylation domain-containing pro...    126   1e-28   
gb|AHH86044.1|  NRPS                                                    125   1e-28   
ref|WP_023067603.1|  linear gramicidin synthase subunit D               125   1e-28   
ref|WP_017307797.1|  hypothetical protein                               125   1e-28   
ref|WP_032864292.1|  hypothetical protein                               124   2e-28   
gb|ENW97168.1|  hypothetical protein F904_00001                         124   2e-28   
ref|WP_023356939.1|  bmyC                                               125   2e-28   
ref|WP_032863998.1|  peptide synthetase                                 125   2e-28   
ref|WP_007410142.1|  MULTISPECIES: peptide synthetase                   125   2e-28   
ref|WP_032865983.1|  peptide synthetase                                 125   2e-28   
ref|WP_014418046.1|  peptide synthetase                                 125   2e-28   
ref|WP_025650130.1|  peptide synthetase                                 125   2e-28   
ref|WP_014721312.1|  peptide synthetase                                 125   2e-28   
ref|WP_038463942.1|  peptide synthetase                                 125   2e-28   
ref|WP_029973834.1|  MULTISPECIES: peptide synthetase                   125   2e-28   
ref|WP_038458177.1|  peptide synthetase                                 125   2e-28   
ref|WP_022553270.1|  Non-ribosomal peptide synthetase BmyC involv...    125   2e-28   
ref|WP_017417901.1|  peptide synthetase                                 125   2e-28   
ref|WP_021493394.1|  peptide synthetase                                 125   2e-28   
ref|WP_012117677.1|  peptide synthetase                                 125   2e-28   
gb|ERH33922.1|  hypothetical protein SEQU_13405                         124   2e-28   
ref|WP_039063176.1|  peptide synthetase                                 125   2e-28   
gb|ETK26989.1|  putative non-ribosomal peptide ligase domain protein    124   2e-28   
gb|AAG16975.1|  micrococcin P1 peptide synthetase                       124   2e-28   Staphylococcus equorum subsp. equorum
ref|WP_018670344.1|  tyrocidine synthase 3                              124   2e-28   
ref|WP_039754091.1|  amino acid adenylation                             124   3e-28   
gb|AAN07014.1|  bacillomycin D synthetase C                             124   3e-28   Bacillus subtilis
ref|WP_007611810.1|  MULTISPECIES: peptide synthetase                   124   3e-28   
ref|WP_031412349.1|  tyrocidine synthase 3                              124   3e-28   
ref|WP_035318261.1|  tyrocidine synthase 3                              124   3e-28   
emb|CCF13110.1|  thioester reductase domain protein                     124   3e-28   
ref|WP_016743545.1|  peptide synthetase                                 123   4e-28   
ref|WP_032871594.1|  peptide synthetase                                 124   4e-28   
ref|WP_024836459.1|  AMP-dependent synthetase                           120   4e-28   
ref|WP_026735861.1|  non-ribosomal peptide synthetase                   124   4e-28   
ref|WP_033334827.1|  hypothetical protein                               123   5e-28   
ref|WP_026723918.1|  peptide synthetase                                 123   6e-28   
ref|WP_003343652.1|  tyrocidine synthase 3                              123   6e-28   
ref|WP_031414820.1|  tyrocidine synthase 3                              123   6e-28   
ref|WP_015891488.1|  peptide synthetase                                 122   7e-28   
gb|AIG27345.1|  NRPS domain-containing protein                          123   8e-28   
ref|WP_036486323.1|  peptide synthetase                                 123   8e-28   
ref|WP_016872029.1|  hypothetical protein                               122   8e-28   
ref|WP_038074856.1|  hypothetical protein                               122   9e-28   
ref|WP_020619068.1|  hypothetical protein                               123   1e-27   
ref|WP_017348402.1|  hypothetical protein                               122   1e-27   
ref|WP_015802446.1|  amino acid adenylation domain-containing pro...    123   1e-27   
ref|WP_022584750.1|  bacitracin synthetase                              123   1e-27   
gb|ETR73595.1|  Amino acid adenylation domain protein                   122   1e-27   
gb|AFG19377.1|  bacillomycin D synthetase C                             122   1e-27   
ref|WP_007954885.1|  thioester reductase                                122   1e-27   
ref|WP_002107057.1|  amino acid adenylation domain-containing pro...    122   1e-27   
ref|WP_024346166.1|  AMP-dependent synthetase [                         119   2e-27   
ref|WP_026796176.1|  MULTISPECIES: proline adenylation protein          119   2e-27   
ref|WP_024294535.1|  MULTISPECIES: AMP-dependent synthetase             119   2e-27   
ref|WP_031463447.1|  bacitracin synthetase                              122   2e-27   
gb|KIE09998.1|  non-ribosomal peptide synthetase                        121   2e-27   
ref|WP_016862258.1|  hypothetical protein                               121   2e-27   
gb|AIG26884.1|  NRPS domain-containing protein                          122   3e-27   
ref|WP_036693983.1|  hypothetical protein                               117   3e-27   
ref|WP_013310169.1|  bacitracin synthetase                              122   3e-27   
ref|WP_022586658.1|  tyrocidine synthase 3                              121   3e-27   
ref|WP_015181756.1|  amino acid adenylation enzyme/thioester redu...    121   3e-27   
ref|WP_010789735.1|  Long-chain-fatty-acid--CoA ligase                  121   3e-27   
ref|WP_016866928.1|  hypothetical protein                               121   3e-27   
ref|WP_004430165.1|  MULTISPECIES: peptide synthetase                   121   3e-27   
ref|WP_003339532.1|  bacitracin synthetase                              122   3e-27   
ref|WP_013428515.1|  non-ribosomal peptide synthetase module            121   3e-27   
ref|WP_038279567.1|  AMP-dependent synthetase [                         118   3e-27   
ref|WP_018670730.1|  gramicidin synthetase                              121   4e-27   
ref|WP_015217385.1|  amino acid adenylation domain protein              120   4e-27   
ref|WP_014281409.1|  bacitracin synthetase                              121   4e-27   
ref|WP_019735700.1|  thioester reductase                                121   4e-27   
ref|WP_010073955.1|  thioester reductase                                121   4e-27   
ref|WP_003340234.1|  gramicidin synthetase                              120   5e-27   
ref|WP_022586906.1|  gramicidin synthetase                              120   6e-27   
ref|WP_039275992.1|  bacitracin synthetase                              121   6e-27   
ref|WP_036812040.1|  hypothetical protein                               120   6e-27   
ref|WP_014599760.1|  bacitracin synthetase                              120   6e-27   
ref|WP_015217386.1|  amino acid adenylation domain protein              120   6e-27   
ref|WP_013371211.1|  bacitracin synthetase                              120   6e-27   
gb|AIG26966.1|  NRPS domain-containing protein                          120   6e-27   
gb|ABW93503.1|  peptide synthetase                                      120   6e-27   Nostoc sp. IO-102-I
ref|WP_036775858.1|  hypothetical protein                               120   6e-27   
gb|AIG28061.1|  NRPS domain-containing protein                          120   7e-27   
gb|EEK53290.1|  hypothetical protein bcere0004_54390                    120   7e-27   Bacillus cereus BGSC 6E1
ref|WP_000471551.1|  hypothetical protein                               120   7e-27   
ref|WP_000471552.1|  hypothetical protein                               120   8e-27   
ref|WP_022586513.1|  tyrocidine synthase 3                              120   8e-27   
ref|WP_007430353.1|  Bacitracin synthetase 1                            120   9e-27   
ref|WP_003339349.1|  phenylalanine racemase                             120   9e-27   
ref|WP_009454436.1|  amino acid adenylation domain protein              120   9e-27   
ref|WP_012294870.1|  polyketide synthase                                120   9e-27   
ref|WP_031463547.1|  hypothetical protein                               120   9e-27   
ref|WP_035951842.1|  hypothetical protein                               120   9e-27   
ref|WP_015351678.1|  non-ribosomal peptide synthetase                   120   1e-26   
ref|WP_036216701.1|  polyketide synthase                                120   1e-26   
ref|WP_036163982.1|  polyketide synthase                                120   1e-26   
ref|WP_006037690.1|  amino acid adenylation domain protein              120   1e-26   
ref|WP_036636159.1|  bacitracin synthetase                              120   1e-26   
ref|WP_017491075.1|  hypothetical protein                               119   1e-26   
ref|WP_011320550.1|  amino acid adenylation protein                     119   1e-26   
ref|WP_038978246.1|  bacitracin synthetase                              120   1e-26   
ref|WP_021728618.1|  putative non-ribosomal peptide synthase            119   1e-26   
gb|ACM79806.1|  ZmaB                                                    119   1e-26   Bacillus cereus
ref|WP_003301872.1|  lichenysin synthetase                              119   1e-26   
ref|WP_015149442.1|  amino acid adenylation enzyme/thioester redu...    119   1e-26   
ref|WP_015139593.1|  amino acid adenylation enzyme/thioester redu...    118   1e-26   
gb|EFY08362.1|  AMP-binding enzyme                                      116   2e-26   
ref|WP_029951781.1|  hypothetical protein                               119   2e-26   
ref|WP_002511955.1|  peptide synthetase                                 119   2e-26   
ref|WP_009672437.1|  MULTISPECIES: surfactin synthetase, subunit 2      119   2e-26   
ref|WP_002101727.1|  lichenysin synthetase                              119   2e-26   
ref|WP_002182143.1|  lichenysin synthetase                              119   2e-26   
ref|WP_019545185.1|  hypothetical protein                               116   2e-26   
ref|WP_039269003.1|  bacitracin synthetase                              119   2e-26   
ref|WP_034886863.1|  AMP-dependent synthetase                           116   2e-26   
ref|WP_004624905.1|  amino acid adenylation domain protein [            119   2e-26   
ref|WP_014213229.1|  amino acid adenylation enzyme/thioester redu...    119   2e-26   
gb|AHM65910.1|  bacillorin synthetase b                                 119   2e-26   
ref|WP_017744607.1|  hypothetical protein                               119   2e-26   
ref|WP_036057017.1|  hypothetical protein                               119   2e-26   
ref|WP_015924499.1|  amino acid adenylation protein [                   119   2e-26   
gb|EUA15063.1|  amino acid adenylation domain protein                   119   2e-26   
gb|KIE11768.1|  peptide synthetase                                      119   2e-26   
gb|AAN28671.1|  peptide synthetase                                      117   2e-26   Fischerella sp. CENA19
ref|WP_025233838.1|  AMP-dependent synthetase                           116   2e-26   
ref|WP_002006245.1|  lichenysin synthetase                              119   2e-26   
ref|WP_006635042.1|  amino acid adenylation domain protein              118   2e-26   
ref|WP_003275112.1|  lichenysin synthetase                              119   2e-26   
gb|KGC15330.1|  D-alanine--poly(phosphoribitol) ligase, subunit 1       119   2e-26   
ref|WP_006627580.1|  AMP-binding enzyme                                 115   2e-26   
ref|WP_036621049.1|  hypothetical protein                               119   2e-26   
ref|WP_026789274.1|  MULTISPECIES: proline adenylation protein          116   2e-26   
ref|WP_017308482.1|  hypothetical protein                               118   2e-26   
ref|WP_036267478.1|  amino acid adenylation protein                     119   3e-26   
gb|AHM66144.1|  hypothetical protein PPSQR21_025020                     117   3e-26   
ref|WP_036399448.1|  thioester reductase                                118   3e-26   
ref|WP_010075444.1|  thioester reductase                                119   3e-26   
ref|WP_036698409.1|  hypothetical protein                               119   3e-26   
gb|EPY04934.1|  nonribosomal peptide synthetase                         119   3e-26   
ref|WP_026723919.1|  amino acid adenylation protein                     117   3e-26   
ref|WP_016078366.1|  amino acid adenylation domain-containing pro...    118   3e-26   
gb|EDN68714.1|  non-ribosomal peptide synthetase                        117   3e-26   Beggiatoa sp. PS
gb|AIG26731.1|  NRPS domain-containing protein                          118   3e-26   
ref|WP_003339387.1|  gramicidin synthetase                              118   3e-26   
ref|WP_021835504.1|  Non-ribosomal peptide synthase:Amino acid ad...    118   3e-26   
ref|WP_034095029.1|  bacitracin synthetase                              119   4e-26   
ref|WP_035060992.1|  hypothetical protein                               118   4e-26   
ref|WP_007305678.1|  Non-ribosomal peptide synthase:Amino acid ad...    118   4e-26   
ref|WP_031415347.1|  gramicidin synthetase                              118   4e-26   
ref|WP_015214493.1|  amino acid adenylation domain protein              118   4e-26   
ref|WP_014312525.1|  peptide synthetase                                 115   4e-26   
ref|WP_018674291.1|  nonribosomal peptide ligase B                      118   4e-26   
ref|WP_010996800.1|  peptide synthetase                                 118   4e-26   
ref|WP_007430356.1|  Bacitracin synthetase 1                            117   4e-26   
ref|WP_013701213.1|  AMP-dependent synthetase                           115   4e-26   
ref|WP_012189422.1|  amino acid adenylation protein                     118   4e-26   
ref|WP_021830052.1|  Long-chain-fatty-acid--CoA ligase                  118   4e-26   
ref|WP_031416160.1|  polyketide synthase                                118   4e-26   
ref|WP_010346055.1|  fusaricidin synthetase                             118   5e-26   
ref|WP_003196772.1|  Phenylalanine racemase                             118   5e-26   
ref|WP_012884080.1|  amino acid adenylation domain-containing pro...    117   5e-26   
ref|WP_032901245.1|  hypothetical protein                               114   5e-26   
ref|WP_026315269.1|  phenylalanine racemase                             118   5e-26   
gb|AGH69814.1|  non-ribosomal peptide synthase                          117   6e-26   
ref|WP_038907505.1|  amino acid adenylation protein                     117   6e-26   
gb|AGH69825.1|  non-ribosomal peptide synthase                          117   6e-26   
ref|WP_016876762.1|  hypothetical protein                               117   6e-26   
ref|WP_036120589.1|  polyketide synthase                                117   6e-26   
ref|WP_029535760.1|  hypothetical protein                               115   6e-26   
ref|WP_013501797.1|  thioester reductase                                116   6e-26   
ref|WP_038903910.1|  amino acid adenylation protein                     117   6e-26   
ref|WP_014471872.1|  peptide synthetase                                 117   6e-26   
ref|WP_014470345.1|  peptide synthetase                                 117   6e-26   
ref|WP_017742641.1|  peptide synthetase                                 117   6e-26   
ref|WP_014472550.1|  peptide synthetase                                 117   6e-26   
ref|WP_026357911.1|  amino acid adenylation protein                     117   6e-26   
ref|WP_038074805.1|  thioester reductase                                117   6e-26   
ref|WP_023639362.1|  hypothetical protein                               117   7e-26   
ref|WP_027403946.1|  peptide synthetase                                 117   7e-26   
gb|AEJ86325.1|  ApnAA2                                                  115   7e-26   
ref|WP_023988772.1|  tyrocidine synthetase III                          117   7e-26   
ref|WP_033796921.1|  amino acid adenylation protein                     114   7e-26   
gb|AEJ86320.1|  ApnAA2                                                  115   7e-26   
ref|WP_017308473.1|  hypothetical protein                               117   7e-26   
ref|WP_036244958.1|  hypothetical protein                               117   8e-26   
ref|WP_029515255.1|  hypothetical protein                               117   8e-26   
gb|EPY04935.1|  tyrocidine synthetase III                               117   8e-26   
ref|WP_028559621.1|  hypothetical protein                               117   8e-26   
ref|WP_009672374.1|  MULTISPECIES: putative linear gramicidin syn...    117   8e-26   
gb|AGM16413.1|  paenibacterin synthetase B                              117   9e-26   
ref|WP_036702982.1|  peptide synthetase                                 117   9e-26   
ref|WP_036621051.1|  hypothetical protein                               117   9e-26   
gb|AHF21228.1|  TriD                                                    117   9e-26   
ref|WP_031415076.1|  gramicidin synthetase                              117   1e-25   
gb|ERM18922.1|  phenylalanine racemase                                  117   1e-25   
ref|WP_002061975.1|  lichenysin synthetase                              117   1e-25   
ref|WP_006892245.1|  amino acid adenylation domain protein              117   1e-25   
gb|ADL59762.1|  non-ribosomal peptide synthase                          117   1e-25   
ref|WP_017496633.1|  hypothetical protein                               117   1e-25   
ref|WP_036221991.1|  polyketide synthase                                117   1e-25   
ref|WP_017308731.1|  hypothetical protein                               116   1e-25   
ref|WP_031309115.1|  phenylalanine racemase                             117   1e-25   
ref|WP_034862967.1|  hypothetical protein, partial [                    116   1e-25   
ref|WP_033797418.1|  amino acid adenylation protein                     114   1e-25   
gb|AIG26695.1|  NRPS domain-containing protein                          117   1e-25   
ref|WP_002164339.1|  lichenysin synthetase                              117   1e-25   
ref|WP_021836626.1|  Linear gramicidin synthetase subunit C [Incl...    116   1e-25   
ref|WP_002099047.1|  lichenysin synthetase                              117   1e-25   
ref|WP_016090569.1|  amino acid adenylation domain-containing pro...    117   1e-25   
ref|WP_010853685.1|  Malonyl CoA-acyl carrier protein transacylase      116   1e-25   
ref|WP_005337937.1|  AMP-dependent synthetase                           114   1e-25   
ref|WP_009327564.1|  lichenysin synthetase                              116   1e-25   
ref|WP_002083439.1|  lichenysin synthetase                              116   1e-25   
ref|WP_025967142.1|  lichenysin synthetase                              116   1e-25   
gb|AIE37496.1|  putative non-ribosomal peptide synthase                 116   1e-25   
gb|AJE54156.1|  hypothetical protein RE92_24380                         117   1e-25   
emb|CAQ76918.1|  microcystin synthetase                                 113   1e-25   
ref|WP_036057018.1|  hypothetical protein                               116   1e-25   
ref|WP_022584720.1|  gramicidin synthetase                              116   1e-25   
emb|CAQ76919.1|  microcystin synthetase                                 113   1e-25   
ref|WP_039716922.1|  peptide synthetase                                 116   1e-25   
ref|WP_017318022.1|  hypothetical protein                               116   1e-25   
gb|AHX21923.1|  lichenysin synthetase                                   116   1e-25   
ref|WP_036032402.1|  hypothetical protein                               116   1e-25   
ref|WP_006194148.1|  hypothetical protein                               116   1e-25   
ref|WP_038915913.1|  amino acid adenylation protein                     116   2e-25   
ref|WP_038913573.1|  amino acid adenylation protein                     116   2e-25   
ref|WP_012409016.1|  peptide synthetase                                 116   2e-25   
ref|WP_033880398.1|  hypothetical protein                               116   2e-25   
ref|WP_035891083.1|  peptide synthetase                                 113   2e-25   
ref|WP_012409516.1|  amino acid adenylation domain-containing pro...    116   2e-25   
ref|WP_036698356.1|  hypothetical protein                               116   2e-25   
ref|WP_038668214.1|  amino acid adenylation protein                     116   2e-25   
ref|WP_016952818.1|  hypothetical protein                               116   2e-25   
ref|WP_039276003.1|  hypothetical protein                               116   2e-25   
ref|WP_039275170.1|  hypothetical protein                               116   2e-25   
ref|WP_016862272.1|  hypothetical protein                               116   2e-25   
ref|WP_038235217.1|  peptide synthetase                                 113   2e-25   
ref|WP_007358582.1|  hypothetical protein [                             113   2e-25   
ref|WP_037958422.1|  hypothetical protein                               115   2e-25   
ref|WP_003307431.1|  lichenysin synthetase                              116   2e-25   
ref|WP_031461470.1|  hypothetical protein                               116   2e-25   
gb|AJE53772.1|  hypothetical protein RE92_23260                         116   2e-25   
ref|WP_007786645.1|  amino acid adenylation enzyme/thioester redu...    116   2e-25   
ref|WP_034862278.1|  hypothetical protein, partial [                    116   2e-25   
ref|WP_026557189.1|  ATP-dependent leucine adenylase                    116   2e-25   
ref|WP_025844100.1|  ATP-dependent leucine adenylase                    116   2e-25   
ref|WP_011470195.1|  polyketide synthase                                116   2e-25   
ref|WP_005330495.1|  AMP-dependent synthetase                           113   2e-25   
ref|WP_026892017.1|  AMP-dependent synthetase [                         113   2e-25   
ref|WP_035798992.1|  hypothetical protein                               116   2e-25   
ref|WP_025721394.1|  hypothetical protein                               116   2e-25   
gb|EAZ91849.1|  Peptide synthetase                                      116   2e-25   
ref|WP_002164690.1|  lichenysin synthetase                              116   2e-25   
gb|AIU56840.1|  anatoxin-a synthetase C adenylating protein             113   2e-25   
ref|WP_039835552.1|  hypothetical protein                               116   2e-25   
ref|WP_038588504.1|  hypothetical protein                               116   2e-25   
ref|WP_022278426.1|  MULTISPECIES: putative uncharacterized protein     113   2e-25   
gb|KIE06743.1|  amino acid adenylation protein                          115   2e-25   
ref|WP_015078977.1|  nonribosomal peptide synthetase anabaenopept...    115   2e-25   
ref|WP_007358385.1|  MULTISPECIES: thioester reductase                  115   2e-25   
sp|O30409.1|TYCC_BREPA  RecName: Full=Tyrocidine synthase 3; AltN...    116   2e-25   
ref|WP_015893428.1|  peptide synthetase                                 116   2e-25   
ref|WP_010996805.1|  hypothetical protein                               115   2e-25   
ref|WP_034327461.1|  hypothetical protein                               116   2e-25   
ref|WP_027631043.1|  hypothetical protein [                             116   2e-25   
ref|WP_004091854.1|  tyrocidine synthetase III                          116   2e-25   
ref|WP_015077934.1|  amino acid adenylation protein                     115   2e-25   
ref|WP_012189555.1|  amino acid adenylation protein                     116   3e-25   
ref|WP_015191173.1|  non-ribosomal peptide synthetase                   116   3e-25   
ref|WP_016741874.1|  peptide synthetase                                 115   3e-25   
ref|WP_027220366.1|  peptide synthetase                                 113   3e-25   
ref|WP_036305782.1|  hypothetical protein                               115   3e-25   
ref|WP_011316891.1|  amino acid adenylation                             115   3e-25   
gb|KGT40810.1|  lichenysin synthetase                                   115   3e-25   
gb|AIG25288.1|  NRPS domain-containing protein                          115   3e-25   
ref|WP_002001163.1|  lichenysin synthetase                              115   3e-25   
ref|WP_026723269.1|  amino acid adenylation protein                     115   3e-25   
gb|AIU56831.1|  anatoxin-a synthetase C adenylating protein             113   3e-25   
ref|WP_006929432.1|  amino acid adenylation domain protein              115   3e-25   
ref|WP_018671879.1|  gramicidin synthetase                              115   3e-25   
ref|WP_029634528.1|  amino acid adenylation protein [                   115   3e-25   
gb|AIW82282.1|  PuwE                                                    115   3e-25   
ref|WP_006194153.1|  peptide synthetase                                 115   3e-25   
gb|AEJ86322.1|  ApnAA2                                                  113   3e-25   
ref|WP_031556580.1|  AMP-dependent synthetase                           112   3e-25   
gb|AEJ86321.1|  ApnAA2                                                  113   3e-25   
ref|WP_017496291.1|  hypothetical protein                               115   3e-25   
emb|CAA31623.1|  unnamed protein product                                115   3e-25   
ref|WP_026342524.1|  hypothetical protein                               115   3e-25   
ref|WP_027437175.1|  AMP-dependent synthetase                           112   3e-25   
gb|AJE49708.1|  hypothetical protein RE92_00935                         115   3e-25   
ref|WP_028497883.1|  hypothetical protein                               112   3e-25   
ref|WP_039714710.1|  hypothetical protein                               115   3e-25   
gb|KEQ27657.1|  hypothetical protein ET33_13275                         115   3e-25   
ref|WP_034287714.1|  hypothetical protein                               115   3e-25   
ref|WP_026315288.1|  tyrocidine synthase 3                              115   3e-25   
gb|KEK22519.1|  thioester reductase                                     115   4e-25   
ref|WP_019421600.1|  hypothetical protein                               115   4e-25   
ref|WP_028077529.1|  AMP-dependent synthetase                           112   4e-25   
ref|WP_036357959.1|  hypothetical protein                               112   4e-25   
ref|WP_003339100.1|  surfactin synthase subunit 2                       115   4e-25   
ref|WP_033677237.1|  thioester reductase                                115   4e-25   
ref|WP_033689763.1|  lichenysin synthetase                              115   4e-25   
ref|WP_039276918.1|  hypothetical protein                               115   4e-25   
ref|WP_010250065.1|  AMP-binding protein                                115   4e-25   
ref|WP_039275298.1|  hypothetical protein                               114   4e-25   
ref|WP_026785829.1|  McnC protein                                       115   4e-25   
ref|WP_030437858.1|  hypothetical protein                               112   4e-25   
gb|AHM64968.1|  amino acid adenylation domain-containing protein        115   4e-25   
ref|WP_002506102.1|  peptide synthetase                                 115   4e-25   
ref|WP_021684615.1|  AMP-binding enzyme                                 112   4e-25   
ref|WP_035067103.1|  hypothetical protein                               115   4e-25   
gb|AEJ86323.1|  ApnAA2                                                  112   4e-25   
gb|AAY29579.1|  nonribosomal peptide synthetase B                       115   4e-25   
ref|WP_037697077.1|  hypothetical protein                               113   4e-25   
gb|AGH69808.1|  non-ribosomal peptide synthase                          115   4e-25   
ref|WP_009456259.1|  amino acid adenylation domain protein              115   4e-25   
ref|WP_022584552.1|  nonribosomal peptide ligase B                      115   4e-25   
ref|WP_009267748.1|  AMP-dependent synthetase                           112   5e-25   
sp|P09095.2|TYCA_BREPA  RecName: Full=Tyrocidine synthase 1; AltN...    114   5e-25   
ref|WP_015198222.1|  amino acid adenylation protein                     115   5e-25   
ref|WP_002169354.1|  thioester reductase                                115   5e-25   
ref|WP_027361894.1|  AMP-binding protein                                115   5e-25   
ref|WP_033797420.1|  hypothetical protein                               111   5e-25   
ref|WP_027219750.1|  peptide synthetase                                 112   5e-25   
ref|WP_033797157.1|  hypothetical protein                               111   5e-25   
ref|WP_033334953.1|  peptide synthetase                                 115   5e-25   
ref|WP_006632793.1|  amino acid adenylation domain protein              114   5e-25   
gb|KFF99115.1|  hypothetical protein IQ62_20745                         113   5e-25   
ref|WP_038459507.1|  hypothetical protein                               115   5e-25   
gb|AJE49707.1|  fusaricidin synthetase                                  115   6e-25   
ref|WP_006526715.1|  AMP-dependent synthetase                           112   6e-25   
ref|WP_015037445.1|  CDA peptide synthetase I                           115   6e-25   
ref|WP_026785823.1|  peptide synthetase                                 114   6e-25   
ref|WP_029988825.1|  hypothetical protein                               115   6e-25   
ref|WP_029881446.1|  MULTISPECIES: glutamate racemase                   115   6e-25   
emb|CEF32444.1|  Non-ribosomal peptide synthase involved in xenem...    114   6e-25   
ref|WP_026798231.1|  peptide synthetase                                 114   6e-25   
ref|WP_036261029.1|  hypothetical protein                               114   7e-25   
ref|WP_020062738.1|  hypothetical protein                               114   7e-25   
ref|WP_038251492.1|  gramicidin synthetase                              114   7e-25   
ref|WP_016937292.1|  peptide synthetase                                 114   7e-25   
ref|WP_027228571.1|  peptide synthetase                                 112   7e-25   
ref|WP_034992699.1|  hypothetical protein                               113   7e-25   
ref|WP_027248862.1|  peptide synthetase                                 114   7e-25   
ref|WP_016362670.1|  fusaricidin synthetase                             114   7e-25   
ref|WP_023068318.1|  D-alanine--poly(phosphoribitol) ligase, subu...    114   7e-25   
gb|AHX21927.1|  thioester reductase                                     114   7e-25   
emb|CDH27331.1|  putative non-ribosomal peptide synthetase              114   8e-25   
ref|WP_036667063.1|  bacitracin synthetase                              114   8e-25   
ref|WP_011320786.1|  amino acid adenylation protein                     114   8e-25   
ref|WP_025724246.1|  hypothetical protein                               114   8e-25   
ref|WP_023068313.1|  non-ribosomal peptide synthase TIGR01720 dom...    114   8e-25   
ref|WP_012986920.1|  peptide synthetase                                 114   8e-25   
ref|WP_013352448.1|  peptide synthetase                                 114   8e-25   
gb|AIQ26138.1|  hypothetical protein H70737_26865                       114   8e-25   
ref|WP_021252556.1|  bacitracin synthetase 1                            114   9e-25   
ref|WP_000659077.1|  thioester reductase                                114   9e-25   
ref|WP_017744628.1|  hypothetical protein                               114   9e-25   
ref|WP_015128985.1|  amino acid adenylation protein                     114   9e-25   
ref|WP_013184596.1|  gramicidin synthetase                              114   9e-25   
gb|AIU56849.1|  anatoxin-a synthetase C adenylating protein             111   9e-25   
ref|WP_038707507.1|  hypothetical protein                               110   9e-25   
ref|WP_023367062.1|  thioester reductase                                114   1e-24   
emb|CAQ76914.1|  microcystin synthetase                                 110   1e-24   
gb|EUA01104.1|  amino acid adenylation domain protein                   114   1e-24   
ref|WP_018669923.1|  hypothetical protein                               114   1e-24   
emb|CAQ76913.1|  microcystin synthetase                                 110   1e-24   



>ref|XP_006354592.1| PREDICTED: putative acyl-activating enzyme 19-like isoform X4 
[Solanum tuberosum]
Length=955

 Score =   312 bits (799),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 191/239 (80%), Gaps = 4/239 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK+LVK+LPQT++LN+YGSTEVSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C
Sbjct  389  FDISLWKMLVKLLPQTSVLNIYGSTEVSGDCTYFDCKWLPTMLEQDALGSVPIGIPIDNC  448

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFRT  362
            +V+L+G++ P+EGEICV G C+++GYF +PS+LPLD VE  Q   D K+ ++ V  YFRT
Sbjct  449  EVVLIGENSPDEGEICVGGSCVASGYFSHPSILPLDNVESHQEIIDGKNDENEV--YFRT  506

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDF RKL +GN +++GR+DRTVKI GHRIALEEVE+VLREH EVAD+AV+ R  + D   
Sbjct  507  GDFGRKLSDGNLVYIGRRDRTVKICGHRIALEEVESVLREHQEVADSAVVSRCVQGDNLF  566

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LEA+L++K+   ++E+ RS I  W+A KLPP MIP RF+F ESFPMSSSGKVDY +LA 
Sbjct  567  LEAYLLLKQKENNLEVFRSTIRCWMASKLPPTMIPTRFYFVESFPMSSSGKVDYKMLAT  625



>ref|XP_006354591.1| PREDICTED: putative acyl-activating enzyme 19-like isoform X3 
[Solanum tuberosum]
Length=1101

 Score =   311 bits (798),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 191/239 (80%), Gaps = 4/239 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK+LVK+LPQT++LN+YGSTEVSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C
Sbjct  389  FDISLWKMLVKLLPQTSVLNIYGSTEVSGDCTYFDCKWLPTMLEQDALGSVPIGIPIDNC  448

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFRT  362
            +V+L+G++ P+EGEICV G C+++GYF +PS+LPLD VE  Q   D K+ ++ V  YFRT
Sbjct  449  EVVLIGENSPDEGEICVGGSCVASGYFSHPSILPLDNVESHQEIIDGKNDENEV--YFRT  506

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDF RKL +GN +++GR+DRTVKI GHRIALEEVE+VLREH EVAD+AV+ R  + D   
Sbjct  507  GDFGRKLSDGNLVYIGRRDRTVKICGHRIALEEVESVLREHQEVADSAVVSRCVQGDNLF  566

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LEA+L++K+   ++E+ RS I  W+A KLPP MIP RF+F ESFPMSSSGKVDY +LA 
Sbjct  567  LEAYLLLKQKENNLEVFRSTIRCWMASKLPPTMIPTRFYFVESFPMSSSGKVDYKMLAT  625



>ref|XP_009764905.1| PREDICTED: putative acyl-activating enzyme 19 isoform X5 [Nicotiana 
sylvestris]
Length=1033

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 187/240 (78%), Gaps = 2/240 (1%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +SLWK+LVK+LPQT+ILN+YGSTEVSGDCTYFDC+ LP +LE  +   VPIG+P+ +
Sbjct  231  VFDISLWKMLVKLLPQTSILNIYGSTEVSGDCTYFDCKWLPPMLEQDAPGSVPIGIPIGN  290

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFR  359
            CDV+L+G++ P EGEICVSG C++AGYFC+PS+ PLD VEL Q   D+++  + V  YFR
Sbjct  291  CDVVLVGENSPYEGEICVSGSCVAAGYFCHPSIFPLDNVELHQEVADAENDKNEVNCYFR  350

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGDF RKL NGN + +GRKDR+VKISG RIALEEVE+VLREH EV DAAV+ R  + D  
Sbjct  351  TGDFGRKLSNGNLVCIGRKDRSVKISGQRIALEEVESVLREHQEVVDAAVVSRCVQGDIL  410

Query  540  LLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LLEA++++K+   ++E  R SI  WIA KLP  M+P RF+F ESFPMSSSGKVDY  LA 
Sbjct  411  LLEAYVLLKQKESNLEFFRSSIRCWIASKLPLIMVPTRFYFVESFPMSSSGKVDYKNLAT  470



>ref|XP_006354589.1| PREDICTED: putative acyl-activating enzyme 19-like isoform X1 
[Solanum tuberosum]
Length=1188

 Score =   311 bits (797),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 191/239 (80%), Gaps = 4/239 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK+LVK+LPQT++LN+YGSTEVSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C
Sbjct  389  FDISLWKMLVKLLPQTSVLNIYGSTEVSGDCTYFDCKWLPTMLEQDALGSVPIGIPIDNC  448

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFRT  362
            +V+L+G++ P+EGEICV G C+++GYF +PS+LPLD VE  Q   D K+ ++ V  YFRT
Sbjct  449  EVVLIGENSPDEGEICVGGSCVASGYFSHPSILPLDNVESHQEIIDGKNDENEV--YFRT  506

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDF RKL +GN +++GR+DRTVKI GHRIALEEVE+VLREH EVAD+AV+ R  + D   
Sbjct  507  GDFGRKLSDGNLVYIGRRDRTVKICGHRIALEEVESVLREHQEVADSAVVSRCVQGDNLF  566

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LEA+L++K+   ++E+ RS I  W+A KLPP MIP RF+F ESFPMSSSGKVDY +LA 
Sbjct  567  LEAYLLLKQKENNLEVFRSTIRCWMASKLPPTMIPTRFYFVESFPMSSSGKVDYKMLAT  625



>ref|XP_009764904.1| PREDICTED: putative acyl-activating enzyme 19 isoform X4 [Nicotiana 
sylvestris]
Length=1132

 Score =   310 bits (794),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 187/240 (78%), Gaps = 2/240 (1%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +SLWK+LVK+LPQT+ILN+YGSTEVSGDCTYFDC+ LP +LE  +   VPIG+P+ +
Sbjct  388  VFDISLWKMLVKLLPQTSILNIYGSTEVSGDCTYFDCKWLPPMLEQDAPGSVPIGIPIGN  447

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFR  359
            CDV+L+G++ P EGEICVSG C++AGYFC+PS+ PLD VEL Q   D+++  + V  YFR
Sbjct  448  CDVVLVGENSPYEGEICVSGSCVAAGYFCHPSIFPLDNVELHQEVADAENDKNEVNCYFR  507

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGDF RKL NGN + +GRKDR+VKISG RIALEEVE+VLREH EV DAAV+ R  + D  
Sbjct  508  TGDFGRKLSNGNLVCIGRKDRSVKISGQRIALEEVESVLREHQEVVDAAVVSRCVQGDIL  567

Query  540  LLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LLEA++++K+   ++E  R SI  WIA KLP  M+P RF+F ESFPMSSSGKVDY  LA 
Sbjct  568  LLEAYVLLKQKESNLEFFRSSIRCWIASKLPLIMVPTRFYFVESFPMSSSGKVDYKNLAT  627



>ref|XP_009764903.1| PREDICTED: putative acyl-activating enzyme 19 isoform X3 [Nicotiana 
sylvestris]
Length=1186

 Score =   310 bits (794),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 187/240 (78%), Gaps = 2/240 (1%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +SLWK+LVK+LPQT+ILN+YGSTEVSGDCTYFDC+ LP +LE  +   VPIG+P+ +
Sbjct  388  VFDISLWKMLVKLLPQTSILNIYGSTEVSGDCTYFDCKWLPPMLEQDAPGSVPIGIPIGN  447

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFR  359
            CDV+L+G++ P EGEICVSG C++AGYFC+PS+ PLD VEL Q   D+++  + V  YFR
Sbjct  448  CDVVLVGENSPYEGEICVSGSCVAAGYFCHPSIFPLDNVELHQEVADAENDKNEVNCYFR  507

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGDF RKL NGN + +GRKDR+VKISG RIALEEVE+VLREH EV DAAV+ R  + D  
Sbjct  508  TGDFGRKLSNGNLVCIGRKDRSVKISGQRIALEEVESVLREHQEVVDAAVVSRCVQGDIL  567

Query  540  LLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LLEA++++K+   ++E  R SI  WIA KLP  M+P RF+F ESFPMSSSGKVDY  LA 
Sbjct  568  LLEAYVLLKQKESNLEFFRSSIRCWIASKLPLIMVPTRFYFVESFPMSSSGKVDYKNLAT  627



>ref|XP_009764902.1| PREDICTED: putative acyl-activating enzyme 19 isoform X2 [Nicotiana 
sylvestris]
Length=1189

 Score =   310 bits (794),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 187/240 (78%), Gaps = 2/240 (1%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +SLWK+LVK+LPQT+ILN+YGSTEVSGDCTYFDC+ LP +LE  +   VPIG+P+ +
Sbjct  387  VFDISLWKMLVKLLPQTSILNIYGSTEVSGDCTYFDCKWLPPMLEQDAPGSVPIGIPIGN  446

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFR  359
            CDV+L+G++ P EGEICVSG C++AGYFC+PS+ PLD VEL Q   D+++  + V  YFR
Sbjct  447  CDVVLVGENSPYEGEICVSGSCVAAGYFCHPSIFPLDNVELHQEVADAENDKNEVNCYFR  506

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGDF RKL NGN + +GRKDR+VKISG RIALEEVE+VLREH EV DAAV+ R  + D  
Sbjct  507  TGDFGRKLSNGNLVCIGRKDRSVKISGQRIALEEVESVLREHQEVVDAAVVSRCVQGDIL  566

Query  540  LLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LLEA++++K+   ++E  R SI  WIA KLP  M+P RF+F ESFPMSSSGKVDY  LA 
Sbjct  567  LLEAYVLLKQKESNLEFFRSSIRCWIASKLPLIMVPTRFYFVESFPMSSSGKVDYKNLAT  626



>ref|XP_009764901.1| PREDICTED: putative acyl-activating enzyme 19 isoform X1 [Nicotiana 
sylvestris]
Length=1190

 Score =   310 bits (794),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 187/240 (78%), Gaps = 2/240 (1%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +SLWK+LVK+LPQT+ILN+YGSTEVSGDCTYFDC+ LP +LE  +   VPIG+P+ +
Sbjct  388  VFDISLWKMLVKLLPQTSILNIYGSTEVSGDCTYFDCKWLPPMLEQDAPGSVPIGIPIGN  447

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFR  359
            CDV+L+G++ P EGEICVSG C++AGYFC+PS+ PLD VEL Q   D+++  + V  YFR
Sbjct  448  CDVVLVGENSPYEGEICVSGSCVAAGYFCHPSIFPLDNVELHQEVADAENDKNEVNCYFR  507

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGDF RKL NGN + +GRKDR+VKISG RIALEEVE+VLREH EV DAAV+ R  + D  
Sbjct  508  TGDFGRKLSNGNLVCIGRKDRSVKISGQRIALEEVESVLREHQEVVDAAVVSRCVQGDIL  567

Query  540  LLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LLEA++++K+   ++E  R SI  WIA KLP  M+P RF+F ESFPMSSSGKVDY  LA 
Sbjct  568  LLEAYVLLKQKESNLEFFRSSIRCWIASKLPLIMVPTRFYFVESFPMSSSGKVDYKNLAT  627



>ref|XP_010323230.1| PREDICTED: putative acyl-activating enzyme 19 isoform X9 [Solanum 
lycopersicum]
Length=955

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 189/238 (79%), Gaps = 4/238 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK+LVK+LP+T +LN+YGSTEVSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C
Sbjct  389  FDISLWKMLVKLLPETTVLNIYGSTEVSGDCTYFDCKWLPTMLEQDALDSVPIGIPIDNC  448

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFRT  362
            +V+L+G++  +EGEICVSG C+++GYF +PS+L LD VEL Q   D K  ++ V  YFRT
Sbjct  449  EVVLIGENSLDEGEICVSGSCVASGYFIHPSILSLDNVELHQEITDGKKDENEV--YFRT  506

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDF+RKL +GN +++GR+DRTVKI GHRIALEEVE++LREH EVAD+AV+ R  + D   
Sbjct  507  GDFSRKLSDGNLVYIGRRDRTVKICGHRIALEEVESILREHQEVADSAVVSRCVQGDILF  566

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            LEA+L++K+   ++E+ +S I  W+A KLPP MIP RF+F ESFP SSSGKVDY +LA
Sbjct  567  LEAYLLLKQKENNLEVFKSTIRCWMASKLPPTMIPARFYFVESFPRSSSGKVDYKMLA  624



>ref|XP_009608911.1| PREDICTED: putative acyl-activating enzyme 19 isoform X6 [Nicotiana 
tomentosiformis]
 ref|XP_009608912.1| PREDICTED: putative acyl-activating enzyme 19 isoform X6 [Nicotiana 
tomentosiformis]
Length=1038

 Score =   304 bits (778),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +SLWK+LVK+LPQT+ILN+YGSTEVSGDCTYFDC+ LP +L+  +   VPIG+P+ +
Sbjct  231  VFDISLWKMLVKLLPQTSILNIYGSTEVSGDCTYFDCKWLPPMLKQDAPGSVPIGIPIGN  290

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFR  359
            C+V+L+G++ P+EGEICVSG C++AGYFC+PS+ PLD VEL Q   D+++  + V  YFR
Sbjct  291  CNVVLVGENSPDEGEICVSGSCVAAGYFCHPSIFPLDNVELHQEVADAENDKNEVNCYFR  350

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGDF RKL NGN + +GRKDRTVKISGHRIALEEVE+VL+EH +VADAAV+ R  + D  
Sbjct  351  TGDFGRKLSNGNLVCIGRKDRTVKISGHRIALEEVESVLKEHQDVADAAVVSRCVQADIL  410

Query  540  LLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LLEA+L++K+   ++E  R SI  WIA KLPP M+P RF+F ESFPMSSSGKVDY  LA 
Sbjct  411  LLEAYLLLKQKESNLEFFRSSIRWWIANKLPPIMVPARFYFVESFPMSSSGKVDYKNLAT  470



>ref|XP_009608910.1| PREDICTED: putative acyl-activating enzyme 19 isoform X5 [Nicotiana 
tomentosiformis]
Length=1079

 Score =   304 bits (778),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +SLWK+LVK+LPQT+ILN+YGSTEVSGDCTYFDC+ LP +L+  +   VPIG+P+ +
Sbjct  272  VFDISLWKMLVKLLPQTSILNIYGSTEVSGDCTYFDCKWLPPMLKQDAPGSVPIGIPIGN  331

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFR  359
            C+V+L+G++ P+EGEICVSG C++AGYFC+PS+ PLD VEL Q   D+++  + V  YFR
Sbjct  332  CNVVLVGENSPDEGEICVSGSCVAAGYFCHPSIFPLDNVELHQEVADAENDKNEVNCYFR  391

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGDF RKL NGN + +GRKDRTVKISGHRIALEEVE+VL+EH +VADAAV+ R  + D  
Sbjct  392  TGDFGRKLSNGNLVCIGRKDRTVKISGHRIALEEVESVLKEHQDVADAAVVSRCVQADIL  451

Query  540  LLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LLEA+L++K+   ++E  R SI  WIA KLPP M+P RF+F ESFPMSSSGKVDY  LA 
Sbjct  452  LLEAYLLLKQKESNLEFFRSSIRWWIANKLPPIMVPARFYFVESFPMSSSGKVDYKNLAT  511



>ref|XP_009608905.1| PREDICTED: putative acyl-activating enzyme 19 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009608906.1| PREDICTED: putative acyl-activating enzyme 19 isoform X2 [Nicotiana 
tomentosiformis]
Length=1195

 Score =   304 bits (778),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +SLWK+LVK+LPQT+ILN+YGSTEVSGDCTYFDC+ LP +L+  +   VPIG+P+ +
Sbjct  388  VFDISLWKMLVKLLPQTSILNIYGSTEVSGDCTYFDCKWLPPMLKQDAPGSVPIGIPIGN  447

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFR  359
            C+V+L+G++ P+EGEICVSG C++AGYFC+PS+ PLD VEL Q   D+++  + V  YFR
Sbjct  448  CNVVLVGENSPDEGEICVSGSCVAAGYFCHPSIFPLDNVELHQEVADAENDKNEVNCYFR  507

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGDF RKL NGN + +GRKDRTVKISGHRIALEEVE+VL+EH +VADAAV+ R  + D  
Sbjct  508  TGDFGRKLSNGNLVCIGRKDRTVKISGHRIALEEVESVLKEHQDVADAAVVSRCVQADIL  567

Query  540  LLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LLEA+L++K+   ++E  R SI  WIA KLPP M+P RF+F ESFPMSSSGKVDY  LA 
Sbjct  568  LLEAYLLLKQKESNLEFFRSSIRWWIANKLPPIMVPARFYFVESFPMSSSGKVDYKNLAT  627



>ref|XP_009608907.1| PREDICTED: putative acyl-activating enzyme 19 isoform X3 [Nicotiana 
tomentosiformis]
Length=1194

 Score =   304 bits (778),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +SLWK+LVK+LPQT+ILN+YGSTEVSGDCTYFDC+ LP +L+  +   VPIG+P+ +
Sbjct  387  VFDISLWKMLVKLLPQTSILNIYGSTEVSGDCTYFDCKWLPPMLKQDAPGSVPIGIPIGN  446

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFR  359
            C+V+L+G++ P+EGEICVSG C++AGYFC+PS+ PLD VEL Q   D+++  + V  YFR
Sbjct  447  CNVVLVGENSPDEGEICVSGSCVAAGYFCHPSIFPLDNVELHQEVADAENDKNEVNCYFR  506

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGDF RKL NGN + +GRKDRTVKISGHRIALEEVE+VL+EH +VADAAV+ R  + D  
Sbjct  507  TGDFGRKLSNGNLVCIGRKDRTVKISGHRIALEEVESVLKEHQDVADAAVVSRCVQADIL  566

Query  540  LLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LLEA+L++K+   ++E  R SI  WIA KLPP M+P RF+F ESFPMSSSGKVDY  LA 
Sbjct  567  LLEAYLLLKQKESNLEFFRSSIRWWIANKLPPIMVPARFYFVESFPMSSSGKVDYKNLAT  626



>ref|XP_009608909.1| PREDICTED: putative acyl-activating enzyme 19 isoform X4 [Nicotiana 
tomentosiformis]
Length=1191

 Score =   304 bits (778),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +SLWK+LVK+LPQT+ILN+YGSTEVSGDCTYFDC+ LP +L+  +   VPIG+P+ +
Sbjct  388  VFDISLWKMLVKLLPQTSILNIYGSTEVSGDCTYFDCKWLPPMLKQDAPGSVPIGIPIGN  447

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFR  359
            C+V+L+G++ P+EGEICVSG C++AGYFC+PS+ PLD VEL Q   D+++  + V  YFR
Sbjct  448  CNVVLVGENSPDEGEICVSGSCVAAGYFCHPSIFPLDNVELHQEVADAENDKNEVNCYFR  507

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGDF RKL NGN + +GRKDRTVKISGHRIALEEVE+VL+EH +VADAAV+ R  + D  
Sbjct  508  TGDFGRKLSNGNLVCIGRKDRTVKISGHRIALEEVESVLKEHQDVADAAVVSRCVQADIL  567

Query  540  LLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LLEA+L++K+   ++E  R SI  WIA KLPP M+P RF+F ESFPMSSSGKVDY  LA 
Sbjct  568  LLEAYLLLKQKESNLEFFRSSIRWWIANKLPPIMVPARFYFVESFPMSSSGKVDYKNLAT  627



>ref|XP_010323220.1| PREDICTED: putative acyl-activating enzyme 19 isoform X7 [Solanum 
lycopersicum]
Length=1058

 Score =   302 bits (774),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 189/238 (79%), Gaps = 4/238 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK+LVK+LP+T +LN+YGSTEVSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C
Sbjct  389  FDISLWKMLVKLLPETTVLNIYGSTEVSGDCTYFDCKWLPTMLEQDALDSVPIGIPIDNC  448

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFRT  362
            +V+L+G++  +EGEICVSG C+++GYF +PS+L LD VEL Q   D K  ++ V  YFRT
Sbjct  449  EVVLIGENSLDEGEICVSGSCVASGYFIHPSILSLDNVELHQEITDGKKDENEV--YFRT  506

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDF+RKL +GN +++GR+DRTVKI GHRIALEEVE++LREH EVAD+AV+ R  + D   
Sbjct  507  GDFSRKLSDGNLVYIGRRDRTVKICGHRIALEEVESILREHQEVADSAVVSRCVQGDILF  566

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            LEA+L++K+   ++E+ +S I  W+A KLPP MIP RF+F ESFP SSSGKVDY +LA
Sbjct  567  LEAYLLLKQKENNLEVFKSTIRCWMASKLPPTMIPARFYFVESFPRSSSGKVDYKMLA  624



>ref|XP_010323214.1| PREDICTED: putative acyl-activating enzyme 19 isoform X6 [Solanum 
lycopersicum]
Length=1088

 Score =   302 bits (774),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 189/239 (79%), Gaps = 4/239 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK+LVK+LP+T +LN+YGSTEVSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C
Sbjct  389  FDISLWKMLVKLLPETTVLNIYGSTEVSGDCTYFDCKWLPTMLEQDALDSVPIGIPIDNC  448

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFRT  362
            +V+L+G++  +EGEICVSG C+++GYF +PS+L LD VEL Q   D K  ++ V  YFRT
Sbjct  449  EVVLIGENSLDEGEICVSGSCVASGYFIHPSILSLDNVELHQEITDGKKDENEV--YFRT  506

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDF+RKL +GN +++GR+DRTVKI GHRIALEEVE++LREH EVAD+AV+ R  + D   
Sbjct  507  GDFSRKLSDGNLVYIGRRDRTVKICGHRIALEEVESILREHQEVADSAVVSRCVQGDILF  566

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LEA+L++K+   ++E+ +S I  W+A KLPP MIP RF+F ESFP SSSGKVDY +LA 
Sbjct  567  LEAYLLLKQKENNLEVFKSTIRCWMASKLPPTMIPARFYFVESFPRSSSGKVDYKMLAT  625



>ref|XP_010323225.1| PREDICTED: putative acyl-activating enzyme 19 isoform X8 [Solanum 
lycopersicum]
Length=1030

 Score =   301 bits (772),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 189/239 (79%), Gaps = 4/239 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK+LVK+LP+T +LN+YGSTEVSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C
Sbjct  232  FDISLWKMLVKLLPETTVLNIYGSTEVSGDCTYFDCKWLPTMLEQDALDSVPIGIPIDNC  291

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFRT  362
            +V+L+G++  +EGEICVSG C+++GYF +PS+L LD VEL Q   D K  ++ V  YFRT
Sbjct  292  EVVLIGENSLDEGEICVSGSCVASGYFIHPSILSLDNVELHQEITDGKKDENEV--YFRT  349

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDF+RKL +GN +++GR+DRTVKI GHRIALEEVE++LREH EVAD+AV+ R  + D   
Sbjct  350  GDFSRKLSDGNLVYIGRRDRTVKICGHRIALEEVESILREHQEVADSAVVSRCVQGDILF  409

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LEA+L++K+   ++E+ +S I  W+A KLPP MIP RF+F ESFP SSSGKVDY +LA 
Sbjct  410  LEAYLLLKQKENNLEVFKSTIRCWMASKLPPTMIPARFYFVESFPRSSSGKVDYKMLAT  468



>ref|XP_010323208.1| PREDICTED: putative acyl-activating enzyme 19 isoform X5 [Solanum 
lycopersicum]
Length=1103

 Score =   302 bits (774),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 189/238 (79%), Gaps = 4/238 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK+LVK+LP+T +LN+YGSTEVSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C
Sbjct  389  FDISLWKMLVKLLPETTVLNIYGSTEVSGDCTYFDCKWLPTMLEQDALDSVPIGIPIDNC  448

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFRT  362
            +V+L+G++  +EGEICVSG C+++GYF +PS+L LD VEL Q   D K  ++ V  YFRT
Sbjct  449  EVVLIGENSLDEGEICVSGSCVASGYFIHPSILSLDNVELHQEITDGKKDENEV--YFRT  506

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDF+RKL +GN +++GR+DRTVKI GHRIALEEVE++LREH EVAD+AV+ R  + D   
Sbjct  507  GDFSRKLSDGNLVYIGRRDRTVKICGHRIALEEVESILREHQEVADSAVVSRCVQGDILF  566

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            LEA+L++K+   ++E+ +S I  W+A KLPP MIP RF+F ESFP SSSGKVDY +LA
Sbjct  567  LEAYLLLKQKENNLEVFKSTIRCWMASKLPPTMIPARFYFVESFPRSSSGKVDYKMLA  624



>ref|XP_010323201.1| PREDICTED: putative acyl-activating enzyme 19 isoform X3 [Solanum 
lycopersicum]
Length=1167

 Score =   302 bits (773),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 189/239 (79%), Gaps = 4/239 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK+LVK+LP+T +LN+YGSTEVSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C
Sbjct  389  FDISLWKMLVKLLPETTVLNIYGSTEVSGDCTYFDCKWLPTMLEQDALDSVPIGIPIDNC  448

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFRT  362
            +V+L+G++  +EGEICVSG C+++GYF +PS+L LD VEL Q   D K  ++ V  YFRT
Sbjct  449  EVVLIGENSLDEGEICVSGSCVASGYFIHPSILSLDNVELHQEITDGKKDENEV--YFRT  506

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDF+RKL +GN +++GR+DRTVKI GHRIALEEVE++LREH EVAD+AV+ R  + D   
Sbjct  507  GDFSRKLSDGNLVYIGRRDRTVKICGHRIALEEVESILREHQEVADSAVVSRCVQGDILF  566

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LEA+L++K+   ++E+ +S I  W+A KLPP MIP RF+F ESFP SSSGKVDY +LA 
Sbjct  567  LEAYLLLKQKENNLEVFKSTIRCWMASKLPPTMIPARFYFVESFPRSSSGKVDYKMLAT  625



>ref|XP_010323205.1| PREDICTED: putative acyl-activating enzyme 19 isoform X4 [Solanum 
lycopersicum]
Length=1152

 Score =   302 bits (773),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 189/239 (79%), Gaps = 4/239 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK+LVK+LP+T +LN+YGSTEVSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C
Sbjct  389  FDISLWKMLVKLLPETTVLNIYGSTEVSGDCTYFDCKWLPTMLEQDALDSVPIGIPIDNC  448

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFRT  362
            +V+L+G++  +EGEICVSG C+++GYF +PS+L LD VEL Q   D K  ++ V  YFRT
Sbjct  449  EVVLIGENSLDEGEICVSGSCVASGYFIHPSILSLDNVELHQEITDGKKDENEV--YFRT  506

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDF+RKL +GN +++GR+DRTVKI GHRIALEEVE++LREH EVAD+AV+ R  + D   
Sbjct  507  GDFSRKLSDGNLVYIGRRDRTVKICGHRIALEEVESILREHQEVADSAVVSRCVQGDILF  566

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LEA+L++K+   ++E+ +S I  W+A KLPP MIP RF+F ESFP SSSGKVDY +LA 
Sbjct  567  LEAYLLLKQKENNLEVFKSTIRCWMASKLPPTMIPARFYFVESFPRSSSGKVDYKMLAT  625



>ref|XP_010323192.1| PREDICTED: putative acyl-activating enzyme 19 isoform X1 [Solanum 
lycopersicum]
Length=1187

 Score =   302 bits (773),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 189/239 (79%), Gaps = 4/239 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK+LVK+LP+T +LN+YGSTEVSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C
Sbjct  389  FDISLWKMLVKLLPETTVLNIYGSTEVSGDCTYFDCKWLPTMLEQDALDSVPIGIPIDNC  448

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFRT  362
            +V+L+G++  +EGEICVSG C+++GYF +PS+L LD VEL Q   D K  ++ V  YFRT
Sbjct  449  EVVLIGENSLDEGEICVSGSCVASGYFIHPSILSLDNVELHQEITDGKKDENEV--YFRT  506

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDF+RKL +GN +++GR+DRTVKI GHRIALEEVE++LREH EVAD+AV+ R  + D   
Sbjct  507  GDFSRKLSDGNLVYIGRRDRTVKICGHRIALEEVESILREHQEVADSAVVSRCVQGDILF  566

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LEA+L++K+   ++E+ +S I  W+A KLPP MIP RF+F ESFP SSSGKVDY +LA 
Sbjct  567  LEAYLLLKQKENNLEVFKSTIRCWMASKLPPTMIPARFYFVESFPRSSSGKVDYKMLAT  625



>ref|XP_010323195.1| PREDICTED: putative acyl-activating enzyme 19 isoform X2 [Solanum 
lycopersicum]
Length=1186

 Score =   302 bits (773),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 189/239 (79%), Gaps = 4/239 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK+LVK+LP+T +LN+YGSTEVSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C
Sbjct  388  FDISLWKMLVKLLPETTVLNIYGSTEVSGDCTYFDCKWLPTMLEQDALDSVPIGIPIDNC  447

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN-HDSKSTDHRVQQYFRT  362
            +V+L+G++  +EGEICVSG C+++GYF +PS+L LD VEL Q   D K  ++ V  YFRT
Sbjct  448  EVVLIGENSLDEGEICVSGSCVASGYFIHPSILSLDNVELHQEITDGKKDENEV--YFRT  505

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDF+RKL +GN +++GR+DRTVKI GHRIALEEVE++LREH EVAD+AV+ R  + D   
Sbjct  506  GDFSRKLSDGNLVYIGRRDRTVKICGHRIALEEVESILREHQEVADSAVVSRCVQGDILF  565

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            LEA+L++K+   ++E+ +S I  W+A KLPP MIP RF+F ESFP SSSGKVDY +LA 
Sbjct  566  LEAYLLLKQKENNLEVFKSTIRCWMASKLPPTMIPARFYFVESFPRSSSGKVDYKMLAT  624



>ref|XP_011093430.1| PREDICTED: putative acyl-activating enzyme 19 [Sesamum indicum]
Length=1191

 Score =   300 bits (769),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 188/240 (78%), Gaps = 3/240 (1%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
              HLSL K+L+K+LPQT+ILNLYGSTEVSGDCTYFDC+ LPLILE + LS VP+GLPL +
Sbjct  384  VLHLSLCKMLLKLLPQTSILNLYGSTEVSGDCTYFDCKRLPLILEKEVLSSVPVGLPLSN  443

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSK--STDHRVQQYF  356
            CDV+L+G+D PNEGEI V GLC++AGYFCYPS++PL   +LS  HD +  S+ + +Q YF
Sbjct  444  CDVVLVGEDAPNEGEIYVGGLCVAAGYFCYPSLMPLADEDLSPEHDIRYPSSGYGIQHYF  503

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGDFARKL NG+ +FLGRKDRT+K++G R+ALEE+E+  R+HP+V DAAV+ R  + + 
Sbjct  504  RTGDFARKLSNGDLVFLGRKDRTLKVNGQRVALEEIESAFRDHPDVVDAAVLSREVEGEI  563

Query  537  SLLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
             LLEAH++ ++  E+ ++L+ S+ NW+  KLP  MIP R F T   P++SSGKVDY  LA
Sbjct  564  LLLEAHVVTEKTLENDQLLKSSLRNWVVGKLPAIMIPRRIFLTRLLPLTSSGKVDYLSLA  623



>ref|XP_010661305.1| PREDICTED: putative acyl-activating enzyme 19 isoform X2 [Vitis 
vinifera]
Length=1155

 Score =   299 bits (765),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 181/238 (76%), Gaps = 4/238 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            LSLW  L  +LPQT+ILNLYGSTEVSGDCTYFDC  LP ILE  SLS VPIG+P+ +C+V
Sbjct  378  LSLWNTLSSLLPQTSILNLYGSTEVSGDCTYFDCRRLPRILESDSLSSVPIGIPISNCNV  437

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQYFRT  362
            +L+G+ D  NEGEICV+GLC++ GYF  P+V+PLDY  LS     +    D+  Q YFRT
Sbjct  438  MLVGESDTSNEGEICVNGLCVNIGYFPDPNVMPLDYSNLSHGSLCNCSINDNESQLYFRT  497

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFAR+LQ+G+ +FLGRKDRTVKI+G RIALEE+EN LR HP+V DAAVIFR  + +  L
Sbjct  498  GDFARRLQSGDLVFLGRKDRTVKINGQRIALEEIENALRGHPDVVDAAVIFRKGQGELEL  557

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            LEA +I+K  NE  E+LRS I  W+  KLP  M+P  FFFT+SFPMS++GKVDY  LA
Sbjct  558  LEAFIILKRTNESDEVLRSCIGCWMVEKLPLVMVPNNFFFTKSFPMSATGKVDYASLA  615



>ref|XP_002265371.1| PREDICTED: putative acyl-activating enzyme 19 isoform X1 [Vitis 
vinifera]
 emb|CBI38218.3| unnamed protein product [Vitis vinifera]
Length=1175

 Score =   299 bits (765),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 181/238 (76%), Gaps = 4/238 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            LSLW  L  +LPQT+ILNLYGSTEVSGDCTYFDC  LP ILE  SLS VPIG+P+ +C+V
Sbjct  378  LSLWNTLSSLLPQTSILNLYGSTEVSGDCTYFDCRRLPRILESDSLSSVPIGIPISNCNV  437

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQYFRT  362
            +L+G+ D  NEGEICV+GLC++ GYF  P+V+PLDY  LS     +    D+  Q YFRT
Sbjct  438  MLVGESDTSNEGEICVNGLCVNIGYFPDPNVMPLDYSNLSHGSLCNCSINDNESQLYFRT  497

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFAR+LQ+G+ +FLGRKDRTVKI+G RIALEE+EN LR HP+V DAAVIFR  + +  L
Sbjct  498  GDFARRLQSGDLVFLGRKDRTVKINGQRIALEEIENALRGHPDVVDAAVIFRKGQGELEL  557

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            LEA +I+K  NE  E+LRS I  W+  KLP  M+P  FFFT+SFPMS++GKVDY  LA
Sbjct  558  LEAFIILKRTNESDEVLRSCIGCWMVEKLPLVMVPNNFFFTKSFPMSATGKVDYASLA  615



>emb|CAN59828.1| hypothetical protein VITISV_014234 [Vitis vinifera]
Length=270

 Score =   266 bits (679),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 169/235 (72%), Gaps = 4/235 (2%)
 Frame = +3

Query  24   KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLG  203
            ++L  I   T    +    EVSGDCTYFDC  LP ILE  SLS VPIG+P+ +C+V+L+G
Sbjct  26   RVLDYIKLPTTTRRMMDMKEVSGDCTYFDCRRLPRILESDSLSSVPIGIPISNCNVMLVG  85

Query  204  DDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQYFRTGDFA  374
            + D  NEGEICV+GLC++ GYF  P+V+PLDY  LS     +    D+  Q YFRTGDFA
Sbjct  86   ESDTSNEGEICVNGLCVNIGYFPDPNVMPLDYSNLSHGSLCNCSINDNESQLYFRTGDFA  145

Query  375  RKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAH  554
            R+LQ+G+ +FLGRKDRTVKI+G RIALEE+EN LR HP+V +AAVIFR  + +  LLEA 
Sbjct  146  RRLQSGDLVFLGRKDRTVKINGQRIALEEIENALRGHPDVVBAAVIFRKGQGELELLEAF  205

Query  555  LIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            +I+K  NE  E+LRS I  W+  KLP  M+P  FFFT+SFPMS++GKVDY  LA+
Sbjct  206  IILKRTNESDEVLRSCIGCWMVEKLPLVMVPNNFFFTKSFPMSATGKVDYASLAD  260



>gb|EYU24460.1| hypothetical protein MIMGU_mgv1a0196452mg, partial [Erythranthe 
guttata]
Length=795

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 174/238 (73%), Gaps = 15/238 (6%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
              HLSL K L+K+LPQT++LNLYGSTEV+GDCTYFDC+ LPLILE + LS VP+GLPL +
Sbjct  69   VLHLSLCKTLLKLLPQTSVLNLYGSTEVTGDCTYFDCKRLPLILEKEELSSVPVGLPLSN  128

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRT  362
            C+V+L+G+D P +GEI VSGLC++AGYF YP ++PL                RVQ+YF+T
Sbjct  129  CEVVLVGEDAPLQGEIYVSGLCVAAGYFDYPYLIPL--------------ADRVQKYFKT  174

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFARKL +G+F+ +GRKDRT+K++G R+ALEE+E   R+HP V DAAV+ R    +  L
Sbjct  175  GDFARKLSSGDFVIIGRKDRTLKVNGQRVALEEIETAFRDHPSVVDAAVLSREVDGEILL  234

Query  543  LEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            LEAH++M+E NE  E+L  S+ NW+   LP  MIP R   T S P++SSGKVDY  LA
Sbjct  235  LEAHVVMEEKNEDDELLESSLRNWLLNMLPQVMIPTRILLTRSLPLTSSGKVDYMSLA  292



>ref|XP_010679069.1| PREDICTED: putative acyl-activating enzyme 19 [Beta vulgaris 
subsp. vulgaris]
Length=1147

 Score =   270 bits (690),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 178/239 (74%), Gaps = 5/239 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +SLWK+L ++ P+T ILN+YGSTEVSGDCTYFDC+ L  +LE + +S VPIG P+ +
Sbjct  348  VFPVSLWKLLSRVFPKTTILNIYGSTEVSGDCTYFDCKELSALLESEVVSSVPIGKPITN  407

Query  183  CDVLLL-GDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ--Y  353
            C+V L+  D + +EGEICV+G+CLS+GY+   +++PLDYVEL +  DS S   RV    Y
Sbjct  408  CNVKLIEKDGNHDEGEICVTGVCLSSGYYSEGNIMPLDYVELRE--DSVSIHERVSSKLY  465

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            +R GDFAR+L NG+ IF GR+DRT+K++G RIALEEVE+ LR HP++ADA+V+F N++  
Sbjct  466  YRMGDFARRLSNGDLIFCGREDRTIKVNGQRIALEEVEDSLRGHPDLADASVVFCNEQEG  525

Query  534  TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             + L A L++K+N    ++LRSI +W+  +LPPAMIP     TE  PMSS+GKV+Y LL
Sbjct  526  HAFLGAILVLKDNGNSSQVLRSIRSWMVDRLPPAMIPKEIICTEEIPMSSTGKVNYTLL  584



>ref|XP_006354590.1| PREDICTED: putative acyl-activating enzyme 19-like isoform X2 
[Solanum tuberosum]
Length=1120

 Score =   269 bits (687),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 167/214 (78%), Gaps = 4/214 (2%)
 Frame = +3

Query  81   EVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNEGEICVSGLCLSAG  260
            +VSGDCTYFDC+ LP +LE  +L  VPIG+P+ +C+V+L+G++ P+EGEICV G C+++G
Sbjct  346  QVSGDCTYFDCKWLPTMLEQDALGSVPIGIPIDNCEVVLIGENSPDEGEICVGGSCVASG  405

Query  261  YFCYPSVLPLDYVELSQNH-DSKSTDHRVQQYFRTGDFARKLQNGNFIFLGRKDRTVKIS  437
            YF +PS+LPLD VE  Q   D K+ ++ V  YFRTGDF RKL +GN +++GR+DRTVKI 
Sbjct  406  YFSHPSILPLDNVESHQEIIDGKNDENEV--YFRTGDFGRKLSDGNLVYIGRRDRTVKIC  463

Query  438  GHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVEILRS-ITNWI  614
            GHRIALEEVE+VLREH EVAD+AV+ R  + D   LEA+L++K+   ++E+ RS I  W+
Sbjct  464  GHRIALEEVESVLREHQEVADSAVVSRCVQGDNLFLEAYLLLKQKENNLEVFRSTIRCWM  523

Query  615  ARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            A KLPP MIP RF+F ESFPMSSSGKVDY +LA 
Sbjct  524  ASKLPPTMIPTRFYFVESFPMSSSGKVDYKMLAT  557



>emb|CDP09317.1| unnamed protein product [Coffea canephora]
Length=1183

 Score =   268 bits (686),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 177/241 (73%), Gaps = 7/241 (3%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
              HLSL + L+K+LP TAILNLYGSTEV+GDCTYFDC+ LPLILE++ +S VPIGLPL +
Sbjct  365  VLHLSLCESLLKLLPHTAILNLYGSTEVAGDCTYFDCKQLPLILENEIVSSVPIGLPLSN  424

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQ----NHDSKSTDHRVQQ  350
            CDV+L+G++ P  GEI V GLC   GYF + S+ P    +L Q    NH S+  D R+Q 
Sbjct  425  CDVVLIGENAPKYGEIYVRGLCNGVGYFDHLSITPFGPAKLPQTSFINHTSR--DPRLQG  482

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
            YF+TGD AR+LQ+G+FIF+GR+DRT+K +G RIALEE+EN LREHP + DAAV       
Sbjct  483  YFKTGDLARQLQSGDFIFIGREDRTIKFNGQRIALEEIENTLREHPHIVDAAVTCLKKHG  542

Query  531  DTSLLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNL  707
            + S +EA+L+ K+  +  E  + SI +W+ +KLP A+IP   FF+ESFP +SSGKVDYN+
Sbjct  543  EISSIEAYLVPKKVQDCNENFKSSIRSWMVKKLPQALIPSCIFFSESFPTTSSGKVDYNM  602

Query  708  L  710
            L
Sbjct  603  L  603



>gb|KCW76684.1| hypothetical protein EUGRSUZ_D01046 [Eucalyptus grandis]
Length=903

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 169/239 (71%), Gaps = 3/239 (1%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK L  +LP+T ILNLYGSTEV+GDCTYFDC+ LP++LE + LS VPIGLP+ +C
Sbjct  379  FSVSLWKELAGLLPKTTILNLYGSTEVAGDCTYFDCKRLPMMLEAEKLSNVPIGLPISNC  438

Query  186  DVLLLGDDDP-NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ--YF  356
            +V+L+G+DD  N GEI V G+C+ +GY   PS   LDYVEL  N     +D   Q+  + 
Sbjct  439  EVVLVGEDDELNHGEIYVGGVCILSGYMSEPSADSLDYVELPHNSSHYQSDEEYQRQLFI  498

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGDFAR+L +G+++FLGRKD  VKI+G RIAL E+E++LR+H  V DAAV+ R    + 
Sbjct  499  RTGDFARQLASGDYVFLGRKDHIVKINGQRIALGEIESMLRQHESVLDAAVVCRIGPEEL  558

Query  537  SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
              LEA L++ E     E+ RSI +W+  KLP AM+P  F F ESFP +SSGKVDY  L+
Sbjct  559  GQLEAFLLLNEKKRPSEVSRSIRHWMVEKLPYAMVPHHFIFLESFPRTSSGKVDYEFLS  617



>ref|XP_008232133.1| PREDICTED: putative acyl-activating enzyme 19 [Prunus mume]
Length=1142

 Score =   266 bits (679),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 179/239 (75%), Gaps = 5/239 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            LSLW +L KILP+T ILNLYGSTEVSGDCTYFDC+ LPLIL    L+ VPIG+P+ +CDV
Sbjct  336  LSLWDMLSKILPRTTILNLYGSTEVSGDCTYFDCKRLPLILAADPLTTVPIGMPIVNCDV  395

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKST--DHRVQQYFRT  362
            +L+G DD  NEGEI V+G+C S+GY+    + PLD V+LSQ+    S+   H+ Q YFRT
Sbjct  396  VLVGGDDVSNEGEIYVAGVCNSSGYYSDSIITPLDTVKLSQDSVCCSSVNGHKSQYYFRT  455

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFA++L++G+ +FLGRKDRT+K++G RIALEE+E+ +R H +V DAAVIF   + +  L
Sbjct  456  GDFAKQLRSGDLVFLGRKDRTIKLNGQRIALEEIEDTVRGHSDVIDAAVIFHKVQGELML  515

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            L A +I++E     EI RS I +W+A KLP AMIP     TESFP+SSSGK++Y LLA+
Sbjct  516  LVAFIILREGIPK-EIFRSTIKSWMADKLPLAMIPGHIVVTESFPVSSSGKINYELLAD  573



>ref|XP_007029808.1| AMP-dependent synthetase and ligase family protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY10310.1| AMP-dependent synthetase and ligase family protein, putative 
isoform 2 [Theobroma cacao]
Length=787

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 173/237 (73%), Gaps = 4/237 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            L+LW +L  +LP+T++LNLYGSTEVSGDC YFDC+ LP ILE ++L+ VPIGLP+  C +
Sbjct  258  LALWNMLSSLLPKTSVLNLYGSTEVSGDCMYFDCKRLPSILEMQTLTTVPIGLPISKCSI  317

Query  192  LLLGDD-DPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRV--QQYFRT  362
            +L G++ +PNEGEI V GLC+S GYF   +++PL+  +L QN   K +      Q YFRT
Sbjct  318  VLNGENSNPNEGEIYVRGLCVSIGYFSENAIIPLNNAKLHQNSLCKCSMEACGSQVYFRT  377

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFA +L +G+ +FLGRKDRTVK++G RIALEEVEN LR H +V DAAVI   D+ + +L
Sbjct  378  GDFAHQLPSGDLVFLGRKDRTVKVNGQRIALEEVENTLRGHNDVIDAAVISHKDQGEDAL  437

Query  543  LEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            + A ++++E  E  E+ + SI NW+  KLP AM+P  F F +S PMS+SGKVDY +L
Sbjct  438  IVAFILLREKEESGEMFKTSIRNWMISKLPTAMVPTHFVFVKSLPMSASGKVDYTVL  494



>ref|XP_007220064.1| hypothetical protein PRUPE_ppa025823mg [Prunus persica]
 gb|EMJ21263.1| hypothetical protein PRUPE_ppa025823mg [Prunus persica]
Length=1037

 Score =   264 bits (675),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 175/238 (74%), Gaps = 3/238 (1%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            LSLW  L K+LP+TAILNLYGSTEVSGDCTYFDC+ LPLIL    L+ VPIG+P+ +CDV
Sbjct  231  LSLWDKLSKMLPRTAILNLYGSTEVSGDCTYFDCKRLPLILAADRLTTVPIGMPIFNCDV  290

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKST--DHRVQQYFRT  362
            +L+G DD  NEGEI V+G+C S+GY+    V PLD V LSQ+    S+   H+ Q YFRT
Sbjct  291  VLIGGDDVSNEGEIYVAGVCNSSGYYSDSMVTPLDTVRLSQDSVCCSSVNGHKSQYYFRT  350

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFA++L++G+ +FLGRKDRT+K++G RIALEE+E+ +R H EV DAAVIF   + +  L
Sbjct  351  GDFAKQLRSGDLVFLGRKDRTIKLNGQRIALEEIEDTVRGHSEVIDAAVIFHKVQGELML  410

Query  543  LEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            L A +I++E         +I +W+A KLP AMIP     TESFP+SSSGK++Y LLA+
Sbjct  411  LVAFIILREGIPKEIFGATIKSWMADKLPLAMIPGHIVVTESFPVSSSGKINYELLAD  468



>ref|XP_010661306.1| PREDICTED: putative acyl-activating enzyme 19 isoform X3 [Vitis 
vinifera]
Length=1135

 Score =   263 bits (673),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 162/215 (75%), Gaps = 4/215 (2%)
 Frame = +3

Query  81   EVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD-PNEGEICVSGLCLSA  257
            +VSGDCTYFDC  LP ILE  SLS VPIG+P+ +C+V+L+G+ D  NEGEICV+GLC++ 
Sbjct  361  QVSGDCTYFDCRRLPRILESDSLSSVPIGIPISNCNVMLVGESDTSNEGEICVNGLCVNI  420

Query  258  GYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQYFRTGDFARKLQNGNFIFLGRKDRTVK  431
            GYF  P+V+PLDY  LS     +    D+  Q YFRTGDFAR+LQ+G+ +FLGRKDRTVK
Sbjct  421  GYFPDPNVMPLDYSNLSHGSLCNCSINDNESQLYFRTGDFARRLQSGDLVFLGRKDRTVK  480

Query  432  ISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVEILRS-ITN  608
            I+G RIALEE+EN LR HP+V DAAVIFR  + +  LLEA +I+K  NE  E+LRS I  
Sbjct  481  INGQRIALEEIENALRGHPDVVDAAVIFRKGQGELELLEAFIILKRTNESDEVLRSCIGC  540

Query  609  WIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            W+  KLP  M+P  FFFT+SFPMS++GKVDY  LA
Sbjct  541  WMVEKLPLVMVPNNFFFTKSFPMSATGKVDYASLA  575



>ref|XP_010052601.1| PREDICTED: putative acyl-activating enzyme 19 [Eucalyptus grandis]
Length=1193

 Score =   263 bits (673),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 169/239 (71%), Gaps = 3/239 (1%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLWK L  +LP+T ILNLYGSTEV+GDCTYFDC+ LP++LE + LS VPIGLP+ +C
Sbjct  379  FSVSLWKELAGLLPKTTILNLYGSTEVAGDCTYFDCKRLPMMLEAEKLSNVPIGLPISNC  438

Query  186  DVLLLGDDDP-NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ--YF  356
            +V+L+G+DD  N GEI V G+C+ +GY   PS   LDYVEL  N     +D   Q+  + 
Sbjct  439  EVVLVGEDDELNHGEIYVGGVCILSGYMSEPSADSLDYVELPHNSSHYQSDEEYQRQLFI  498

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGDFAR+L +G+++FLGRKD  VKI+G RIAL E+E++LR+H  V DAAV+ R    + 
Sbjct  499  RTGDFARQLASGDYVFLGRKDHIVKINGQRIALGEIESMLRQHESVLDAAVVCRIGPEEL  558

Query  537  SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
              LEA L++ E     E+ RSI +W+  KLP AM+P  F F ESFP +SSGKVDY  L+
Sbjct  559  GQLEAFLLLNEKKRPSEVSRSIRHWMVEKLPYAMVPHHFIFLESFPRTSSGKVDYEFLS  617



>gb|KDO42619.1| hypothetical protein CISIN_1g0026152mg [Citrus sinensis]
 gb|KDO42620.1| hypothetical protein CISIN_1g0026152mg [Citrus sinensis]
Length=829

 Score =   259 bits (662),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 168/238 (71%), Gaps = 4/238 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            LS+W I+ K+ P  +ILNLYGSTEVSGDCTYFDC+ LP ILE  +L  VPIGLP+ +CD+
Sbjct  32   LSMWDIISKLFPNISILNLYGSTEVSGDCTYFDCKRLPSILEMSTLKSVPIGLPISNCDI  91

Query  192  LLLGDD--DPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSK-STDHRVQQYFRT  362
            +L+  D   P+EGEI   GLCLS GYF   + +P +YV+L  N     S     Q YFRT
Sbjct  92   VLVESDTVKPDEGEIYAGGLCLSNGYFSESTFMPSEYVKLHNNSICNCSVSCGSQTYFRT  151

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFAR++Q+G+ +FLGRKDRT+KI+G R+ALEE+E+ LR HP+V D AV+    + +  +
Sbjct  152  GDFARRIQSGDLVFLGRKDRTIKINGQRMALEEIEHTLRGHPDVVDTAVVSHKHQGELVI  211

Query  543  LEAHLIMKENNEHVEI-LRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            L A +++KE     EI L SI +W++ KLP AMIP RF F +S PM+SSGKVDY  L+
Sbjct  212  LVAFIVLKEKKTSSEIFLSSIKSWVSSKLPLAMIPNRFVFMDSLPMTSSGKVDYASLS  269



>ref|XP_007029807.1| AMP-dependent synthetase and ligase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY10309.1| AMP-dependent synthetase and ligase family protein, putative 
isoform 1 [Theobroma cacao]
Length=1195

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 173/237 (73%), Gaps = 4/237 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            L+LW +L  +LP+T++LNLYGSTEVSGDC YFDC+ LP ILE ++L+ VPIGLP+  C +
Sbjct  380  LALWNMLSSLLPKTSVLNLYGSTEVSGDCMYFDCKRLPSILEMQTLTTVPIGLPISKCSI  439

Query  192  LLLGDD-DPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRV--QQYFRT  362
            +L G++ +PNEGEI V GLC+S GYF   +++PL+  +L QN   K +      Q YFRT
Sbjct  440  VLNGENSNPNEGEIYVRGLCVSIGYFSENAIIPLNNAKLHQNSLCKCSMEACGSQVYFRT  499

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFA +L +G+ +FLGRKDRTVK++G RIALEEVEN LR H +V DAAVI   D+ + +L
Sbjct  500  GDFAHQLPSGDLVFLGRKDRTVKVNGQRIALEEVENTLRGHNDVIDAAVISHKDQGEDAL  559

Query  543  LEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            + A ++++E  E  E+ + SI NW+  KLP AM+P  F F +S PMS+SGKVDY +L
Sbjct  560  IVAFILLREKEESGEMFKTSIRNWMISKLPTAMVPTHFVFVKSLPMSASGKVDYTVL  616



>gb|KDO42618.1| hypothetical protein CISIN_1g0026152mg [Citrus sinensis]
Length=900

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 168/238 (71%), Gaps = 4/238 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            LS+W I+ K+ P  +ILNLYGSTEVSGDCTYFDC+ LP ILE  +L  VPIGLP+ +CD+
Sbjct  103  LSMWDIISKLFPNISILNLYGSTEVSGDCTYFDCKRLPSILEMSTLKSVPIGLPISNCDI  162

Query  192  LLLGDD--DPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSK-STDHRVQQYFRT  362
            +L+  D   P+EGEI   GLCLS GYF   + +P +YV+L  N     S     Q YFRT
Sbjct  163  VLVESDTVKPDEGEIYAGGLCLSNGYFSESTFMPSEYVKLHNNSICNCSVSCGSQTYFRT  222

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFAR++Q+G+ +FLGRKDRT+KI+G R+ALEE+E+ LR HP+V D AV+    + +  +
Sbjct  223  GDFARRIQSGDLVFLGRKDRTIKINGQRMALEEIEHTLRGHPDVVDTAVVSHKHQGELVI  282

Query  543  LEAHLIMKENNEHVEI-LRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            L A +++KE     EI L SI +W++ KLP AMIP RF F +S PM+SSGKVDY  L+
Sbjct  283  LVAFIVLKEKKTSSEIFLSSIKSWVSSKLPLAMIPNRFVFMDSLPMTSSGKVDYASLS  340



>gb|EYU42289.1| hypothetical protein MIMGU_mgv1a0007031mg, partial [Erythranthe 
guttata]
Length=575

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 168/238 (71%), Gaps = 16/238 (7%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
              HLSL K L+K+LPQT+ILNLYGSTEV+GDCTYFDC+ LPLILE + LS VP+GLPL +
Sbjct  349  VLHLSLCKTLLKLLPQTSILNLYGSTEVTGDCTYFDCKRLPLILEKEELSSVPVGLPLSN  408

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRT  362
            C+V+L+G+D P +GEI VSGLC++AGYF YP ++PL                RVQ+YF+T
Sbjct  409  CEVVLVGEDAPLQGEIYVSGLCVAAGYFDYPYLIPL--------------ADRVQKYFKT  454

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFARKL +G+ + LGRKDRT+K++G R+ALEE+E   R+HP V DAAV+ R    +  L
Sbjct  455  GDFARKLSSGDLVILGRKDRTLKVNGQRVALEEIETAFRDHPSVVDAAVLSREVDGEILL  514

Query  543  LEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            LEAH++M+E NE  E+L+ S+ NW+   LP          T++   + SGKVDY  LA
Sbjct  515  LEAHVVMEEKNEDDELLKSSLRNWLLNMLPLGYDTDSHIVTDTL-WTLSGKVDYMSLA  571



>ref|XP_006484719.1| PREDICTED: putative acyl-activating enzyme 19-like [Citrus sinensis]
Length=1163

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 169/238 (71%), Gaps = 4/238 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            LS+W I+ K+ P+ +ILNLYGSTEVSGDCTYFDC+ LP ILE  +L  VPIGLP+ +CD+
Sbjct  366  LSMWGIISKLFPKISILNLYGSTEVSGDCTYFDCKRLPSILEMNTLESVPIGLPISNCDI  425

Query  192  LLLGDD--DPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSK-STDHRVQQYFRT  362
            +L+  D   P+EGEI V GLCLS GYF    V+P +YV+L  N     S     Q YFRT
Sbjct  426  VLVESDTGKPDEGEIYVGGLCLSNGYFSESIVMPSEYVKLHNNSICNCSVSCGSQMYFRT  485

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFAR++Q+G+ +FLGRKDRT+KISG R+ALEE+E+ LR HP+V D AV+    + +  +
Sbjct  486  GDFARRIQSGDLVFLGRKDRTIKISGQRMALEEIEHTLRGHPDVVDTAVVSHKHQGELVI  545

Query  543  LEAHLIMKENNEHVE-ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            LEA +++KE     E  + SI +W++ KL  AMIP RF F +S PM+SSGKVDY  L+
Sbjct  546  LEAFIVLKEKKTSSEAFVSSIKSWVSNKLSLAMIPSRFVFMDSLPMTSSGKVDYASLS  603



>ref|XP_009361407.1| PREDICTED: putative acyl-activating enzyme 19 isoform X2 [Pyrus 
x bretschneideri]
Length=1132

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 177/240 (74%), Gaps = 7/240 (3%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLI--LEHKSLSGVPIGLPLQSC  185
            LSLW++L KILP+T+ILNLYGSTEVSGDCTYFDC+ LP+I  LE  +L+ VPIG+P+ +C
Sbjct  346  LSLWEMLSKILPRTSILNLYGSTEVSGDCTYFDCKRLPMIFPLETDTLTSVPIGMPIVNC  405

Query  186  DVLLL-GDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKST--DHRVQQYF  356
            D++L+ GD   +EGEICV+G+C S+GY+   +  PLD V + Q+    S+   HR Q YF
Sbjct  406  DIVLVDGDGVSSEGEICVAGVCNSSGYYSDSTFTPLDTVNVLQDSACCSSVNGHRSQSYF  465

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGDFA++L +G+ +FLGRKDRT+K +G RIALEE+E+ LR HP+V DAAVIF   + + 
Sbjct  466  RTGDFAKQLPSGDLVFLGRKDRTIKYNGQRIALEEIEDTLRGHPDVKDAAVIFHKVQGEL  525

Query  537  SLLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
              L A +I++E     EILR SI +W+A  LP  MIP     +ESFP+SSSGK+DY LLA
Sbjct  526  MSLVAFVILREGRPS-EILRSSIKSWMADILPSVMIPGHIVISESFPVSSSGKIDYELLA  584



>ref|XP_009361406.1| PREDICTED: putative acyl-activating enzyme 19 isoform X1 [Pyrus 
x bretschneideri]
Length=1152

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 177/240 (74%), Gaps = 7/240 (3%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLI--LEHKSLSGVPIGLPLQSC  185
            LSLW++L KILP+T+ILNLYGSTEVSGDCTYFDC+ LP+I  LE  +L+ VPIG+P+ +C
Sbjct  346  LSLWEMLSKILPRTSILNLYGSTEVSGDCTYFDCKRLPMIFPLETDTLTSVPIGMPIVNC  405

Query  186  DVLLL-GDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKST--DHRVQQYF  356
            D++L+ GD   +EGEICV+G+C S+GY+   +  PLD V + Q+    S+   HR Q YF
Sbjct  406  DIVLVDGDGVSSEGEICVAGVCNSSGYYSDSTFTPLDTVNVLQDSACCSSVNGHRSQSYF  465

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGDFA++L +G+ +FLGRKDRT+K +G RIALEE+E+ LR HP+V DAAVIF   + + 
Sbjct  466  RTGDFAKQLPSGDLVFLGRKDRTIKYNGQRIALEEIEDTLRGHPDVKDAAVIFHKVQGEL  525

Query  537  SLLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
              L A +I++E     EILR SI +W+A  LP  MIP     +ESFP+SSSGK+DY LLA
Sbjct  526  MSLVAFVILREGRPS-EILRSSIKSWMADILPSVMIPGHIVISESFPVSSSGKIDYELLA  584



>gb|AET02133.2| AMP-dependent synthetase and ligase family protein [Medicago 
truncatula]
Length=1193

 Score =   256 bits (654),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 177/242 (73%), Gaps = 4/242 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            TF  +LW+ L  ILP+T+ILNLYGSTEVSGDCTYFDC+ +PL+L+ + L+ VPIGLP+ +
Sbjct  382  TFPYTLWETLSTILPKTSILNLYGSTEVSGDCTYFDCKRIPLVLKEEMLTSVPIGLPITN  441

Query  183  CDVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ--Y  353
            C+V+L+G++  PNEGE+ V G C+  GY+    ++   +V+L QN+  +++    Q   Y
Sbjct  442  CNVVLIGENGAPNEGELYVGGSCIFRGYYDESDIMSEGFVKLPQNYGCENSVDVFQSELY  501

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            FRTGD  ++L +G+FIFLGRKDR VK+ G RI+LEEVEN+LREHP + DAAV+ RN + +
Sbjct  502  FRTGDLVKQLPSGDFIFLGRKDRIVKVHGQRISLEEVENLLREHPNINDAAVVCRNLQAE  561

Query  534  TSLLEAHLIMKENNEHVEIL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               +EA +I+K+  +  E+L  +I +W+  KLP   +P RF FTESFP+SSSGKV+Y LL
Sbjct  562  LVFIEAFIILKDKQQLGELLVPAIRSWMINKLPSVWLPNRFIFTESFPISSSGKVNYELL  621

Query  711  AN  716
             +
Sbjct  622  VS  623



>ref|XP_010556078.1| PREDICTED: LOW QUALITY PROTEIN: putative acyl-activating enzyme 
19 [Tarenaya hassleriana]
Length=864

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 166/243 (68%), Gaps = 10/243 (4%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F LSLW  L  +LP+T ILNLYGSTEVSGDCTYFDC  LP +L  + ++ VPIGLP+ +C
Sbjct  53   FPLSLWSTLQNLLPRTCILNLYGSTEVSGDCTYFDCRRLPKLLMTEKIASVPIGLPISNC  112

Query  186  DVLLLGDDDPN-EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRV-----Q  347
            +++++ D D + EGEICV GLCLS GY  +   L  DYV+L   H +   DH       Q
Sbjct  113  EIVVIQDSDISYEGEICVGGLCLSRGYL-HTWTLSRDYVKL---HGNSVCDHLTNGCGSQ  168

Query  348  QYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK  527
             YFRTGD+ RKL +G+ +FLGR+DRT+K++G RI+LEE+E  L  HP VA+A V+   D+
Sbjct  169  LYFRTGDYGRKLPSGDLVFLGRRDRTIKLNGQRISLEEIERTLERHPGVAEAVVVLNRDQ  228

Query  528  RDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNL  707
             + +LLEA L++K+      I+ SI NW+A KLP  MIP  F F ES P+SS+GKVDY  
Sbjct  229  EELALLEAFLVLKKEAGSDNIIYSIRNWLADKLPSVMIPKHFVFMESLPVSSNGKVDYEA  288

Query  708  LAN  716
            LA 
Sbjct  289  LAG  291



>ref|XP_010556089.1| PREDICTED: putative acyl-activating enzyme 19 [Tarenaya hassleriana]
Length=887

 Score =   251 bits (642),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 166/244 (68%), Gaps = 10/244 (4%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F LSLW  L  +LP+T ILNLYGSTEVSGDCTYFDC  LP +L  + ++ VPIGLP+ +
Sbjct  372  VFPLSLWSTLQNLLPRTCILNLYGSTEVSGDCTYFDCRRLPKLLMTEKIASVPIGLPISN  431

Query  183  CDVLLLGDDDPN-EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRV-----  344
            C+++++ D D + EGEICV GLCLS GY  +   L  DYV+L   H +   DH       
Sbjct  432  CEIVVIQDSDISYEGEICVGGLCLSRGYL-HTWTLSRDYVKL---HGNSVCDHLTNGCGS  487

Query  345  QQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRND  524
            Q YFRTGD+ RKL +G+ +FLGR+DRT+K++G RI+LEE+E  L  HP VA+A V+   D
Sbjct  488  QLYFRTGDYGRKLPSGDLVFLGRRDRTIKLNGQRISLEEIERTLERHPGVAEAVVVLNRD  547

Query  525  KRDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYN  704
            + + +LLEA L++K+      I+ SI NW+A KLP  MIP  F F ES P+SS+GKVDY 
Sbjct  548  QEELALLEAFLVLKKEAGSDNIIYSIRNWLADKLPSVMIPKHFVFMESLPVSSNGKVDYE  607

Query  705  LLAN  716
             LA 
Sbjct  608  ALAG  611



>ref|XP_002325887.2| hypothetical protein POPTR_0019s06060g [Populus trichocarpa]
 gb|EEF00269.2| hypothetical protein POPTR_0019s06060g [Populus trichocarpa]
Length=1202

 Score =   252 bits (644),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 168/243 (69%), Gaps = 9/243 (4%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F LSLW  L  +LP+T ILNLYG+TEVSGDCTYFDC+ LP ILE ++L+ +PIGLP+ +C
Sbjct  382  FSLSLWDALSTLLPRTTILNLYGTTEVSGDCTYFDCKRLPAILETEALTSIPIGLPISNC  441

Query  186  DVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHD----SKSTDHRVQQ  350
            DV L+ + D  NEGEI V GLC+S GY+   +V    ++  + + D    S   +   Q 
Sbjct  442  DVALICESDTSNEGEIYVGGLCVSNGYYSESTVT--SFISANPHMDNICNSSVDNWGCQA  499

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
            Y+RTGDFA++LQNG+ +FLGR DRTVKI+G RI LEE+EN LR HP+VADAAVI R    
Sbjct  500  YYRTGDFAQRLQNGDLVFLGRTDRTVKINGQRIVLEEIENTLRGHPDVADAAVISREGPG  559

Query  531  DTSLLEAHLIMK--ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYN  704
            +   L+A L+ K  E +E   +  SI  W+  K+P AM+P RF  TES PMSS+GKVDY 
Sbjct  560  ELLFLDAILLFKEREKSEDFFVRSSIRKWMVDKVPLAMVPNRFVITESLPMSSTGKVDYA  619

Query  705  LLA  713
            LLA
Sbjct  620  LLA  622



>ref|XP_008457169.1| PREDICTED: putative acyl-activating enzyme 19 isoform X3 [Cucumis 
melo]
Length=1084

 Score =   251 bits (640),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 173/240 (72%), Gaps = 5/240 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            T  + LW  LVK+LP+T ILNLYGSTEVSGDCTYFDC+ +P+ILE  +++ +PIG+P+  
Sbjct  367  TLPIQLWDALVKLLPETTILNLYGSTEVSGDCTYFDCKKMPMILETDAINTIPIGVPISH  426

Query  183  CDVLLLGDDDP-NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN--HDSKSTDHRVQQY  353
            CDV+++GD+D  N+GE+CV G C+ +GY+     LPLD ++ SQ+  H+     +  Q Y
Sbjct  427  CDVVVVGDNDALNQGELCVGGPCVCSGYYSDSIFLPLDGIKFSQDFIHEGSFNVNCSQIY  486

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             RTGDF ++L++G+ +FLGRKDR +K++G RI+LEE+E+ LREHP+V DAAV+ R    +
Sbjct  487  IRTGDFVQQLRSGDLVFLGRKDRIIKVNGQRISLEEIEDALREHPDVVDAAVVSRKSDWE  546

Query  534  TSLLEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L A L++K+N +  E+ RS + +W+  K+  AMIP  FFF +S P ++SGKVDY +L
Sbjct  547  LEYLVAFLVLKDNMKS-EVFRSPVRSWMVEKVSLAMIPNSFFFIDSIPKTTSGKVDYEIL  605



>ref|XP_004510927.1| PREDICTED: putative acyl-activating enzyme 19-like [Cicer arietinum]
Length=1193

 Score =   251 bits (641),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 175/242 (72%), Gaps = 4/242 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            TF  +LW+ L  ILP+T+ILNLYGSTEV+GDCTYFDC  +PLIL+ + L+ VPIGLP+ +
Sbjct  387  TFPFALWEKLSTILPKTSILNLYGSTEVAGDCTYFDCNRIPLILKEEMLTNVPIGLPITN  446

Query  183  CDVLLLGDDDP-NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ--Y  353
            C V+L+G++   NEGE+ V G C+  GYF    ++   +V+L Q++  + +    Q   Y
Sbjct  447  CKVVLIGENSASNEGELYVGGSCIFRGYFNESDIMSDGFVKLPQSYGCEDSVDACQSELY  506

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            FRTGDF ++L +G+FIFLGRKDR VK++G RIALEEVEN+LREHP + DAAV+ RN + +
Sbjct  507  FRTGDFVKQLPSGDFIFLGRKDRIVKVNGQRIALEEVENLLREHPHINDAAVVCRNLQSE  566

Query  534  TSLLEAHLIMKENNEHVEIL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              L+EA +I+K+  +  E+L  +I +W+  KLP  ++P RF F ESFPMS SGK++Y +L
Sbjct  567  LVLIEAFVILKDKQQLGELLVPAIRSWMLNKLPLVVLPNRFIFIESFPMSFSGKINYEIL  626

Query  711  AN  716
             +
Sbjct  627  VS  628



>ref|XP_008457170.1| PREDICTED: putative acyl-activating enzyme 19 isoform X4 [Cucumis 
melo]
Length=1076

 Score =   250 bits (639),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 173/240 (72%), Gaps = 5/240 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            T  + LW  LVK+LP+T ILNLYGSTEVSGDCTYFDC+ +P+ILE  +++ +PIG+P+  
Sbjct  367  TLPIQLWDALVKLLPETTILNLYGSTEVSGDCTYFDCKKMPMILETDAINTIPIGVPISH  426

Query  183  CDVLLLGDDDP-NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN--HDSKSTDHRVQQY  353
            CDV+++GD+D  N+GE+CV G C+ +GY+     LPLD ++ SQ+  H+     +  Q Y
Sbjct  427  CDVVVVGDNDALNQGELCVGGPCVCSGYYSDSIFLPLDGIKFSQDFIHEGSFNVNCSQIY  486

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             RTGDF ++L++G+ +FLGRKDR +K++G RI+LEE+E+ LREHP+V DAAV+ R    +
Sbjct  487  IRTGDFVQQLRSGDLVFLGRKDRIIKVNGQRISLEEIEDALREHPDVVDAAVVSRKSDWE  546

Query  534  TSLLEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L A L++K+N +  E+ RS + +W+  K+  AMIP  FFF +S P ++SGKVDY +L
Sbjct  547  LEYLVAFLVLKDNMKS-EVFRSPVRSWMVEKVSLAMIPNSFFFIDSIPKTTSGKVDYEIL  605



>ref|XP_008457168.1| PREDICTED: putative acyl-activating enzyme 19 isoform X2 [Cucumis 
melo]
Length=1179

 Score =   251 bits (640),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 173/240 (72%), Gaps = 5/240 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            T  + LW  LVK+LP+T ILNLYGSTEVSGDCTYFDC+ +P+ILE  +++ +PIG+P+  
Sbjct  367  TLPIQLWDALVKLLPETTILNLYGSTEVSGDCTYFDCKKMPMILETDAINTIPIGVPISH  426

Query  183  CDVLLLGDDDP-NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN--HDSKSTDHRVQQY  353
            CDV+++GD+D  N+GE+CV G C+ +GY+     LPLD ++ SQ+  H+     +  Q Y
Sbjct  427  CDVVVVGDNDALNQGELCVGGPCVCSGYYSDSIFLPLDGIKFSQDFIHEGSFNVNCSQIY  486

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             RTGDF ++L++G+ +FLGRKDR +K++G RI+LEE+E+ LREHP+V DAAV+ R    +
Sbjct  487  IRTGDFVQQLRSGDLVFLGRKDRIIKVNGQRISLEEIEDALREHPDVVDAAVVSRKSDWE  546

Query  534  TSLLEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L A L++K+N +  E+ RS + +W+  K+  AMIP  FFF +S P ++SGKVDY +L
Sbjct  547  LEYLVAFLVLKDNMKS-EVFRSPVRSWMVEKVSLAMIPNSFFFIDSIPKTTSGKVDYEIL  605



>ref|XP_008457167.1| PREDICTED: putative acyl-activating enzyme 19 isoform X1 [Cucumis 
melo]
Length=1199

 Score =   251 bits (640),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 173/240 (72%), Gaps = 5/240 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            T  + LW  LVK+LP+T ILNLYGSTEVSGDCTYFDC+ +P+ILE  +++ +PIG+P+  
Sbjct  367  TLPIQLWDALVKLLPETTILNLYGSTEVSGDCTYFDCKKMPMILETDAINTIPIGVPISH  426

Query  183  CDVLLLGDDDP-NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN--HDSKSTDHRVQQY  353
            CDV+++GD+D  N+GE+CV G C+ +GY+     LPLD ++ SQ+  H+     +  Q Y
Sbjct  427  CDVVVVGDNDALNQGELCVGGPCVCSGYYSDSIFLPLDGIKFSQDFIHEGSFNVNCSQIY  486

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             RTGDF ++L++G+ +FLGRKDR +K++G RI+LEE+E+ LREHP+V DAAV+ R    +
Sbjct  487  IRTGDFVQQLRSGDLVFLGRKDRIIKVNGQRISLEEIEDALREHPDVVDAAVVSRKSDWE  546

Query  534  TSLLEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L A L++K+N +  E+ RS + +W+  K+  AMIP  FFF +S P ++SGKVDY +L
Sbjct  547  LEYLVAFLVLKDNMKS-EVFRSPVRSWMVEKVSLAMIPNSFFFIDSIPKTTSGKVDYEIL  605



>ref|XP_004138998.1| PREDICTED: putative acyl-activating enzyme 19-like [Cucumis sativus]
Length=1209

 Score =   250 bits (639),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 174/250 (70%), Gaps = 13/250 (5%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTE--------VSGDCTYFDCESLPLILEHKSLSGV  158
            T  + LW  LVK+LP+T ILNLYGSTE        VSGDCTYFDC+ +P+ILE  ++  V
Sbjct  368  TLPILLWDALVKLLPETTILNLYGSTEYLNFLNKKVSGDCTYFDCKKMPMILETDAIKTV  427

Query  159  PIGLPLQSCDVLLLGDDDP-NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN--HDSKS  329
            PIG+P+  CDV+++GD+D  N GE+CV G C+ +GY+     LPLD ++ SQ+  H+   
Sbjct  428  PIGVPISHCDVVVVGDNDALNLGELCVGGPCVCSGYYSDSVFLPLDGIKFSQDFIHEGSF  487

Query  330  TDHRVQQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAV  509
                 Q Y RTGDF ++L++G+ +FLGRKDR +K++G RI+LEE+E+ LREHP+V DAAV
Sbjct  488  NVTCSQIYIRTGDFVQQLRSGDLVFLGRKDRIIKVNGQRISLEEIEDALREHPDVVDAAV  547

Query  510  IFRNDKRDTSLLEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSS  686
            + R    +   L A L++K+ NE  E+ RS + +W+  K+P AMIP  FFFT+S PM++S
Sbjct  548  VSRKSDWELEYLVAFLVLKD-NEKSEVFRSTVRSWMVEKVPLAMIPNSFFFTDSIPMTTS  606

Query  687  GKVDYNLLAN  716
            GKVDY +L +
Sbjct  607  GKVDYEILTH  616



>gb|EPS71901.1| hypothetical protein M569_02857, partial [Genlisea aurea]
Length=625

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 157/231 (68%), Gaps = 7/231 (3%)
 Frame = +3

Query  24   KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLG  203
            K+ + +LPQT ILNLYGS+EV+GDCTYFDC+ LP+ILE+  LS VPIGLP+ +CDV L G
Sbjct  373  KMFLDLLPQTLILNLYGSSEVAGDCTYFDCKRLPMILENHELSSVPIGLPISNCDVFLAG  432

Query  204  DDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKL  383
               P +GEICVSGLCL+ GYF YP      Y++          D     +FRTGD A+KL
Sbjct  433  QGAPYQGEICVSGLCLAKGYFDYP------YLKSLSQLSLSPEDGPTPFHFRTGDLAQKL  486

Query  384  QNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIM  563
             +G+ +FLGRKDR++KISG RIALEEVE+   +HP+V DAAV+ R    +   LEAH+++
Sbjct  487  PSGDLVFLGRKDRSIKISGQRIALEEVEDAFLDHPDVMDAAVLSREVNGEILFLEAHVVV  546

Query  564  KENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            K   E  E L+ S+ NW+  KLP AM+P    F+   P++SSGKVDY  L 
Sbjct  547  KNAIEDHESLKFSLRNWVLGKLPQAMVPTYIVFSNGLPLTSSGKVDYATLV  597



>gb|KDP39582.1| hypothetical protein JCGZ_02602 [Jatropha curcas]
Length=697

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 168/240 (70%), Gaps = 4/240 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F LSLW +L  +LP+T+ILNLYGSTEVSGDCTYFDC+ LP ILE ++L+ VPIG+P+ +
Sbjct  356  VFPLSLWDLLSNLLPRTSILNLYGSTEVSGDCTYFDCKRLPAILETEALTSVPIGVPISN  415

Query  183  CDVLLLGD-DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQY  353
            CDVLL+G+ D P +GEICV GLC+ +GY    +++P D V++ +N   +    D   Q Y
Sbjct  416  CDVLLIGETDTPIQGEICVGGLCVCSGYSSKSAIMPFDSVKMHKNFVCNCLVDDCGSQVY  475

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVI-FRNDKR  530
            +RTGDFA++LQ G+ +FLGR DR++K++G RIALEE+E+ LR HP+V DAAVI F    +
Sbjct  476  YRTGDFAQRLQCGDLVFLGRTDRSIKVNGQRIALEEIEDTLRGHPDVVDAAVISFDGPDK  535

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L    L+  ++     +  SI +W+  K+P  MIP  F FTE  P+SSSGKVDY LL
Sbjct  536  LLLLKAFLLLKDKDKSGDSVRSSIRSWMVGKVPLVMIPNHFVFTELLPISSSGKVDYALL  595



>emb|CDY65676.1| BnaCnng48170D [Brassica napus]
Length=1165

 Score =   247 bits (631),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 164/241 (68%), Gaps = 5/241 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            TF LSLW  L K+LP T  LNLYGSTEVSGDCTYFDC  LP +LE + +  VPIG P+ +
Sbjct  338  TFPLSLWDSLHKLLPDTCFLNLYGSTEVSGDCTYFDCSRLPKLLETEKIGSVPIGKPISN  397

Query  183  CDVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQY  353
            C +LLLGD+D P EGEICV GLCLS GY  + S+    YV L      +  ++D   Q Y
Sbjct  398  CKILLLGDEDKPCEGEICVGGLCLSQGYL-HSSIESQSYVMLHNTSLCNHLTSDCGSQLY  456

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            +RTGD+ RKL +G+F+F+GR+DRTVK++GHR++LEE+E  L  +P V +A VI   D+ +
Sbjct  457  YRTGDYGRKLSSGDFVFIGRRDRTVKVNGHRLSLEEMETTLELNPYVTEAVVILNRDQTE  516

Query  534  TSLLEAHLIM-KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             + L+A L++ KE     +++ SI NW+  KLP AMIP  F   ES P +SSGKVDY  L
Sbjct  517  LASLDAFLVLNKETKPDEDVIYSIRNWMREKLPSAMIPNHFVLVESLPSTSSGKVDYEAL  576

Query  711  A  713
            A
Sbjct  577  A  577



>ref|XP_011012746.1| PREDICTED: putative acyl-activating enzyme 19 isoform X4 [Populus 
euphratica]
Length=987

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/243 (53%), Positives = 167/243 (69%), Gaps = 9/243 (4%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F LSLW  L  +LP+T ILNLYG+TEVSGDCTYFDC+ LP ILE ++L+ +PIGLP+ +C
Sbjct  375  FSLSLWDALSTLLPRTTILNLYGTTEVSGDCTYFDCKRLPAILETEALTSIPIGLPISNC  434

Query  186  DVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHD----SKSTDHRVQQ  350
            DV L+ + D  N+GEI V GLC+S GY+   +V    ++  + + D    S   +   Q 
Sbjct  435  DVALICESDTSNKGEIYVGGLCVSNGYYSESTV--TSFISANPHMDNICNSSVDNWGCQA  492

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
            Y+RTGDFA++LQNG+ +FLGR DRTVKI+G RI LEE+EN LR H +VADAAVI R    
Sbjct  493  YYRTGDFAQRLQNGDLVFLGRTDRTVKINGQRIVLEEIENTLRGHADVADAAVISREGPG  552

Query  531  DTSLLEAHLIMK--ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYN  704
            +   L+A L+ K  E +E   +  SI  W+  K+P AM+P RF  TES P+SS+GKVDY 
Sbjct  553  ELLFLDAILLFKEREKSEDFFVRSSIRKWMVDKVPLAMVPNRFVITESLPISSTGKVDYA  612

Query  705  LLA  713
            LLA
Sbjct  613  LLA  615



>ref|XP_011012745.1| PREDICTED: putative acyl-activating enzyme 19 isoform X3 [Populus 
euphratica]
Length=1020

 Score =   246 bits (628),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/243 (53%), Positives = 167/243 (69%), Gaps = 9/243 (4%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F LSLW  L  +LP+T ILNLYG+TEVSGDCTYFDC+ LP ILE ++L+ +PIGLP+ +C
Sbjct  375  FSLSLWDALSTLLPRTTILNLYGTTEVSGDCTYFDCKRLPAILETEALTSIPIGLPISNC  434

Query  186  DVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHD----SKSTDHRVQQ  350
            DV L+ + D  N+GEI V GLC+S GY+   +V    ++  + + D    S   +   Q 
Sbjct  435  DVALICESDTSNKGEIYVGGLCVSNGYYSESTV--TSFISANPHMDNICNSSVDNWGCQA  492

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
            Y+RTGDFA++LQNG+ +FLGR DRTVKI+G RI LEE+EN LR H +VADAAVI R    
Sbjct  493  YYRTGDFAQRLQNGDLVFLGRTDRTVKINGQRIVLEEIENTLRGHADVADAAVISREGPG  552

Query  531  DTSLLEAHLIMK--ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYN  704
            +   L+A L+ K  E +E   +  SI  W+  K+P AM+P RF  TES P+SS+GKVDY 
Sbjct  553  ELLFLDAILLFKEREKSEDFFVRSSIRKWMVDKVPLAMVPNRFVITESLPISSTGKVDYA  612

Query  705  LLA  713
            LLA
Sbjct  613  LLA  615



>ref|XP_011012743.1| PREDICTED: putative acyl-activating enzyme 19 isoform X1 [Populus 
euphratica]
Length=1200

 Score =   246 bits (627),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 167/244 (68%), Gaps = 9/244 (4%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F LSLW  L  +LP+T ILNLYG+TEVSGDCTYFDC+ LP ILE ++L+ +PIGLP+ +
Sbjct  374  VFSLSLWDALSTLLPRTTILNLYGTTEVSGDCTYFDCKRLPAILETEALTSIPIGLPISN  433

Query  183  CDVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHD----SKSTDHRVQ  347
            CDV L+ + D  N+GEI V GLC+S GY+   +V    ++  + + D    S   +   Q
Sbjct  434  CDVALICESDTSNKGEIYVGGLCVSNGYYSESTV--TSFISANPHMDNICNSSVDNWGCQ  491

Query  348  QYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK  527
             Y+RTGDFA++LQNG+ +FLGR DRTVKI+G RI LEE+EN LR H +VADAAVI R   
Sbjct  492  AYYRTGDFAQRLQNGDLVFLGRTDRTVKINGQRIVLEEIENTLRGHADVADAAVISREGP  551

Query  528  RDTSLLEAHLIMK--ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDY  701
             +   L+A L+ K  E +E   +  SI  W+  K+P AM+P RF  TES P+SS+GKVDY
Sbjct  552  GELLFLDAILLFKEREKSEDFFVRSSIRKWMVDKVPLAMVPNRFVITESLPISSTGKVDY  611

Query  702  NLLA  713
             LLA
Sbjct  612  ALLA  615



>ref|XP_004307155.1| PREDICTED: putative acyl-activating enzyme 19-like [Fragaria 
vesca subsp. vesca]
Length=1126

 Score =   244 bits (624),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 172/238 (72%), Gaps = 3/238 (1%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            LSLW +L K LP+T+ILNLYGSTEVSGDCTYFDC+ LP+ILE ++L+ VPIG+P+  CDV
Sbjct  336  LSLWDMLSKRLPRTSILNLYGSTEVSGDCTYFDCKRLPMILETETLTSVPIGIPIAGCDV  395

Query  192  LLLGDDDPN-EGEICVSGLCLSAGYFCYPSVLPLDYVEL--SQNHDSKSTDHRVQQYFRT  362
            +++ DDD   EGEI V+GLC S+GY+   +  PLD V+L  S   DS    H  + YF+T
Sbjct  396  VIVSDDDVLDEGEIFVAGLCNSSGYYSDSTFTPLDTVKLPPSSLCDSSVNGHESRSYFQT  455

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFA++L +G+ +FLGRKDRT+K +G RIALEE+E++L  HP+V DAAV+F + + +   
Sbjct  456  GDFAKQLHSGDLVFLGRKDRTIKHNGQRIALEEIEHILVGHPDVTDAAVVFHHGQGELMQ  515

Query  543  LEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            L A +I+KE         SI +W+  KLP AMIP R    +SFP+S+SGKVDY LLA+
Sbjct  516  LVAFIILKEGQSDETFRSSIKSWMVDKLPLAMIPGRIVIMKSFPVSTSGKVDYTLLAD  573



>ref|XP_010097707.1| Putative acyl-activating enzyme 19 [Morus notabilis]
 gb|EXB70662.1| Putative acyl-activating enzyme 19 [Morus notabilis]
Length=1120

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/243 (52%), Positives = 171/243 (70%), Gaps = 6/243 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            T  L LW+ L ++ P+T+ILNLYGSTEVSGDCTYFDC+ LP I+E ++L+ VPIG+P+ +
Sbjct  328  TLPLDLWETLSRVFPKTSILNLYGSTEVSGDCTYFDCKRLPKIVESETLTSVPIGVPIAN  387

Query  183  CDVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQ---NHDSKSTDHRVQQ  350
            CDV+L+ DD+  ++GEI VSG+C S GYF   + + L+ V+L Q   N  S +  H    
Sbjct  388  CDVVLVDDDNLADQGEIYVSGICNSTGYFSDSTYMSLEQVKLPQDCANSGSAADGHGDIL  447

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
            YFRTGDFA++L+ G+F+FLGRKDRT+K++  RIALEE+E  LR HP+V +AAVI      
Sbjct  448  YFRTGDFAKRLEGGDFVFLGRKDRTIKLNAQRIALEEIEGALRGHPDVINAAVISHKILG  507

Query  531  DTSLLEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNL  707
               LL A LI+K+   + EILRS I +W+  KLP  M+P  F + E+FPM+ SGKVDY  
Sbjct  508  KIELLVAFLILKKERCN-EILRSHIKSWMLGKLPLVMVPNFFIYAEAFPMTYSGKVDYKS  566

Query  708  LAN  716
            L +
Sbjct  567  LTS  569



>ref|XP_010942743.1| PREDICTED: putative acyl-activating enzyme 19 [Elaeis guineensis]
Length=1193

 Score =   242 bits (618),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 170/250 (68%), Gaps = 27/250 (11%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SLW+ + KILP+T ILNLYGSTEVSGDC YFDC++LP ILE +  S VPIG+P+ +C  
Sbjct  373  ISLWRSVQKILPKTTILNLYGSTEVSGDCMYFDCKNLPTILEVEPPSSVPIGIPISNCKA  432

Query  192  LLLGD-DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
            +L+G+ D P+EGEI V G CLS GYF  P +             +   D+    +++TGD
Sbjct  433  VLVGEPDKPDEGEIYVEGACLSIGYFGEPLI------------GNPIMDNGSPLHYKTGD  480

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
            FAR+LQ+G+ +FLGR+DR +K++G R+ALEE+EN LREHPEV+DAAVIF       S L+
Sbjct  481  FARRLQSGDLVFLGRRDRIIKVNGQRVALEEIENTLREHPEVSDAAVIFHATHGVPSHLD  540

Query  549  AHLIMK-------ENNEHV-------EILRSITNWIARKLPPAMIPVRFFFTESFPMSSS  686
            A++++K       E+  H        +++ SI +W+ +KLPP MIP  FF T+S P S+S
Sbjct  541  AYIMLKIIGESQEEHKSHTDEHHLIEDLITSIRSWLIKKLPPVMIPSHFFCTKSLPKSTS  600

Query  687  GKVDYNLLAN  716
            GK+DY+ LAN
Sbjct  601  GKIDYSKLAN  610



>ref|XP_002870455.1| hypothetical protein ARALYDRAFT_330218 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46714.1| hypothetical protein ARALYDRAFT_330218 [Arabidopsis lyrata subsp. 
lyrata]
Length=1120

 Score =   240 bits (613),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 166/241 (69%), Gaps = 6/241 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLW  L  +LP+T  LNLYGSTEVSGDCTYFDC  LP IL+ + +  VPIG P+ +C
Sbjct  321  FPVSLWDSLHSLLPETCFLNLYGSTEVSGDCTYFDCSGLPRILKTEEIGSVPIGKPISNC  380

Query  186  DVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH---DSKSTDHRVQQY  353
             VLL GD+D P EGEICV GLC+S GY  + S+    YV+L  N    +  + D   + Y
Sbjct  381  KVLLFGDEDKPYEGEICVGGLCISQGYM-HSSIESQGYVKLHNNKSLCNHLTNDCGSELY  439

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            +RTGD+ R+L +G+ IF+GR+DRTVK++G R+ALEE+E  L  +P+VA+A V+   D+++
Sbjct  440  YRTGDYGRQLSSGDLIFIGRRDRTVKLNGKRMALEEIETTLELNPDVAEAVVLLSRDEKE  499

Query  534  TSLLEAHLIM-KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             + L+A L++ KE+N    I+ SI NW++ KLP  MIP  F   ES P+++SGKV+Y  L
Sbjct  500  LASLKAFLVLNKESNSGDGIIFSIRNWMSEKLPTVMIPNHFLLVESLPLTASGKVNYEAL  559

Query  711  A  713
            A
Sbjct  560  A  560



>ref|NP_198442.2| AMP-dependent synthetase and ligase family protein [Arabidopsis 
thaliana]
 sp|F4K1G2.1|AEE19_ARATH RecName: Full=Putative acyl-activating enzyme 19 [Arabidopsis 
thaliana]
 gb|AED94029.1| AMP-dependent synthetase and ligase family protein [Arabidopsis 
thaliana]
Length=1040

 Score =   239 bits (611),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 165/240 (69%), Gaps = 5/240 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLW  L  +LP+T  LNLYGSTEVSGDCTYFDC  LP +L+ + +  VPIG  + +C
Sbjct  235  FPVSLWDSLHSLLPETCFLNLYGSTEVSGDCTYFDCSELPRLLKTEEIGSVPIGKSISNC  294

Query  186  DVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQYF  356
             V+LLGD+D P EGEICVSGLCLS GY  + S+    YV+L  N   +  + D   Q Y+
Sbjct  295  KVVLLGDEDKPYEGEICVSGLCLSQGYM-HSSIESEGYVKLHNNSLCNHLTNDCGSQLYY  353

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGD+ R+L +G+ IF+GR+DRTVK++G R+ALEE+E  L  +P++A+A V+   D+ + 
Sbjct  354  RTGDYGRQLSSGDLIFIGRRDRTVKLNGKRMALEEIETTLELNPDIAEAVVLLSRDETEL  413

Query  537  SLLEAHLIM-KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            + L+A +++ KE+N    I+ SI NW+  KLPP MIP  F   E  P++SSGKVDY  LA
Sbjct  414  ASLKAFVVLNKESNSSDGIIFSIRNWMGGKLPPVMIPNHFVLVEKLPLTSSGKVDYEALA  473



>dbj|BAA97455.1| unnamed protein product [Arabidopsis thaliana]
Length=1175

 Score =   240 bits (612),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 165/240 (69%), Gaps = 5/240 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLW  L  +LP+T  LNLYGSTEVSGDCTYFDC  LP +L+ + +  VPIG  + +C
Sbjct  327  FPVSLWDSLHSLLPETCFLNLYGSTEVSGDCTYFDCSELPRLLKTEEIGSVPIGKSISNC  386

Query  186  DVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQYF  356
             V+LLGD+D P EGEICVSGLCLS GY  + S+    YV+L  N   +  + D   Q Y+
Sbjct  387  KVVLLGDEDKPYEGEICVSGLCLSQGYM-HSSIESEGYVKLHNNSLCNHLTNDCGSQLYY  445

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGD+ R+L +G+ IF+GR+DRTVK++G R+ALEE+E  L  +P++A+A V+   D+ + 
Sbjct  446  RTGDYGRQLSSGDLIFIGRRDRTVKLNGKRMALEEIETTLELNPDIAEAVVLLSRDETEL  505

Query  537  SLLEAHLIM-KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            + L+A +++ KE+N    I+ SI NW+  KLPP MIP  F   E  P++SSGKVDY  LA
Sbjct  506  ASLKAFVVLNKESNSSDGIIFSIRNWMGGKLPPVMIPNHFVLVEKLPLTSSGKVDYEALA  565



>ref|XP_010268208.1| PREDICTED: putative acyl-activating enzyme 19 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010268209.1| PREDICTED: putative acyl-activating enzyme 19 isoform X3 [Nelumbo 
nucifera]
Length=1044

 Score =   239 bits (609),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 162/238 (68%), Gaps = 5/238 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SLW +L K+ P T ILNLYGSTEVSGDCTYFDC+ LP ILE + L+ VPIG+P+ +CDV
Sbjct  389  ISLWDMLQKLFPDTNILNLYGSTEVSGDCTYFDCKKLPTILETEELNSVPIGVPIPNCDV  448

Query  192  LLLGD-DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH---DSKSTDHRVQQYFR  359
             L+ + +   EGEI VSG C+S GY    + +  D+VEL QN         +   Q YF+
Sbjct  449  ALVQELNASREGEIYVSGHCMSMGYLLNSTFMTSDHVELPQNSILIGPSIKNPGTQLYFK  508

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGD AR+L  G+ +FLGR+DR VKI+G R+ALEE+EN LR+HP+V DAAVI    + +  
Sbjct  509  TGDIARQLPTGDLVFLGRRDRIVKINGQRVALEEIENTLRDHPDVVDAAVIHHKFQGEIG  568

Query  540  LLEAHLIMKENNEHVEIL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             L A+L+    +E  ++L  S+ +W+ RKLPP MIP  +   +S P+SS+GK+DY +L
Sbjct  569  YLVAYLVSNRTDEFFKLLISSVRSWLTRKLPPVMIPQHYLCIDSLPISSTGKIDYAIL  626



>ref|XP_010268210.1| PREDICTED: putative acyl-activating enzyme 19 isoform X4 [Nelumbo 
nucifera]
Length=1043

 Score =   239 bits (609),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 162/238 (68%), Gaps = 5/238 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SLW +L K+ P T ILNLYGSTEVSGDCTYFDC+ LP ILE + L+ VPIG+P+ +CDV
Sbjct  222  ISLWDMLQKLFPDTNILNLYGSTEVSGDCTYFDCKKLPTILETEELNSVPIGVPIPNCDV  281

Query  192  LLLGD-DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH---DSKSTDHRVQQYFR  359
             L+ + +   EGEI VSG C+S GY    + +  D+VEL QN         +   Q YF+
Sbjct  282  ALVQELNASREGEIYVSGHCMSMGYLLNSTFMTSDHVELPQNSILIGPSIKNPGTQLYFK  341

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGD AR+L  G+ +FLGR+DR VKI+G R+ALEE+EN LR+HP+V DAAVI    + +  
Sbjct  342  TGDIARQLPTGDLVFLGRRDRIVKINGQRVALEEIENTLRDHPDVVDAAVIHHKFQGEIG  401

Query  540  LLEAHLIMKENNEHVEIL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             L A+L+    +E  ++L  S+ +W+ RKLPP MIP  +   +S P+SS+GK+DY +L
Sbjct  402  YLVAYLVSNRTDEFFKLLISSVRSWLTRKLPPVMIPQHYLCIDSLPISSTGKIDYAIL  459



>ref|XP_010268211.1| PREDICTED: putative acyl-activating enzyme 19 isoform X5 [Nelumbo 
nucifera]
Length=981

 Score =   238 bits (608),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 162/238 (68%), Gaps = 5/238 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SLW +L K+ P T ILNLYGSTEVSGDCTYFDC+ LP ILE + L+ VPIG+P+ +CDV
Sbjct  389  ISLWDMLQKLFPDTNILNLYGSTEVSGDCTYFDCKKLPTILETEELNSVPIGVPIPNCDV  448

Query  192  LLLGD-DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH---DSKSTDHRVQQYFR  359
             L+ + +   EGEI VSG C+S GY    + +  D+VEL QN         +   Q YF+
Sbjct  449  ALVQELNASREGEIYVSGHCMSMGYLLNSTFMTSDHVELPQNSILIGPSIKNPGTQLYFK  508

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGD AR+L  G+ +FLGR+DR VKI+G R+ALEE+EN LR+HP+V DAAVI    + +  
Sbjct  509  TGDIARQLPTGDLVFLGRRDRIVKINGQRVALEEIENTLRDHPDVVDAAVIHHKFQGEIG  568

Query  540  LLEAHLIMKENNEHVEIL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             L A+L+    +E  ++L  S+ +W+ RKLPP MIP  +   +S P+SS+GK+DY +L
Sbjct  569  YLVAYLVSNRTDEFFKLLISSVRSWLTRKLPPVMIPQHYLCIDSLPISSTGKIDYAIL  626



>ref|XP_003627657.1| Acetyl-coenzyme A synthetase [Medicago truncatula]
Length=1224

 Score =   239 bits (611),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 177/273 (65%), Gaps = 35/273 (13%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTE-------------------------------VS  89
            TF  +LW+ L  ILP+T+ILNLYGSTE                               VS
Sbjct  382  TFPYTLWETLSTILPKTSILNLYGSTEFLSYCTLLFFSIIIIGYSSLTILFPIHFLTKVS  441

Query  90   GDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD-PNEGEICVSGLCLSAGYF  266
            GDCTYFDC+ +PL+L+ + L+ VPIGLP+ +C+V+L+G++  PNEGE+ V G C+  GY+
Sbjct  442  GDCTYFDCKRIPLVLKEEMLTSVPIGLPITNCNVVLIGENGAPNEGELYVGGSCIFRGYY  501

Query  267  CYPSVLPLDYVELSQNHDSKSTDHRVQQ--YFRTGDFARKLQNGNFIFLGRKDRTVKISG  440
                ++   +V+L QN+  +++    Q   YFRTGD  ++L +G+FIFLGRKDR VK+ G
Sbjct  502  DESDIMSEGFVKLPQNYGCENSVDVFQSELYFRTGDLVKQLPSGDFIFLGRKDRIVKVHG  561

Query  441  HRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVEIL-RSITNWIA  617
             RI+LEEVEN+LREHP + DAAV+ RN + +   +EA +I+K+  +  E+L  +I +W+ 
Sbjct  562  QRISLEEVENLLREHPNINDAAVVCRNLQAELVFIEAFIILKDKQQLGELLVPAIRSWMI  621

Query  618  RKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
             KLP   +P RF FTESFP+SSSGKV+Y LL +
Sbjct  622  NKLPSVWLPNRFIFTESFPISSSGKVNYELLVS  654



>gb|AAM20623.1| unknown protein [Arabidopsis thaliana]
Length=1040

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 165/240 (69%), Gaps = 5/240 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLW  L  +LP+T  LNLYGSTEVSGDCTYFDC  LP +L+ + +  VPIG  + +C
Sbjct  235  FPVSLWDSLHSLLPETCFLNLYGSTEVSGDCTYFDCSELPRLLKTEEIGSVPIGKSISNC  294

Query  186  DVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQYF  356
             V+LLGD+D P EGEICVSGLCLS GY  + S+    YV+L  N   +  + D   Q Y+
Sbjct  295  KVVLLGDEDKPYEGEICVSGLCLSQGYM-HSSIESEGYVKLHNNSLCNHLTNDCGSQLYY  353

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGD+ R+L +G+ IF+GR+DRTVK++G R+ALEE++  L  +P++A+A V+   D+ + 
Sbjct  354  RTGDYGRQLSSGDLIFIGRRDRTVKLNGKRMALEEIKTTLELNPDIAEAVVLLSRDETEL  413

Query  537  SLLEAHLIM-KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            + L+A +++ KE+N    I+ SI NW+  KLPP MIP  F   E  P++SSGKVDY  LA
Sbjct  414  ASLKAFVVLNKESNSSDGIIFSIRNWMGGKLPPVMIPNHFVLVEKLPLTSSGKVDYEALA  473



>gb|KFK29611.1| hypothetical protein AALP_AA7G156500 [Arabis alpina]
Length=1105

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 162/240 (68%), Gaps = 5/240 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLW  L  +LP+T  LNLYGSTEVSGDCTYFDC  LP +L+ + +S VPIG P+ +C
Sbjct  304  FPVSLWDSLHNLLPETCFLNLYGSTEVSGDCTYFDCSGLPKLLKTEKISSVPIGKPISNC  363

Query  186  DVLLL-GDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQYF  356
             ++L  G+D P EGEICV GLCLS GY    S+   DYV+L  N   +  + D   Q Y+
Sbjct  364  KIVLFGGEDKPYEGEICVGGLCLSQGYL-NSSIESQDYVKLHDNSLCNHLTNDCGSQLYY  422

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGD+ RKL +G+ IF+GR+DRTVK +G R+ALEE+E  L  +P+V +A V+   D+ + 
Sbjct  423  RTGDYGRKLSSGDLIFIGRRDRTVKRNGQRMALEEIETTLELNPDVTEAVVVLNRDQTEL  482

Query  537  SLLEAHLIM-KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            + LEA L++ KE      I+ SI NW+  +LPP MIP  F   +S+P +SSGK+DY+ LA
Sbjct  483  ASLEAFLVLNKETKSDEGIVYSIRNWMRERLPPVMIPDHFVLVDSWPSTSSGKIDYDALA  542



>ref|XP_010268207.1| PREDICTED: putative acyl-activating enzyme 19 isoform X2 [Nelumbo 
nucifera]
Length=1190

 Score =   238 bits (608),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 162/238 (68%), Gaps = 5/238 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SLW +L K+ P T ILNLYGSTEVSGDCTYFDC+ LP ILE + L+ VPIG+P+ +CDV
Sbjct  389  ISLWDMLQKLFPDTNILNLYGSTEVSGDCTYFDCKKLPTILETEELNSVPIGVPIPNCDV  448

Query  192  LLLGD-DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH---DSKSTDHRVQQYFR  359
             L+ + +   EGEI VSG C+S GY    + +  D+VEL QN         +   Q YF+
Sbjct  449  ALVQELNASREGEIYVSGHCMSMGYLLNSTFMTSDHVELPQNSILIGPSIKNPGTQLYFK  508

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGD AR+L  G+ +FLGR+DR VKI+G R+ALEE+EN LR+HP+V DAAVI    + +  
Sbjct  509  TGDIARQLPTGDLVFLGRRDRIVKINGQRVALEEIENTLRDHPDVVDAAVIHHKFQGEIG  568

Query  540  LLEAHLIMKENNEHVEIL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             L A+L+    +E  ++L  S+ +W+ RKLPP MIP  +   +S P+SS+GK+DY +L
Sbjct  569  YLVAYLVSNRTDEFFKLLISSVRSWLTRKLPPVMIPQHYLCIDSLPISSTGKIDYAIL  626



>ref|XP_010268206.1| PREDICTED: putative acyl-activating enzyme 19 isoform X1 [Nelumbo 
nucifera]
Length=1210

 Score =   238 bits (608),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 162/238 (68%), Gaps = 5/238 (2%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SLW +L K+ P T ILNLYGSTEVSGDCTYFDC+ LP ILE + L+ VPIG+P+ +CDV
Sbjct  389  ISLWDMLQKLFPDTNILNLYGSTEVSGDCTYFDCKKLPTILETEELNSVPIGVPIPNCDV  448

Query  192  LLLGD-DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH---DSKSTDHRVQQYFR  359
             L+ + +   EGEI VSG C+S GY    + +  D+VEL QN         +   Q YF+
Sbjct  449  ALVQELNASREGEIYVSGHCMSMGYLLNSTFMTSDHVELPQNSILIGPSIKNPGTQLYFK  508

Query  360  TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
            TGD AR+L  G+ +FLGR+DR VKI+G R+ALEE+EN LR+HP+V DAAVI    + +  
Sbjct  509  TGDIARQLPTGDLVFLGRRDRIVKINGQRVALEEIENTLRDHPDVVDAAVIHHKFQGEIG  568

Query  540  LLEAHLIMKENNEHVEIL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             L A+L+    +E  ++L  S+ +W+ RKLPP MIP  +   +S P+SS+GK+DY +L
Sbjct  569  YLVAYLVSNRTDEFFKLLISSVRSWLTRKLPPVMIPQHYLCIDSLPISSTGKIDYAIL  626



>ref|XP_007134908.1| hypothetical protein PHAVU_010G085900g [Phaseolus vulgaris]
 gb|ESW06902.1| hypothetical protein PHAVU_010G085900g [Phaseolus vulgaris]
Length=978

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 166/241 (69%), Gaps = 4/241 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            TF L+LW++L  +LP+T++LNLYGSTEVSGDCTYFDC+ +P I + + L+ VPIGLP+ +
Sbjct  390  TFPLTLWEMLSTLLPKTSVLNLYGSTEVSGDCTYFDCKRMPFIFKEERLTSVPIGLPIPN  449

Query  183  CDVLLLGDDDP-NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQY  353
            CDV+LL ++   NEGE+ V G C+  GY+     +   + +L   +  D        + Y
Sbjct  450  CDVILLSENGASNEGELYVGGPCIFRGYYNESKEMSDAFAKLLPRYSCDDFVNGCHDKLY  509

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            FRTGD  ++L +G+ +FLGRKDR +KI+G RIALEEVE++LR HP + DAAV+ RN+K +
Sbjct  510  FRTGDLVKQLPSGDLVFLGRKDRIIKINGQRIALEEVEDLLRAHPHINDAAVVCRNNKAE  569

Query  534  TSLLEAHLIMKENNEHVE-ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               LEA +I+K+     E ++ +I NW+  KLP  ++P  FFF ESFP+S SGKV+Y LL
Sbjct  570  LVFLEAFIILKKKESLGESLIPAIRNWMINKLPSVVLPNHFFFIESFPVSPSGKVNYELL  629

Query  711  A  713
             
Sbjct  630  V  630



>ref|XP_010435476.1| PREDICTED: putative acyl-activating enzyme 19 [Camelina sativa]
Length=1137

 Score =   236 bits (602),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 165/244 (68%), Gaps = 9/244 (4%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLW  L  +LP+T  LNLYGSTEVSGDCTYFDC  LP +L+   +S VPIG P+ +C
Sbjct  329  FPVSLWDSLHNLLPETCFLNLYGSTEVSGDCTYFDCSGLPRLLKTGEISSVPIGKPISNC  388

Query  186  DVLLLGDDDPN-----EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRV  344
             V+LLGD+D       EGEICV GLCLS GY  + S+    YV+L  N   +    D   
Sbjct  389  KVVLLGDEDKPADICVEGEICVGGLCLSQGYM-HSSIESQSYVKLHNNSLCNHLKNDCGS  447

Query  345  QQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRND  524
            Q Y+RTGD+ R+L +G+ +F+GR+DRTVK++G R+ALEE+E  L  +P+V++A V+   D
Sbjct  448  QLYYRTGDYGRQLPSGDLVFIGRRDRTVKLNGKRMALEEIETTLELNPDVSEAVVLLSRD  507

Query  525  KRDTSLLEAHLIM-KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDY  701
            ++  + L+A L++ KE+N    I+ +I  W++ KLP  M+P +FF  ES P++SSGKVDY
Sbjct  508  EKQLASLKAFLVLNKESNSSDGIIFAIRKWMSEKLPSVMVPNQFFLVESLPLTSSGKVDY  567

Query  702  NLLA  713
              LA
Sbjct  568  EALA  571



>ref|XP_008775823.1| PREDICTED: putative acyl-activating enzyme 19 isoform X1 [Phoenix 
dactylifera]
Length=1192

 Score =   236 bits (602),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 167/250 (67%), Gaps = 27/250 (11%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SLW+ L K LP+T+ILNLYGSTEVSGDCTYFDC+SLP ILE + LS VPIG+P+ +C V
Sbjct  373  ISLWQSLQKNLPETSILNLYGSTEVSGDCTYFDCKSLPRILEVEPLSSVPIGIPISNCKV  432

Query  192  LLLGD-DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
            +L+G+ D P+EGEI V G CLS GYF  P +  L              D+     + TGD
Sbjct  433  VLVGEPDKPDEGEIYVQGACLSIGYFGEPLIGNL------------IMDNGTPLCYGTGD  480

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
            FAR+L++G+ +FLGR+DR +K++G R+ALEE+EN LREHPEV+DAAV F       S L+
Sbjct  481  FARRLKSGDLVFLGRRDRIIKVNGQRVALEEIENTLREHPEVSDAAVTFHATHGVPSHLD  540

Query  549  AHLIMK-------ENNEHVE-------ILRSITNWIARKLPPAMIPVRFFFTESFPMSSS  686
            A++++K       E+  H +       ++ SI +W+ RKLP  MIP  FF T S P+S+S
Sbjct  541  AYIVLKIIGVPQEEHKSHTDEQHLIEGLITSIRSWLVRKLPLVMIPRHFFCTNSLPISTS  600

Query  687  GKVDYNLLAN  716
             K+DY  LAN
Sbjct  601  RKIDYAKLAN  610



>emb|CDY41755.1| BnaA08g07100D [Brassica napus]
Length=1124

 Score =   235 bits (600),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 160/241 (66%), Gaps = 5/241 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            TF LSLW  L  +LP+T  LNLYGSTEVSGDCTYFDC  LP +LE + +  VPIG P+ +
Sbjct  330  TFPLSLWDSLHTLLPETCFLNLYGSTEVSGDCTYFDCSGLPKLLETEKIGSVPIGKPISN  389

Query  183  CDVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQY  353
            C +LLLGD+D P EGEICV GLCLS GY  + S+    YV L      +  ++D   Q Y
Sbjct  390  CKILLLGDEDKPCEGEICVGGLCLSQGYL-HSSIESQSYVMLHNTSLCNHLTSDCGSQLY  448

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            +RTGD+ RKL +G+ +F+GR+DRTVK++G R++LEE+E  L  +P V +A VI   D+ +
Sbjct  449  YRTGDYGRKLSSGDLVFIGRRDRTVKVNGQRLSLEEIETTLELNPYVTEAVVILNRDQTE  508

Query  534  TSLLEAHLIM-KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             + L+A L++ KE     +++ SI N +  KLP  MIP  F   ES P +SSGKVDY  L
Sbjct  509  LASLDAFLVLNKETKSDEDVIYSIRNGMREKLPSVMIPNHFVLVESLPSTSSGKVDYEAL  568

Query  711  A  713
            A
Sbjct  569  A  569



>ref|XP_006283033.1| hypothetical protein CARUB_v10004025mg [Capsella rubella]
 gb|EOA15931.1| hypothetical protein CARUB_v10004025mg [Capsella rubella]
Length=1133

 Score =   235 bits (600),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 165/240 (69%), Gaps = 5/240 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLW  L  +LP+T  LNLYGSTEVSGDCTYFDC  LP +L+   +S VPIG P+ +C
Sbjct  329  FPMSLWNSLHNLLPETCFLNLYGSTEVSGDCTYFDCSGLPRLLKTNEISTVPIGKPISNC  388

Query  186  DVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQYF  356
             V+LLGD++ P EGEICV GLCLS GY  + S+    YV+L  N   +    D   Q Y+
Sbjct  389  KVVLLGDENKPYEGEICVGGLCLSQGYM-HSSIESQGYVKLHNNSLCNHLKNDCGSQLYY  447

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGD+ R+L +G+ +F+GR+DRTVK++G R+ALEE+E +L+ +P+VA+A V+   D+ + 
Sbjct  448  RTGDYGRQLPSGDLVFIGRRDRTVKLNGIRMALEEIETILQLNPDVAEAVVLLSRDETEL  507

Query  537  SLLEAHLIM-KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            + L+A L++ KE +    I+ SI  W++ KLP  M+P  F   ES P++SSGKVDY  LA
Sbjct  508  ASLKAFLVLNKEVDSSDGIIFSIRRWMSEKLPSVMVPNHFVLVESLPLTSSGKVDYEALA  567



>ref|XP_009108010.1| PREDICTED: putative acyl-activating enzyme 19 [Brassica rapa]
Length=1132

 Score =   235 bits (599),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 160/241 (66%), Gaps = 5/241 (2%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            TF LSLW  L  +LP+T  LNLYGSTEVSGDCTYFDC  LP +LE + +  VPIG P+ +
Sbjct  338  TFPLSLWDSLHTLLPETCFLNLYGSTEVSGDCTYFDCSGLPKLLETEKIGSVPIGKPISN  397

Query  183  CDVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQY  353
            C +LLLGD+D P EGEICV GLCLS GY  + S+    YV L      +  ++D   Q Y
Sbjct  398  CKILLLGDEDKPCEGEICVGGLCLSQGYL-HSSIESQSYVMLHNTSLCNHLTSDCGSQLY  456

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            +RTGD+ RKL +G+ +F+GR+DRTVK++G R++LEE+E  L  +P V +A VI   D+ +
Sbjct  457  YRTGDYGRKLSSGDLVFIGRRDRTVKVNGQRLSLEEIETTLELNPYVTEAVVILNRDQTE  516

Query  534  TSLLEAHLIM-KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             + L+A L++ KE     +++ SI N +  KLP  MIP  F   ES P +SSGKVDY  L
Sbjct  517  LASLDAFLVLNKETKPDEDVIYSIRNGMREKLPSVMIPNHFVLVESLPSTSSGKVDYEAL  576

Query  711  A  713
            A
Sbjct  577  A  577



>gb|KHN04088.1| Putative acyl-activating enzyme 19 [Glycine soja]
Length=1190

 Score =   233 bits (595),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 176/239 (74%), Gaps = 8/239 (3%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            TF L+LW++L  ILP+T+ILNLYGSTEVSGDCTYFDC+ +PLIL+ + L+ VPIGLP+ +
Sbjct  391  TFPLTLWEMLSTILPKTSILNLYGSTEVSGDCTYFDCKRMPLILKEEKLTSVPIGLPITN  450

Query  183  CDVLLLGDDD--PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
            CDV++L +++   NEGE+ V G C+   Y+  P+++   + +L +++  +      Q YF
Sbjct  451  CDVMMLLNENGASNEGELYVGGSCIFRDYYNEPNIMSDAFAKLPRSYACQG-----QLYF  505

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGD  ++L +G+F+FLGRKDR +KI+G RIALEEVE +LREHP + DAAV+ RN++ + 
Sbjct  506  RTGDLVKQLPSGDFVFLGRKDRIIKINGQRIALEEVEELLREHPYINDAAVVCRNNEAEL  565

Query  537  SLLEAHLIMKENNEHVEIL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             LLEA +I+K+     E+L  +I +W+  KLP  +IP RFFF ESFP+S SGKV+Y LL
Sbjct  566  VLLEAFIILKKKERSGELLIPAIRSWMINKLPSIVIPNRFFFMESFPVSPSGKVNYELL  624



>ref|XP_006395926.1| hypothetical protein EUTSA_v10003545mg [Eutrema salsugineum]
 gb|ESQ33212.1| hypothetical protein EUTSA_v10003545mg [Eutrema salsugineum]
Length=1160

 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 163/241 (68%), Gaps = 6/241 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F +SLW  L  +LP+T  LNLYGSTEVSGDCTYFDC  LP +L+ + +  VPIG P+ +C
Sbjct  358  FPVSLWDSLHNLLPETCFLNLYGSTEVSGDCTYFDCSELPTLLKTEMIGTVPIGKPISNC  417

Query  186  DVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH---DSKSTDHRVQQY  353
             ++L GD+D P EG+ICV G+CLS GY  + S+    YV+L  N+   +  + D   Q Y
Sbjct  418  KIVLFGDEDKPCEGDICVGGICLSQGYQ-HSSIESQGYVKLHNNNSLCNHITNDCGSQLY  476

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            +RTGD+ RKL +G+ IF GR+DRTVK++G R+ALEE+E  L  +P+V++A V+   D+ +
Sbjct  477  YRTGDYGRKLSSGDLIFTGRRDRTVKLNGQRMALEEIETTLELNPDVSEAVVLLNRDQTE  536

Query  534  TSLLEAHLIMKENNEHVE-ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             + LEA+L++    +  + I+ +I NW+  KLPP MIP  F   ES P +SSGKVDY  L
Sbjct  537  LASLEAYLVLNMKTKSDDGIIYAIKNWMREKLPPVMIPNHFVLVESLPSTSSGKVDYEAL  596

Query  711  A  713
            +
Sbjct  597  S  597



>ref|XP_006576398.1| PREDICTED: putative acyl-activating enzyme 19-like isoform X4 
[Glycine max]
Length=996

 Score =   227 bits (579),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 175/240 (73%), Gaps = 9/240 (4%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            TF L+LW++L  ILP+T+ILNLYGSTEVSGDCTYFDC+ +PLIL+ + L  VPIGLP+ +
Sbjct  391  TFPLTLWEMLSTILPKTSILNLYGSTEVSGDCTYFDCKRMPLILKEEKLFSVPIGLPITN  450

Query  183  CDVLLLGDDD--PNEGEICVSGLCLSAGYFCYPSVLPLD-YVELSQNHDSKSTDHRVQQY  353
            CDV++L +++   NEGE+ V G C+   Y+  P+ +  D + +L +++  +      Q Y
Sbjct  451  CDVMMLLNENGASNEGELYVGGSCIFRDYYNEPNNIMSDAFAKLPRSYACQG-----QLY  505

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            FRTGD  ++L +G+F+FLGRKDR +KI+G RIALEEVE +LREHP + DAAV+ RN++ +
Sbjct  506  FRTGDLVKQLPSGDFVFLGRKDRIIKINGQRIALEEVEELLREHPYINDAAVVCRNNEAE  565

Query  534  TSLLEAHLIMKENNEHVEIL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              LLEA +I+K+     E+L  +I +W+  KLP  ++P RFFF ESFP+S SGKV+Y LL
Sbjct  566  LVLLEAFIILKKKERSGELLIPAIRSWMINKLPSIVLPNRFFFMESFPVSPSGKVNYELL  625



>ref|XP_006576397.1| PREDICTED: putative acyl-activating enzyme 19-like isoform X3 
[Glycine max]
Length=1027

 Score =   227 bits (579),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 175/240 (73%), Gaps = 9/240 (4%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            TF L+LW++L  ILP+T+ILNLYGSTEVSGDCTYFDC+ +PLIL+ + L  VPIGLP+ +
Sbjct  391  TFPLTLWEMLSTILPKTSILNLYGSTEVSGDCTYFDCKRMPLILKEEKLFSVPIGLPITN  450

Query  183  CDVLLLGDDD--PNEGEICVSGLCLSAGYFCYPSVLPLD-YVELSQNHDSKSTDHRVQQY  353
            CDV++L +++   NEGE+ V G C+   Y+  P+ +  D + +L +++  +      Q Y
Sbjct  451  CDVMMLLNENGASNEGELYVGGSCIFRDYYNEPNNIMSDAFAKLPRSYACQG-----QLY  505

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            FRTGD  ++L +G+F+FLGRKDR +KI+G RIALEEVE +LREHP + DAAV+ RN++ +
Sbjct  506  FRTGDLVKQLPSGDFVFLGRKDRIIKINGQRIALEEVEELLREHPYINDAAVVCRNNEAE  565

Query  534  TSLLEAHLIMKENNEHVEIL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              LLEA +I+K+     E+L  +I +W+  KLP  ++P RFFF ESFP+S SGKV+Y LL
Sbjct  566  LVLLEAFIILKKKERSGELLIPAIRSWMINKLPSIVLPNRFFFMESFPVSPSGKVNYELL  625



>ref|XP_006576396.1| PREDICTED: putative acyl-activating enzyme 19-like isoform X2 
[Glycine max]
Length=1085

 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 175/241 (73%), Gaps = 9/241 (4%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            TF L+LW++L  ILP+T+ILNLYGSTEVSGDCTYFDC+ +PLIL+ + L  VPIGLP+ +
Sbjct  285  TFPLTLWEMLSTILPKTSILNLYGSTEVSGDCTYFDCKRMPLILKEEKLFSVPIGLPITN  344

Query  183  CDVLLLGDDD--PNEGEICVSGLCLSAGYFCYPSVLPLD-YVELSQNHDSKSTDHRVQQY  353
            CDV++L +++   NEGE+ V G C+   Y+  P+ +  D + +L +++  +      Q Y
Sbjct  345  CDVMMLLNENGASNEGELYVGGSCIFRDYYNEPNNIMSDAFAKLPRSYACQG-----QLY  399

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            FRTGD  ++L +G+F+FLGRKDR +KI+G RIALEEVE +LREHP + DAAV+ RN++ +
Sbjct  400  FRTGDLVKQLPSGDFVFLGRKDRIIKINGQRIALEEVEELLREHPYINDAAVVCRNNEAE  459

Query  534  TSLLEAHLIMKENNEHVEIL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              LLEA +I+K+     E+L  +I +W+  KLP  ++P RFFF ESFP+S SGKV+Y LL
Sbjct  460  LVLLEAFIILKKKERSGELLIPAIRSWMINKLPSIVLPNRFFFMESFPVSPSGKVNYELL  519

Query  711  A  713
             
Sbjct  520  V  520



>ref|XP_009415280.1| PREDICTED: putative acyl-activating enzyme 19 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=1076

 Score =   226 bits (575),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/244 (48%), Positives = 164/244 (67%), Gaps = 27/244 (11%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SL + L++ LP+T ILNLYGSTEVSGDCTYFDC++L  +LE +SLS VPIG+ + +CD+
Sbjct  251  ISLCRSLLETLPETTILNLYGSTEVSGDCTYFDCKNLASVLETESLSSVPIGIAISNCDI  310

Query  192  LLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDF  371
            +L   D+P+EGEI VSG CL AG           Y++   N + K     +Q  FRTGDF
Sbjct  311  ILGEFDNPDEGEIFVSGSCLFAG-----------YLDEHLNDNPKGNSSGLQ--FRTGDF  357

Query  372  ARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEA  551
            A++LQ+G+ +FLGR DRTVKI+G R+A+EE+E++L+EHPEV+DAAV F      ++ LEA
Sbjct  358  AKRLQSGDLVFLGRNDRTVKINGQRVAMEEIESMLKEHPEVSDAAVTFHGTDGVSTHLEA  417

Query  552  HLIMK------ENNEHVE--------ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSG  689
            + +MK      + N+H          ++ SI +W+ +KLPP MIP  +F   S P  +SG
Sbjct  418  YFVMKTSEDLQKENKHSSDEQHLIENLITSIRSWLVKKLPPVMIPSYYFCMRSLPTLASG  477

Query  690  KVDY  701
            K+DY
Sbjct  478  KIDY  481



>ref|XP_002524008.1| AMP dependent ligase, putative [Ricinus communis]
 gb|EEF38376.1| AMP dependent ligase, putative [Ricinus communis]
Length=1144

 Score =   226 bits (576),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 172/239 (72%), Gaps = 4/239 (2%)
 Frame = +3

Query  6    FHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSC  185
            F LSLW +L  +LP+T+ILNLYG+TEVSGDCTYFDC+ LP+ILE ++L+ VPIG+P+ +C
Sbjct  330  FPLSLWDVLSDLLPRTSILNLYGTTEVSGDCTYFDCKRLPMILEKEALTSVPIGVPISNC  389

Query  186  DVLLLGDDDP-NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQN--HDSKSTDHRVQQYF  356
            DV+L+ +    ++GEICVSG C+ +GY    +V+P D V+L +N   +    +     Y+
Sbjct  390  DVVLVAETATCDQGEICVSGPCVCSGYSSNLAVMPSDSVKLHKNLICNCVVDNCGSHVYY  449

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGDFA++LQ G+ +FLGR DRT+K++G+R+ALEEVEN LR HP V DAAV+    + + 
Sbjct  450  RTGDFAQRLQCGDLVFLGRTDRTIKVNGNRVALEEVENTLRGHPAVVDAAVVAHEGQGEL  509

Query  537  SLLEAHLIMKENNEHVEILR-SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             LLEA L++KEN +  +  R SI +W+  K+  AMIP  F F +S P SSSGKVDY LL
Sbjct  510  MLLEAFLLLKENEKSGDPFRSSIRSWMVGKVSSAMIPNHFVFVKSLPKSSSGKVDYALL  568



>ref|XP_006576395.1| PREDICTED: putative acyl-activating enzyme 19-like isoform X1 
[Glycine max]
Length=1191

 Score =   226 bits (577),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 175/240 (73%), Gaps = 9/240 (4%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            TF L+LW++L  ILP+T+ILNLYGSTEVSGDCTYFDC+ +PLIL+ + L  VPIGLP+ +
Sbjct  391  TFPLTLWEMLSTILPKTSILNLYGSTEVSGDCTYFDCKRMPLILKEEKLFSVPIGLPITN  450

Query  183  CDVLLLGDDD--PNEGEICVSGLCLSAGYFCYPSVLPLD-YVELSQNHDSKSTDHRVQQY  353
            CDV++L +++   NEGE+ V G C+   Y+  P+ +  D + +L +++  +      Q Y
Sbjct  451  CDVMMLLNENGASNEGELYVGGSCIFRDYYNEPNNIMSDAFAKLPRSYACQG-----QLY  505

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            FRTGD  ++L +G+F+FLGRKDR +KI+G RIALEEVE +LREHP + DAAV+ RN++ +
Sbjct  506  FRTGDLVKQLPSGDFVFLGRKDRIIKINGQRIALEEVEELLREHPYINDAAVVCRNNEAE  565

Query  534  TSLLEAHLIMKENNEHVEIL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              LLEA +I+K+     E+L  +I +W+  KLP  ++P RFFF ESFP+S SGKV+Y LL
Sbjct  566  LVLLEAFIILKKKERSGELLIPAIRSWMINKLPSIVLPNRFFFMESFPVSPSGKVNYELL  625



>emb|CAN82109.1| hypothetical protein VITISV_002742 [Vitis vinifera]
Length=277

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = +3

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQYFRT  362
            +L+G+ D  NEGEICV+GLC++ GYF  P+V+PLDY  LS     +    D+  Q YFRT
Sbjct  1    MLVGESDTSNEGEICVNGLCVNIGYFPDPNVMPLDYSNLSHGSLCNCSINDNESQLYFRT  60

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GDFAR+LQ+G+ +FLGRKDRTVKI+G RIALEE+EN LR HP+V DAAVIFR  + +  L
Sbjct  61   GDFARRLQSGDLVFLGRKDRTVKINGQRIALEEIENALRGHPDVVDAAVIFRKGQGELEL  120

Query  543  LEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            LEA +I+K  NE  E+LRS I  W+  KLP  M+P  FFFT+SFPMS++GKVDY  LA
Sbjct  121  LEAFIILKRTNESDEVLRSCIRRWMVEKLPLVMVPNNFFFTKSFPMSATGKVDYASLA  178



>ref|XP_009415272.1| PREDICTED: putative acyl-activating enzyme 19 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1168

 Score =   226 bits (575),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 167/249 (67%), Gaps = 27/249 (11%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SL + L++ LP+T ILNLYGSTEVSGDCTYFDC++L  +LE +SLS VPIG+ + +CD+
Sbjct  363  ISLCRSLLETLPETTILNLYGSTEVSGDCTYFDCKNLASVLETESLSSVPIGIAISNCDI  422

Query  192  LLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDF  371
            +L   D+P+EGEI VSG CL AG           Y++   N + K     +Q  FRTGDF
Sbjct  423  ILGEFDNPDEGEIFVSGSCLFAG-----------YLDEHLNDNPKGNSSGLQ--FRTGDF  469

Query  372  ARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEA  551
            A++LQ+G+ +FLGR DRTVKI+G R+A+EE+E++L+EHPEV+DAAV F      ++ LEA
Sbjct  470  AKRLQSGDLVFLGRNDRTVKINGQRVAMEEIESMLKEHPEVSDAAVTFHGTDGVSTHLEA  529

Query  552  HLIMK------ENNEHVE--------ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSG  689
            + +MK      + N+H          ++ SI +W+ +KLPP MIP  +F   S P  +SG
Sbjct  530  YFVMKTSEDLQKENKHSSDEQHLIENLITSIRSWLVKKLPPVMIPSYYFCMRSLPTLASG  589

Query  690  KVDYNLLAN  716
            K+DY  L++
Sbjct  590  KIDYLKLSS  598



>ref|XP_009415264.1| PREDICTED: putative acyl-activating enzyme 19 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1188

 Score =   226 bits (575),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 167/249 (67%), Gaps = 27/249 (11%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SL + L++ LP+T ILNLYGSTEVSGDCTYFDC++L  +LE +SLS VPIG+ + +CD+
Sbjct  363  ISLCRSLLETLPETTILNLYGSTEVSGDCTYFDCKNLASVLETESLSSVPIGIAISNCDI  422

Query  192  LLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDF  371
            +L   D+P+EGEI VSG CL AG           Y++   N + K     +Q  FRTGDF
Sbjct  423  ILGEFDNPDEGEIFVSGSCLFAG-----------YLDEHLNDNPKGNSSGLQ--FRTGDF  469

Query  372  ARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEA  551
            A++LQ+G+ +FLGR DRTVKI+G R+A+EE+E++L+EHPEV+DAAV F      ++ LEA
Sbjct  470  AKRLQSGDLVFLGRNDRTVKINGQRVAMEEIESMLKEHPEVSDAAVTFHGTDGVSTHLEA  529

Query  552  HLIMK------ENNEHVE--------ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSG  689
            + +MK      + N+H          ++ SI +W+ +KLPP MIP  +F   S P  +SG
Sbjct  530  YFVMKTSEDLQKENKHSSDEQHLIENLITSIRSWLVKKLPPVMIPSYYFCMRSLPTLASG  589

Query  690  KVDYNLLAN  716
            K+DY  L++
Sbjct  590  KIDYLKLSS  598



>dbj|BAK03819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=816

 Score =   223 bits (568),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 163/249 (65%), Gaps = 28/249 (11%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            L LWK + +I+P+T I+NLYG+TEVSGDCT+FDC+ LP ILEH+ ++ VPIG P+ +C+V
Sbjct  62   LVLWKRVREIMPETTIINLYGTTEVSGDCTFFDCKDLPAILEHEEITSVPIGFPIANCEV  121

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             L+      +EGEICVSG CL  GY             L  NH   S       Y++TGD
Sbjct  122  FLMTHAGMADEGEICVSGACLFNGYLAE---------FLRSNHTEGSEG---STYYKTGD  169

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
            +AR+L+ G  +FLGRKDRTVKI G R +LEE+E+ L+EHP+V+DAAV F++  + +   +
Sbjct  170  YARRLKAGELVFLGRKDRTVKIYGQRFSLEEIESTLKEHPDVSDAAVTFQS--KGSPNYK  227

Query  549  AHLIMKENNEHV-------------EILRSITNWIARKLPPAMIPVRFFFTESFPMSSSG  689
            A+L+ + N+E V             +I+ SI +W+ +K+PPAMIP  F   +S P++SSG
Sbjct  228  AYLVFRNNDEIVKGRPQYREVNSSQDIMASIRSWLIKKVPPAMIPSFFLPMKSLPLTSSG  287

Query  690  KVDYNLLAN  716
            KVDY  L++
Sbjct  288  KVDYFKLSS  296



>dbj|BAK03714.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=882

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 163/249 (65%), Gaps = 28/249 (11%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            L LWK + +I+P+T I+NLYG+TEVSGDCT+FDC+ LP ILEH+ ++ VPIG P+ +C+V
Sbjct  62   LVLWKRVREIMPETTIINLYGTTEVSGDCTFFDCKDLPAILEHEEITSVPIGFPIANCEV  121

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             L+      +EGEICVSG CL  GY             L  NH   S       Y++TGD
Sbjct  122  FLMTHAGMADEGEICVSGACLFNGYLAE---------FLRSNHTEGSEG---STYYKTGD  169

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
            +AR+L+ G  +FLGRKDRTVKI G R +LEE+E+ L+EHP+V+DAAV F++  + +   +
Sbjct  170  YARRLKAGELVFLGRKDRTVKIYGQRFSLEEIESTLKEHPDVSDAAVTFQS--KGSPNYK  227

Query  549  AHLIMKENNEHV-------------EILRSITNWIARKLPPAMIPVRFFFTESFPMSSSG  689
            A+L+ + N+E V             +I+ SI +W+ +K+PPAMIP  F   +S P++SSG
Sbjct  228  AYLVFRNNDEIVKGRPQYREVNSSQDIMASIRSWLIKKVPPAMIPSFFLPMKSLPLTSSG  287

Query  690  KVDYNLLAN  716
            KVDY  L++
Sbjct  288  KVDYFKLSS  296



>gb|EMT03524.1| Acyl-CoA synthetase family member 4 [Aegilops tauschii]
Length=1110

 Score =   222 bits (566),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 159/247 (64%), Gaps = 24/247 (10%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            L LWK + +ILP+T I+NLYG+TEVSGDCT+FDC+ LP ILE + ++ VPIG P+ +C+V
Sbjct  280  LVLWKRVREILPETTIINLYGTTEVSGDCTFFDCKDLPGILEREEITSVPIGFPIANCEV  339

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             L+      +EGEICVSG CL  GY             LS NH   S    +  Y++TGD
Sbjct  340  FLVTHAGIADEGEICVSGACLFNGYLAE---------FLSSNHTEGSV---ISTYYKTGD  387

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRND--------  524
            +AR+L+ G  +FLGRKDRTVKI G R +LEEVE+ L+EHP V+DAA+ F++         
Sbjct  388  YARRLKAGELVFLGRKDRTVKIYGQRFSLEEVESTLKEHPAVSDAALTFQSKGSPDYKAY  447

Query  525  ---KRDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKV  695
               K    +++  L  +E N   +I+ SI +W+ +K+PPAMIP  F   +S P++SSGKV
Sbjct  448  LVFKNKDGIVKDSLQYREVNSSQDIMASIRSWLIKKVPPAMIPSFFLHVKSLPLTSSGKV  507

Query  696  DYNLLAN  716
            DY  L++
Sbjct  508  DYVKLSS  514



>ref|NP_001056587.2| Os06g0111600 [Oryza sativa Japonica Group]
 dbj|BAD67775.1| putative 2-aminoadipic 6-semialdehyde dehydrogenase [Oryza sativa 
Japonica Group]
 dbj|BAF18501.2| Os06g0111600 [Oryza sativa Japonica Group]
Length=986

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 162/247 (66%), Gaps = 28/247 (11%)
 Frame = +3

Query  18   LWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLL  197
            LWK + +ILP+T I+NLYG+TEVSGDCT+FDC  LP++L+ + L+ VPIG P+ +C+V +
Sbjct  166  LWKRVHEILPETTIVNLYGTTEVSGDCTFFDCTDLPILLKREELTSVPIGFPISNCEVCI  225

Query  198  LGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFA  374
              D +  +EGE+ V+G CL AGY             ++ NH   + D+    Y+RTGDFA
Sbjct  226  ATDAEVADEGEMHVTGACLFAGYL---------EESMASNH---TEDNGSSTYYRTGDFA  273

Query  375  RKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAH  554
            R+L++G FIFLGRKDRTVKI G R +L+EVE+ L EHP+V+ AAV F+N++       A+
Sbjct  274  RRLKSGEFIFLGRKDRTVKIYGQRFSLQEVESTLNEHPDVSAAAVTFQNNEFLD--FRAY  331

Query  555  LIMKENNEHVE-------------ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKV  695
            L++K +   VE             I+ SI +W+  KLPPAMIP  F   ES P++SSGK+
Sbjct  332  LVLKSSAASVEDCQRRKRYKSFEVIMPSIRSWLIMKLPPAMIPRFFLPMESLPLTSSGKI  391

Query  696  DYNLLAN  716
            DY  L++
Sbjct  392  DYMKLSS  398



>gb|EEE64969.1| hypothetical protein OsJ_19865 [Oryza sativa Japonica Group]
Length=1168

 Score =   218 bits (556),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 162/247 (66%), Gaps = 28/247 (11%)
 Frame = +3

Query  18   LWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLL  197
            LWK + +ILP+T I+NLYG+TEVSGDCT+FDC  LP++L+ + L+ VPIG P+ +C+V +
Sbjct  333  LWKRVHEILPETTIVNLYGTTEVSGDCTFFDCTDLPILLKREELTSVPIGFPISNCEVCI  392

Query  198  LGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFA  374
              D +  +EGE+ V+G CL AGY             ++ NH   + D+    Y+RTGDFA
Sbjct  393  ATDAEVADEGEMHVTGACLFAGYL---------EESMASNH---TEDNGSSTYYRTGDFA  440

Query  375  RKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAH  554
            R+L++G FIFLGRKDRTVKI G R +L+EVE+ L EHP+V+ AAV F+N++       A+
Sbjct  441  RRLKSGEFIFLGRKDRTVKIYGQRFSLQEVESTLNEHPDVSAAAVTFQNNEFLD--FRAY  498

Query  555  LIMKENNEHVE-------------ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKV  695
            L++K +   VE             I+ SI +W+  KLPPAMIP  F   ES P++SSGK+
Sbjct  499  LVLKSSAASVEDCQRRKRYKSFEVIMPSIRSWLIMKLPPAMIPRFFLPMESLPLTSSGKI  558

Query  696  DYNLLAN  716
            DY  L++
Sbjct  559  DYMKLSS  565



>ref|XP_003561146.1| PREDICTED: putative acyl-activating enzyme 19 [Brachypodium distachyon]
Length=1142

 Score =   217 bits (552),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 160/250 (64%), Gaps = 30/250 (12%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            L LWK + +ILP+T I+NLYG+TEVSGDCT+FDC  LP ILE + L+ VPIG P+ +C+V
Sbjct  324  LVLWKRVHEILPETTIINLYGTTEVSGDCTFFDCNDLPTILEREKLTSVPIGFPISNCEV  383

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDH-RVQQYFRTG  365
             L+ D+   +EGEI V G CL  GY             L ++  S  T+      Y+ TG
Sbjct  384  YLVTDNGVADEGEIYVGGACLFNGY-------------LGESMRSDVTERSECSTYYNTG  430

Query  366  DFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL  545
            D+AR+L+ G  IFLGRKDRTVKI G R +LEEVE+ L+EHP+V+DAAV F++  + ++  
Sbjct  431  DYARRLKTGELIFLGRKDRTVKIHGQRFSLEEVESTLKEHPDVSDAAVTFQS--KGSTDY  488

Query  546  EAHLIMKENNEHV-------------EILRSITNWIARKLPPAMIPVRFFFTESFPMSSS  686
            +A+L+ K  +  V             +I+ SI +W+ +K+PPAMIP  F    S P++SS
Sbjct  489  KAYLVFKSEDNIVKDSLHCRALSSSQDIMASIRSWLVKKVPPAMIPSFFLLMNSLPLTSS  548

Query  687  GKVDYNLLAN  716
            GKVDY  L++
Sbjct  549  GKVDYVKLSS  558



>gb|EEC83401.1| hypothetical protein OsI_28845 [Oryza sativa Indica Group]
Length=1170

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 162/247 (66%), Gaps = 28/247 (11%)
 Frame = +3

Query  18   LWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLL  197
            LWK + +ILP+T I+NLYG+TEVSGDCT+FDC  LP++L+ + L+ VPIG P+ +C+V +
Sbjct  335  LWKRVHEILPETTIVNLYGTTEVSGDCTFFDCTDLPILLKREELTSVPIGFPISNCEVCI  394

Query  198  LGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFA  374
              D +  +EGE+ V+G CL AGY             ++ NH   + ++    Y+RTGDFA
Sbjct  395  ATDAEVADEGEMHVTGACLFAGYL---------EESMASNH---TEENGSSTYYRTGDFA  442

Query  375  RKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAH  554
            R+L++G FIFLGRKDRTVKI G R +L+EVE+ L EHP+V+ AAV F+N++       A+
Sbjct  443  RRLKSGEFIFLGRKDRTVKIYGQRFSLQEVESTLNEHPDVSAAAVTFQNNEFLD--FRAY  500

Query  555  LIMKENNEHVE-------------ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKV  695
            L++K +   VE             I+ SI +W+  KLPPAMIP  F   ES P++SSGK+
Sbjct  501  LVLKSSAASVEDCQRRKRYKSFEVIMPSIRSWLIMKLPPAMIPRFFLPMESLPLTSSGKI  560

Query  696  DYNLLAN  716
            DY  L++
Sbjct  561  DYMKLSS  567



>ref|XP_004966593.1| PREDICTED: putative acyl-activating enzyme 19-like [Setaria italica]
Length=1136

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/245 (47%), Positives = 160/245 (65%), Gaps = 27/245 (11%)
 Frame = +3

Query  18   LWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLL  197
            LWK + ++LP+T I+NLYG+TEVSGDCT+FDC+ LP ILE + L+ VPIG P+ +C+V L
Sbjct  321  LWKRVYEVLPETTIINLYGTTEVSGDCTFFDCKDLPTILEREDLNSVPIGFPISNCEVSL  380

Query  198  LGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFA  374
            + +D   +EGEI VSG CL +GY   P         ++ N      D+ +  Y++TGDF 
Sbjct  381  VTEDGLGDEGEISVSGACLFSGYLADP---------MTSN---GLGDNGISAYYKTGDFG  428

Query  375  RKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFR-NDKRDTSLLEA  551
            R+L+ G  IFLGRKDRTVKI G R +LEEVE+ LREHP+V+DAAV F+ N   D    +A
Sbjct  429  RRLKTGELIFLGRKDRTVKIYGQRFSLEEVESTLREHPDVSDAAVTFQGNGSLD---FKA  485

Query  552  HLIMKENNE----------HVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDY  701
            +L++K N+E            +I+  + +W+  KLP AM+P  F   ES P++ SGK+DY
Sbjct  486  YLVLKSNDEFPKCYSRLNSSQDIMAPLRSWLIMKLPLAMVPRLFIPMESLPLTLSGKIDY  545

Query  702  NLLAN  716
              L++
Sbjct  546  AKLSS  550



>gb|EMS56380.1| Acyl-CoA synthetase family member 4 [Triticum urartu]
Length=1209

 Score =   214 bits (546),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 163/249 (65%), Gaps = 28/249 (11%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            L LWK + +ILP+T I+NLYG+TEVSGDCT+FDC+ LP ILE + ++ VPIG P+ +C+V
Sbjct  338  LVLWKRVREILPETTIINLYGTTEVSGDCTFFDCKDLPAILEREEITSVPIGFPIANCEV  397

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             L+       EGEICVSG CL  GY         +++  +    S+S+     +Y++TGD
Sbjct  398  FLVKHAGIAAEGEICVSGACLFYGYLA-------EFLRSNHTEGSESS-----KYYKTGD  445

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
            +AR+L+ G  +FLGR+DR+VK  G R +LEEVE+ L+EHP V+DAAV F++  + +   +
Sbjct  446  YARRLKAGELVFLGRRDRSVKNYGQRFSLEEVESTLKEHPAVSDAAVTFQS--KGSPDYK  503

Query  549  AHLIMKENNEHV-------------EILRSITNWIARKLPPAMIPVRFFFTESFPMSSSG  689
            A+L+ K  +E V             +++ SI +W+ +K+PPAMIP  F   +S P++SSG
Sbjct  504  AYLVFKNKDEIVKDSVQYREVNSSQDVMASIRSWLIKKVPPAMIPSFFLHVKSLPLTSSG  563

Query  690  KVDYNLLAN  716
            KVDY  L++
Sbjct  564  KVDYVKLSS  572



>gb|AFW86153.1| hypothetical protein ZEAMMB73_432269 [Zea mays]
Length=918

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 159/249 (64%), Gaps = 28/249 (11%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SLWK + + LP+  I+NLYG+TEVSGDC +FDC+ LP ILE + L+ VPIG P+ +C+V
Sbjct  304  VSLWKRVYEFLPEATIINLYGTTEVSGDCAFFDCKKLPTILEQEELNSVPIGFPISNCEV  363

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             L+ +D   +EGEI VSG CL  GY   P         ++ N    S    V  Y+RTGD
Sbjct  364  SLVTNDGLSDEGEISVSGACLFTGYLADP---------MTSNCPEGS---EVLAYYRTGD  411

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
            FAR+L+ G  IFLGRKDR VKI GHR +LEEVE+ LR+HP+V+DAAV F+++   +   +
Sbjct  412  FARRLKTGELIFLGRKDRIVKIYGHRFSLEEVESTLRDHPDVSDAAVTFQSN--GSLDFK  469

Query  549  AHLIMKENNEHV-------------EILRSITNWIARKLPPAMIPVRFFFTESFPMSSSG  689
            A+L+++ NN+ +             +I+  + NW+  K P AM+P  F   +S P++ SG
Sbjct  470  AYLVLRSNNKFLKCTQGYSGLHSSRDIIAPLRNWLIMKFPLAMVPRLFIPMKSLPLTLSG  529

Query  690  KVDYNLLAN  716
            K+DY  L++
Sbjct  530  KIDYVKLSS  538



>gb|AFW86152.1| hypothetical protein ZEAMMB73_432269 [Zea mays]
Length=994

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 158/250 (63%), Gaps = 30/250 (12%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SLWK + + LP+  I+NLYG+TEVSGDC +FDC+ LP ILE + L+ VPIG P+ +C+V
Sbjct  304  VSLWKRVYEFLPEATIINLYGTTEVSGDCAFFDCKKLPTILEQEELNSVPIGFPISNCEV  363

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             L+ +D   +EGEI VSG CL  GY   P         ++ N    S    V  Y+RTGD
Sbjct  364  SLVTNDGLSDEGEISVSGACLFTGYLADP---------MTSNCPEGS---EVLAYYRTGD  411

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFR-NDKRDTSLL  545
            FAR+L+ G  IFLGRKDR VKI GHR +LEEVE+ LR+HP+V+DAAV F+ N   D    
Sbjct  412  FARRLKTGELIFLGRKDRIVKIYGHRFSLEEVESTLRDHPDVSDAAVTFQSNGSLD---F  468

Query  546  EAHLIMKENNEHV-------------EILRSITNWIARKLPPAMIPVRFFFTESFPMSSS  686
            +A+L+++ NN+ +             +I+  + NW+  K P AM+P  F   +S P++ S
Sbjct  469  KAYLVLRSNNKFLKCTQGYSGLHSSRDIIAPLRNWLIMKFPLAMVPRLFIPMKSLPLTLS  528

Query  687  GKVDYNLLAN  716
            GK+DY  L++
Sbjct  529  GKIDYVKLSS  538



>ref|XP_008659375.1| PREDICTED: putative acyl-activating enzyme 19 [Zea mays]
Length=1168

 Score =   212 bits (539),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 160/250 (64%), Gaps = 30/250 (12%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SLWK + + LP+  I+NLYG+TEVSGDC +FDC+ LP ILE + L+ VPIG P+ +C+V
Sbjct  321  VSLWKRVYEFLPEATIINLYGTTEVSGDCAFFDCKKLPTILEQEELNSVPIGFPISNCEV  380

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             L+ +D   +EGEI VSG CL  GY   P         ++ N    S    V  Y+RTGD
Sbjct  381  SLVTNDGLSDEGEISVSGACLFTGYLADP---------MTSNCPEGS---EVLAYYRTGD  428

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL-L  545
            FAR+L+ G  IFLGRKDR VKI GHR +LEEVE+ LR+HP+V+DAAV F+++    SL  
Sbjct  429  FARRLKTGELIFLGRKDRIVKIYGHRFSLEEVESTLRDHPDVSDAAVTFQSNG---SLDF  485

Query  546  EAHLIMKENNEHV-------------EILRSITNWIARKLPPAMIPVRFFFTESFPMSSS  686
            +A+L+++ NN+ +             +I+  + NW+  K P AM+P  F   +S P++ S
Sbjct  486  KAYLVLRSNNKFLKCTQGYSGLHSSRDIIAPLRNWLIMKFPLAMVPRLFIPMKSLPLTLS  545

Query  687  GKVDYNLLAN  716
            GK+DY  L++
Sbjct  546  GKIDYVKLSS  555



>gb|AFW86151.1| hypothetical protein ZEAMMB73_432269, partial [Zea mays]
Length=1140

 Score =   211 bits (538),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 158/250 (63%), Gaps = 30/250 (12%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SLWK + + LP+  I+NLYG+TEVSGDC +FDC+ LP ILE + L+ VPIG P+ +C+V
Sbjct  304  VSLWKRVYEFLPEATIINLYGTTEVSGDCAFFDCKKLPTILEQEELNSVPIGFPISNCEV  363

Query  192  LLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             L+ +D   +EGEI VSG CL  GY   P         ++ N    S    V  Y+RTGD
Sbjct  364  SLVTNDGLSDEGEISVSGACLFTGYLADP---------MTSNCPEGS---EVLAYYRTGD  411

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFR-NDKRDTSLL  545
            FAR+L+ G  IFLGRKDR VKI GHR +LEEVE+ LR+HP+V+DAAV F+ N   D    
Sbjct  412  FARRLKTGELIFLGRKDRIVKIYGHRFSLEEVESTLRDHPDVSDAAVTFQSNGSLD---F  468

Query  546  EAHLIMKENNEHV-------------EILRSITNWIARKLPPAMIPVRFFFTESFPMSSS  686
            +A+L+++ NN+ +             +I+  + NW+  K P AM+P  F   +S P++ S
Sbjct  469  KAYLVLRSNNKFLKCTQGYSGLHSSRDIIAPLRNWLIMKFPLAMVPRLFIPMKSLPLTLS  528

Query  687  GKVDYNLLAN  716
            GK+DY  L++
Sbjct  529  GKIDYVKLSS  538



>ref|XP_006655708.1| PREDICTED: putative acyl-activating enzyme 19-like [Oryza brachyantha]
Length=992

 Score =   210 bits (535),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 152/243 (63%), Gaps = 27/243 (11%)
 Frame = +3

Query  18   LWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLL  197
            LW+ + +ILP+T I+NLYG TEVSGDCT+FDC  LP IL+ + L+ VPIG P+ +C+V +
Sbjct  166  LWRRVHRILPETTIVNLYGMTEVSGDCTFFDCTDLPAILKREELTSVPIGFPISNCEVCI  225

Query  198  LGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFA  374
              D    +EGE+ VSG CL AGY             +  NH   S       Y+RTGDFA
Sbjct  226  ATDARIADEGEMHVSGACLFAGYL---------EESMMTNHSQGSGS---STYYRTGDFA  273

Query  375  RKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL-LEA  551
            R+L++G FIFLGRKDRTVK+ G R +L EVE+ L+EHP V+ AAV F+N+  + S+   A
Sbjct  274  RRLKSGEFIFLGRKDRTVKLYGQRFSLHEVESTLKEHPAVSAAAVTFQNNGNNGSVDFRA  333

Query  552  HLIMKENNEHVE-------------ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGK  692
            +L++K +    E             I+ S+ +W+  KL PAMIP  F   ES P++SSGK
Sbjct  334  YLVLKNSAASAEDCQQRKKHKSSQVIMPSMRSWLVMKLSPAMIPRFFHPVESLPLTSSGK  393

Query  693  VDY  701
            +DY
Sbjct  394  IDY  396



>ref|XP_011012744.1| PREDICTED: putative acyl-activating enzyme 19 isoform X2 [Populus 
euphratica]
Length=1132

 Score =   211 bits (538),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 148/218 (68%), Gaps = 9/218 (4%)
 Frame = +3

Query  81   EVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD-PNEGEICVSGLCLSA  257
            +VSGDCTYFDC+ LP ILE ++L+ +PIGLP+ +CDV L+ + D  N+GEI V GLC+S 
Sbjct  332  QVSGDCTYFDCKRLPAILETEALTSIPIGLPISNCDVALICESDTSNKGEIYVGGLCVSN  391

Query  258  GYFCYPSVLPLDYVELSQNHD----SKSTDHRVQQYFRTGDFARKLQNGNFIFLGRKDRT  425
            GY+   +V    ++  + + D    S   +   Q Y+RTGDFA++LQNG+ +FLGR DRT
Sbjct  392  GYYSESTVT--SFISANPHMDNICNSSVDNWGCQAYYRTGDFAQRLQNGDLVFLGRTDRT  449

Query  426  VKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK--ENNEHVEILRS  599
            VKI+G RI LEE+EN LR H +VADAAVI R    +   L+A L+ K  E +E   +  S
Sbjct  450  VKINGQRIVLEEIENTLRGHADVADAAVISREGPGELLFLDAILLFKEREKSEDFFVRSS  509

Query  600  ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
            I  W+  K+P AM+P RF  TES P+SS+GKVDY LLA
Sbjct  510  IRKWMVDKVPLAMVPNRFVITESLPISSTGKVDYALLA  547



>gb|EMT29437.1| Acyl-CoA synthetase family member 4 [Aegilops tauschii]
Length=1153

 Score =   208 bits (529),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/256 (44%), Positives = 157/256 (61%), Gaps = 33/256 (13%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTE---------VSGDCTYFDCESLPLILEHKSLSGVPI  164
            L LWK + +ILP+T ++NLYG+TE         VSGDCT+FDC+ LP ILE + ++ VPI
Sbjct  324  LVLWKRVREILPETTVVNLYGTTEFTPHRDWLKVSGDCTFFDCKDLPAILECEEITSVPI  383

Query  165  GLPLQSCDVLLLGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHR  341
            G P+ +C+V+L+      +EGEICVSG CL  GY             L  NH   S    
Sbjct  384  GFPIANCEVVLVTHAGMADEGEICVSGACLFNGYLAE---------FLMSNHTEGSES--  432

Query  342  VQQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRN  521
               Y++TGD+AR+L+ G  +FLGRKDRTVK  G R +LEEVE+ L+EHP V+DAAV F++
Sbjct  433  -STYYKTGDYARRLKAGELVFLGRKDRTVKNYGQRFSLEEVESTLKEHPAVSDAAVTFQS  491

Query  522  D-----------KRDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTES  668
                        K    +++  L  +E N   +I+ SI +W+ +K+PPAMIP  F   +S
Sbjct  492  KGSPDYKAYLVFKNKDGIVKDSLQYREVNSSQDIMASIRSWLIKKVPPAMIPSFFLHVKS  551

Query  669  FPMSSSGKVDYNLLAN  716
             P++SSGKVDY  L++
Sbjct  552  LPLTSSGKVDYVKLSS  567



>ref|XP_002437697.1| hypothetical protein SORBIDRAFT_10g001030 [Sorghum bicolor]
 gb|EER89064.1| hypothetical protein SORBIDRAFT_10g001030 [Sorghum bicolor]
Length=1113

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 157/248 (63%), Gaps = 30/248 (12%)
 Frame = +3

Query  18   LWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLL  197
            LWK + ++LP+  I+NLYG+TEVSGDCT+FDC+ LP ILE + L+ VPIG P+ +CDV L
Sbjct  307  LWKRVYEVLPEATIINLYGTTEVSGDCTFFDCKDLPAILEQEELNSVPIGFPISNCDVSL  366

Query  198  LGDDD-PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFA  374
            + DD   +EGEI VSG CL  GY             ++ N    S    +  ++RTGDFA
Sbjct  367  VTDDGLADEGEISVSGACLFTGYLAD---------SMTSNCPEGS---EILAHYRTGDFA  414

Query  375  RKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL-LEA  551
            R+L+ G  IFLGRKDR VKI G R +LEEVE++LREHP+V+DAAV F+++    SL  +A
Sbjct  415  RRLKTGELIFLGRKDRIVKIYGQRFSLEEVESILREHPDVSDAAVTFQSNG---SLDFKA  471

Query  552  HLIMKEN-------------NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGK  692
            +L++K               N   +++  + NW+  KLP AM+P  F   +S P++ SGK
Sbjct  472  YLVLKSIDQSPKCIQRYSGLNSSQDVIAPLRNWLIMKLPLAMVPRLFIPMKSLPLTLSGK  531

Query  693  VDYNLLAN  716
            +DY  L++
Sbjct  532  IDYVKLSS  539



>ref|XP_008775824.1| PREDICTED: putative acyl-activating enzyme 19 isoform X2 [Phoenix 
dactylifera]
Length=815

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 144/224 (64%), Gaps = 27/224 (12%)
 Frame = +3

Query  90   GDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGD-DDPNEGEICVSGLCLSAGYF  266
            GDCTYFDC+SLP ILE + LS VPIG+P+ +C V+L+G+ D P+EGEI V G CLS GYF
Sbjct  22   GDCTYFDCKSLPRILEVEPLSSVPIGIPISNCKVVLVGEPDKPDEGEIYVQGACLSIGYF  81

Query  267  CYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHR  446
              P +  L              D+     + TGDFAR+L++G+ +FLGR+DR +K++G R
Sbjct  82   GEPLIGNL------------IMDNGTPLCYGTGDFARRLKSGDLVFLGRRDRIIKVNGQR  129

Query  447  IALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK-------ENNEHVE------  587
            +ALEE+EN LREHPEV+DAAV F       S L+A++++K       E+  H +      
Sbjct  130  VALEEIENTLREHPEVSDAAVTFHATHGVPSHLDAYIVLKIIGVPQEEHKSHTDEQHLIE  189

Query  588  -ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
             ++ SI +W+ RKLP  MIP  FF T S P+S+S K+DY  LAN
Sbjct  190  GLITSIRSWLVRKLPLVMIPRHFFCTNSLPISTSRKIDYAKLAN  233



>gb|KGN61419.1| hypothetical protein Csa_2G120130 [Cucumis sativus]
Length=565

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 140/201 (70%), Gaps = 5/201 (2%)
 Frame = +3

Query  126  LILEHKSLSGVPIGLPLQSCDVLLLGDDDP-NEGEICVSGLCLSAGYFCYPSVLPLDYVE  302
            +ILE  ++  VPIG+P+  CDV+++GD+D  N GE+CV G C+ +GY+     LPLD ++
Sbjct  1    MILETDAIKTVPIGVPISHCDVVVVGDNDALNLGELCVGGPCVCSGYYSDSVFLPLDGIK  60

Query  303  LSQN--HDSKSTDHRVQQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVL  476
             SQ+  H+        Q Y RTGDF ++L++G+ +FLGRKDR +K++G RI+LEE+E+ L
Sbjct  61   FSQDFIHEGSFNVTCSQIYIRTGDFVQQLRSGDLVFLGRKDRIIKVNGQRISLEEIEDAL  120

Query  477  REHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRF  653
            REHP+V DAAV+ R    +   L A L++K+ NE  E+ RS + +W+  K+P AMIP  F
Sbjct  121  REHPDVVDAAVVSRKSDWELEYLVAFLVLKD-NEKSEVFRSTVRSWMVEKVPLAMIPNSF  179

Query  654  FFTESFPMSSSGKVDYNLLAN  716
            FFT+S PM++SGKVDY +L +
Sbjct  180  FFTDSIPMTTSGKVDYEILTH  200



>ref|XP_006854069.1| hypothetical protein AMTR_s00048p00109480 [Amborella trichopoda]
 gb|ERN15536.1| hypothetical protein AMTR_s00048p00109480 [Amborella trichopoda]
Length=1224

 Score =   197 bits (502),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/255 (41%), Positives = 153/255 (60%), Gaps = 51/255 (20%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +SLWK + ++LP T++LN+YGSTEVSGDCT+FDC++LP +LE + LS VPIG+P+  
Sbjct  407  VFPISLWKDIHELLPHTSVLNIYGSTEVSGDCTFFDCKNLPRMLETEMLSSVPIGIPISG  466

Query  183  CDVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRT  362
            C+V+L+G+            +C   G                    S   ++  Q YFRT
Sbjct  467  CEVILVGES-----------MCQMKG-------------------KSGLENNGAQIYFRT  496

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GD+ARKL  G+++FLGRKDR VK++G R+ LEE+EN LR+HP+V D AV+  + +R    
Sbjct  497  GDYARKLACGDYVFLGRKDRLVKVNGQRVGLEEIENSLRDHPDVVDVAVV--SHRRQNFS  554

Query  543  LEAHLIMKENN------------EHVEI-------LRSITNWIARKLPPAMIPVRFFFTE  665
            L A ++ KE +            +HV I       + S+  W+A +LP  M+P +F F +
Sbjct  555  LSAFIVWKEMDGSTINDFWEERFDHVHIFGVSNRLVASLKRWLAERLPSGMLPSQFLFVK  614

Query  666  SFPMSSSGKVDYNLL  710
            S P+SSSGK+ Y+LL
Sbjct  615  SLPLSSSGKIYYDLL  629



>ref|XP_002975786.1| hypothetical protein SELMODRAFT_103915 [Selaginella moellendorffii]
 gb|EFJ23415.1| hypothetical protein SELMODRAFT_103915 [Selaginella moellendorffii]
Length=1056

 Score =   158 bits (399),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 134/230 (58%), Gaps = 19/230 (8%)
 Frame = +3

Query  30   LVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD  209
            L K LP   +LNLYGSTEVSGDC+ FDC  L  +    S + VPIG P+  C + +   D
Sbjct  311  LRKSLPWIRVLNLYGSTEVSGDCSCFDCNELSDMF---SETNVPIGTPITGCFIHIQPVD  367

Query  210  --DPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKL  383
              D N GE+C+SG  +S GY+   S   L + E  +           ++ FRTGD AR+L
Sbjct  368  GADVNFGELCISGAGVSHGYWNDESGTSLRFFESEK-----------KKAFRTGDLARRL  416

Query  384  QNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIM  563
            +NG+ I +GR DR  ++ G R+  EEVE  L E+ +V  +AV       D   L A +I+
Sbjct  417  ENGDIILVGRTDRLFQVHGQRVEPEEVERCLEENQQVKKSAVYPLRLASDDIQLAACVIL  476

Query  564  KENNE-HVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            K N++ H E   ++  W+ ++LP  M+P R+ F ++FP++SSGKVDY+ +
Sbjct  477  KANDDNHKE--DNLREWLTKRLPSYMVPERYIFVDAFPLTSSGKVDYSAI  524



>ref|XP_002973737.1| hypothetical protein SELMODRAFT_149203 [Selaginella moellendorffii]
 gb|EFJ25397.1| hypothetical protein SELMODRAFT_149203 [Selaginella moellendorffii]
Length=976

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 132/230 (57%), Gaps = 19/230 (8%)
 Frame = +3

Query  30   LVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD  209
            L K LP   +LNLYGSTEVSGDC+ FDC  L  +    S + VPIG P+  C + +   D
Sbjct  237  LRKSLPWIRVLNLYGSTEVSGDCSCFDCNELSDMF---SETNVPIGKPITGCFIHIQPVD  293

Query  210  --DPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKL  383
              D N GE+C+SG  +S GY+   S   L + E            + ++ FRTGD AR+L
Sbjct  294  GADVNFGELCISGAGVSHGYWNDESGTSLRFFE-----------SKKKKAFRTGDLARRL  342

Query  384  QNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIM  563
            +NG  I +GR DR  ++ G R+  EEVE  L E+ +V  AAV       D   L A +I+
Sbjct  343  ENGGIILVGRTDRLFQVHGQRVEPEEVERCLEENQQVKKAAVYPLRLASDDIQLAACVIL  402

Query  564  KENNE-HVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            + N++ H E    +  W+ ++LP  M+P R+ F ++FP++SSGKVDY+ +
Sbjct  403  EANDDNHKE--DKLREWLTKRLPSYMVPERYIFVDAFPLTSSGKVDYSAI  450



>ref|XP_006437382.1| hypothetical protein CICLE_v100305621mg, partial [Citrus clementina]
 gb|ESR50622.1| hypothetical protein CICLE_v100305621mg, partial [Citrus clementina]
Length=705

 Score =   144 bits (363),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  345  QQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRND  524
            Q YFRTGDFAR++Q+G+ +FLGRKDRT+KISG R+ALEE+E+ LR HP+V D AV+    
Sbjct  16   QMYFRTGDFARRIQSGDLVFLGRKDRTIKISGQRMALEEIEHTLRGHPDVVDTAVVSHKH  75

Query  525  KRDTSLLEAHLIMKENNEHVE-ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDY  701
            + +  +LEA +++KE     E  + SI +W++ KL  AMIP RF F +S PM+SSGKVDY
Sbjct  76   QGELVILEAFIVLKEKKTSSEAFVSSIKSWVSNKLSLAMIPSRFVFMDSLPMTSSGKVDY  135

Query  702  NLLA  713
              L+
Sbjct  136  ASLS  139



>ref|XP_001763026.1| predicted protein [Physcomitrella patens]
 gb|EDQ72231.1| predicted protein [Physcomitrella patens]
Length=1115

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/251 (36%), Positives = 128/251 (51%), Gaps = 25/251 (10%)
 Frame = +3

Query  39   ILPQTAILNLYGSTEVSGDCTYFDCESL-------PLILEHKSLSGVPIGLPLQSCDVLL  197
            +L  T ILNLYGSTEVSGD + FDC SL         +LE   LS  PIG P+  C   +
Sbjct  278  VLENTTILNLYGSTEVSGDSSCFDCTSLWDASSTSIQLLEDSRLSTTPIGDPINGCYHFI  337

Query  198  LGDDDP-----NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKST-----DHRVQ  347
            + D +       EGE+ V G+ ++  Y          +++LS +  S  +         +
Sbjct  338  VVDGEKLGGVNEEGELWVGGVGVAQSYLNDNESTREKFIDLSSSDASGISRLPPWTSFGE  397

Query  348  QYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK  527
            + FRTGD  +KL +GN + LGR DR VKI G+RI+LEE+E  +  HP+V+   V      
Sbjct  398  RIFRTGDVVKKLPDGNVVLLGRIDRQVKIRGNRISLEEIEGYIEMHPKVSRCVVTLHTRL  457

Query  528  RDTSLLEAHLIMKENNEHVEILRSITN--------WIARKLPPAMIPVRFFFTESFPMSS  683
                 L A+++       + I   IT+        W+A KLP  MIP  F    S P+++
Sbjct  458  ESDMDLVAYVVYDRAMTSLLIYEEITSNLSHELKLWLAEKLPSVMIPQIFIPLVSLPLTN  517

Query  684  SGKVDYNLLAN  716
            SGKVDY+ L +
Sbjct  518  SGKVDYDSLPD  528



>ref|WP_007358387.1| MULTISPECIES: multifunctional peptide synthetase [Kamptonema]
 emb|CBN59216.1| multifunctional peptide synthetase [ [[Oscillatoria] sp. PCC 
6506]
Length=1124

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/241 (36%), Positives = 133/241 (55%), Gaps = 23/241 (10%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            T  + L +   + +PQ+ ++NLYGS+EVS D T++D        +++SLS +PIG P+ +
Sbjct  778  TLSVELCQRFQERMPQSILINLYGSSEVSADVTWYDTS------KNQSLSSIPIGRPISN  831

Query  183  CDVLLLGDD-DPNE----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQ  347
              V +L     P      GE+C+ G  L+ GY   P +    ++    + ++ +      
Sbjct  832  MQVYVLDAHLQPVPIGVPGELCIGGDGLARGYLNRPELTAEKFIPNPFSSENGAY-----  886

Query  348  QYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK  527
              +R+GD  R L NG   +LGR DR +K+ G RI L EVENVL +HP V  A VI R D+
Sbjct  887  -LYRSGDIGRYLFNGEIEYLGRSDRQIKLRGFRIELGEVENVLTQHPLVKQAVVILREDE  945

Query  528  RDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNL  707
             D   L A+++   +N ++E LRS   ++A KLP  M+P      E+ P++ +GKVDY  
Sbjct  946  VDNKRLVAYIV--SDNINLE-LRS---FLAEKLPDYMVPSVVIQLEALPLTPNGKVDYRA  999

Query  708  L  710
            L
Sbjct  1000 L  1000



>ref|WP_016862252.1| hypothetical protein [Fischerella muscicola]
Length=1362

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 126/234 (54%), Gaps = 22/234 (9%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            + L +   +++P   ++NLYGS+EVS + TY+D   LP     +  + VPIG P+ +  V
Sbjct  770  IKLVQTFQELMPLAKLINLYGSSEVSANATYYDTSLLP-----EQANSVPIGRPIDNTQV  824

Query  192  LLLGDD-DPNE----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
             +L  D  P      GE+ + G  L+ GY   P        EL++           ++ +
Sbjct  825  YVLNRDLQPTPAGVVGELYIGGDGLARGYLHRP--------ELTKEKFITKPFILGKKLY  876

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            +TGD  R+LQ+GN  +LGR+D  VKI G R+ L E+ N++ +HP+V ++ VI  ND +D 
Sbjct  877  KTGDLVRRLQDGNLEYLGRQDEQVKIRGFRVELGEIANIINQHPDVEESVVIASNDAQDN  936

Query  537  SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              L A+++  + +   +IL     ++ +KLP  M+P      E  P++ +GK+D
Sbjct  937  PRLIAYVVTDKQDISTQILL----YLQQKLPNYMLPSALVVLEQLPLTPNGKID  986



>ref|WP_038341182.1| hypothetical protein, partial [delta proteobacterium PSCGC 5451]
Length=422

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 119/236 (50%), Gaps = 27/236 (11%)
 Frame = +3

Query  15   SLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVL  194
             L K   K +PQ+ +LNLYGSTEVS DCT++D        + K    VPIG P+ +  + 
Sbjct  111  KLVKQFYKTIPQSILLNLYGSTEVSADCTWYDTR------KGKLSPHVPIGRPISNTRIY  164

Query  195  LLGDDDPN--------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            LL   D N         GEI V G  L+ GY   P        EL++    +        
Sbjct  165  LL---DSNLQPVPIGVPGEIHVGGDGLARGYLNRP--------ELTKKRFIRIPYLSEPL  213

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD A    +GN  FLGR D  VKI G+RI L E+E +L +HP V +  V+ R+D  
Sbjct  214  LYRTGDLACYRPDGNLEFLGRIDNQVKIRGYRIELGEIEALLNQHPAVGENVVMVRDDAP  273

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            D   L A+L+   N + +     +  ++  +LP  M+P  F F  + P++ SGKVD
Sbjct  274  DDRRLVAYLVA--NTDDLPPEPDLRRFLKERLPDYMVPSAFVFLNALPLTPSGKVD  327



>ref|WP_017308737.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=1368

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 128/234 (55%), Gaps = 22/234 (9%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            + L K   K+LP   ++NLYGS+EVS + TY+D   LP        + VPIG P+ +  +
Sbjct  774  IKLVKSFRKLLPFAKLINLYGSSEVSANATYYDTTLLP-----DQANSVPIGCPIDNTQI  828

Query  192  LLLGDD-DPNE----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
             +L  +  P      GE+ + G  L+ GY   P      +++     ++K         +
Sbjct  829  YVLNRNLQPTPVGVIGELYIGGDGLARGYLHRPEFTQEKFIDNPFIPETK--------LY  880

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            +TGD  R L++GN  +LGR+D  VKI G R+ L E+  V+ +HP++ ++ VI   D+++ 
Sbjct  881  KTGDLVRYLKDGNLEYLGRRDEQVKIRGFRVELAEIVAVITQHPDIQESVVIAEKDEQED  940

Query  537  SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
             +L A+++ K+ N   ++L     ++ +KLP  M+P  F   ++FP++ +GK+D
Sbjct  941  QILIAYIVTKKQNIAAQLLP----YLQQKLPNYMLPSAFVVVDAFPLTPNGKID  990



>gb|AIE12107.1| putative NRPS/PKS hybrid synthase module E2C [uncultured bacterium]
Length=2099

 Score =   129 bits (325),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/238 (34%), Positives = 127/238 (53%), Gaps = 22/238 (9%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H+ L+  +        + NLYG TE + D TYFDC +         ++ VPIG P+ +  
Sbjct  314  HVQLFNAIWGSRTSARLTNLYGPTEATVDVTYFDCPA------RGEVARVPIGKPIDNIR  367

Query  189  VLLLGDDD----PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
              ++ ++        GE+C++G+ L+ GY   P++  L +VE      S + D   ++ +
Sbjct  368  AYVIREESVMPVGEPGELCLAGVGLARGYLKNPNLTKLRFVE------SPAVDE--ERVY  419

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGD AR L +GN  FLGR+D+ VKI G RI L E+E+ +REHP VAD  V  +      
Sbjct  420  RTGDLARWLPDGNIEFLGREDQQVKIRGIRIELGEIEHAVREHPAVADCVVTTKRYAESV  479

Query  537  SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             LL A+++ K+  +  E+ R +      +LP  MIP  +      P++++GKVD + L
Sbjct  480  ILLIAYIVGKDELDLEELRRHLKT----RLPDYMIPGHYERIPQIPLTANGKVDRDEL  533



>ref|WP_027841528.1| non-ribosomal peptide synthetase [Mastigocoleus testarum]
Length=1365

 Score =   129 bits (323),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 126/240 (53%), Gaps = 22/240 (9%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            + L +   +++P+  ++NLYGS+EVS + TY+D   LP          VPIG P+ +  +
Sbjct  770  VDLVRTFQELIPEAKLINLYGSSEVSANATYYDTSLLP-----NQAHSVPIGRPIDNTQI  824

Query  192  LLLGDD-DPNE----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
             +L  D  P      GE+ V G  L+ GY   P        EL+Q     +      + +
Sbjct  825  YVLNRDLQPTPVGIVGELYVGGDGLAKGYLHRP--------ELTQERFISNPFITGNKIY  876

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            +TGD  R L++GN  +LGR D  +KI G R+ L E+  V+ +H +V ++ VI RND ++ 
Sbjct  877  KTGDLVRYLKDGNIEYLGRSDEQIKIRGFRVELGEIATVITQHQDVQESVVIARNDNQEN  936

Query  537  SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
              L A+++     E+ +I   +  ++ +KLP  M+P  F   ++ P++ +GKVD   L N
Sbjct  937  QCLIAYIL----TENKDIATQLLPYLQQKLPNYMLPFAFVVLDALPLTPNGKVDKRALPN  992



>ref|WP_007358381.1| MULTISPECIES: non-ribosomal peptide synthase (fragment) [Kamptonema]
 emb|CBN59210.1| non-ribosomal peptide synthase (fragment) [ [[Oscillatoria] sp. 
PCC 6506]
Length=1362

 Score =   129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 126/234 (54%), Gaps = 22/234 (9%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            L+L +   K+LP   ++NLYGS+EVS + TY+D   LP     +  + VPIG P+ +  V
Sbjct  768  LNLARSFTKLLPSAKLINLYGSSEVSANATYYDTSLLP-----EKATSVPIGRPINNTQV  822

Query  192  LLLGDD-DPNE----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
             +L     P      GE+ + G  L+ GY   P +    +++   N     T     + +
Sbjct  823  YILDRHLQPTPVGVWGELYIGGDGLAKGYLNRPELTAERFID---NIFVSGT-----KLY  874

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            +TGD  R L +GN  +LGR+D  VKI G R+ L E+E+ + +HP++ ++ VI R+D +  
Sbjct  875  KTGDLGRYLHDGNVEYLGRRDEQVKIRGFRVELGEIESAIVQHPDIRESVVIIRDDTQGD  934

Query  537  SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              L A+++  E N    ++  +  ++  KLP  MIP  F   ++ P++ +GKVD
Sbjct  935  KQLIAYIVTDEPN----LVSQLHGYLLLKLPDYMIPSAFVVLDAIPLTPNGKVD  984



>gb|AEQ38168.1| AnaC [Anabaena sp. 37]
Length=532

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 128/234 (55%), Gaps = 18/234 (8%)
 Frame = +3

Query  18   LWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLL  197
            L +++V I P     NLYG TE +  CTY+   S P I   ++   VPIG    + +V +
Sbjct  300  LHQLMVHI-PDAGYYNLYGPTE-TNVCTYYRV-SPPDI---ETSEAVPIGQACANTEVFV  353

Query  198  LGDDDP-----NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRT  362
            LG  +        GE+CV G  L  GY+  P       V  + +H   S     +  +RT
Sbjct  354  LGTSNELVARGEVGELCVRGPGLMTGYWDLPEKTAQVLVPFTLHHGLGS-----EMIYRT  408

Query  363  GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
            GD  ++   G++IFLGR+DR +K  G+RI L E+E+VL  HP +A+ AVI   D   ++ 
Sbjct  409  GDLVKQSPEGDYIFLGRRDRMIKSRGYRIELGEIESVLYSHPALAEVAVIPIPDNEISNR  468

Query  543  LEAHLIMKENNEHVEIL--RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            ++A ++ + +N+  EIL  +++ ++ A +LP  M+P  F F  S P +S+GK+D
Sbjct  469  IKAFVVTRGDNKDTEILNVQTLKSFCAERLPKYMVPDLFEFRSSLPQTSTGKID  522



>ref|WP_036709312.1| peptide synthetase [Paenibacillus pinihumi]
Length=531

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/239 (34%), Positives = 126/239 (53%), Gaps = 21/239 (9%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H+  +  L+     T + NLYG TE + D TY+DC     I++      VPIG P+ +  
Sbjct  303  HVKKFNTLLGQKNGTRLTNLYGPTEATVDVTYYDCPGSGEIIK------VPIGKPIDNTA  356

Query  189  VLLLGDDD---PNE-GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
            + +LG+     P E GE+C++G+ L+ GY   P        +LS      S   R  + +
Sbjct  357  MYILGESGLMPPGEKGELCIAGVGLARGYLNQP--------KLSDERFVDSPVCRGARIY  408

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            RTGD+AR L NGN  +LGR D  VKI G RI L E+E  L EH  V+   V+ ++ +   
Sbjct  409  RTGDYARLLPNGNIEYLGRMDNQVKIRGLRIELGEIEARLCEHEAVSQCVVVLKDVESIN  468

Query  537  SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
             +L A+L+  +++   + ++    ++   LP  M+P  +   +SFP + +GKVD N LA
Sbjct  469  PVLTAYLLTADSSLTDKKMKM---FLRNFLPDYMVPNHYIIMDSFPKTMNGKVDRNALA  524



>ref|WP_017332089.1| hypothetical protein [Burkholderia pyrrocinia]
Length=4951

 Score =   127 bits (320),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 76/228 (33%), Positives = 118/228 (52%), Gaps = 14/228 (6%)
 Frame = +3

Query  42    LPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP--  215
             LP   + NLYG TE + D T F C   P   + ++   VPIG P+ +  + LL DD    
Sbjct  1756  LPHAQLHNLYGPTEAAIDVTAFTC---PTDFDAQT---VPIGKPIANTRIYLLDDDQAPV  1809

Query  216   ---NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQ  386
                  GE+ + G  ++ GY   P +    ++    +  +   D R+   +RTGD AR L 
Sbjct  1810  PLGAVGELYIGGTGVARGYLNRPELTAERFLSDPFSRAAGQPDARM---YRTGDLARYLP  1866

Query  387   NGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK  566
             +GN +FLGR D  VKI G RI   E+E  L  H  V DA VI R+D    + L A++++ 
Sbjct  1867  DGNLVFLGRNDEQVKIRGFRIEPGEIEVQLATHDAVRDAIVIARHDSAGNARLLAYVVLH  1926

Query  567   ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             ++    E++R +   +A +LP  M+P  F   ++ P++ +GK+D   L
Sbjct  1927  DDAPRAELVRQLREHLAARLPEYMVPAAFIVIDALPLTPNGKLDRRAL  1974


 Score =   124 bits (310),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 76/228 (33%), Positives = 118/228 (52%), Gaps = 14/228 (6%)
 Frame = +3

Query  42    LPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP--  215
             LPQ  + NLYG TE + D T F C   P   + +S   VPIG P+ +  + LL +     
Sbjct  3279  LPQAQLHNLYGPTEAAIDVTAFTC---PADFDAQS---VPIGKPIANTRIYLLDEVKAPV  3332

Query  216   ---NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQ  386
                  GE+ + G  ++ GY   P +    ++       +   D R+   +RTGD AR L 
Sbjct  3333  PLGAVGELYIGGTGVARGYLNRPELAAERFLPDPFARAAGQPDARM---YRTGDLARYLP  3389

Query  387   NGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK  566
             +GN +F+GR D  VKI G RI L E+E  L  H  V DA VI R+D    + L A++++ 
Sbjct  3390  DGNLVFVGRNDDQVKIRGFRIELGEIEVQLTTHDAVRDAIVIARHDAAGNARLLAYVVLH  3449

Query  567   ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             ++    E++R +   +A +LP  M+P  F   ++ P++ +GK+D   L
Sbjct  3450  DDAPRAELVRGLREHLAARLPEYMVPAAFIVLDALPLTPNGKLDRRAL  3497


 Score =   103 bits (258),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 70/227 (31%), Positives = 110/227 (48%), Gaps = 14/227 (6%)
 Frame = +3

Query  45    PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP---  215
             P   I+N YG TE +   T  +      I      +  PIG P+ +  + LL +      
Sbjct  4345  PSLRIVNNYGPTETTIVATSGE------IAPSSGDTLYPIGKPIANTRIYLLDECRAPVP  4398

Query  216   --NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                 GE+ + G  ++ GY   P +    ++       +   D R+   +RTGD AR L +
Sbjct  4399  LGAVGELYIGGAGVARGYLNRPELTAERFLSDPFARAAGQPDARM---YRTGDLARYLPD  4455

Query  390   GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
             GN +FLGR D  VKI G RI   E+   L  H  V DA VI R+D    + L A++ + +
Sbjct  4456  GNLVFLGRNDEQVKIRGFRIEPGEIAVQLATHDAVRDAIVIARHDAAGNARLLAYVTLHD  4515

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             +   VEI+R +   +A +LP  M+P  F   ++ P++++GK+D   L
Sbjct  4516  DAPRVEIVRRLREHLAARLPEYMVPAAFIVLDALPLTANGKLDRRAL  4562


 Score =   102 bits (254),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 71/229 (31%), Positives = 111/229 (48%), Gaps = 15/229 (7%)
 Frame = +3

Query  42   LPQT-AILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP-  215
            LP +  I+N YG TE +   T  +      I      +   IG P+ +  + LL +D   
Sbjct  662  LPSSLRIVNNYGPTETTVVATSGE------IATSSGDTLYSIGKPIANTRIYLLDEDQTP  715

Query  216  ----NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKL  383
                  GE+ + G  ++ GY   P +    ++       +   D R+   +RTGD AR L
Sbjct  716  VPLGAVGELYIGGAGVARGYLNRPELTAERFLSDPFARAAGQPDARM---YRTGDLARYL  772

Query  384  QNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIM  563
             +GN +FLGR D  VKI G RI   E+   L  H  V DA VI R+D    + L A++ +
Sbjct  773  PDGNLVFLGRNDDQVKIRGFRIEPGEIAAQLATHDAVRDAIVIARHDAAGNARLLAYVAL  832

Query  564  KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             +    VEI+R +   +A +LP  M+P  F   ++ P++++GK+D   L
Sbjct  833  HDEAPRVEIVRRLLEHLAARLPEYMVPAAFIVLDALPLTANGKLDRRAL  881



>ref|WP_024094051.1| putative non-ribosomal peptide ligase domain protein [Paenibacillus 
larvae]
 ref|YP_008967565.1| putative non-ribosomal peptide ligase domain protein [Paenibacillus 
larvae subsp. larvae DSM 25430]
 gb|AHD05618.1| putative non-ribosomal peptide ligase domain protein [Paenibacillus 
larvae subsp. larvae DSM 25430]
Length=1099

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 128/242 (53%), Gaps = 25/242 (10%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +  L+  + Q  ++NLYG TE + D +YFDC++       +    +PIG P+ +  
Sbjct  755  HVARFHRLITPVNQVKLINLYGPTEATVDVSYFDCQA------DREYDVIPIGKPISNIQ  808

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + ++G++          GE+C+SG+ L+ GY   P +    +V      D+       ++
Sbjct  809  IYMVGNESEQLQPVGVAGELCISGVGLARGYLNRPELTAEKFV------DNPFVPG--EK  860

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G RI LEE+E+ L+ + ++  AAV FR    
Sbjct  861  MYRTGDLARWLPDGNIEYLGRIDSQVKIRGFRIELEEIESALQGYDKLQKAAVSFREAGN  920

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            +  L+ A++ + E     E+ R +++     LP  MIP  F      P++SSGK+D   L
Sbjct  921  EKKLV-AYITVHEELSVSELRRFLSDI----LPEYMIPAEFVIVHDIPLNSSGKIDRKRL  975

Query  711  AN  716
             +
Sbjct  976  KD  977



>ref|WP_017249069.1| peptide synthetase [Brevibacillus brevis]
Length=895

 Score =   125 bits (314),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 119/241 (49%), Gaps = 29/241 (12%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            T HL L +      P   I NLYG TE S    YF+       ++H     +PIG P+ +
Sbjct  545  TVHLFLQR-----FPHVRITNLYGPTETSIGVIYFE-------IDHTHQGPIPIGKPIAN  592

Query  183  CDVLLLGDDDP-----NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQ  347
              +LLL  +       ++GEI ++GLCL  GY   P      +V      D+   +   Q
Sbjct  593  TKILLLDSNRKLVPAGHQGEIYITGLCLGHGYLHDPEKTAASFV------DNPYPEIGYQ  646

Query  348  QYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK  527
            + +RTGD  R L NGN  F GR D  VK+ GHRI L E++ VL  HP V + AV+F+ +K
Sbjct  647  KLYRTGDLGRYLPNGNIKFCGRIDHQVKVRGHRIELGEIDEVLLSHPLVKECAVLFQEEK  706

Query  528  RDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNL  707
               + L A+ +          LR    +++ +LP  MIP  F   E  P+++ GK++  L
Sbjct  707  ---ARLCAYYVPNAQELTASDLR---GYLSERLPDHMIPSFFVSIEKMPLTAGGKINRKL  760

Query  708  L  710
            L
Sbjct  761  L  761



>gb|AHZ46177.1| NRPS [uncultured bacterium 14-4D]
Length=1109

 Score =   125 bits (315),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 126/240 (53%), Gaps = 24/240 (10%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            T  +S+ +   + +P   +LNLYGS+EV+GD T F+ E L      + +  VPIG P+ +
Sbjct  772  TLPVSMCRRFQEAVPGAVLLNLYGSSEVAGDVTCFNTEEL-----DEGVGAVPIGRPIAN  826

Query  183  CDVLL---LGDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQ  347
              + +    G   P    GE+CV G  ++ GY+C   +    ++E   +  S  +D R+ 
Sbjct  827  TRIYVCDTAGQPMPIGIAGELCVGGDGVANGYWCQAELTAERFIE---DPYSAESDARL-  882

Query  348  QYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK  527
              +R GD AR   +G+  +LGRKDR VKI G R+ L +VE +L  HP V + AV     K
Sbjct  883  --YRMGDLARWRTDGSLDYLGRKDRQVKIRGFRVELGDVEAMLANHPSVDECAVALWGKK  940

Query  528  RDTSLLEAHLIMKE---NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
             D   L A+++ +     + H      +  ++  KLP  M+P  F   E+FP++ SGK+D
Sbjct  941  TDERGLVAYVVPRAYPGPSAH-----ELRQYLEAKLPHYMVPFAFVALEAFPLTPSGKID  995



>ref|WP_020955897.1| bmyC protein [Bacillus amyloliquefaciens]
 ref|YP_008421196.1| bmyC protein [Bacillus amyloliquefaciens subsp. plantarum UCMB5113]
 emb|CDG26064.1| bmyC protein [Bacillus amyloliquefaciens subsp. plantarum UCMB5113]
Length=2619

 Score =   126 bits (316),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/236 (33%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H+S +K ++  + Q  I+NLYG TE + D +YFDC++       +  + +PIG P+ +  
Sbjct  540  HVSGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EEMYASIPIGKPISNIQ  593

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D  +       GE+C++G  L+ GY   P +    +V    NH   S +    +
Sbjct  594  LYILHADLEHMQPIGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIASGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R  + 
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIEG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 114/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQSESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++   + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKSHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_007727245.1| peptide synthetase [Brevibacillus sp. BC25]
 gb|EJL22782.1| amino acid adenylation enzyme/thioester reductase family protein 
[Brevibacillus sp. BC25]
Length=896

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 117/241 (49%), Gaps = 29/241 (12%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
            T HL L +      P   I NLYG TE S    YF+       ++H     +PIG P+ +
Sbjct  546  TVHLFLQR-----FPHVRITNLYGPTETSIGVIYFE-------IDHTHQGPIPIGKPIAN  593

Query  183  CDVLLLGDDDP-----NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQ  347
              +LLL  +        +GEI ++GLCL  GY   P      +V      D+   +   Q
Sbjct  594  TKILLLDSNRKLVPAGQQGEIYITGLCLGHGYLHDPEKTAASFV------DNPYPEIGYQ  647

Query  348  QYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK  527
            + +RTGD  R L NGN  F GR D  VK+ GHRI L E++ VL  HP V + AV+F+ +K
Sbjct  648  KLYRTGDLGRYLSNGNIKFCGRIDHQVKVRGHRIELGEIDEVLLSHPLVKECAVLFQEEK  707

Query  528  RDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNL  707
               + L A+ +          LR    +++ +LP  MIP  F   E  P++  GK++  L
Sbjct  708  ---ARLCAYYVSNAQELTASDLR---GYLSERLPDHMIPSFFVSIEKMPLTVGGKINRKL  761

Query  708  L  710
            L
Sbjct  762  L  762



>ref|WP_012704165.1| amino acid adenylation domain-containing protein [Clostridium 
botulinum]
 ref|YP_002802629.1| amino acid adenylation domain-containing protein [Clostridium 
botulinum A2 str. Kyoto]
 gb|ACO84323.1| amino acid adenylation domain protein [Clostridium botulinum 
A2 str. Kyoto]
Length=3852

 Score =   126 bits (316),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 80/236 (34%), Positives = 125/236 (53%), Gaps = 21/236 (9%)
 Frame = +3

Query  24   KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLG  203
            K + KIL    I N+YG TE   DC+ +  E      ++K++  + IG P+ +C++ +L 
Sbjct  542  KKVFKILEDIKISNVYGPTECCVDCSIYTMEQE----KNKNMENMSIGRPISNCEIYILD  597

Query  204  DDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             D         GE+C+SG  L+ GY   P +    +V+          +  ++ Y +TGD
Sbjct  598  KDYKLAPIGVLGELCISGDGLARGYLNNPELTAEKFVD-------NPFEPGIKMY-KTGD  649

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
             AR L +GN  FLGR D  VKI G RI LEE+EN L E+  V +A V+ + DK  +  L 
Sbjct  650  LARWLPDGNIEFLGRIDNQVKIRGFRIELEEIENRLLEYEGVKEAVVVAKEDKERSKYLC  709

Query  549  AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            A+++     +  E    + N++ + LP  MIP+ F   +  P++S+GKVD  +L N
Sbjct  710  AYIVSNNKIDRNE----LKNYLLKDLPEYMIPLNFVNIKKIPLTSNGKVDRKILEN  761


 Score =   117 bits (292),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 75/227 (33%), Positives = 119/227 (52%), Gaps = 24/227 (11%)
 Frame = +3

Query  48    QTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPN---  218
             Q +I+N YG TE +   T ++ +S         ++ +PIG P+ +  V +L +       
Sbjct  3087  QISIINNYGPTEATVLTTSYNVKS--------KVNNIPIGKPMYNQRVYILNNKKVAPIG  3138

Query  219   -EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               GE+C+SG  L+ GY   P +    +V+        +     ++ +RTGD AR L +GN
Sbjct  3139  VSGELCISGDGLARGYLNNPELTSEKFVD--------NPFEPGERMYRTGDLARWLPDGN  3190

Query  396   FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
               FLGR D  VKI G RI LEE+EN L E+  V +A V+ + DK  +  L A+++     
Sbjct  3191  IEFLGRIDNQVKIRGFRIELEEIENRLLEYEGVKEAVVVAKEDKERSKYLCAYIVSNNKI  3250

Query  576   EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
             +  E    + N++ + LP  MIP+ F   +  P++S+GKVD  +L N
Sbjct  3251  DRNE----LKNYLLKDLPEYMIPLNFVNIKKIPLTSNGKVDRKILEN  3293


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 70/224 (31%), Positives = 113/224 (50%), Gaps = 26/224 (12%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPN------  218
             I+N YG TE   + T+    S   ++E +  S +PIG P+ + +V ++ D + N      
Sbjct  2064  IINGYGPTE---NTTF----STAYLIEKRYYSSIPIGKPISNSNVYIV-DKNCNLTPIGI  2115

Query  219   EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNF  398
              GE+CV G  L+ GY        L+  +L+     ++     ++ +RTGD AR L +GN 
Sbjct  2116  SGELCVGGEGLAKGY--------LNREDLTAEKFIENPFEPGKRMYRTGDLARWLPDGNI  2167

Query  399   IFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNE  578
              FLGR D  VKI G RI L E+++ L  +  V + AVI R D+     + A+++  +   
Sbjct  2168  EFLGRIDNQVKIRGFRIELNEIQSHLLTYEAVKEVAVIDREDEDKNKYICAYIVCDKE--  2225

Query  579   HVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 +  I  ++  KLP  M+P  F   E  P++ +GK+D   L
Sbjct  2226  --LTVGEIRGYLLNKLPEYMVPSYFIQIEKLPLTLNGKLDKKAL  2267



>gb|AHH86044.1| NRPS [Brevibacillus brevis]
Length=896

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 113/223 (51%), Gaps = 24/223 (11%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP-----NE  221
            I NLYG TE S    YF+       ++H     +PIG P+ +  +LLL  +       ++
Sbjct  559  ITNLYGPTETSIGVIYFE-------IDHTHEGPIPIGKPIANTKILLLDSNSKLVPAGHQ  611

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            GEI ++GLCL  GY   P      +V      D+   +   Q+ +RTGD  R L NGN  
Sbjct  612  GEIYITGLCLGHGYLHDPEKTAASFV------DNPYPEIGYQKLYRTGDLGRYLPNGNIK  665

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
            F GR D  VK+ GHRI L E++ VL  HP V + AV+F+ +K   + L A+ +       
Sbjct  666  FCGRIDHQVKVRGHRIELGEIDEVLLSHPLVKECAVLFQEEK---ARLCAYYVANAEELT  722

Query  582  VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               LR    +++ +LP  MIP  F   E  P+++ GK+D  LL
Sbjct  723  ASDLR---GYLSERLPDHMIPSFFVSIEKMPLTAGGKIDRKLL  762



>ref|WP_023067603.1| linear gramicidin synthase subunit D, partial [Lyngbya aestuarii]
 gb|ERT06162.1| linear gramicidin synthase subunit D, partial [Lyngbya aestuarii 
BL J]
Length=1004

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 117/218 (54%), Gaps = 17/218 (8%)
 Frame = +3

Query  63   NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD-DPNE----GE  227
            NLYG TE + D T + C      + + +LS VPIG P+ +  + +L     P      GE
Sbjct  682  NLYGPTEAAIDVTAWTC------IRNNNLSTVPIGYPIANTQIYVLDSHLQPVPVGVPGE  735

Query  228  ICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFIFL  407
            + + G+ L+ GY+  P +    ++    N   KS      + ++TGD  R L +G   +L
Sbjct  736  LHIGGIGLARGYYNRPELTAEKFIPNPFNSQQKS-----DRLYKTGDLVRYLSDGKLEYL  790

Query  408  GRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVE  587
            GR D  VKI G RI L E+E VL++HP++    VI +N++ +   + A++I+ E     E
Sbjct  791  GRLDYQVKIRGQRIELGEIEAVLQQHPKIKSCRVIAQNNRLNDQYIVAYIILPEKPSQPE  850

Query  588  IL-RSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
             L + + N++A KLP  MIP  F   + FP++ SGK+D
Sbjct  851  NLHQKLHNFLAEKLPEYMIPSHFITLDDFPLTPSGKLD  888



>ref|WP_017307797.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=922

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/230 (35%), Positives = 121/230 (53%), Gaps = 20/230 (9%)
 Frame = +3

Query  39   ILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP-  215
            I PQ  I N YG TE + D T F  +  PL    ++   +PIG PL + ++ +L +    
Sbjct  571  IYPQIKIANAYGPTEAADDITQFIVDK-PLGENQRT---IPIGKPLANLNLYILDEQMKL  626

Query  216  ----NEGEICVSGLCLSAGYF-----CYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
                  GEICVSG+ + AGY+        S +P  + + SQ    K   +R    ++TGD
Sbjct  627  LPIGAPGEICVSGIGVGAGYWKNEEKTKLSFVPNPFTDASQ----KLPANRPDLIYKTGD  682

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
              R L +GN  FLGR D  VKI G R+ L E+E  L +HP V +  V+   ++ D ++L 
Sbjct  683  LGRWLPDGNIEFLGRIDHQVKIRGFRVELGEIETFLGQHPNVRENVVVVYQEEVDNTVLV  742

Query  549  AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            A+++ K   E V  +  + +++  KLP  MIP  F   E+ P++ SGK+D
Sbjct  743  AYVVAK--TEPVPSISELRSFLKEKLPDHMIPSTFVMLENLPLAPSGKID  790



>ref|WP_032864292.1| hypothetical protein, partial [Acinetobacter sp. ANC 4105]
Length=1107

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 128/235 (54%), Gaps = 21/235 (9%)
 Frame = +3

Query  24   KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
            K+  +ILPQT + NLYG TE + D T ++C   P  ++ KS   +PIG P+ +  V LL 
Sbjct  303  KLFNRILPQTELHNLYGPTEAAVDVTAWEC---PKSVDMKS---IPIGKPIGNTKVYLLD  356

Query  201  --GDDDPNE--GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
              G+  P    GE+ + G+ ++ GY   P +    ++   Q+  S+  D R+   +RTGD
Sbjct  357  SQGEPVPVGVVGELYIGGVQVARGYLNRPELTSERFL---QDPFSREVDARM---YRTGD  410

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
             AR L +GN  +LGR D  VKI G RI   E+   L  +PEV D AV+    + D   L 
Sbjct  411  IARWLADGNIEYLGRNDEQVKIRGFRIEPGEIATQLMTYPEVKD-AVVLACGEGDQRHLT  469

Query  549  AHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            A  I    +E VE+  S + NW+A +LP  M+P  +   ESFP++ +GK+D   L
Sbjct  470  AWWIA--TDEMVEVDSSDLHNWLASELPDYMVPRSYVRVESFPLTPNGKLDRKAL  522



>gb|ENW97168.1| hypothetical protein F904_00001, partial [Acinetobacter sp. ANC 
4105]
Length=1128

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 128/235 (54%), Gaps = 21/235 (9%)
 Frame = +3

Query  24   KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
            K+  +ILPQT + NLYG TE + D T ++C   P  ++ KS   +PIG P+ +  V LL 
Sbjct  324  KLFNRILPQTELHNLYGPTEAAVDVTAWEC---PKSVDMKS---IPIGKPIGNTKVYLLD  377

Query  201  --GDDDPNE--GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
              G+  P    GE+ + G+ ++ GY   P +    ++   Q+  S+  D R+   +RTGD
Sbjct  378  SQGEPVPVGVVGELYIGGVQVARGYLNRPELTSERFL---QDPFSREVDARM---YRTGD  431

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
             AR L +GN  +LGR D  VKI G RI   E+   L  +PEV D AV+    + D   L 
Sbjct  432  IARWLADGNIEYLGRNDEQVKIRGFRIEPGEIATQLMTYPEVKD-AVVLACGEGDQRHLT  490

Query  549  AHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            A  I    +E VE+  S + NW+A +LP  M+P  +   ESFP++ +GK+D   L
Sbjct  491  AWWIA--TDEMVEVDSSDLHNWLASELPDYMVPRSYVRVESFPLTPNGKLDRKAL  543



>ref|WP_023356939.1| bmyC [Bacillus amyloliquefaciens]
 ref|YP_008727149.1| bmyC [Bacillus amyloliquefaciens CC178]
 gb|AGZ56571.1| bmyC [Bacillus amyloliquefaciens CC178]
Length=2554

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  475  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  528

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D  +       GE+C++G  L+ GY   P +    +V    NH   S +    +
Sbjct  529  LYILHADLEHMQPIGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIASGE----R  580

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A +I R    
Sbjct  581  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIIIAREIDG  640

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  641  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  691


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 114/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  1993  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2043

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2044  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTGEKFVE----HPFAAGE----KM  2095

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2096  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQLESVKEAVVIAIEEEGS  2155

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++   + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2156  KQLC-AYLSGDDSLNTAQLKHHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2209



>ref|WP_032863998.1| peptide synthetase [Bacillus subtilis]
 gb|KFI14237.1| peptide synthetase [Bacillus subtilis]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  593

Query  189  VLLLGDD----DPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D     P    GE+C++G  L+ GY   P +    +V    NH   + +    +
Sbjct  594  LYILHADLEHMQPTGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIAAGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R    
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIDG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGQLREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 115/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQLESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++ R + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKRHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_007410142.1| MULTISPECIES: peptide synthetase [Bacillus]
 ref|YP_008412785.1| bmyC protein [Bacillus amyloliquefaciens subsp. plantarum UCMB5033]
 gb|ACI22673.1| bacillorin synthetase C [Bacillus subtilis]
 gb|EJD66074.1| BmyC [Bacillus sp. 916]
 emb|CDG29759.1| bmyC protein [Bacillus amyloliquefaciens subsp. plantarum UCMB5033]
 gb|AIW30045.1| peptide synthetase [Bacillus subtilis]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       +  + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EEMYASIPIGKPISNIQ  593

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D  +       GE+C++G  L+ GY   P +    +V    NH   S +    +
Sbjct  594  LYILHADLEHMQPIGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIASGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R  + 
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIEG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 114/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQSESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++   + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKSHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_032865983.1| peptide synthetase [Bacillus amyloliquefaciens]
 gb|EYB37905.1| peptide synthetase [Bacillus amyloliquefaciens EBL11]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       +  + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EEMYASIPIGKPISNIQ  593

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D  +       GE+C++G  L+ GY   P +    +V    NH   S +    +
Sbjct  594  LYILHADLEHMQPIGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIASGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R  + 
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIEG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 114/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQSESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++   + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKSHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_014418046.1| peptide synthetase [Bacillus amyloliquefaciens]
 ref|YP_005421278.1| bacillomycin D synthetase C [Bacillus amyloliquefaciens subsp. 
plantarum YAU B9601-Y2]
 emb|CCG49962.1| bacillomycin D synthetase C [Bacillus amyloliquefaciens subsp. 
plantarum YAU B9601-Y2]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  593

Query  189  VLLLGDD----DPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D     P    GE+C++G  L+ GY   P +    +V    NH   + +    +
Sbjct  594  LYILHADLEHMQPTGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIAAGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R    
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIDG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGQLREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 115/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQLESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++ R + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKRHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_025650130.1| peptide synthetase [Bacillus methylotrophicus]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  593

Query  189  VLLLGDD----DPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D     P    GE+C++G  L+ GY   P +    +V    NH   + +    +
Sbjct  594  LYILHADLEHMQPTGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIAAGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R    
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIDG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 114/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +  VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQLESVKETVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++ R + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKRHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_014721312.1| peptide synthetase [Bacillus amyloliquefaciens]
 ref|YP_006328852.1| linear gramicidin synthetase subunit D [Bacillus amyloliquefaciens 
Y2]
 gb|AFJ62127.1| linear gramicidin synthetase subunit D [Bacillus amyloliquefaciens 
Y2]
Length=2554

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  475  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  528

Query  189  VLLLGDD----DPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D     P    GE+C++G  L+ GY   P +    +V    NH   + +    +
Sbjct  529  LYILHADLEHMQPTGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIAAGE----R  580

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R    
Sbjct  581  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIDG  640

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  641  ETSLCAYY-----TAQHALTAGQLREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  691


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 115/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  1993  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2043

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2044  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2095

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2096  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQLESVKEAVVIAIEEEGS  2155

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++ R + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2156  KQLC-AYLSGDDSLNTAQLKRHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2209



>ref|WP_038463942.1| peptide synthetase [Bacillus subtilis]
 gb|AIW37603.1| peptide synthetase [Bacillus subtilis]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       +  + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EEMYASIPIGKPISNIQ  593

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D  +       GE+C++G  L+ GY   P +    +V    NH   S +    +
Sbjct  594  LYILHADLEHMQPIGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIASGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R  + 
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIEG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 114/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQSESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++   + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKSHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_029973834.1| MULTISPECIES: peptide synthetase [Bacillales]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  593

Query  189  VLLLGDD----DPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D     P    GE+C++G  L+ GY   P +    +V    NH   + +    +
Sbjct  594  LYILHADLEHMQPTGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIAAGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R    
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIDG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 115/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V ++ VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQLESVKESVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++ R + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKRHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_038458177.1| peptide synthetase [Bacillus amyloliquefaciens]
 gb|AHZ15812.1| BmyC [Bacillus amyloliquefaciens SQR9]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       +  + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EEMYASIPIGKPISNIQ  593

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D  +       GE+C++G  L+ GY   P +    +V    NH   S +    +
Sbjct  594  LYILHADLEHMQPIGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIASGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R  + 
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIEG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 114/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQSESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++   + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKSHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_022553270.1| Non-ribosomal peptide synthetase BmyC involved in Bacillomycin 
D synthesis [Bacillus amyloliquefaciens]
 ref|YP_008626570.1| Non-ribosomal peptide synthetase BmyC involved in Bacillomycin 
D synthesis [Bacillus amyloliquefaciens subsp. plantarum NAU-B3]
 emb|CDH95709.1| Non-ribosomal peptide synthetase BmyC involved in Bacillomycin 
D synthesis [Bacillus amyloliquefaciens subsp. plantarum NAU-B3]
 gb|AIU81972.1| Linear gramicidin synthase subunit D [Bacillus methylotrophicus]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  593

Query  189  VLLLGDD----DPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D     P    GE+C++G  L+ GY   P +    +V    NH   + +    +
Sbjct  594  LYILHADLEHMQPTGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIAAGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R    
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIDG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 115/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQLESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++ R + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKRHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_017417901.1| peptide synthetase [Bacillus amyloliquefaciens]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  593

Query  189  VLLLGDD----DPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D     P    GE+C++G  L+ GY   P +    +V    NH   + +    +
Sbjct  594  LYILHADLEHMQPTGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIAAGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R    
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIDG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 114/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +  VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQLESVKETVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++ R + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKRHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_021493394.1| peptide synthetase [Bacillus amyloliquefaciens]
 gb|ERH58583.1| peptide synthetase [Bacillus amyloliquefaciens EGD-AQ14]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  593

Query  189  VLLLGDD----DPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D     P    GE+C++G  L+ GY   P +    +V    NH   +     ++
Sbjct  594  LYILHADLEHMQPTGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIAAG----ER  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R    
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIDG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 115/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   +     ++ 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAG----EKM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQLESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++ R + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKRHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_012117677.1| peptide synthetase [Bacillus amyloliquefaciens]
 ref|YP_001421410.1| BmyC [Bacillus amyloliquefaciens subsp. plantarum str. FZB42]
 emb|CAE11248.1| BmyC protein [Bacillus amyloliquefaciens subsp. plantarum str. 
FZB42]
 gb|ABS74179.1| BmyC [Bacillus amyloliquefaciens subsp. plantarum str. FZB42]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  593

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D  +       GE+C++G  L+ GY   P +    +V    NH   S +    +
Sbjct  594  LYILHADLEHMQPIGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIASGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A +I R    
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIIIAREIDG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 114/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTGEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQLESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++   + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKHHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>gb|ERH33922.1| hypothetical protein SEQU_13405, partial [Staphylococcus equorum 
UMC-CNS-924]
Length=828

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 124/227 (55%), Gaps = 28/227 (12%)
 Frame = +3

Query  51   TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD------  212
            TA+LNLYG TE + D T FDCE+      HK+   +PIG P+ +    +L +D+      
Sbjct  473  TALLNLYGPTETTVDVTSFDCEN------HKTYDSIPIGKPISNIQAYILNEDNNIMGIG  526

Query  213  -PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
             P  GE+C++G+ ++AGY   P +    +++   N   K       + +RTGD A+   +
Sbjct  527  VP--GELCIAGVGVTAGYLNRPELTQEKFID---NPFGKG------KLYRTGDLAKWNGD  575

Query  390  GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
            GN I++GR D  VKI G+RI L E+E++LR+H  + D A++ R    +   + A+L+  +
Sbjct  576  GNIIYIGRIDEQVKIRGYRIELGEIESILRQHTHINDVAIVARPMVDNELSICAYLVSDD  635

Query  570  NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            + +      S+   + +KLP  MIP      +  P++S+GK++   L
Sbjct  636  SLD----FGSLKTSLGQKLPDYMIPAYMTQLDELPVTSNGKLNKKAL  678



>ref|WP_039063176.1| peptide synthetase [Bacillus amyloliquefaciens]
Length=2619

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       +  + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EEMYASIPIGKPISNIQ  593

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D  +       GE+C++G  L+ GY   P +    +V    NH   S +    +
Sbjct  594  LYILHADLEHMQPIGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIASGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R  + 
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIEG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 114/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HLFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQSESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++   + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKSHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>gb|ETK26989.1| putative non-ribosomal peptide ligase domain protein [Paenibacillus 
larvae subsp. larvae DSM 25719]
Length=1099

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 128/242 (53%), Gaps = 25/242 (10%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +  L+  + Q  ++NLYG TE + D +YFDC++       +    +PIG P+ +  
Sbjct  755  HVARFHRLITPVNQVKLINLYGPTEATVDVSYFDCQA------DREYDVIPIGKPISNIQ  808

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + ++G++          GE+C+SG+ L+ GY   P +    +V      D+       ++
Sbjct  809  IYMVGNESEQLQPVGVAGELCISGVGLARGYLNRPELTAEKFV------DNPFVPG--EK  860

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             ++TGD AR L +GN  +LGR D  VKI G RI LEE+E+ L+ + ++  AAV FR    
Sbjct  861  MYQTGDLARWLPDGNIEYLGRIDSQVKIRGFRIELEEIESALQGYDKLQKAAVSFREAGN  920

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            +  L+ A++ + E     E+ R +++     LP  MIP  F      P++SSGK+D   L
Sbjct  921  EKKLV-AYITVHEELSVSELRRFLSDI----LPEYMIPAEFVIVHDIPLNSSGKIDRKRL  975

Query  711  AN  716
             +
Sbjct  976  KD  977



>gb|AAG16975.1| micrococcin P1 peptide synthetase [Staphylococcus equorum]
Length=915

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 124/227 (55%), Gaps = 28/227 (12%)
 Frame = +3

Query  51   TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD------  212
            TA+LNLYG TE + D T FDCE+      HK+   +PIG P+ +    +L +D+      
Sbjct  447  TALLNLYGPTETTVDVTSFDCEN------HKTYDSIPIGKPISNIQAYILNEDNNIMGIG  500

Query  213  -PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
             P  GE+C++G+ ++AGY   P +    +++   N   K       + +RTGD A+   +
Sbjct  501  VP--GELCIAGVGVTAGYLNRPELTQEKFID---NPFGKG------KLYRTGDLAKWNGD  549

Query  390  GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
            GN I++GR D  VKI G+RI L E+E++LR+H  + D A++ R    +   + A+L+  +
Sbjct  550  GNIIYIGRIDEQVKIRGYRIELGEIESILRQHTHINDVAIVARPMVDNELSICAYLVSDD  609

Query  570  NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            + +      S+   + +KLP  MIP      +  P++S+GK++   L
Sbjct  610  SLD----FGSLKTSLGQKLPDYMIPAYMTQLDELPVTSNGKLNKKAL  652



>ref|WP_018670344.1| tyrocidine synthase 3 [Brevibacillus laterosporus]
Length=2337

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 125/236 (53%), Gaps = 24/236 (10%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H+  ++  V  + +  ++NLYG TE + D TYFDC++       + L+ +PIG P+ +  
Sbjct  739  HVDRFRRAVSSVCEARLINLYGPTEATVDVTYFDCDT------DEELAAIPIGKPIYNTQ  792

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + ++  D  N       GE+C++G+ L+ GY   P        EL++    K+     ++
Sbjct  793  LYIVQADSENLQPIGIAGELCIAGVGLARGYLNRP--------ELTEEKFVKNPFVAGER  844

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G RI L E+E+ +R+   + +  V+ + D+ 
Sbjct  845  MYRTGDLARWLPDGNIEYLGRIDDQVKIRGVRIELGEIESQMRKLDGLREVVVVAKEDQA  904

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                L A+++        EI   +T     +LP AMIP  F   E+ P++++GK+D
Sbjct  905  KEKFLCAYMVTDREVSTAEIRAHLTT----QLPIAMIPSTFISLEAMPLTANGKID  956


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 92/190 (48%), Gaps = 17/190 (9%)
 Frame = +3

Query  156   VPIGLPLQSCDVLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHD  320
             + IG PL +  V ++ ++   +     GE+C++G  L  GY   P        EL++   
Sbjct  1820  ITIGRPLANVTVYIVNNEHHLQPIGVVGELCIAGRGLGRGYLNRP--------ELTEEKF  1871

Query  321   SKSTDHRVQQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVAD  500
               +     ++ ++TGD A+   +G   ++GR D  VK+ G RI + E+E+ + ++  V +
Sbjct  1872  VANPFVSGERMYKTGDLAKWRPDGTIEYVGRVDEQVKVRGFRIEIGEIESTILQYHGVKE  1931

Query  501   AAVIFRNDKRDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMS  680
               V  + D+     L A+ +     E   +L  +  +++++LP  M+P  F      P +
Sbjct  1932  VVVTAQEDQHAQQFLCAYFVA----EKEVVLADLRKFVSKELPAYMVPTYFVQLLELPTT  1987

Query  681   SSGKVDYNLL  710
             ++GKVD   L
Sbjct  1988  ANGKVDKRAL  1997



>ref|WP_039754091.1| amino acid adenylation, partial [Hassallia byssoidea]
Length=2091

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 120/226 (53%), Gaps = 19/226 (8%)
 Frame = +3

Query  36    KILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GD  206
             ++LP T++ N YG TE +   + +DC++      H   + VPIG P+ +  V LL   G 
Sbjct  1836  QLLPSTSLFNEYGPTEATVWSSVYDCQN------HDLTTPVPIGRPIANTQVYLLNFYGQ  1889

Query  207   DDP--NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARK  380
               P    GE+ +SG  L+ GY   P +    ++    N  S     R+   ++TGD AR 
Sbjct  1890  LVPIGVPGELHISGFGLAKGYLNRPELTAQKFIP---NLFSNEPSDRL---YKTGDLARY  1943

Query  381   LQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLI  560
             L NGN  FLGR D  VK+ G+RI L E+E VL +HP + +A VI R D      L A+++
Sbjct  1944  LPNGNIEFLGRSDHQVKLRGYRIELTEIEAVLLQHPLIREAVVIVREDNSGNKRLVAYVL  2003

Query  561   MKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              ++     +    + +++ +KLP  MIP  F   ++ P++ +GKVD
Sbjct  2004  SEQKPAPTK--GELQSFLKQKLPEYMIPTTFVMLDTLPLTPNGKVD  2047


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 112/253 (44%), Gaps = 50/253 (20%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLS-GVPIGLPLQSCDVLLLGDDDPN-----  218
            ++N+YG TE +   TY      P+ +   S     PIG  +    V LL           
Sbjct  737  LINMYGITETTVHVTY-----RPITMADLSQRVASPIGHRIPDLQVYLLDSQQQPVPIGV  791

Query  219  EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNF  398
             GE+ + G  ++ GY   P +    ++       +   + +  + +++GD AR L NG  
Sbjct  792  AGELYIGGAGVTRGYLNRPELNAERFI------TNPFENSKFNRLYKSGDLARYLPNGEL  845

Query  399  IFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFR------------NDKRDT-S  539
             +LGR D+ VKI G RI L E+E VL +HP + +A  + R            ND  D+ +
Sbjct  846  EYLGRIDQQVKIRGFRIELGEIEAVLCQHPAIQEAIALVRENNSKSWGINSINDLEDSVA  905

Query  540  LLEAHLIMKENNE-----------------HVEI---LRSITNWIARKLPPAMIPVRFFF  659
            + +    +KE +                  H E+   L  +  ++  +LP  MIP  F  
Sbjct  906  IADLRRFIKERSPESKSEHSNQLLVAYCVYHQELKPNLTELRGFLQERLPNYMIPAAFVM  965

Query  660  TESFPMSSSGKVD  698
             ++FP++++GKVD
Sbjct  966  LKAFPLTANGKVD  978



>gb|AAN07014.1| bacillomycin D synthetase C [Bacillus subtilis]
Length=2619

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  540  HVAGFKHIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  593

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D  +       GE+C++G  L+ GY   P +    +V    NH   S +    +
Sbjct  594  LYILHADLEHMQPIGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIASGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R    
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPVIKEAIVIAREIDG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 115/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQHIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQSESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++ R + N    KLP  MIP  F   E  P++++GK++   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKRHLLN----KLPAYMIPAYFVQMEKMPITANGKIERKAL  2274



>ref|WP_007611810.1| MULTISPECIES: peptide synthetase [Bacillus]
 gb|EIF13401.1| BmyC [Bacillus sp. 5B6]
Length=2619

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  540  HVAGFKHIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  593

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D  +       GE+C++G  L+ GY   P +    +V    NH   S +    +
Sbjct  594  LYILHADLEHMQPIGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIASGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R    
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPVIKEAIVIAREIDG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 115/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQHIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQSESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++ R + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKRHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_031412349.1| tyrocidine synthase 3 [Brevibacillus laterosporus]
Length=2544

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/243 (34%), Positives = 129/243 (53%), Gaps = 24/243 (10%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFD-CESLPLILEHKSLSGVPIGLPLQSCD  188
            + +W+   K+  +  I N YG TE +   T +D  E LP   E K    +PIG PL + D
Sbjct  749  VRMWQ--RKVGTRILIANAYGPTEATVCKTIYDLTEMLP---EEKQ--SIPIGKPLANSD  801

Query  189  VLLLGD-------DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQ  347
            + +L         + P  GEI + G+ L+ GY          +V L+  +  +      +
Sbjct  802  IFILNKHGMLCPLNVP--GEIILGGVGLAKGYLNQVEQTKAAFVSLALPNQPE------K  853

Query  348  QYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK  527
            +++RTGD  R L +GN  F+GR D  VKI G+RI L+E+E VL +HP+V D+A++   D 
Sbjct  854  RFYRTGDIGRILPDGNLEFMGRMDHQVKIRGYRIELDEIETVLLQHPKVKDSAIVVYKDD  913

Query  528  RDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNL  707
             D S L A  +  +++E + +   +T ++ ++LP  M+P  F+   S P+S SGKVD   
Sbjct  914  HDRSRLVAFYMTADSDEDIPVDELVT-YLNQRLPVYMVPEHFYTLSSMPLSPSGKVDRKS  972

Query  708  LAN  716
            LA 
Sbjct  973  LAQ  975


 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 105/223 (47%), Gaps = 21/223 (9%)
 Frame = +3

Query  48    QTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP----  215
             QT I+N YG TE +   T++     P+         VPIG PL +  + +L         
Sbjct  1831  QTLIINEYGPTEATVSATFY-----PIHRIEPEQKNVPIGKPLANTKIHILHSQKTPCPI  1885

Query  216   -NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GEI +  + LS GY+         ++     H+         + +RTGD AR L +G
Sbjct  1886  GAIGEIYIESVGLSPGYWNQEKKNEEVFISNPFTHEF------ADRLYRTGDLARWLPDG  1939

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
             N  F+GR+D  +KI G+R+ L E+E  L +HP +  + V+  +   +  L+  +      
Sbjct  1940  NIEFVGRRDDQIKIRGYRVELGEIEETLLQHPLIHQSVVLAVDSGAEKVLVSYYT----T  1995

Query  573   NEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
             N   EI  S + ++++  +P  M+P  +   E  P++ +GKVD
Sbjct  1996  NSQQEIQASELNSYLSGTIPEYMLPRHYIHLEELPLTPNGKVD  2038



>ref|WP_035318261.1| tyrocidine synthase 3 [Brevibacillus laterosporus]
Length=2544

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/241 (33%), Positives = 126/241 (52%), Gaps = 20/241 (8%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFD-CESLPLILEHKSLSGVPIGLPLQSCD  188
            + +W+   K+  +  I N YG TE +   T +D  E LP     +    +PIG PL + +
Sbjct  749  VRMWQ--RKVGTRILIANAYGPTEATVCKTIYDITEMLP-----EEQQSIPIGKPLANSE  801

Query  189  VLLLGDDD-----PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
            + +L   D        GEI + G+ L+ GY          +V L+  +  +      +++
Sbjct  802  IFILNKHDILCPLNVPGEIILGGVGLAKGYLNQAEQTKTAFVSLALPNQPE------KRF  855

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            +RTGD  R L +GN  F+GR D  VKI G+RI L+E+E VL +HP+V D+A++   D  D
Sbjct  856  YRTGDIGRILPDGNLEFMGRMDHQVKIRGYRIELDEIETVLLQHPKVKDSAIVVYKDDHD  915

Query  534  TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
             S L A  +  +++  V +   +T ++ ++LP  M+P  F+   S P+S SGKVD   LA
Sbjct  916  RSRLVAFYMTADSDGDVPVDELVT-YLNQRLPVYMVPEHFYTLSSMPLSPSGKVDRKSLA  974

Query  714  N  716
             
Sbjct  975  Q  975


 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/223 (29%), Positives = 105/223 (47%), Gaps = 21/223 (9%)
 Frame = +3

Query  48    QTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP----  215
             QT I+N YG TE +   T++     P+         VPIG PL +  + +L         
Sbjct  1831  QTLIINEYGPTEATVSATFY-----PIHRIEPEQKNVPIGKPLANTKIHILHSQKTPCPI  1885

Query  216   -NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GEI +  + LS GY+         ++     H+         + +RTGD AR L +G
Sbjct  1886  GAIGEIYIESVGLSPGYWNQEKKNEEVFISNPFTHEF------ADRLYRTGDLARWLPDG  1939

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
             N  F+GR+D  +KI G+R+ L E+E  L +HP +  + V+  +   +  L+  +      
Sbjct  1940  NIEFVGRRDDQIKIRGYRVELGEIEETLLQHPLIHQSVVLAVDSGAEKVLVSYYT----T  1995

Query  573   NEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
             N   EI  S + ++++  LP  M+P  +   E  P++ +GKVD
Sbjct  1996  NSQQEIQASELNSYLSGTLPEYMLPRHYIHLEELPLTPNGKVD  2038



>emb|CCF13110.1| thioester reductase domain protein [Brevibacillus laterosporus 
GI-9]
Length=2577

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/241 (33%), Positives = 126/241 (52%), Gaps = 20/241 (8%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFD-CESLPLILEHKSLSGVPIGLPLQSCD  188
             + +W+   K+  +  I N YG TE +   T +D  E LP     +    +PIG PL + +
Sbjct  782   VRMWQ--RKVGTRILIANAYGPTEATVCKTIYDITEMLP-----EEQQSIPIGKPLANSE  834

Query  189   VLLLGDDD-----PNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
             + +L   D        GEI + G+ L+ GY          +V L+  +  +      +++
Sbjct  835   IFILNKHDILCPLNVPGEIILGGVGLAKGYLNQAEQTKTAFVSLALPNQPE------KRF  888

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             +RTGD  R L +GN  F+GR D  VKI G+RI L+E+E VL +HP+V D+A++   D  D
Sbjct  889   YRTGDIGRILPDGNLEFMGRMDHQVKIRGYRIELDEIETVLLQHPKVKDSAIVVYKDDHD  948

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
              S L A  +  +++  V +   +T ++ ++LP  M+P  F+   S P+S SGKVD   LA
Sbjct  949   RSRLVAFYMTADSDGDVPVDELVT-YLNQRLPVYMVPEHFYTLSSMPLSPSGKVDRKSLA  1007

Query  714   N  716
              
Sbjct  1008  Q  1008


 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/223 (29%), Positives = 105/223 (47%), Gaps = 21/223 (9%)
 Frame = +3

Query  48    QTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP----  215
             QT I+N YG TE +   T++     P+         VPIG PL +  + +L         
Sbjct  1864  QTLIINEYGPTEATVSATFY-----PIHRIEPEQKNVPIGKPLANTKIHILHSQKTPCPI  1918

Query  216   -NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GEI +  + LS GY+         ++     H+         + +RTGD AR L +G
Sbjct  1919  GAIGEIYIESVGLSPGYWNQEKKNEEVFISNPFTHEF------ADRLYRTGDLARWLPDG  1972

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
             N  F+GR+D  +KI G+R+ L E+E  L +HP +  + V+  +   +  L+  +      
Sbjct  1973  NIEFVGRRDDQIKIRGYRVELGEIEETLLQHPLIHQSVVLAVDSGAEKVLVSYYT----T  2028

Query  573   NEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
             N   EI  S + ++++  LP  M+P  +   E  P++ +GKVD
Sbjct  2029  NSQQEIQASELNSYLSGTLPEYMLPRHYIHLEELPLTPNGKVD  2071



>ref|WP_016743545.1| peptide synthetase [Brevibacillus brevis]
Length=896

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 114/223 (51%), Gaps = 24/223 (11%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP-----NE  221
            I NLYG TE S    YF+       ++H     +PIG P+ +  +LLL  +       ++
Sbjct  559  ITNLYGPTETSIGVIYFE-------IDHTHEGPIPIGKPIANTKILLLDSNRKLVPAGHQ  611

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            GEI ++GLCL  GY   P      +V      D+   +   Q+ +RTGD  R L NGN  
Sbjct  612  GEIYITGLCLGHGYLHDPKKTAASFV------DNPYPEIGYQKLYRTGDLGRYLPNGNIK  665

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
            F GR D  VK+ GHRI L E++ VL  HP V + AV+F+ +K   + L A+ +    +  
Sbjct  666  FCGRIDHQVKVRGHRIELGEIDEVLLSHPLVKECAVLFQEEK---ARLCAYYVANAEDLT  722

Query  582  VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               LR    +++ +LP  MIP  F   E  P+++ GK++  LL
Sbjct  723  ASDLR---GYLSERLPDHMIPSFFVSIEKMPLTAGGKINRKLL  762



>ref|WP_032871594.1| peptide synthetase [Bacillus sp. UNC69MF]
Length=2619

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +PIG P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGPTEATIDVSYFDCQT------EETYASIPIGKPISNIQ  593

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D  +       GE+C++G  L+ GY   P +    +V    NH   + +    +
Sbjct  594  LYILHADLEHMQPIGVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIAAGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R    
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIDG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEVPLTFNGKID  756


 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 114/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   TY +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTYKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L +    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDEYQRIQVMGIPGELYVAGEGLARGYLNRPELTAEKFVE----HLFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V +A VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQSESVKEAVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++   + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKSHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_024836459.1| AMP-dependent synthetase [Clostridium sp. 12(A)]
Length=501

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 118/236 (50%), Gaps = 29/236 (12%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             L+ WK   K LP    +NLYG TE++ +CTY++ +      E ++   +PIG P  +  
Sbjct  280  QLNTWK---KYLPDARYVNLYGPTEITCNCTYYEIDR-----EFQTDEKIPIGKPFPNEK  331

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            V LL ++D         GE+CV+G  L+ GY+  P      +V+   N      +H ++ 
Sbjct  332  VFLLDEEDKQVTGPGINGELCVAGTALALGYYNNPEQTKRAFVQNPLN------NHYLEL  385

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD A   +N +  F GRKD  +K  GHRI LEE+E  +  +P +  A  +F  D++
Sbjct  386  IYRTGDLAFYNENKDLCFAGRKDFQIKHMGHRIELEEIEMAMNSYPSMERACCVF--DEK  443

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
               +   ++   E  E  E +RS        LP  MIP  F     FP++ +GK+D
Sbjct  444  RNRITAFYVGTMEGKELSEKMRST-------LPSYMIPTGFHSLTEFPITPNGKID  492



>ref|WP_026735861.1| non-ribosomal peptide synthetase [Fischerella sp. PCC 9605]
Length=1365

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 125/240 (52%), Gaps = 22/240 (9%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            + L +   +++P   ++NLYGS+EVS + TY+D   L         + VPIG P+ +  +
Sbjct  770  VKLVQTFRELMPFAKLINLYGSSEVSANATYYDTSLL-----SGQANSVPIGRPIDNTQI  824

Query  192  LLLGDD-DPNE----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
             +L  D  P      GE+ VSG  L+ GY   P        EL+Q     +      + +
Sbjct  825  YVLNHDLQPTPIGVVGELYVSGDGLARGYLYRP--------ELTQERFIDNPFIPKTKLY  876

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            +TGD  R L++GN  +LGR D  VKI G R+ L E+   + +HP+V ++ VI R+D +  
Sbjct  877  KTGDLVRHLKDGNLEYLGRHDEQVKIRGFRVELGEIATAIAQHPDVQESVVIARDDAQKN  936

Query  537  SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
              L A+++  + +   + L    +++ +KLP  M+P  F   ++ P++ +GKVD   L N
Sbjct  937  QTLIAYIVTNKQDIKTQFL----SYLQQKLPNYMLPSAFIVLDALPLTPNGKVDKLALPN  992



>ref|WP_033334827.1| hypothetical protein, partial [Scytonema hofmanni]
Length=1463

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 110/207 (53%), Gaps = 21/207 (10%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            L+L +    I+PQ+ ++NLYGS+EVS D T +D  +      + S++ VPIG P+ +  +
Sbjct  273  LALSQRFQTIMPQSILINLYGSSEVSADVTSYDTRA------NSSVTSVPIGRPIANTQI  326

Query  192  LLLGDD-DPN----EGEICVSGLCLSAGYFCYPSVLPLDYVE--LSQNHDSKSTDHRVQQ  350
             +L     P      GE+CVS + L+ GY   P +    ++    SQN D +        
Sbjct  327  YILDSHLQPVPVGVTGELCVSSVGLARGYLNRPDLTAEKFITNPFSQNQDVR--------  378

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             ++TGD AR L NG+  FLGR D  VKI G R+ L E+E +L +HP V ++ VI   DK 
Sbjct  379  MYKTGDLARYLTNGDIEFLGRLDHQVKIRGFRVELGEIEAILNQHPAVEESVVITHEDKP  438

Query  531  DTSLLEAHLIMKENNEHVEILRSITNW  611
            D   L A+++     + VE   + T W
Sbjct  439  DNKYLTAYIVANPQYQKVEQQVTGTQW  465



>ref|WP_026723918.1| peptide synthetase [Fischerella sp. PCC 9431]
Length=1602

 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 116/221 (52%), Gaps = 22/221 (10%)
 Frame = +3

Query  63    NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD-DPN----EGE  227
             NLYG TE + D TY+ C+       + + + VPIG P+ +  + +L     P      GE
Sbjct  822   NLYGPTEAAIDVTYWACQP------NSNETIVPIGRPIANTQIYILDKHLQPVPIGVSGE  875

Query  228   ICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFIFL  407
             + + G+ L+ GY+  P        EL+Q     S     Q  ++TGD AR L NG+  +L
Sbjct  876   LHIGGVGLARGYWNKP--------ELTQEKFIYSPFKSGQVLYKTGDLARYLPNGDIEYL  927

Query  408   GRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVE  587
             GR D  VKI G RI + E+E  + ++PE+ +  VI R D++D   L A+++ +  N  V 
Sbjct  928   GRIDHQVKIRGFRIEMGEIETAIHQNPEIRETVVIVREDRQDDKRLVAYIVAQSTNISVL  987

Query  588   ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              LR   N++  KLP  MIP  F   + FP++ +GK+D   L
Sbjct  988   ELR---NFLKTKLPDYMIPSAFVVLDKFPLTPNGKIDRRAL  1025



>ref|WP_003343652.1| tyrocidine synthase 3 [Brevibacillus laterosporus]
 emb|CCF15463.1| plipastatin synthase subunit A [Brevibacillus laterosporus GI-9]
Length=2337

 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/236 (31%), Positives = 125/236 (53%), Gaps = 24/236 (10%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H+  ++  V  + +  ++NLYG TE + D TYFDC++       + L+ +PIG P+ +  
Sbjct  739  HVDRFRRAVSSVCEARLINLYGPTEATVDVTYFDCDT------DEELAAIPIGKPIYNTQ  792

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + ++  +  N       GE+C++G+ L+ GY   P        EL++    K+     ++
Sbjct  793  LYIVQANSENLQPIGIAGELCIAGVGLARGYLNRP--------ELTEEKFVKNPFVAGER  844

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G RI L E+E+ +R+   + +  V+ + D+ 
Sbjct  845  MYRTGDLARWLPDGNIEYLGRIDDQVKIRGVRIELGEIESQMRKLNGLREVVVVAKEDQA  904

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                L A+++        EI   +T     +LP AMIP  F   E+ P++++GK+D
Sbjct  905  KEKFLCAYMVTDREVSTAEIRAHLTT----QLPIAMIPTTFISLEAMPLTANGKID  956


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 102/227 (45%), Gaps = 25/227 (11%)
 Frame = +3

Query  45    PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
             P   I N YG TE S   T      +           + IG PL +  V ++ ++   + 
Sbjct  1791  PAIEINNEYGPTENSVVTTIQRAIGVD--------QAITIGRPLANVTVYIVNNEHHLQP  1842

Query  222   ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                 GE+C++G  L  GY   P        EL++     +     ++ ++TGD A+   +
Sbjct  1843  IGVVGELCIAGRGLGRGYLNRP--------ELTEEKFVANPFVPGERMYKTGDLAKWRPD  1894

Query  390   GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
             G   ++GR D  VK+ G RI + E+E+ + ++  V +  V  + D+     L A+ +   
Sbjct  1895  GTIEYVGRVDEQVKVRGFRIEIGEIESTILQYHGVGEVVVTAQQDQHAQQYLCAYFVA--  1952

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               E   +L  +  +++++LP  M+P  F      P +++GKVD   L
Sbjct  1953  --EKEVVLADLRKFVSKELPAYMVPTYFVQLLELPTTANGKVDKRAL  1997



>ref|WP_031414820.1| tyrocidine synthase 3 [Brevibacillus laterosporus]
Length=2338

 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 124/236 (53%), Gaps = 24/236 (10%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H+  ++  V  +    ++NLYG TE + D TYFDC++       + L+ +PIG P+ +  
Sbjct  739  HVDRFRRAVSSVCGARLINLYGPTEATVDVTYFDCDT------DEELAAIPIGKPIYNTQ  792

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + ++  D  N       GE+C++G+ L+ GY   P        EL++    K+     ++
Sbjct  793  LYIVQADSENLQPIGIAGELCIAGVGLARGYLNRP--------ELTEEKFVKNPFVAGER  844

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G RI L E+E+ +R+   + +  V+ + D+ 
Sbjct  845  MYRTGDLARWLPDGNIEYLGRIDDQVKIRGVRIELGEIESQMRKLDGLREVVVVAKEDQA  904

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                L A+++        EI   +T     +LP AMIP  F   E+ P++++GK+D
Sbjct  905  KEKFLCAYMVTDREVSTAEIRAHLTT----QLPIAMIPSTFISLEAMPLTANGKID  956


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 102/227 (45%), Gaps = 25/227 (11%)
 Frame = +3

Query  45    PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
             P   I N YG TE S   T      +           + IG PL +  V ++ ++   + 
Sbjct  1792  PAIEINNEYGPTENSVVTTIQRAIGVD--------QEITIGRPLANVTVYIVNNEHHLQP  1843

Query  222   ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                 GE+C++G  L  GY   P        EL++     +     ++ ++TGD A+   +
Sbjct  1844  IGVVGELCIAGRGLGRGYLNRP--------ELTEEKFVANPFVPGERMYKTGDLAKWRPD  1895

Query  390   GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
             G   ++GR D  VK+ G RI + E+E+ + ++  V +  V  + D+     L A+ +   
Sbjct  1896  GTIEYVGRVDEQVKVRGFRIEIGEIESTILQYHGVKEVVVTAQEDQHAQQYLCAYFVA--  1953

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               E   +L  +  +++++LP  M+P  F      P +++GKVD   L
Sbjct  1954  --EKEVVLADLRKFVSKELPAYMVPTYFVQLLELPTTANGKVDKRAL  1998



>ref|WP_015891488.1| peptide synthetase [Brevibacillus brevis]
 ref|YP_002772677.1| non-ribosomal peptide synthetase [Brevibacillus brevis NBRC 100599]
 dbj|BAH44173.1| putative non-ribosomal peptide synthetase [Brevibacillus brevis 
NBRC 100599]
Length=896

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 113/223 (51%), Gaps = 24/223 (11%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP-----NE  221
            I NLYG TE S    YF+       ++H     +PIG P+ +  +LLL  +       ++
Sbjct  559  ITNLYGPTETSIGVIYFE-------IDHTHEGPIPIGKPIANTKILLLDSNRKLVPAGHQ  611

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            GEI ++GLCL  GY   P      +V      D+   +   Q+ +RTGD  R L NGN  
Sbjct  612  GEIYITGLCLGHGYLHDPEKTAASFV------DNPYPEIGYQELYRTGDLGRYLPNGNIK  665

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
            F GR D  VK+ GHRI L E++ VL  HP V + AV+F+ +K   + L A+ +       
Sbjct  666  FCGRIDHQVKVRGHRIELGEIDEVLLSHPLVKECAVLFQEEK---ARLCAYYVANAEELT  722

Query  582  VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               LR    +++ +LP  MIP  F   E  P+++ GK++  LL
Sbjct  723  ASDLR---GYLSERLPDHMIPSFFVSIEKMPLTAGGKINRKLL  762



>gb|AIG27345.1| NRPS domain-containing protein [Brevibacillus laterosporus LMG 
15441]
Length=2337

 Score =   123 bits (308),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 73/236 (31%), Positives = 125/236 (53%), Gaps = 24/236 (10%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H+  ++  V  + +  ++NLYG TE + D TYFDC++       + L+ +PIG P+ +  
Sbjct  739  HVDRFRQAVSSVCEARLINLYGPTEATVDVTYFDCDT------DEELAAIPIGKPIYNTQ  792

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + ++  +  N       GE+C++G+ L+ GY   P        EL++    K+     ++
Sbjct  793  LYIVQANSENLQPIGIAGELCIAGVGLARGYLNRP--------ELTEEKFVKNPFVAGER  844

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G RI L E+E+ +R+   + +  V+ + D+ 
Sbjct  845  MYRTGDLARWLPDGNIEYLGRIDDQVKIRGVRIELGEIESQMRKLDGLREVVVVAKQDQA  904

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                L A+++        EI   +T     +LP AMIP  F   E+ P++++GK+D
Sbjct  905  KEKFLCAYMVTDREVSTAEIRAHLTT----QLPIAMIPSTFISLEAMPLTANGKID  956


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 102/227 (45%), Gaps = 25/227 (11%)
 Frame = +3

Query  45    PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
             P   I N YG TE S   T      +           + IG PL +  V ++ ++   + 
Sbjct  1791  PAIEINNEYGPTENSVVTTIQRAIEVD--------QAITIGRPLANVTVYIVNNEHHLQP  1842

Query  222   ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                 GE+C++G  L  GY   P        EL++     +     ++ ++TGD A+   +
Sbjct  1843  IGVVGELCIAGRGLGRGYLNRP--------ELTEEKFVANPFVPGERMYKTGDLAKWRPD  1894

Query  390   GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
             G   ++GR D  VK+ G RI + E+E+ + ++  V +  V  + D+     L A+ +   
Sbjct  1895  GTIEYVGRVDEQVKVRGFRIEIGEIESTILQYHGVGEVVVTAQEDQHAQQYLCAYFVA--  1952

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               E   +L  +  +++++LP  M+P  F      P +++GKVD   L
Sbjct  1953  --EKEVVLADLRKFVSKELPAYMVPTYFVQLLELPTTANGKVDKRAL  1997



>ref|WP_036486323.1| peptide synthetase [Myxosarcina sp. GI1]
Length=1695

 Score =   123 bits (308),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 117/227 (52%), Gaps = 12/227 (5%)
 Frame = +3

Query  33   VKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD  212
            + + P+  + N YG TE S D T +     PL    K+   VPIG PL +  + ++    
Sbjct  571  LSLYPEIKVANAYGPTEASDDITQYIINE-PLAANQKT---VPIGKPLANNSIYIVNSQM  626

Query  213  PNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFAR  377
              +     GEICVSG+ +  GY+   +     +V    N  +   +      +RTGD  +
Sbjct  627  QLQPIGIPGEICVSGIGVGDGYWRNETKTKECFVP---NPFAVRANGGSPLLYRTGDLGK  683

Query  378  KLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHL  557
             L +GN  FLGR D  VKI G RI L E+E VL +HP V+ A VI R D  +   L A++
Sbjct  684  WLPDGNIEFLGRIDHQVKIRGFRIELGEIETVLSQHPTVSSAVVILREDTPEDKRLVAYV  743

Query  558  IMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +  ++N+  E+   + N++  KLP   IP  F F ++ P++ SGKVD
Sbjct  744  VPHKDNDTDELPTILRNFLKAKLPEYAIPSNFIFLDALPLTPSGKVD  790



>ref|WP_016872029.1| hypothetical protein [Fischerella thermalis]
Length=1371

 Score =   122 bits (307),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 78/247 (32%), Positives = 126/247 (51%), Gaps = 34/247 (14%)
 Frame = +3

Query  9    HLSLW------------KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLS  152
            HL LW            K   ++LP+  ++NLYGS+EVS + TY D   LP       L+
Sbjct  762  HLKLWITSGEVLSVNLAKTFRELLPEAKLINLYGSSEVSANVTYCDLSLLP-----DQLT  816

Query  153  GVPIGLPLQSCDVLLLGD-DDPNE----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNH  317
             +PIG P+ +  V +L     P      GE+ + G  L+ GY   P        EL+Q  
Sbjct  817  TIPIGRPIDNTLVYVLSSCLQPTPIGVVGELYIGGDGLAKGYLHRP--------ELTQER  868

Query  318  DSKSTDHRVQQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVA  497
               +      + ++TGD  R L +GN  FLGR+DR VKI G R+ L E+E  + +HP + 
Sbjct  869  FIDNPFVPGTKLYKTGDLVRYLNDGNLEFLGRRDRQVKIRGFRVELGEIEAAIAKHPSIR  928

Query  498  DAAVIFRNDKRDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPM  677
            ++ VI ++       L A+++ K++ +    +  ++N++  KLP  M+P  F   ++ P+
Sbjct  929  ESFVIAQDHNPKDQRLIAYVVTKQDID----IPQLSNYLQEKLPNYMVPSAFVILDALPL  984

Query  678  SSSGKVD  698
            + +GKVD
Sbjct  985  TPNGKVD  991



>ref|WP_038074856.1| hypothetical protein [Tolypothrix bouteillei]
 gb|KIE10575.1| hypothetical protein DA73_0218785 [Tolypothrix bouteillei VB521301]
Length=1399

 Score =   122 bits (307),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 116/228 (51%), Gaps = 17/228 (7%)
 Frame = +3

Query  42    LPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD-DPN  218
             LP T I+N YG TE     T+  C S+P  L+ K++  + IG P+ +  V LL     P 
Sbjct  792   LPSTEIINGYGPTE---STTFTCCYSIPRQLD-KTVQSISIGRPISNTQVYLLNTQLQPT  847

Query  219   E----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQ  386
                  GE+ + G  L+ GY   P +    ++    N   +      ++ ++TGD AR L 
Sbjct  848   PIGVPGELYIGGAGLAQGYLNRPELTAEKFISNPFNQQDE------ERLYKTGDLARYLP  901

Query  387   NGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK  566
             +GN  FLGR D  VK+ G RI L E+E VL +HP V   AVI R D R    L A+++  
Sbjct  902   DGNIEFLGRIDNQVKLRGFRIELGEIETVLSQHPSVLQNAVILREDIRGDKRLVAYVV--  959

Query  567   ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              N E    +  + +++  KLP  M+P  F   E+ P+S +GKV+   L
Sbjct  960   PNPETALTVNELRHFLQEKLPKYMVPASFVMLEALPLSPNGKVNRRAL  1007



>ref|WP_020619068.1| hypothetical protein [Paenibacillus daejeonensis]
Length=3950

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/236 (35%), Positives = 120/236 (51%), Gaps = 27/236 (11%)
 Frame = +3

Query  39    ILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD--  212
             + P  AI+N YG  E S D T +  +S+P     + L+ VPIG PL +  + +L  +   
Sbjct  2115  VYPDIAIVNAYGPAEASDDVTQYVADSMP-----EKLTNVPIGKPLANVRIYILDAEGRL  2169

Query  213   ---PNEGEICVSGLCLSAGYF-----CYPSVLPLDYVELS--QNHDSKSTDHRVQQYFRT  362
                   GE+CV+G+ +  GY         S L   Y E S  + H+         + +RT
Sbjct  2170  CPVGVAGELCVAGISVGRGYVNQLEKTRQSFLLDPYAEPSSIKGHN---------RMYRT  2220

Query  363   GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
             GD AR   +GN  +LGR D  VKI GHRI L E+E+VLR  P V DAAVI R D+     
Sbjct  2221  GDLARWKPDGNIEYLGRMDEQVKIRGHRIELGEIESVLRAQPGVRDAAVIAREDEAGDPY  2280

Query  543   LEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             + A+++        ++ +S    + R+LP  M+P  F   E  P++S+GK+D   L
Sbjct  2281  ICAYVVPAAEGTTFDVDQSRIQ-LRRELPDYMMPSYFVTLEQLPVTSNGKLDRRAL  2335


 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 122/240 (51%), Gaps = 18/240 (8%)
 Frame = +3

Query  3     TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
               H+S  K   +  P+ AI+N+YG TE +   T+    +  +    + +S +   +P   
Sbjct  3169  ALHVSKLKAWHEKYPEMAIVNMYGITETTVHVTHKRIGAEDI---QRGISNIGQAIPTLK  3225

Query  183   CDVL----LLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
               +L    L G   P  GE+C++G  ++ GY        ++  EL+Q     +     ++
Sbjct  3226  LYILNGDQLCGIGMP--GELCIAGAGVARGY--------VNRAELTQAKFVDNPYVPGER  3275

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +R+GD AR L +GN  ++GR D  VKI G+RI L+E+E VL + P V DAAVI R D  
Sbjct  3276  MYRSGDLARWLPDGNVEYIGRIDDQVKIRGYRIELKEIEKVLMKQPGVQDAAVIVRKDGA  3335

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               S L A+++ KEN   ++ L S+   I   LP  M+P         P++S+GK+D   L
Sbjct  3336  GDSYLSAYVVGKENEADLD-LESLKAGIGEDLPDYMVPGSIMVLAKLPITSNGKLDRRAL  3394



>ref|WP_017348402.1| hypothetical protein [Pantoea sp. A4]
Length=1161

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 122/232 (53%), Gaps = 21/232 (9%)
 Frame = +3

Query  42    LPQTAILNLYGSTEVSGDCTYFDC-ESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD-DP  215
             LP TA+ NLYG TE + D T + C   LP      + + VPIG P+ +  + LL     P
Sbjct  849   LPDTAVHNLYGPTEAAIDVTAWTCPRDLP------AAAIVPIGRPIANLRIYLLDQHLRP  902

Query  216   N----EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKL  383
                   GE+ ++G  ++ GY   P +    +++     D   TD   + Y RTGD AR L
Sbjct  903   VPLGVAGELYIAGTGVARGYLNRPDLTAERFLK-----DPFVTDSHARMY-RTGDLARYL  956

Query  384   QNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIM  563
             +NG+  +LGR D  VKI G RI L E++ VL + P++++A V+ R+D +    L A++++
Sbjct  957   RNGDIEYLGRNDNQVKIRGFRIELGEIDAVLLQQPDISEAVVVARDDAQGDLRLVAYVVL  1016

Query  564   KENNEHVEILRSITNW---IARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 E      SI  W   +A +LP  M+P  F   +  P++++GK+D   L
Sbjct  1017  NATAERHNTSESIAQWREHLAAQLPDYMVPAAFVRLDGLPLTANGKLDRKAL  1068



>ref|WP_015802446.1| amino acid adenylation domain-containing protein [Actinosynnema 
mirum]
 ref|YP_003101405.1| amino acid adenylation domain-containing protein [Actinosynnema 
mirum DSM 43827]
 gb|ACU37559.1| amino acid adenylation domain protein [Actinosynnema mirum DSM 
43827]
Length=2619

 Score =   123 bits (308),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 82/224 (37%), Positives = 113/224 (50%), Gaps = 19/224 (8%)
 Frame = +3

Query  42   LPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDD  212
            LP   +LNLYGS EV+ D T F  E  P    H +   VPIG PL   DV +L   G   
Sbjct  786  LPGRRLLNLYGSAEVAADATAF--EVAPGCANHPA---VPIGAPLDGVDVEVLTPSGVPA  840

Query  213  P--NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQ  386
            P    GE+ V G  L+ GY C P+     ++       +   D   ++ FRTGD  R+  
Sbjct  841  PPLGVGELHVGGAGLALGYHCRPAETAARFLP------APGADRAGRRRFRTGDQVRRRV  894

Query  387  NGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK  566
             G   +LGR D  V+I GHR+   EVE VLREHP V +AAV  R D      L A+++  
Sbjct  895  EGGLDYLGRLDSQVQIRGHRVEPGEVEGVLREHPRVREAAVTARADAIGDLSLVAYVVTA  954

Query  567  ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            ++    +    +T ++ R+LPP  +P         P+++SGKVD
Sbjct  955  DDTGQAD---DLTAFLRRRLPPYAVPSAVVRLPELPLNASGKVD  995


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 68/236 (29%), Positives = 109/236 (46%), Gaps = 41/236 (17%)
 Frame = +3

Query  48    QTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIG--LPLQSCDVLLLGDDD---  212
             +  +L+L G+TE S    ++     P+     +   VP G  +P QS  VL   D+D   
Sbjct  1858  RATVLSLGGATEGSIWSVWY-----PIGEVDPAWPSVPYGVAMPGQSARVL---DEDLRP  1909

Query  213   -PN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQ-------QYFRT  362
              P+   GE+ + G  ++ GY+                 D + TDHR         + +RT
Sbjct  1910  RPDWVVGELFLGGQGVALGYW----------------RDREQTDHRFPTDPDTGGRLYRT  1953

Query  363   GDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSL  542
             GD AR L +GN  FLGR+D  VK++G+R+ L EVE  ++  P V  AAV+   +      
Sbjct  1954  GDLARHLPDGNLEFLGREDGQVKVNGYRVELGEVETAVQRLPGVQAAAVVAAGEPGADRR  2013

Query  543   LEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             L A  + +   E   +   +   +   LP  ++P  F   +  P++ +GKVD + L
Sbjct  2014  LVAFYVPEPGFEPDPV--GLRPRLGEALPGYLVPALFRPLDRIPLTPNGKVDRSAL  2067



>ref|WP_022584750.1| bacitracin synthetase [Brevibacillus laterosporus]
 gb|ERM18856.1| bacitracin synthetase [Brevibacillus laterosporus PE36]
Length=12190

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 125/240 (52%), Gaps = 24/240 (10%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ ++  +  + Q  ++NLYG TE + D TYFDC++       + L+ +PIG P+ +  
Sbjct  739  HVARFRRAISSVCQARLINLYGPTEATVDVTYFDCDT------DEELAAIPIGKPIYNTQ  792

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + ++  D  N       GE+C++G+ L+ GY   P        EL++    K+     ++
Sbjct  793  LYIVQADSVNLQPIGIAGELCIAGVGLARGYLNRP--------ELTEEKFVKNPFASGER  844

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI L EVE  L +   + +A VI R D  
Sbjct  845  MYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIELGEVELQLLKIEAIQEAVVIVREDAS  904

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                + A+ +  +     E+   ++    R+LP  M+P  F   +  P+S +GK+D  +L
Sbjct  905  GQKQMCAYYVANKQLTVGELRADLS----RELPTYMVPSYFVQMDKMPLSPNGKIDRKML  960


 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (49%), Gaps = 29/239 (12%)
 Frame = +3

Query  15    SLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVL  194
             SL K + ++ P   I N YG TE S   T     SL +    + LS   IG P+ +  V 
Sbjct  3764  SLVKKVAELNPSIEICNEYGPTESSVVTT-----SLSITQPEQELS---IGRPIANKQVY  3815

Query  195   LLGDDDPNE-------GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
             +L  D  N+       GE+C++G  L+ GY   P +    +V      D+  T    ++ 
Sbjct  3816  IL--DQHNQLQPVGVAGELCIAGTGLARGYLHLPQLSTEKFV------DNPFTPE--EKM  3865

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  ++GR D  VKI G+RI L EVE  L     V +A V+ R ++  
Sbjct  3866  YKTGDLARWLPDGNIEYVGRIDHQVKIRGYRIELGEVEAHLLRIDSVQEAIVVAREEEEG  3925

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                L A+ +  +       +  I N +A++LP  MIP  F   E  P++++GK+D   L
Sbjct  3926  QKHLCAYFVADKQV----TVGEIRNVLAQELPSFMIPAFFIQLEQMPLTTNGKIDRKAL  3980


 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 69/224 (31%), Positives = 111/224 (50%), Gaps = 26/224 (12%)
 Frame = +3

Query  60    LNLYGSTE--VSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD-----PN  218
              N YG TE  +      +D ES+       S + VPIG PL++  + ++  +        
Sbjct  2263  FNAYGPTEDTICSSVWSYDRESM-------SENVVPIGRPLKNHRIYIVDAEGHLLPIGV  2315

Query  219   EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNF  398
              GE+C++G+ L+ GY   P        EL++     S     ++ ++TGD AR + +G  
Sbjct  2316  AGELCIAGVGLARGYLNRP--------ELTEEKFVNSRFRAGERMYKTGDLARWMSDGTI  2367

Query  399   IFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNE  578
              +LGR D  VKI G+RI L EVE  L +   V +A VI R+D+     L A+ +     E
Sbjct  2368  EYLGRIDHQVKIRGYRIELGEVEAQLLKVDTVQEAIVIARDDEAGQKHLCAYFVA----E  2423

Query  579   HVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              +  +  + + ++ +LP  MIP  F   E  P++S+GK+D   L
Sbjct  2424  SLLSMAKLRSELSHELPNYMIPSYFVQLEQMPLTSNGKIDRKAL  2467


 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 111/227 (49%), Gaps = 25/227 (11%)
 Frame = +3

Query  48    QTAILNLYGSTEVSGDCTYFDCESL-PLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
             Q  ILN YG TE   D +YF+  ++ P +        +PIG PL + ++ +L ++     
Sbjct  8885  QMRILNSYGVTEACIDSSYFEQVTIVPSV-------SLPIGKPLPNVNLYVLNENHAMLP  8937

Query  222   ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                 GE+ + G  +  GY   P +    +V+       K         +RTGD AR L +
Sbjct  8938  IGVLGELYIGGKGVGRGYLNRPELTAEKFVDNPFVPGEK--------MYRTGDLARWLSD  8989

Query  390   GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
             GN  ++GR D  VKI G+RI L EVE+ L + P + +A V+ + ++     L A+ +  +
Sbjct  8990  GNMEYVGRIDHQVKIRGNRIELGEVESKLLKTPFMQEAIVVAQENEAGVKQLCAYFVATK  9049

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                    L  + N ++++LP  MIP  F   +  P++ +GK+D   L
Sbjct  9050  TL----TLSELRNTLSQELPGYMIPTYFIQLDEMPLTPNGKIDRKAL  9092


 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 114/234 (49%), Gaps = 23/234 (10%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLG  203
             ++L +   Q  ILN YG TE   D ++++  +  L L       +PIG PL +  + +L 
Sbjct  6800  QLLSRFGDQMRILNSYGVTEACIDSSFYEQTTNLLSL------NLPIGKPLPNVKMYVLD  6853

Query  204   DDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             ++   +     GE+ +SG+ +  GY   P +    +V      DS   D+  ++ +RTGD
Sbjct  6854  ENRAIQPVGIPGELYISGIGVGRGYLNRPDLTAEKFV------DSPFVDN--ERMYRTGD  6905

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
               R L +GN  ++GR D  VKI G+RI L E+E  L +   + +  VI + D      L 
Sbjct  6906  LVRWLPDGNIEYVGRIDHQVKIRGNRIELGEIEAQLLKIHAIEEVVVIAQEDSVGQKHLC  6965

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ +  +      I+  +   + ++LP  MIP  F   E  P++ +GK+D   L
Sbjct  6966  AYFVADDQL----IVSDLRATLMQELPAYMIPSYFVQLEELPLTPNGKIDRKAL  7015


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 115/234 (49%), Gaps = 25/234 (11%)
 Frame = +3

Query  27    ILVKILPQTAILNLYGSTEVSGDCTYFD-CESLPLILEHKSLSGVPIGLPLQSCDVLLLG  203
             +L +      ILN YG TE   D ++F+  +SL  +        +PIG PL + ++ +L 
Sbjct  5284  LLTRFGSHMRILNSYGVTEACIDSSFFEQTDSLFAM-------NIPIGKPLPNVNMYVLH  5336

Query  204   DDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             +++  +     GE+ ++G  +  GY   P +    +VE     +      R+   +RTGD
Sbjct  5337  ENNVMQPIGIPGELYIAGKGVGRGYLNRPELTAEKFVE-----NPFVAGERM---YRTGD  5388

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
               R L +GN  +LGR D  VKI G+RI L EVE  L +  ++ +  V+ + D+     L 
Sbjct  5389  LVRWLPDGNIEYLGRIDHQVKIRGNRIELGEVETQLLKIAKIKENVVVAQEDQAGRKYLC  5448

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ +  +     E+  +++    + LP  M+P  F   E  P++ +GK+D + L
Sbjct  5449  AYFVADQKLSSSELREALS----QVLPKFMVPSYFMQVEQLPLTPNGKIDRSAL  5498


 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 107/230 (47%), Gaps = 36/230 (16%)
 Frame = +3

Query  51    TAILNLYGSTEVS-----GDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-GDDD  212
              ++ N+YG TE +     GD T  D E             + IG PL +    LL  +  
Sbjct  7847  ASLYNMYGPTETTVWSSVGDVT--DEEQ------------ITIGKPLLNTRFYLLNAEGQ  7892

Query  213   PN----EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARK  380
             P      GE+ ++G  L+ GY+  P +    +VE     +      R+   ++TGD A+ 
Sbjct  7893  PQPIGVAGELYIAGEGLARGYWNRPELTAEKFVE-----NPFVPGERI---YQTGDLAKW  7944

Query  381   LQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLI  560
             L +G   +LGR D  VKI GHRI L E+E  L     VA+A VI R D+     L A+ +
Sbjct  7945  LPDGTIEYLGRIDHQVKIRGHRIELGEIETQLLHVSSVAEAVVIARGDQEGQQQLCAYFV  8004

Query  561   MKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               +       +  +   ++++LP  M+P  F   E  P++ +GK+D N L
Sbjct  8005  ADQQL----TVYDLKAQLSQELPSYMVPSYFIQLEQMPLTPNGKIDRNAL  8050


 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 115/237 (49%), Gaps = 25/237 (11%)
 Frame = +3

Query  15     SLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVL  194
              SL   ++++ P   I N YG TE S   T     SL +    + +S   IG P+ +  V 
Sbjct  10389  SLVNKVMEMKPSIEICNEYGPTESSVVST-----SLLITNPEQEIS---IGSPIANKQVY  10440

Query  195    LLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFR  359
              ++G  +  +     GE+C++G  L+ GY   P +    +V+     +  +   R+   ++
Sbjct  10441  IIGVHNQLQPIGVAGELCMAGSGLARGYLHLPELTAEKFVD-----NPFAAGERM---YK  10492

Query  360    TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
              TGD AR L +GN  +LGR D  VKI G+RI L EVE  L +   + +A VI +      +
Sbjct  10493  TGDLARWLPDGNIEYLGRIDHQVKIRGYRIELSEVEVQLMKVAPIQEAIVIVKEGDAGQN  10552

Query  540    LLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L A+ +  E+   V  LR   N +   LP  M+P  F   E  P++ +GK+D   L
Sbjct  10553  QLCAYFV-SEDQLKVRELRKALNQV---LPEFMVPSYFVQLEKMPLTPNGKIDRKAL  10605


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/225 (29%), Positives = 106/225 (47%), Gaps = 18/225 (8%)
 Frame = +3

Query  45     PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVL---LLGDDDP  215
              PQ  ++N+YG TE +   TY +   + +    ++ S +   +P  S  +L   L      
Sbjct  11437  PQVKLINMYGITETTVHVTYKEITEVEI---SQAKSNIGKTIPTLSAYILDEHLRLQPVG  11493

Query  216    NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               +GE+ ++G  L+ GY   P        EL+      +     ++ ++TGD AR L +GN
Sbjct  11494  VKGELYIAGEGLARGYLNRP--------ELTNERFVPNPFVPGERMYKTGDLARWLADGN  11545

Query  396    FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
                +LGR D  VKI G+RI L EVE  L     + +A VI   D      L A+ +     
Sbjct  11546  IEYLGRIDHQVKIRGYRIELGEVETQLLNIESMQEAIVIAHEDASGDKYLCAYFVA----  11601

Query  576    EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              +H   +  +   ++++LP  MIP  F   E  P++ +GK+D   L
Sbjct  11602  DHELTVAELRKALSQQLPDYMIPAYFVQMERMPLTGNGKLDRKAL  11646



>gb|ETR73595.1| Amino acid adenylation domain protein [Candidatus Magnetoglobus 
multicellularis str. Araruama]
Length=1067

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 113/218 (52%), Gaps = 24/218 (11%)
 Frame = +3

Query  63   NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD------DPNEG  224
            NLYG TE + D TY+DC+S      + +L  VPIG P+ +  + +L           + G
Sbjct  254  NLYGPTEATVDGTYYDCDS------NFNLPVVPIGKPIDNTQIYILDKTVKKPVPTGSVG  307

Query  225  EICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFIF  404
            EIC+ G+ L+ GY   P        EL++         + ++ +RTGD  R   +GN  +
Sbjct  308  EICIGGILLARGYLNKP--------ELTKEKFIPHPFKQGERIYRTGDLGRWQHDGNIEY  359

Query  405  LGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHV  584
            LGR D  VKI G RI L E+EN L  HP++  A V+ R  K D+   E  LI    N + 
Sbjct  360  LGRTDNQVKIRGFRIELGEIENALARHPQIHQAVVLVR--KSDSG--EKELIAYVQNANE  415

Query  585  EILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                 +  ++++ LP  MIP  + F E+FP++ SGK+D
Sbjct  416  LTASDLKAYLSKILPYYMIPECYVFLENFPLNPSGKID  453



>gb|AFG19377.1| bacillomycin D synthetase C [Bacillus amyloliquefaciens]
Length=2619

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 122/236 (52%), Gaps = 25/236 (11%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H++ +K ++  + Q  I+NLYG TE + D +YFDC++       ++ + +P G P+ +  
Sbjct  540  HVAGFKRIITSVSQAQIINLYGRTEATIDVSYFDCQT------EETYASIPKGKPISNIQ  593

Query  189  VLLLGDD----DPNE--GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + +L  D     P    GE+C++G  L+ GY   P +    +V    NH   + +    +
Sbjct  594  LYILHADLEHMQPTRVAGELCIAGDGLARGYLNRPELTAEKFV----NHPIAAGE----R  645

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI + EVE    + P + +A VI R    
Sbjct  646  IYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEGAFFQLPAIKEAIVIAREIDG  705

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            +TSL   +       +H      +   ++R+LP  MIP  F   E  P++ +GK+D
Sbjct  706  ETSLCAYY-----TAQHALTAGELREELSRQLPSYMIPAYFVQLEEMPLTFNGKID  756


 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 115/239 (48%), Gaps = 28/239 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCD  188
             L  WK+     P T ++N+YG TE +   T+ +      I E +   G   IG P+ +  
Sbjct  2058  LKDWKLK---YPLTQLINMYGITETTVHVTHKE------ITEREIDEGRSNIGQPIPTLQ  2108

Query  189   VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
               +L D    +     GE+ V+G  L+ GY   P +    +VE    H   + +    + 
Sbjct  2109  AYILDDYQRIQVMGIPGELYVAGEGLARGYLNRPELTGEKFVE----HPFAAGE----KM  2160

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  +LGR D  VKI G+RI + EVE  L +   V ++ VI   ++  
Sbjct  2161  YKTGDVARWLPDGNIEYLGRIDHQVKIRGYRIEIGEVEAALLQLESVKESVVIAIEEEGS  2220

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L  A+L   ++    ++ R + N    KLP  MIP  F   E  P++++GK+D   L
Sbjct  2221  KQLC-AYLSGDDSLNTAQLKRHLLN----KLPAYMIPAYFVQMEKMPITANGKIDRKAL  2274



>ref|WP_007954885.1| thioester reductase [Pelosinus fermentans]
 gb|EIW49786.1| amino acid adenylation domain protein [Pelosinus fermentans JBW45]
Length=1331

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 121/239 (51%), Gaps = 24/239 (10%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H + +  L+K  P   ++NLYG TE + D +YFDC +       K L  VPIG P+ +  
Sbjct  547  HANKFNTLLKGQP-VKLINLYGPTEATVDVSYFDCST------GKELEIVPIGKPIDNIK  599

Query  189  VLLLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
            + ++  ++  +     GE+C++G  L+ GY   P        EL+     K+      + 
Sbjct  600  LFIVNKNNKLQPIGMAGELCIAGEGLARGYLNKP--------ELTAEKFVKNPFFPGARM  651

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            +RTGD AR L +GN  FLGR D  VKI G RI L E+E  L +HP + ++ V+ +  K  
Sbjct  652  YRTGDLARWLPDGNIEFLGRIDHQVKIRGFRIELGEIETQLLKHPSIKESVVVAKEGKDS  711

Query  534  TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L A+++     E    +  +   ++R+LP  MIP  F   E  P+SS+GK D   L
Sbjct  712  DKYLCAYIVA----EREVTISELRGHLSRELPDYMIPSYFVQLEKMPLSSNGKADRKAL  766



>ref|WP_002107057.1| amino acid adenylation domain-containing protein, partial [Bacillus 
cereus]
 gb|EJQ37504.1| amino acid adenylation domain-containing protein, partial [Bacillus 
cereus BAG5X1-1]
Length=4293

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/226 (35%), Positives = 119/226 (53%), Gaps = 21/226 (9%)
 Frame = +3

Query  48    QTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE--  221
             +  I N+YG TE   D T   C  +     +K+++ +PIG PL + ++ +L  ++  +  
Sbjct  3016  KANITNVYGPTECCVDST---CYRIEFDQVNKNIA-IPIGKPLLNTNIYILDKENNLQPI  3071

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GEIC+SG  ++ GY   P +    +VE   +   K         +RTGD AR L +G
Sbjct  3072  GVAGEICISGEGIARGYLNNPELTTEKFVENPFDFGKK--------MYRTGDLARWLPDG  3123

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
             N  FLGR D  VKI G+RI LEE+E+ L  H ++ D  VI R DK +   L A++I    
Sbjct  3124  NIEFLGRIDHQVKIRGYRIELEEIESQLSAHQDIEDVVVIARKDKENNQYLCAYII----  3179

Query  573   NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             +E V   R I  ++ + LP  MIP  F   +  P++++GKVD   L
Sbjct  3180  SEKVLRARDIREYLEQGLPDYMIPAYFVKLDKLPLTTNGKVDRKAL  3225


 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/241 (32%), Positives = 123/241 (51%), Gaps = 25/241 (10%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
             +S  K  ++ L +  I+++YG TE +   TY+  + +     ++ +  +PIG PL +   
Sbjct  1959  VSHTKQALEYLGKGKIIHVYGPTESTVYATYYFIDEI-----NEEVETIPIGKPLANTAA  2013

Query  192   LLLGDDDPNEG--------EICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQ  347
              ++   D N+G        E+C+SG  L+ GY   P +    +V         +     +
Sbjct  2014  FIV---DENQGLLPIGVAGELCLSGAGLAYGYLNRPELTAEKFV--------SNPFIPGE  2062

Query  348   QYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK  527
             + +RTGD AR L +GN  FLGR D  VKI G+RI L E+EN L +H EV +  VI R D 
Sbjct  2063  RMYRTGDLARMLPDGNIEFLGRIDHQVKIRGYRIELGEIENQLLKHDEVKEVVVIAREDN  2122

Query  528   RDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNL  707
                  L A+      NE + +++ I   +A++LP  MIP  F   +  P++++GKVD   
Sbjct  2123  NSHQYLCAYFTSDIANEEL-LIQDIRGNLAKELPEYMIPAFFVRLDKMPLTANGKVDRKA  2181

Query  708   L  710
             L
Sbjct  2182  L  2182


 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 114/240 (48%), Gaps = 28/240 (12%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
             L L K + +      +++L G+TE S    Y+     P+         +P G PL +  +
Sbjct  909   LDLPKKIKETFNDAEVISLGGATEGSIWSIYY-----PIKEIKDEWKSIPYGKPLANQKI  963

Query  192   LLLGDDDP-----NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY-  353
              +L  +        EGE+ + GL +++GY        + ++            H+   Y 
Sbjct  964   YVLNQNRQLCPVGVEGELYIGGLGVASGYINDIEKTKMSFI-----------SHKELGYI  1012

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD     ++G   FLGRKD  VKI G+R+ L E+EN L ++ +V    VI   D   
Sbjct  1013  YKTGDHGVLKEDGYVEFLGRKDSQVKIRGYRVELGEIENCLIKYDDVKKTVVIDYTDNNG  1072

Query  534   TSLLEAHLIM-KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                L A ++  KE N +      +  ++ +KLP  MIPVRFF  +  P++ +GKV+ ++L
Sbjct  1073  MKNLYAFVVSGKEINPN-----GLKQFLQKKLPDYMIPVRFFRIDEIPLTVNGKVNKSIL  1127


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +3

Query  438  GHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVEILRSITNWIA  617
            G+RI L E+E  L +H EV +A V+ R D      L A+   +   E   I++ I  ++A
Sbjct  1    GYRIELGEIETQLLKHEEVKEAVVVAREDNHHHQYLCAYFTSETWKEE-SIIQEIRKFLA  59

Query  618  RKLPPAMIPVRFFFTESFPMSSSGKVD  698
            ++LP  MIP  F   +   ++++GKVD
Sbjct  60   KELPEYMIPAFFVQIDKLSLTTNGKVD  86



>ref|WP_024346166.1| AMP-dependent synthetase [[Clostridium] methoxybenzovorans]
Length=505

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/236 (35%), Positives = 119/236 (50%), Gaps = 31/236 (13%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            L++W+   K LP  + +NLYG TE++ +CTY+     P+  E K+   +PIG P  +  V
Sbjct  281  LTIWQ---KYLPNASYVNLYGPTEITCNCTYY-----PVNREFKAHETLPIGKPFPNEKV  332

Query  192  LLLGDDDP------NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
             LL  DD         GE+CVSG  L+ GY+  P      +V+   N         ++  
Sbjct  333  FLLDPDDKPVTEKFRSGELCVSGTALALGYYNNPEQTKRAFVQNPLN------TRYLETI  386

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            +RTGD A   +NG   F GRKD  +K  GHRI LEE+E  L   P +  A  +F  D+  
Sbjct  387  YRTGDLAFYDENGELCFAGRKDFQIKHMGHRIELEEIEAALNSCPLIERACCVF--DEEK  444

Query  534  TSLLEAHL-IMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              +L  ++  MKE    VE+ +S        LP  MIP  F    S P++++GK+D
Sbjct  445  NRILAFYIGDMKEKEISVEMRKS--------LPVYMIPSVFCPLRSLPVTANGKMD  492



>ref|WP_026796176.1| MULTISPECIES: proline adenylation protein [Planktothrix]
Length=529

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 131/243 (54%), Gaps = 14/243 (6%)
 Frame = +3

Query  3    TFHLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQS  182
             F +   + L++ +PQ    NLYG TE +  C Y+  E +P     KS + +PIG    +
Sbjct  294  VFPIKYLRQLMECVPQVKYYNLYGPTE-TNVCNYYPVEKIP----DKSSAVLPIGKACAN  348

Query  183  CDVLLLGDDDP-----NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQ  347
             +V  + D          GE+ V G  L  GY+ +  +     V  S N  S+S +   +
Sbjct  349  NEVFAVNDRGEIATVGEVGELYVRGRSLMDGYWGHSDLTEEVLVSRSCNMSSQSAEGEQK  408

Query  348  Q--YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRN  521
            Q   ++TGD  R+  +GN+IFLGR+DRT+K  G+RI L E+E  L +HP+VA+ AV+  +
Sbjct  409  QDLVYKTGDLVRQEPDGNYIFLGRRDRTIKSRGYRIDLGEIETTLYKHPQVAEVAVVAIS  468

Query  522  DKRDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDY  701
            D++   +++A +++  + + ++  + + ++ +  LP  M+P       S P +SSGKVD 
Sbjct  469  DEQFGHIVKA-VVVPHDIQSLQ-KQDLASFCSDYLPKYMVPAVIEIRASLPKTSSGKVDL  526

Query  702  NLL  710
             LL
Sbjct  527  KLL  529



>ref|WP_024294535.1| MULTISPECIES: AMP-dependent synthetase [Lachnoclostridium]
Length=505

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/236 (35%), Positives = 119/236 (50%), Gaps = 31/236 (13%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            L++W+   K LP  + +NLYG TE++ +CTY+     P+  E K+   +PIG P  +  V
Sbjct  281  LTIWQ---KYLPNASYVNLYGPTEITCNCTYY-----PVNREFKAHETLPIGKPFPNEKV  332

Query  192  LLLGDDDP------NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
             LL  DD         GE+CVSG  L+ GY+  P      +V+   N         ++  
Sbjct  333  FLLDPDDKPVTEKCRSGELCVSGTALALGYYNNPEQTKRAFVQNPLN------TRYLETI  386

Query  354  FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
            +RTGD A   +NG   F GRKD  +K  GHRI LEE+E  L   P +  A  +F  D+  
Sbjct  387  YRTGDLAFYDENGELCFAGRKDFQIKHMGHRIELEEIEAALNSCPLIERACCVF--DEEK  444

Query  534  TSLLEAHL-IMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              +L  ++  MKE    VE+ +S        LP  MIP  F    S P++++GK+D
Sbjct  445  NRILAFYVGDMKEKEISVEMRKS--------LPVYMIPSVFCPLRSLPVTANGKMD  492



>ref|WP_031463447.1| bacitracin synthetase [Paenibacillus polymyxa]
Length=14130

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 124/240 (52%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  8523  HVARFQRLVSSLAGAKLVNLYGPTEATVDVSYFDCEP------DEEYAAIPIGKPIQNIR  8576

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V+       ++ D R+  
Sbjct  8577  LYIVKEGTEQLKPIGVAGELCIGGVGVARGYLNRPELTAEKFVK-DPFAGGEAGDERM--  8633

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+ 
Sbjct  8634  -YRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVETQLLQVESVREAVVMARADET  8692

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E LRS    + R+LP  M+P  F   E  P+S +GK+D   L
Sbjct  8693  GQKQMVAYYVAGQEIRASE-LRS---ELGRELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  8748


 Score =   121 bits (303),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 123/240 (51%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  5445  HVARFQRLVSSLAGAKLVNLYGPTEATVDVSYFDCEP------DEEYAVIPIGKPIQNIR  5498

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V+        S +   ++
Sbjct  5499  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVK----DPFASGETGYER  5554

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+ 
Sbjct  5555  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVETQLLQVKSVREAVVMARTDET  5614

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E LRS    + R+LP  M+P  F   E  P+S +GK+D   L
Sbjct  5615  GQKQMVAYYVAGQEISASE-LRS---ELGRELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  5670


 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 111/226 (49%), Gaps = 27/226 (12%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
              I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  10778  IINSYGVTEAAIDSSFYDEELSKLP------SSGNVPIGQAWLNARFYIV-DSQLNPVPI  10830

Query  222    ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                 GE+C+ G+ ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  10831  GVLGELCIGGIGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  10882

Query  393    NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
              N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L  + I  E 
Sbjct  10883  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQAVVIDRTDERGHKYLCGY-ITGET  10941

Query  573    NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 +E +++    +   LP  M+P R    E+ P++S+GK+D   L
Sbjct  10942  ELRIEEVQAA---LEAGLPAHMVPARLMRLETIPLTSNGKIDRKAL  10984


 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 108/226 (48%), Gaps = 27/226 (12%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  2366  IINSYGVTEAAIDSSFYDEELSKLP------SSGNVPIGQAWLNARFYIV-DSQLNPVPI  2418

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  2419  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  2470

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
             N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L  + I  E 
Sbjct  2471  NVDFIGRMDYQVKIRGYRIELGEIETAIQRIPGVRQAVVIDRTDERGHKYLCGY-ITGET  2529

Query  573   NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                +E    +   +   LP  M+P R    E+ P++S+GK+D   L
Sbjct  2530  ELRIE---EVQAELEAGLPAHMVPARLMRLETIPLTSNGKIDRKAL  2572


 Score = 93.6 bits (231),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/219 (28%), Positives = 107/219 (49%), Gaps = 22/219 (10%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN--E  221
             I N+YG TE +   T         + E      + IG P+ +  + ++   G+  P    
Sbjct  3897  IYNMYGPTETTVWST---------VQELTHAQHIHIGRPIANTQIYIMNANGELQPVGVP  3947

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+C++G  L+ GY+    +    +V    NH         ++ +RTGD AR + +GN  
Sbjct  3948  GELCIAGEGLARGYWKRKELTAEKFV----NHPFAGGKAGHERMYRTGDLARWMPDGNIE  4003

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             +LGR D  +KI G+RI L E+E+ L +   V +A ++ R D+   + L A+ +  +    
Sbjct  4004  YLGRMDHQIKIRGYRIELGEIESQLLQVESVQEAVIMARTDETGQTQLVAYYVASQELGA  4063

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              E+ +     + + LP  M+P  F + E  P++ +GK+D
Sbjct  4064  GELRQK----LGQALPNYMVPSYFIWLEQMPLTPNGKID  4098


 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 110/230 (48%), Gaps = 18/230 (8%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYF---DCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP----  215
              I N+YG TE + D T +   D ESL ++LE K    V IG P+ +  V +L         
Sbjct  13363  ITNVYGPTEATVDATAYTIEDVESLNVLLE-KGEHTVSIGTPIANQAVYILNTRQQLVPI  13421

Query  216    -NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY----FRTGDFARK  380
                EGE+ + G  ++ GY   P +    +V  +   D+ + D     Y    +RTGD AR 
Sbjct  13422  GIEGELYIGGAGIAQGYLNLPELTAEKFVP-NPFADATAADQVDSTYANRMYRTGDLARW  13480

Query  381    LQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLI  560
              L +G+  +LGR D  VKI G+RI L EVE  L     +  A V    ++     L A+++
Sbjct  13481  LPDGSIEYLGRIDHQVKIRGYRIELGEVEAQLLTVDGIQKAVVTAWENEDGHKDLCAYIV  13540

Query  561    MKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                E+      L  + N +  KLP  MIP      + FP++ +GK+D   L
Sbjct  13541  ASESLS----LPELRNALQPKLPDYMIPTYVVQLDRFPLTPNGKIDRKAL  13586


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 117/234 (50%), Gaps = 18/234 (8%)
 Frame = +3

Query  24     KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
              +++ K   Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V ++ 
Sbjct  12277  ELVYKWKDQVAYYNGYGPTENSVATSIW-----PVSKDERAGQLISIGRPVPNHRVYMVD  12331

Query  201    --GDDDP--NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
                G   P    GE+CVSG  L+ GY   P +    +V     +   + +   ++ +RTGD
Sbjct  12332  VHGHLAPIGVAGELCVSGPGLARGYLDRPELTAEKFVP----NPFAAGEAGYERMYRTGD  12387

Query  369    FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
               AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  + L 
Sbjct  12388  LARWMPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQNQLV  12447

Query  549    AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              A+ + + +    E LRS+   +  +LP  M+P      E  P++ +GK+D   L
Sbjct  12448  AYYVAERDVSAGE-LRSL---LGEELPNYMVPSFLVQLEQMPLTPNGKIDRKAL  12497


 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 118/238 (50%), Gaps = 26/238 (11%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
             +++ K   Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V +L 
Sbjct  6966  ELVYKWKDQVAYYNGYGPTENSVATSIW-----PVSEDERAGQLISIGRPMPNHRVYMLD  7020

Query  201   --GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQN----HDSKSTDHRVQQYF  356
               G   P    GE+CVSG  L+ GY        LD  EL+      +   + +   ++ +
Sbjct  7021  VHGHLAPVGVAGELCVSGPGLARGY--------LDRSELTAEKFVPNPFAAGEAGYERMY  7072

Query  357   RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
             RTGD AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  
Sbjct  7073  RTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQ  7132

Query  537   SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             + L A+ + + +    E LRS+   +   LP  M+P  F   +  P++ +GK+D   L
Sbjct  7133  NQLVAYYVAERDVSAGE-LRSL---LGEDLPNYMVPSYFIQLKQMPLTPNGKIDRKAL  7186


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 65/227 (29%), Positives = 106/227 (47%), Gaps = 24/227 (11%)
 Frame = +3

Query  45   PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
            P   I+N YG TE   + T+    ++  +        VPIG P+ +    ++      + 
Sbjct  776  PSLRIINGYGPTE---NTTFSTTHAIAGV----QSEAVPIGRPIHNSTAYVVDRSMQLQP  828

Query  222  ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                GE+ V G  ++ GY   P +    +++        S     ++ +RTGD  R  ++
Sbjct  829  VGAWGELIVGGDGVARGYRNRPDLTAEKFID--------SPFRSGERCYRTGDLVRWNED  880

Query  390  GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
            G   + GR D  VKI G+RI L EVE  L +   V +A VI R D++    L A+++   
Sbjct  881  GTLEYKGRIDAQVKIRGYRIELGEVEAQLLKLEAVQEAVVIAREDEQGQKQLCAYVVTLA  940

Query  570  NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            +    E LRS    ++++LP  M+P  F   E  P++ +GKVD   L
Sbjct  941  DITASE-LRSA---LSQELPGYMVPSYFVQMEQLPLTPNGKVDRRAL  983


 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 106/227 (47%), Gaps = 29/227 (13%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  9673  IINSYGVTEAAIDSSFYDEELSKLP------SSGNVPIGQAWLNARFYIV-DSQLNPVPI  9725

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  9726  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  9777

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVI-FRNDKRDTSLLEAHLIMKE  569
             +  F+GR D  VKI G RI L EVE  L     +  A V  + N+  D  L  A+++  E
Sbjct  9778  HVDFIGRMDDQVKIRGFRIELGEVEAQLLTVAGIEKAIVTAWENEDGDKDLC-AYVVASE  9836

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                  E LRS    +  KLP  MIP      + FP++ +GK+D   L
Sbjct  9837  ALNLPE-LRST---LQPKLPGYMIPTYVVPLDHFPLTPNGKIDRKAL  9879



>gb|KIE09998.1| non-ribosomal peptide synthetase [Tolypothrix bouteillei VB521301]
Length=1368

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 122/238 (51%), Gaps = 22/238 (9%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            LSL +   K++P   ++NLYGS+EVS + TY+D   LP     +  + VPIG P+ +   
Sbjct  775  LSLAQTFRKLMPHAKLINLYGSSEVSANVTYYDTTLLP-----ERSTSVPIGHPIDNTQA  829

Query  192  LLLGD-----DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
             +L            GE+ + G  L+  Y        L+  +L+Q     +      + +
Sbjct  830  YVLNRYLQLVPKGAVGELYIGGDGLAKSY--------LNRAKLTQEKFIDNPFVLGTKLY  881

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            +TGD  R L NG   +LGR D  VKI G R+ L E+   + +HP+V +A VI RND +  
Sbjct  882  KTGDLVRYLNNGELEYLGRYDDQVKIRGFRVELGEIAIAIAQHPDVREAVVIVRNDAQGD  941

Query  537  SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              L A+L+ K+ N   ++L     ++ ++LP  MIP  F   ++ P++ +GKVD   L
Sbjct  942  RHLIAYLVQKKENLASDLLP----YLQQRLPKHMIPSSFVVLDAIPLTPNGKVDKQAL  995



>ref|WP_016862258.1| hypothetical protein [Fischerella muscicola]
Length=927

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 121/230 (53%), Gaps = 14/230 (6%)
 Frame = +3

Query  33   VKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD  212
            ++I P+  I+N YG TE + D T F  +  PL    ++   +PIG PL + ++ +L +  
Sbjct  575  LQIYPKIKIVNAYGPTEAADDITQFIVDK-PLPENQRT---IPIGKPLANLNIYILDEQM  630

Query  213  P-----NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKS-TDHRVQQYFRTGDFA  374
                    GEICVSG+ + AGY+       L +V  S    SK   ++R    ++TGD  
Sbjct  631  KLLPIGAPGEICVSGIGVGAGYWKNEEKTKLSFVPNSFPDPSKKLPENRADLIYKTGDLG  690

Query  375  RKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEV--ADAAVIFRNDKRDTSLLE  548
            R L NGN  FLGR D  VKI G R+ L E+E  L +HP V      V    ++ D+++L 
Sbjct  691  RWLSNGNIEFLGRIDHQVKIRGFRVELGEIETFLGQHPNVRENVVVVYQEEEEVDSTVLV  750

Query  549  AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
            A+++ K   E    +  + N++  KLP  M+P  F   E+ P++ SGK+D
Sbjct  751  AYIVAK--TEPAPSISELRNFLREKLPDHMVPSAFMMLENLPLAPSGKID  798



>gb|AIG26884.1| NRPS domain-containing protein [Brevibacillus laterosporus LMG 
15441]
Length=12190

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 124/240 (52%), Gaps = 24/240 (10%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H+  ++  +  + Q  ++NLYG TE + D TYFDC++       + L+ +PIG P+ +  
Sbjct  739  HVDRFRRAISSVCQAKLINLYGPTEATVDVTYFDCDT------DEELAAIPIGKPIYNTQ  792

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + ++  D  N       GE+C++G+ L+ GY   P        EL++    K+     ++
Sbjct  793  LYIVQADSVNLQPIGIAGELCIAGVGLARGYLNRP--------ELTEEKFVKNPFAPGER  844

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI L EVE  L +   + +A VI R D  
Sbjct  845  MYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIELGEVELQLLKIEAIQEAVVIVREDAS  904

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                + A+ +  +     E+   ++    R+LP  M+P  F   +  P+S +GK+D  +L
Sbjct  905  GQKQMCAYYVANKQLTVGELRADLS----RELPTYMVPSYFVQMDKMPLSPNGKIDRKML  960


 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 117/235 (50%), Gaps = 29/235 (12%)
 Frame = +3

Query  15    SLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVL  194
             SL K + ++ P+  I N YG TE S   T     SL +    + LS   IG P+ +  V 
Sbjct  3764  SLVKKVAELNPRIEICNEYGPTESSVVTT-----SLSITQPDQELS---IGRPIANKQVY  3815

Query  195   LLGDDDPNE-------GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
             +L  D  N+       GE+C++G  L+ GY   P +    +V      D+  T    ++ 
Sbjct  3816  IL--DQHNQLQPVGVAGELCIAGTGLARGYLHLPQLSTEKFV------DNPFTPE--EKM  3865

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  ++GR D  VKI G+RI L EVE  L     V +A V+ R ++  
Sbjct  3866  YKTGDLARWLPDGNIEYVGRIDHQVKIRGYRIELGEVEAHLLRIDSVQEAIVVAREEQEG  3925

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                L A+ +  +       +  I N +A++LP  MIP  F   E  P++++GK+D
Sbjct  3926  QKHLCAYFVADKQV----TVGEIRNVLAQELPSFMIPAFFIQLEQMPLTTNGKID  3976


 Score = 93.6 bits (231),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 110/224 (49%), Gaps = 26/224 (12%)
 Frame = +3

Query  60    LNLYGSTE--VSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD-----PN  218
              N YG TE  +      +D ES+       S + VPIG PL++  + ++ ++        
Sbjct  2263  FNAYGPTEDTICSSVWSYDRESM-------SENVVPIGRPLKNHRIYIVDEEGHLLPIGV  2315

Query  219   EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNF  398
              GE+C++G+ L+ GY   P        EL++     S     ++ ++TGD AR + +G  
Sbjct  2316  AGELCIAGVGLARGYLNRP--------ELTEEKFVNSRFRAGERMYKTGDLARWMSDGTI  2367

Query  399   IFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNE  578
              +LGR D  VKI G+RI L EVE  L +   V +A VI R+D+     L A+ +      
Sbjct  2368  EYLGRIDHQVKIRGYRIELGEVEAQLLKVDTVQEAIVIARDDEAGQKHLCAYFVAGS---  2424

Query  579   HVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              +  +  +   ++ +LP  MIP  F   E  P++S+GK+D   L
Sbjct  2425  -LLSMAKLRGELSHELPNYMIPSYFVQLEQMPLTSNGKIDRKAL  2467


 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/234 (29%), Positives = 115/234 (49%), Gaps = 25/234 (11%)
 Frame = +3

Query  27    ILVKILPQTAILNLYGSTEVSGDCTYFD-CESLPLILEHKSLSGVPIGLPLQSCDVLLLG  203
             +L +      ILN YG TE   D ++F+  +SL  +        +PIG PL + ++ +L 
Sbjct  5284  LLTRFGSHMRILNSYGVTEACIDSSFFEQTDSLFAM-------NIPIGKPLPNVNMYVLH  5336

Query  204   DDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             +++  +     GE+ ++G  +  GY   P +    +VE     +      R+   +RTGD
Sbjct  5337  ENNVMQPIGIPGELYIAGKGVGRGYLNRPELTAEKFVE-----NPFIAGERM---YRTGD  5388

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
               R L NGN  +LGR D  VKI G+RI L EVE  L +  ++ +  V+ + D+     L 
Sbjct  5389  LVRWLPNGNIEYLGRIDHQVKIRGNRIELGEVETQLLKIAKIKENVVVAQEDQAGRKYLC  5448

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ +  +     E+  +++    + LP  M+P  F   E  P++ +GK+D + L
Sbjct  5449  AYFVADQKLSSSELREALS----QVLPKFMVPSYFMQVEQLPLTPNGKIDRSAL  5498


 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 111/227 (49%), Gaps = 25/227 (11%)
 Frame = +3

Query  48    QTAILNLYGSTEVSGDCTYFDCESL-PLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
             Q  ILN YG TE   D +YF+  ++ P +        +PIG PL + ++ +L ++     
Sbjct  8885  QMRILNSYGVTEACIDSSYFEQVTIVPSV-------SLPIGKPLPNVNLYVLNENHAMLP  8937

Query  222   ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                 GE+ + G  +  GY   P +    +V+       K         +RTGD AR L +
Sbjct  8938  IGVLGELYIGGKGVGRGYLNRPELTAEKFVDNPFVPGEK--------MYRTGDLARWLSD  8989

Query  390   GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
             GN  ++GR D  VKI G+RI L EVE+ L + P + +A V+ + ++     L A+ +  +
Sbjct  8990  GNMEYVGRIDHQVKIRGNRIELGEVESKLLKTPFMQEAIVVAQENEAGVKQLCAYFVATK  9049

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                    L  + N ++++LP  MIP  F   +  P++ +GK+D   L
Sbjct  9050  TL----TLSELRNTLSQELPGYMIPTYFIQLDEMPLTPNGKIDRKAL  9092


 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 108/230 (47%), Gaps = 36/230 (16%)
 Frame = +3

Query  51    TAILNLYGSTEVS-----GDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-GDDD  212
              ++ N+YG TE +     GD T  D E             + IG PL +    LL  +  
Sbjct  7847  ASLYNMYGPTETTVWSSVGDVT--DEEQ------------ITIGKPLLNTRFYLLNAEGQ  7892

Query  213   PN----EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARK  380
             P      GE+C++G  L+ GY+  P +    +VE     +      R+   ++TGD A+ 
Sbjct  7893  PQPIGVAGELCIAGEGLARGYWNRPELTAEKFVE-----NPFVPGERI---YQTGDLAKW  7944

Query  381   LQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLI  560
             L +G   +LGR D  VKI GHRI L E+E  L     VA+A VI R D+     L A+ +
Sbjct  7945  LPDGTIEYLGRIDHQVKIRGHRIELGEIETQLLHVGSVAEAVVIARGDQEGQQQLCAYFV  8004

Query  561   MKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               +       +  +   ++++LP  M+P  F   E  P++ +GK+D N L
Sbjct  8005  ADQQL----TVYDLKAQLSQELPSYMVPSYFIQLEQMPLTPNGKIDRNAL  8050


 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 114/234 (49%), Gaps = 23/234 (10%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLG  203
             ++L +   Q  ILN YG TE   D ++++  +  L L       +PIG PL +  + +L 
Sbjct  6800  QLLSRFGDQMRILNSYGVTEACIDSSFYEQTTNLLSL------NLPIGKPLPNVKMYVLD  6853

Query  204   DDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             ++   +     GE+ +SG+ +  GY   P +    +V      DS   D+  ++ +RTGD
Sbjct  6854  ENRAIQPVGIPGELYISGIGVGRGYLNRPDLTAEKFV------DSPFVDN--ERMYRTGD  6905

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
               R L +GN  ++GR D  VKI G+RI L E+E  L +   + +  VI + D      L 
Sbjct  6906  LVRWLPDGNIEYVGRIDHQVKIRGNRIELGEIEAQLLKIHAIEEVVVIAQEDSVGQKHLC  6965

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ +  +      I+  +   + ++LP  MIP  F   E  P++ +GK+D   L
Sbjct  6966  AYFVADDQL----IVSDLRATLMQELPAYMIPSYFVQLEELPLTPNGKIDRKAL  7015


 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 116/237 (49%), Gaps = 25/237 (11%)
 Frame = +3

Query  15     SLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVL  194
              SL   ++++ P   I N YG TE S   T     SL +    + +S   IG P+ +  V 
Sbjct  10389  SLVNKVMEMKPSIEICNEYGPTESSVVST-----SLMITNPEQEIS---IGSPIANKQVY  10440

Query  195    LLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFR  359
              ++G  +  +     GE+C++G  L+ GY   P +    +V+     +  +   R+   ++
Sbjct  10441  IIGVHNQLQPIGVAGELCMAGSGLARGYLHLPELTAEKFVD-----NPFAAGERM---YK  10492

Query  360    TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
              TGD AR L NG+  +LGR D  VKI G+RI L EVE  L +   + +A VI +      +
Sbjct  10493  TGDLARWLPNGSIEYLGRIDHQVKIRGYRIELSEVEVQLMKVAPIQEAIVIVKEGDAGQN  10552

Query  540    LLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L A+ +    +E +  +R +   + + LP  M+P  F   E  P++ +GK+D   L
Sbjct  10553  QLCAYFV----SEDLLKVRELRKALNQVLPEFMVPSYFVQLEKMPLTPNGKIDRKAL  10605


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/225 (29%), Positives = 106/225 (47%), Gaps = 18/225 (8%)
 Frame = +3

Query  45     PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVL---LLGDDDP  215
              PQ  ++N+YG TE +   TY +   + +    ++ S +   +P  S  +L   L      
Sbjct  11437  PQVKLINMYGITETTVHVTYKEITEVEI---SQAKSNIGKTIPTLSAYILDEHLRLQPVG  11493

Query  216    NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               +GE+ ++G  L+ GY   P        EL+      +     ++ ++TGD AR L +GN
Sbjct  11494  VKGELYIAGEGLARGYLNRP--------ELTNERFVPNPFVPGERMYKTGDLARWLADGN  11545

Query  396    FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
                +LGR D  VKI G+RI L EVE  L     + +A VI   D      L A+ +     
Sbjct  11546  IEYLGRIDHQVKIRGYRIELGEVETQLLNIESMQEAIVIAHEDASGDKYLCAYFVA----  11601

Query  576    EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              +H   +  +   ++++LP  MIP  F   E  P++ +GK+D   L
Sbjct  11602  DHELTVAELRKALSQQLPDYMIPAYFVQMERMPLTGNGKLDRKAL  11646



>ref|WP_036693983.1| hypothetical protein, partial [Paenibacillus sp. MSt1]
Length=372

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 118/227 (52%), Gaps = 26/227 (11%)
 Frame = +3

Query  51   TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSG-VPIGLPLQSCDVLLLGDDDPN---  218
            T ++NLYG TE + D +Y++C +         LSG VPIG P+ +  + ++G+ +     
Sbjct  165  TRLINLYGPTEATVDVSYYECTA-------GELSGTVPIGKPIDNIRLYIIGEGNQGLQP  217

Query  219  ---EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                GE+C++G+ L+ GY   P +    +V    NH     +    + +RTGD AR L +
Sbjct  218  VGVAGELCIAGVGLARGYLNRPELTEEKFV----NHPLVPGE----RIYRTGDLARWLPD  269

Query  390  GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
            GN  +LGR D  VKI G+RI L E+E  L +   V  A VI R D      L A+ I+ E
Sbjct  270  GNIEYLGRIDHQVKIRGYRIELGEIEAQLLKLAPVQQAVVIAREDGSGQKQLCAY-IVAE  328

Query  570  NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                V  LR     ++R+LP  MIP  F   E  P+S++GK+D   L
Sbjct  329  QQMTVSELRGE---LSRELPGYMIPSYFVQMEQMPLSANGKLDRKAL  372



>ref|WP_013310169.1| bacitracin synthetase [Paenibacillus polymyxa]
 ref|YP_003870551.1| bacitracin synthetase 1 [Paenibacillus polymyxa E681]
 gb|ADM70013.1| Bacitracin synthetase 1 [Paenibacillus polymyxa E681]
Length=14048

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 123/240 (51%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE L      +  S +PIG P+Q+  
Sbjct  5447  HVARFQRLVSSLAGAKLINLYGPTEATVDVSYFDCEPL------EEYSVIPIGKPIQNIR  5500

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V           +   ++
Sbjct  5501  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVA----DPFAGGEAGYER  5556

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE+ L +   V +A V+ R D+ 
Sbjct  5557  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVESQLLQVESVREAVVMARADET  5616

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E LRS    + R+LP  M+P  F   E  P+S +GK+D   L
Sbjct  5617  GQKQMVAYYVAGQEMGASE-LRS---ELGRELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  5672


 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 124/240 (52%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE       +++ S +PIG P+Q+  
Sbjct  8526  HVARFQRLVSSLAGAKLINLYGPTEATVDVSYFDCEP------NEAYSVIPIGKPIQNIR  8579

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V           +   ++
Sbjct  8580  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVA----DPFAGGEAGYER  8635

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE+ L +   V +A V+ R D+ 
Sbjct  8636  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVESQLLQVESVREAVVMARADET  8695

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E LRS    + R+LP  M+P  F   E  P+S +GK+D   L
Sbjct  8696  GQKQMVAYYVAGQEMGASE-LRS---ELGRELPSYMVPTYFVQLEQMPLSPNGKIDRKAL  8751


 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 109/232 (47%), Gaps = 39/232 (17%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
              I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  10698  IMNSYGVTEAAIDSSFYDEELSKLP------SSGSVPIGQAWLNARFYIV-DSQLNPVPI  10750

Query  222    ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                 GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  10751  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPFVPGERLYRTGDLARWMPDG  10802

Query  393    NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL------EAH  554
              N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L      EA 
Sbjct  10803  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQAVVIDRTDERGHKYLCGYITGEAE  10862

Query  555    LIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              L ++E    +E            LP  M+P R    E+ P++S+GK+D   L
Sbjct  10863  LRIEEVQAELEA----------GLPAHMVPARLMRLETIPLTSNGKIDRKAL  10904


 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 70/226 (31%), Positives = 107/226 (47%), Gaps = 27/226 (12%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  2367  IINSYGVTEAAIDSSFYDEELSKLP------SSGSVPIGQAWLNARFYIV-DSQLNPVPI  2419

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  2420  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVAGERLYRTGDLARWMPDG  2471

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
             N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L  + I  E 
Sbjct  2472  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQAVVIDRTDERGHKYLCGY-ITGET  2530

Query  573   NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                +E    +   +   LP  M+P R    E+ P++ +GK+D   L
Sbjct  2531  ELRIE---EVQAELEAGLPAHMVPARLMRLETLPLTHNGKIDRKAL  2573


 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 108/219 (49%), Gaps = 22/219 (10%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN--E  221
             I N+YG TE +   T         + E      + IG P+ +  + ++   G+  P    
Sbjct  3898  IYNMYGPTETTVWST---------VQELTHAQHIHIGRPIANTQIYIMNANGELQPVGVP  3948

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+C++G  L+ GY+    +    +V    N+         ++ +RTGD AR + +GN  
Sbjct  3949  GELCIAGEGLARGYWKREELTAEKFV----NNPFAGGKAGHERMYRTGDLARWMPDGNIE  4004

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             +LGR D  VKI G+RI L E+E+ L +   V +A V+ R D+   + L A+ +  +    
Sbjct  4005  YLGRMDHQVKIRGYRIELGEIESQLLQVESVQEAVVMARKDETGQTQLVAYYVASQELGA  4064

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              E+ +     + R+LP  M+P  F + E  P++ +GK+D
Sbjct  4065  GELRQE----MGRELPSYMVPSYFIWLEQMPLTPNGKID  4099


 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 106/230 (46%), Gaps = 18/230 (8%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYF---DCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP----  215
              I N+YG TE + D T +   D ESL  +LE K    V IG P+ +  V +L         
Sbjct  13281  ITNVYGPTETTVDATAYTIEDVESLNALLE-KGEHTVSIGTPIANQSVYILNSQQQLVPI  13339

Query  216    -NEGEICVSGLCLSAGYFCYPSVLPLDYV----ELSQNHDSKSTDHRVQQYFRTGDFARK  380
                 GE+ + G  +  GY   P +    +V      +   D   + H   + +RTGD AR 
Sbjct  13340  GIAGELYIGGAGVGRGYLNLPELTAEKFVLNPFADAAAADQADSTH-ANRMYRTGDLARW  13398

Query  381    LQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLI  560
              + +G+  +LGR D  VKI G+RI L EVE  L     +  A V    ++     L A++I
Sbjct  13399  MPDGSIEYLGRIDHQVKIRGYRIELGEVEAQLLTVNGIQKAVVTAWENEDGHKDLCAYII  13458

Query  561    MKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                E+      L  + N +  KLP  MIP      + FP++ +GK+D   L
Sbjct  13459  ASESLS----LPELRNALQPKLPDYMIPTYVVQLDRFPLTPNGKIDRKAL  13504


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/235 (30%), Positives = 118/235 (50%), Gaps = 20/235 (9%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILE-HKSLSGVPIGLPLQSCDVLLL  200
             +++ K   Q A  N YG TE S         S+ L+ E  ++   + IG P+ +  + ++
Sbjct  6969  ELVYKWKDQVAYYNGYGPTENSV------ATSIWLVSEDERAGQLISIGRPVPNHRIYMV  7022

Query  201   ---GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTG  365
                G   P    GE+CVSG  L+ GY   P +    +V     +   + +   ++ +RTG
Sbjct  7023  DVHGHLAPVGVAGELCVSGPGLARGYLDRPELTAEKFVP----NPFAAGEAGYERMYRTG  7078

Query  366   DFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL  545
             D AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  + L
Sbjct  7079  DLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQNQL  7138

Query  546   EAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              A+ + + +    E LRS+   +  +LP  M+P  F   E  P++ +GK+D   L
Sbjct  7139  VAYYVAERDVSAGE-LRSL---LGEELPNYMVPSYFIQLEQMPLTPNGKIDRKAL  7189


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 116/234 (50%), Gaps = 18/234 (8%)
 Frame = +3

Query  24     KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
              +++ K   Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V ++ 
Sbjct  12197  ELVYKWKDQVAYYNGYGPTENSVATSIW-----PVSEDERAGQLISIGRPVPNHRVYMVD  12251

Query  201    --GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
                G   P    GE+CVSG  L+ GY   P +    +V     +   + +   ++ +RTGD
Sbjct  12252  VHGHLAPVGVAGELCVSGPGLARGYLDRPELTAEKFVP----NPFAAGEAGYERMYRTGD  12307

Query  369    FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
               AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  + L 
Sbjct  12308  LARWMPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQNQLV  12367

Query  549    AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              A+ + +      E LRS+   +  +LP  M+P      E  P++ +GK+D   L
Sbjct  12368  AYYVAEREVSTGE-LRSL---LGEELPNYMVPSYLVQLEQMPLTPNGKIDRKAL  12417


 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 107/227 (47%), Gaps = 24/227 (11%)
 Frame = +3

Query  45   PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
            P   I+N YG TE   + T+    ++  +     L  VPIG P+ +    ++      + 
Sbjct  777  PSLRIINGYGPTE---NTTFSTTHAIASV----QLEAVPIGRPIHNSTAYVVDRSMQLQP  829

Query  222  ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                GE+ V G  ++ GY   P +    +V+        S     ++ +RTGD  R  ++
Sbjct  830  VGAWGELIVGGDGVARGYRNRPDLTAEKFVD--------SPFRSGERCYRTGDLVRWNED  881

Query  390  GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
            G   + GR D  VKI G+RI L EVE  L +   V +A VI R D++    L A+++   
Sbjct  882  GTLEYKGRIDAQVKIRGYRIELGEVEAQLLKLEAVQEAVVIAREDEQGQKQLCAYVVTLA  941

Query  570  NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            +    E LRS    ++++LP  M+P  F   E  P++ +GKVD   L
Sbjct  942  DIAASE-LRSA---LSQELPGYMVPSYFVQLEQLPLTPNGKVDRRAL  984


 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 105/227 (46%), Gaps = 29/227 (13%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  9633  IMNSYGVTEAAIDSSFYDEELSKLP------SSGNVPIGQAWLNARFYIV-DSQLNPVPI  9685

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  9686  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  9737

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVI-FRNDKRDTSLLEAHLIMKE  569
             N  F+GR D  VKI G RI L EVE  L     +  A V  + N+  D  L  A+++  +
Sbjct  9738  NVDFIGRMDDQVKIRGFRIELGEVEAQLLTVDSIQKAIVTAWENEDGDKDLC-AYVVASD  9796

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                    L  + N +  KLP  MIP      + FP++ +GK+D   L
Sbjct  9797  ALN----LPELRNLLQPKLPGYMIPTYVVQLDHFPLTPNGKIDRKAL  9839



>ref|WP_022586658.1| tyrocidine synthase 3 [Brevibacillus laterosporus]
 gb|ERM16085.1| tyrocidine synthase 3 [Brevibacillus laterosporus PE36]
Length=2337

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 126/236 (53%), Gaps = 24/236 (10%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H+  ++  V  + +  ++NLYG TE + D TYFDC+        + L+ +PIG P+ +  
Sbjct  739  HVDRFRRAVSSVCEARLINLYGPTEATVDVTYFDCD------RDEELATIPIGKPIYNTQ  792

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + ++  +  N       GE+C++G+ L+ GY   P        EL++    K+     ++
Sbjct  793  LYIVQANSENLQPIGIAGELCIAGVGLARGYLNRP--------ELTEEKFVKNPFVAGER  844

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G RI L E+E+ +R+   + +  V+ + D+ 
Sbjct  845  MYRTGDLARWLPDGNIEYLGRIDDQVKIRGVRIELGEIESQMRKLDGLREVVVVAKEDQA  904

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                L A+++    +  V I   I   +A KLP AMIP  F   E+ P++++GK+D
Sbjct  905  KEKFLCAYMV---TDREVSIA-EIRAHLAAKLPIAMIPSTFISLEAMPLTANGKID  956


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 102/227 (45%), Gaps = 25/227 (11%)
 Frame = +3

Query  45    PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
             P   I N YG TE S   T      +           + IG PL +  V ++ ++   + 
Sbjct  1791  PAIEINNEYGPTENSVVTTIQRAIGVD--------QAITIGRPLANVTVYIVNNEHHLQP  1842

Query  222   ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                 GE+C++G  L  GY   P        EL++     +     ++ ++TGD A+   +
Sbjct  1843  IGVVGELCIAGRGLGRGYLNRP--------ELTEEKFVANPFVPGERMYKTGDLAKWRPD  1894

Query  390   GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
             G   ++GR D  VK+ G RI + E+E+ + ++  V +  V  + D+     L A+ +   
Sbjct  1895  GTIEYVGRVDEQVKVRGFRIEIGEIESTILQYHGVGEVVVTAQQDQHAQQYLCAYFVA--  1952

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               E   +L  +  +++++LP  M+P  F      P +++GKVD   L
Sbjct  1953  --EKEVVLADLRKFVSKELPAYMVPTYFVQLLELPTTANGKVDKRAL  1997



>ref|WP_015181756.1| amino acid adenylation enzyme/thioester reductase family protein 
[Microcoleus sp. PCC 7113]
 ref|YP_007121010.1| amino acid adenylation enzyme/thioester reductase family protein 
[Microcoleus sp. PCC 7113]
 gb|AFZ17604.1| amino acid adenylation enzyme/thioester reductase family protein 
[Microcoleus sp. PCC 7113]
Length=1370

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/238 (32%), Positives = 126/238 (53%), Gaps = 22/238 (9%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SL +   +++P   ++NLYGS+EVS + TY+D   LP     +  + +PIG P+ +  V
Sbjct  770  VSLAQTFRELMPSAKLINLYGSSEVSANVTYYDISLLP-----EQATSIPIGRPIDNTLV  824

Query  192  LLLGDD---DPNE--GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
             +L       P    GE+ + G  L+ GY   P        EL+Q     +      + +
Sbjct  825  YVLNRHLQLTPVGVVGELYIGGDGLARGYLHRP--------ELTQARFIDNPFFPGTKLY  876

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            +TGD  R L +GN  +LGR D  VKI G R+ LEE+  V+ +HP+V ++ VI R+D +  
Sbjct  877  KTGDLVRYLNDGNLEYLGRHDDQVKIRGFRVELEEIATVVSQHPDVQESVVIVRDDAQGD  936

Query  537  SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              L A+++     +  +I+  ++  + +KLP  M+P  F   ++ P++ +GKVD   L
Sbjct  937  RRLIAYIV----TDQPDIVPQLSADLQQKLPNYMLPSAFVVLDALPLTPNGKVDKQAL  990



>ref|WP_010789735.1| Long-chain-fatty-acid--CoA ligase [Bacillus atrophaeus]
 gb|EOB36397.1| Long-chain-fatty-acid--CoA ligase [Bacillus atrophaeus UCMB-5137]
Length=1276

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 118/223 (53%), Gaps = 22/223 (10%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-----  221
            ++++YG TEV+   T    + +P     +S+S +PIG PL   +  +L +    +     
Sbjct  749  LIHVYGPTEVTVFATAHQVQEVP-----ESMSAIPIGKPLNETEAYILTETSQLQPFGAV  803

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            GE+C+SG+ +S GY     +    +++    H  K  +    + +RTGD AR L +G   
Sbjct  804  GELCLSGMGVSKGYLNREELTKQKFIQ----HPFKPGE----RLYRTGDLARWLPDGTIE  855

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
            F GR D  VKI GHRI LEE+E  L+EH EV DA V+    +   + + A+L+ +     
Sbjct  856  FAGRIDDQVKIRGHRIELEEIEKQLQEHEEVKDAVVVVDRTETGDASINAYLVCETQASS  915

Query  582  VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             E    I  +I+++LP  M+P  F F +  P++ +GKV+  LL
Sbjct  916  KE----IQAFISKQLPAYMVPQSFTFLDQLPLTPNGKVNRRLL  954



>ref|WP_016866928.1| hypothetical protein [Fischerella muscicola]
Length=1371

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/247 (31%), Positives = 125/247 (51%), Gaps = 34/247 (14%)
 Frame = +3

Query  9    HLSLW------------KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLS  152
            HL LW            K   ++LP+  ++NLYGS+EVS + TY D   LP       L+
Sbjct  762  HLKLWITSGEALSVNLAKTFRELLPEAKLINLYGSSEVSANVTYCDLSLLP-----DQLT  816

Query  153  GVPIGLPLQSCDVLLLGD-DDPNE----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNH  317
             +PIG P+ +  V +L     P      GE+ + G  L+ GY   P        EL+Q  
Sbjct  817  TIPIGRPIDNTLVYVLSSCLQPTPIGVVGELYIGGDGLAKGYLHRP--------ELTQER  868

Query  318  DSKSTDHRVQQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVA  497
               +      + ++TGD  R L +GN  + GR+DR VKI G R+ L E+E  + +HP + 
Sbjct  869  FIDNPFVPGTKLYKTGDLVRYLNDGNLEYFGRRDRQVKIRGFRVELGEIEAAIAKHPSIR  928

Query  498  DAAVIFRNDKRDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPM  677
            ++ VI ++       L A+++ K++ +    +  ++N++  KLP  M+P  F   ++ P+
Sbjct  929  ESVVIAQDHNPKDQRLIAYVVTKQDID----IPQLSNYLQEKLPNYMVPSAFVILDALPL  984

Query  678  SSSGKVD  698
            + +GKVD
Sbjct  985  TPNGKVD  991



>ref|WP_004430165.1| MULTISPECIES: peptide synthetase [Bacillus subtilis group]
 ref|YP_003975933.1| surfactin synthetase [Bacillus atrophaeus 1942]
 gb|ADP35002.1| surfactin synthetase [Bacillus atrophaeus 1942]
 gb|EIM09625.1| surfactin synthetase [Bacillus atrophaeus C89]
 gb|AIK48462.1| surfactin synthase subunit 3 [Bacillus atrophaeus subsp. globigii]
 gb|KFK81055.1| surfactin synthase subunit 3 [Bacillus subtilis subsp. niger]
Length=1276

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 118/223 (53%), Gaps = 22/223 (10%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-----  221
            ++++YG TEV+   T    + +P     +S+S +PIG PL   +  +L +    +     
Sbjct  749  LIHVYGPTEVTVFATAHQVQEVP-----ESMSAIPIGKPLNETEAYILTETSQLQPFGAV  803

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            GE+C+SG+ +S GY     +    +++    H  K  +    + +RTGD AR L +G   
Sbjct  804  GELCLSGMGVSKGYLNREELTKQKFIQ----HPFKPGE----RLYRTGDLARWLPDGTIE  855

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
            F GR D  VKI GHRI LEE+E  L+EH EV DA V+    +   + + A+L+ +     
Sbjct  856  FAGRIDDQVKIRGHRIELEEIEKQLQEHEEVKDAVVVVDRTETGDASINAYLVCETQASS  915

Query  582  VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             E    I  +I+++LP  M+P  F F +  P++ +GKV+  LL
Sbjct  916  KE----IQAFISKQLPAYMVPQSFTFLDQLPLTPNGKVNKRLL  954



>ref|WP_003339532.1| bacitracin synthetase [Brevibacillus laterosporus]
 emb|CCF12836.1| D-alanine--poly(phosphoribitol) ligase, subunit 1 [Brevibacillus 
laterosporus GI-9]
Length=12190

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 124/240 (52%), Gaps = 24/240 (10%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            H+  ++  +  + Q  ++NLYG TE + D TYFDC++       + L+ +PIG P+ +  
Sbjct  739  HVDRFRRAISSVCQARLINLYGPTEATVDVTYFDCDT------DEELAAIPIGKPIYNTQ  792

Query  189  VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            + ++  D  N       GE+C++G+ L+ GY   P        EL++    K+     ++
Sbjct  793  LYIVQADSVNLQPIGIAGELCIAGVGLARGYLNRP--------ELTEEKFVKNPFAPGER  844

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD AR L +GN  +LGR D  VKI G+RI L EVE  L +   + +A VI R D  
Sbjct  845  MYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIELGEVELQLLKIEAIQEAVVIVREDAS  904

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                + A+ +  +     E+   ++    R+LP  M+P  F   +  P+S +GK+D  +L
Sbjct  905  GQKQMCAYYVANKQLTVGELRADLS----RELPTYMVPSYFVQMDKMPLSPNGKIDRKML  960


 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (49%), Gaps = 29/239 (12%)
 Frame = +3

Query  15    SLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVL  194
             SL K + ++ P   I N YG TE S   T     SL +    + LS   IG P+ +  V 
Sbjct  3764  SLVKKVAELNPSIEICNEYGPTESSVVTT-----SLSITQPEQELS---IGRPIANKQVY  3815

Query  195   LLGDDDPNE-------GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
             +L  D  N+       GE+C++G  L+ GY   P +    +V      D+  T    ++ 
Sbjct  3816  IL--DQHNQLQPVGVAGELCIAGTGLARGYLHLPQLSTEKFV------DNPFTPE--EKM  3865

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             ++TGD AR L +GN  ++GR D  VKI G+RI L EVE  L     V +A V+ R ++  
Sbjct  3866  YKTGDLARWLPDGNIEYVGRIDHQVKIRGYRIELGEVEAHLLRIDSVQEAIVVAREEQEG  3925

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                L A+ +  +       +  I N +A++LP  MIP  F   E  P++++GK+D   L
Sbjct  3926  QKHLCAYFVADKQV----TVGEIRNVLAQELPSFMIPAFFIQLEQMPLTTNGKIDRKAL  3980


 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/224 (31%), Positives = 111/224 (50%), Gaps = 26/224 (12%)
 Frame = +3

Query  60    LNLYGSTE--VSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD-----PN  218
              N YG TE  +      +D ES+P  +       VPIG PL++  + ++  +        
Sbjct  2263  FNAYGPTEDTICSSVWSYDRESMPENV-------VPIGRPLKNHRIYIVDAEGHLLPIGV  2315

Query  219   EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNF  398
              GE+C++G+ L+ GY   P        EL++     S     ++ ++TGD AR + +G  
Sbjct  2316  AGELCIAGVGLARGYLNRP--------ELTEEKFVNSRFRAGERMYKTGDLARWMSDGTI  2367

Query  399   IFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNE  578
              +LGR D  VKI G+RI L EVE  L +   V +A VI R+D+     L A+ +     E
Sbjct  2368  EYLGRIDHQVKIRGYRIELGEVEAQLLKVDTVQEAIVIARDDEAGQKHLCAYFVA----E  2423

Query  579   HVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              +  +  + + ++ +LP  MIP  F   E  P++S+GK+D   L
Sbjct  2424  SLLSMAKLRSELSHELPNYMIPSYFVQLEQMPLTSNGKIDRKAL  2467


 Score = 93.6 bits (231),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 67/234 (29%), Positives = 115/234 (49%), Gaps = 25/234 (11%)
 Frame = +3

Query  27    ILVKILPQTAILNLYGSTEVSGDCTYFD-CESLPLILEHKSLSGVPIGLPLQSCDVLLLG  203
             +L +      ILN YG TE   D ++F+  +SL  +        +PIG PL + ++ +L 
Sbjct  5284  LLTRFGSHMRILNSYGVTEACIDSSFFEQTDSLFAM-------NIPIGKPLPNVNMYVLH  5336

Query  204   DDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             +++  +     GE+ ++G  +  GY   P +    +VE     +      R+   +RTGD
Sbjct  5337  ENNVMQPIGIPGELYIAGKGVGRGYLNRPELTAEKFVE-----NPFVAGERM---YRTGD  5388

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
               R L NGN  +LGR D  VKI G+RI L EVE  L +  ++ +  V+ + D+     L 
Sbjct  5389  LVRWLPNGNIEYLGRIDHQVKIRGNRIELGEVETQLLKIAKIKENVVVAQEDQAGRKYLC  5448

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ +  +     E+  +++    + LP  M+P  F   E  P++ +GK+D + L
Sbjct  5449  AYFVADQKLSSSELREALS----QVLPSFMVPSYFMQVEQLPLTPNGKIDRSAL  5498


 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 111/227 (49%), Gaps = 25/227 (11%)
 Frame = +3

Query  48    QTAILNLYGSTEVSGDCTYFDCESL-PLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
             Q  ILN YG TE   D +YF+  ++ P +        +PIG PL + ++ +L ++     
Sbjct  8885  QIRILNSYGVTEACIDSSYFEQVTIVPSV-------SLPIGKPLPNVNMYVLNENHAMLP  8937

Query  222   ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                 GE+ + G  +  GY   P +    +V+       K         +RTGD AR L +
Sbjct  8938  IGVLGELYIGGKGVGRGYLNRPELTAEKFVDNPFVPGEK--------MYRTGDLARWLSD  8989

Query  390   GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
             GN  ++GR D  VKI G+RI L EVE+ L + P + +A V+ + ++     L A+ +  +
Sbjct  8990  GNMEYVGRIDHQVKIRGNRIELGEVESKLLKTPFMQEAIVVAQENEAGVKQLCAYFVATK  9049

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                    L  + N ++++LP  MIP  F   +  P++ +GK+D   L
Sbjct  9050  TL----TLSELRNTLSQELPGYMIPTYFIQLDEMPLTPNGKIDRKAL  9092


 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 114/234 (49%), Gaps = 23/234 (10%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLG  203
             ++L +   Q  ILN YG TE   D ++++  +  L L       +PIG PL +  + +L 
Sbjct  6800  QLLSRFGDQMRILNSYGVTEACIDSSFYEQTTNLLSL------NLPIGKPLPNVKMYVLD  6853

Query  204   DDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             ++   +     GE+ +SG+ +  GY   P +    +V      DS   D+  ++ +RTGD
Sbjct  6854  ENRAIQPVGIPGELYISGIGVGRGYLNRPELTAEKFV------DSPFVDN--ERMYRTGD  6905

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
               R L +GN  ++GR D  VKI G+RI L E+E  L +   + +  VI + D      L 
Sbjct  6906  LVRWLPDGNIEYVGRIDHQVKIRGNRIELGEIEAQLLKIHAIEEVVVIAQEDSVGQKHLC  6965

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ +  +      I+  +   + ++LP  MIP  F   E  P++ +GK+D   L
Sbjct  6966  AYFVADDQL----IVSDLRATLMQELPAYMIPSYFVQLEELPLTPNGKIDRKAL  7015


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 108/230 (47%), Gaps = 36/230 (16%)
 Frame = +3

Query  51    TAILNLYGSTEVS-----GDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-GDDD  212
              ++ N+YG TE +     GD T  D E             + IG PL +    LL  +  
Sbjct  7847  ASLYNMYGPTETTVWSSVGDVT--DEEQ------------ITIGKPLLNTRFYLLNAEGQ  7892

Query  213   PN----EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARK  380
             P      GE+C++G  L+ GY+  P +    +VE     +      R+   ++TGD A+ 
Sbjct  7893  PQPIGVAGELCIAGEGLARGYWNRPELTREKFVE-----NPFVPGERI---YQTGDLAKW  7944

Query  381   LQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLI  560
             L +G   +LGR D  VKI GHRI L E+E  L     VA+A VI R D+     L A+ +
Sbjct  7945  LPDGTIEYLGRIDHQVKIRGHRIELGEIETQLLHVSSVAEAVVIARGDQEGQQQLCAYFV  8004

Query  561   MKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                  +    +  +   ++++LP  M+P  F   E  P++ +GK+D N L
Sbjct  8005  A----DQPLTVYDLKAQLSQELPSYMVPSYFIQLEQMPLTPNGKIDRNAL  8050


 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 115/237 (49%), Gaps = 25/237 (11%)
 Frame = +3

Query  15     SLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVL  194
              SL   ++++ P   I N YG TE S   T     SL +    + +S   IG P+ +  V 
Sbjct  10389  SLVNKVMEMKPSIEICNEYGPTESSVVST-----SLRITNPEQEIS---IGSPIANKQVY  10440

Query  195    LLGDDDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFR  359
              ++G  +  +     GE+C++G  L+ GY   P +    +VE     +  +   R+   ++
Sbjct  10441  IIGVHNQLQPIGVAGELCMAGSGLARGYLHLPELTAEKFVE-----NPFAAGERM---YK  10492

Query  360    TGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTS  539
              TGD AR L NG+  +LGR D  VKI G+RI L EVE  L +   + +A VI +      +
Sbjct  10493  TGDLARWLPNGSIEYLGRIDHQVKIRGYRIELSEVEVQLMKVAPIQEAIVIVKEGDAGQN  10552

Query  540    LLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L A+ +  E+   V  LR   N +   LP  M+P  F   E  P++ +GK+D   L
Sbjct  10553  QLCAYFV-SEDQLKVRELRKALNQV---LPEFMVPSYFVQLEKMPLTPNGKIDRKAL  10605


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/225 (29%), Positives = 106/225 (47%), Gaps = 18/225 (8%)
 Frame = +3

Query  45     PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVL---LLGDDDP  215
              PQ  ++N+YG TE +   TY +   + +    ++ S +   +P  S  +L   L      
Sbjct  11437  PQVKLINMYGITETTVHVTYKEITEVEI---SQAKSNIGKTIPTLSAYILDEHLRLQPVG  11493

Query  216    NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               +GE+ ++G  L+ GY   P        EL+      +     ++ ++TGD AR L +GN
Sbjct  11494  VKGELYIAGEGLARGYLNRP--------ELTNERFVPNPFVPGERMYKTGDLARWLADGN  11545

Query  396    FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
                +LGR D  VKI G+RI L EVE  L     + +A VI   D      L A+ +     
Sbjct  11546  IEYLGRIDHQVKIRGYRIELGEVETQLLNIESMQEAIVIAHEDASGDKYLCAYFVA----  11601

Query  576    EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              +H   +  +   ++++LP  MIP  F   E  P++ +GK+D   L
Sbjct  11602  DHELTVAELRKALSQQLPDYMIPAYFVQMERMPLTGNGKLDRKAL  11646



>ref|WP_013428515.1| non-ribosomal peptide synthetase module [Burkholderia rhizoxinica]
 ref|YP_004022173.1| non-ribosomal peptide synthetase module [Burkholderia rhizoxinica 
HKI 454]
 emb|CBW76654.1| Non-ribosomal peptide synthetase modules (EC 6.3.2.-) [Burkholderia 
rhizoxinica HKI 454]
Length=2515

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 122/234 (52%), Gaps = 17/234 (7%)
 Frame = +3

Query  24   KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
            K+   +LP T + NLYG TE + D T + C +      + +   VPIG P+ +  + LL 
Sbjct  729  KLCRTLLPDTQLYNLYGPTEAAIDVTAWCCPA------NYAEETVPIGKPIANTCIYLLD  782

Query  201  --GDDDPNE--GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
              G   P+   GE+ + G  ++ GY   P +    ++      D  ST    + Y +TGD
Sbjct  783  RHGHLVPSGAVGELYIGGAGVARGYLNRPELTAACFLS-----DPFSTAPNARMY-KTGD  836

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
            FAR L +GN  F+GR D  VK+ G+R+ L E+E VL+ HP+VA A V  R+D++    L 
Sbjct  837  FARYLPDGNLEFMGRSDHQVKVRGYRVELSEIETVLQRHPDVAQAIVAIRDDRQGHKQLI  896

Query  549  AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             +++     ++   +  +   +A  LP  M+PV     ++ P++ SGKVD + L
Sbjct  897  GYVVADPQGKNKLDVAGLRQHVAHHLPEYMVPVAVVLLDALPLTPSGKVDRHAL  950


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/225 (29%), Positives = 110/225 (49%), Gaps = 20/225 (9%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD-DPN----E  221
             I+N YG TE +      +   LP  +  +S   +P+G P+ +    +L +   P      
Sbjct  1801  IINHYGPTEATIGMLVGE---LPHEISLESTPFLPLGRPISNTQAYVLDNGLQPVPVGVA  1857

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+ ++G  L+ GY   P +    +V       +        + +R+GD  +   +G+  
Sbjct  1858  GELYIAGSSLARGYLDRPGLTSERFV-------ADPFGPPGSRMYRSGDLMKWRSDGSLD  1910

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             FLGR D  VKI G RI L E+E VLR +P V   AVI R+D   +  L ++++ K +   
Sbjct  1911  FLGRVDDQVKIRGFRIELREIEAVLRRNPAVRQVAVITRDDHSGSQQLVSYVVPKGDGTS  1970

Query  582   VE--ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             ++  +LR     IA++LP  M+P      ++ P++ +GK+D   L
Sbjct  1971  IDPVLLR---RQIAQQLPDYMVPAAIVLLDALPLTPNGKLDRKAL  2012



>ref|WP_038279567.1| AMP-dependent synthetase [[Clostridium] celerecrescens]
 gb|KEZ90534.1| AMP-dependent synthetase [ [[Clostridium] celerecrescens]
Length=503

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 118/236 (50%), Gaps = 29/236 (12%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            HL++W+   K LP    +NLYG TE++ +CTY+     P+  + +S   +PIG    +  
Sbjct  280  HLTIWQ---KYLPDARYVNLYGPTEITCNCTYY-----PVERKFESHETLPIGKAFPNER  331

Query  189  VLLLGDDDP------NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            V LL  DD         GE+CVSG  L+ GY+  P      +V+   N       H ++ 
Sbjct  332  VFLLDQDDKPVTEKGRIGELCVSGTALALGYYNNPEQTKRAFVQNPLN------THCLET  385

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD A   +NG   F GRKD  +K  GHRI LEE+E V+  +P +  A  +F  +K 
Sbjct  386  IYRTGDLAFYGENGELCFAGRKDFQIKHMGHRIELEEIEAVINSYPLIQRACCVFDEEK-  444

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              S + A  + +         R I+  +   LP  MIP  F+     P++++GK+D
Sbjct  445  --SRIGAFYVGEMEG------REISVRMRESLPVYMIPSAFYPLPELPVTANGKID  492



>ref|WP_018670730.1| gramicidin synthetase [Brevibacillus laterosporus]
Length=2587

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 115/231 (50%), Gaps = 23/231 (10%)
 Frame = +3

Query  36    KILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP  215
             K+ P   + N YG +E S D T    + LP          VPIG PL +  + ++ D+  
Sbjct  1825  KLFPHIPLANAYGPSEASDDVTIHILDQLP------QSEIVPIGKPLHNFKIYIV-DEKM  1877

Query  216   N------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFAR  377
             N      +GEICVSGL +  GY   P      ++E          DH+  + ++TGD  R
Sbjct  1878  NLCPVGIKGEICVSGLGVGRGYLNDPERTAKVFME------DPFADHKGVRLYKTGDMGR  1931

Query  378   KLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHL  557
              L +G   F GRKD  VKI G RI LEE+EN +  HP++ +  V+   D R    L A++
Sbjct  1932  WLSDGTLEFFGRKDYQVKIRGFRIELEEIENQINNHPDILETVVMDIEDTRGQKSLCAYV  1991

Query  558   IMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             ++K++      +  + + +A  LP  MIP  F   E  P++++GKVD   L
Sbjct  1992  VLKQDVP----INQLKSHLANALPDYMIPAFFVKMERLPLTTNGKVDRKAL  2038


 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 109/225 (48%), Gaps = 22/225 (10%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGD-----DDPNE  221
            ++N+YG  E    CT F        +   +LS +PIG P+ +  V +L            
Sbjct  763  LINVYGPAE----CTVFTTTHHVTQVAADALS-IPIGKPIANTQVYVLDQYLQVVPIGVP  817

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKS--TDHRVQQYFRTGDFARKLQNGN  395
            GE+ V G  L+ GY        L  +E++     K+  + +   + ++TGD  R L +G 
Sbjct  818  GELYVGGPGLALGY--------LHRLEITSERFIKNIFSSNETDRLYKTGDIVRYLPDGT  869

Query  396  FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
              ++GR+D  VKI G RI L E+E VL +HPE+ DA V+ R D+     L A+    +  
Sbjct  870  LSYIGREDDQVKIRGFRIELGEIEAVLGQHPEIRDAVVMMREDQNSNKQLIAYFTAYKPG  929

Query  576  EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              V     + ++  +K+P  MIP  F + +  P++ +GKVD   L
Sbjct  930  --VVTTCELRSFAEKKIPMHMIPATFIYLDHLPVTPNGKVDRKAL  972



>ref|WP_015217385.1| amino acid adenylation domain protein [Anabaena cylindrica]
 ref|YP_007159683.1| amino acid adenylation domain protein [Anabaena cylindrica PCC 
7122]
 gb|AFZ60773.1| amino acid adenylation domain protein [Anabaena cylindrica PCC 
7122]
Length=1070

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 119/223 (53%), Gaps = 23/223 (10%)
 Frame = +3

Query  63   NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-GDDDPNE----GE  227
            NLYG TE + D T++ C+       H  L  VPIG P+ +  + +L G   P      GE
Sbjct  751  NLYGPTEAAIDVTFWQCQP------HSQLPFVPIGRPISNTQIYILDGQGKPTPVGVPGE  804

Query  228  ICVSGLCLSAGYFCYPSVLPLDYVE--LSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            + + G+ L+ GY   P +    ++    SQ  DS+         ++TGD AR L +G+  
Sbjct  805  LHIGGVGLARGYLNRPDLTNEKFIPHPFSQELDSR--------LYKTGDLARYLSHGDIE  856

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
            +LGR D  VK+ G RI L E+E+V+ +HP++ +  VI  +D+ D   L A+L+ +  +E 
Sbjct  857  YLGRVDYQVKLRGFRIELGEIESVISQHPDIREVVVIVHSDQADFQRLVAYLVPR--SEQ  914

Query  582  VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              I+  + +++  +LP  MIP  F   E+ P++ +GKV+   L
Sbjct  915  KLIIAELRHFLELRLPDYMIPNVFVILEALPLTPNGKVNRKAL  957



>ref|WP_014281409.1| bacitracin synthetase [Paenibacillus terrae]
 ref|YP_005076932.1| bacitracin synthetase 1 [Paenibacillus terrae HPL-003]
 gb|AET60709.1| bacitracin synthetase 1 [Paenibacillus terrae HPL-003]
Length=10743

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 123/240 (51%), Gaps = 16/240 (7%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  +    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  5441  HVARFQRLVSGIAGAKLINLYGPTEATVDVSYFDCEPT------EKYAVIPIGKPIQNIR  5494

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V+          +   ++
Sbjct  5495  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVK----DPFAGGEAGYER  5550

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE+ L +   V +A V+ R D+ 
Sbjct  5551  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVESQLLKVESVREAVVMARADET  5610

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E+   + + + R+LP  M+P  F   E  P+S +GK+D   L
Sbjct  5611  GQKQMVAYYVAGQELGASELRNELRSELGRELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  5670


 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 123/240 (51%), Gaps = 16/240 (7%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  +    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  8521  HVARFQRLVSGIAGAKLINLYGPTEATVDVSYFDCEPT------EKYAVIPIGKPIQNIR  8574

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V+          +   ++
Sbjct  8575  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVK----DPFAGGEAGYER  8630

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE+ L +   V +A V+ R D+ 
Sbjct  8631  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVESQLLKVESVREAVVMARADET  8690

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E+   + + + R+LP  M+P  F   E  P++ +GK+D   L
Sbjct  8691  GQKQMVAYYVAGQELGASELRNELRSELGRELPSYMVPSYFVQLEQMPLNPNGKIDRKAL  8750


 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/223 (30%), Positives = 111/223 (50%), Gaps = 18/223 (8%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-----  221
             I N+YG TE +   T         + E      + IG P+ +  + ++  +D  +     
Sbjct  3886  IYNMYGPTETTVWST---------VQELTHADQINIGRPIANTQMYIMNANDGVQPIGVP  3936

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+C++G  L+ GY+    +    +V  +     K+ + R+   +RTGD AR + +GN  
Sbjct  3937  GELCIAGEGLARGYWNREELTAEKFVN-NPFAGGKAGNERM---YRTGDLARWMPDGNIE  3992

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             +LGR D  VKI G+RI L EVE+ L +   V +A V+ R D+   + L A+ I  +    
Sbjct  3993  YLGRIDHQVKIRGYRIELGEVESQLLKVEPVREAIVVARADETGQNQLVAYFIAGQELGA  4052

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              E+   + + + R+LP  M+P  F   E  P++ +GK+D   L
Sbjct  4053  GELRNELRSELGRELPSYMVPSYFIQLEQMPLTPNGKIDRKAL  4095


 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 110/232 (47%), Gaps = 39/232 (17%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  2355  IINSYGVTEAAIDSSFYDEELSKLP------SSGSVPIGQAWLNARFYIV-DSQLNPVPI  2407

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  2408  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVLGERLYRTGDLARWMPDG  2459

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL------EAH  554
             N  F+GR D  VKI G+RI L E+E V++  P V  A VI R D+R    L      EA 
Sbjct  2460  NVDFIGRMDYQVKIRGYRIELGEIETVIQRVPGVRQAIVIDRTDERGHKYLCGYITGEAE  2519

Query  555   LIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             L ++E    +E            LP  M+P R    E+ P++S+GK+D   L
Sbjct  2520  LRIEEVQAELEA----------GLPAHMVPARLMRLETVPLTSNGKIDRKAL  2561


 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 115/234 (49%), Gaps = 18/234 (8%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
             +++ K   Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V ++ 
Sbjct  6967  ELVYKWKDQVAYYNGYGPTENSVATSIW-----PVSEDERAGQLISIGRPMPNHRVYMVD  7021

Query  201   --GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
               G   P    GE+CVSG  L+ GY   P +    +V     +   +     +  +RTGD
Sbjct  7022  VHGHLAPVGVAGELCVSGPGLARGYLDRPELTAEKFVP----NPFAAGKAGYEWMYRTGD  7077

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
              AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  + L 
Sbjct  7078  LARWMPDGNIEYLGRIDYQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQNQLV  7137

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ + + +    E LR +   +  +LP  M+P  F   E  P++ +GK+D   L
Sbjct  7138  AYYVAERDVSAGE-LRGL---LGEELPNYMVPSYFIQLEQMPLTPNGKIDRKAL  7187


 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 85/163 (52%), Gaps = 8/163 (5%)
 Frame = +3

Query  222    GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
              GE+CVSG  L+ GY   P +    ++  +   + +S   R+   +RTGD AR + NGN  
Sbjct  9954   GELCVSGQGLARGYLHRPELTDEKFIP-NPFANGESGYERI---YRTGDLARWMPNGNIE  10009

Query  402    FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
               LGR D  VKI G+RI L EVE  L +   + +  V+   D++  + L A+ + +     
Sbjct  10010  HLGRIDHQVKIRGYRIELGEVEANLLKVEALQEVIVLAHEDEQGQNQLVAYYVAEREVST  10069

Query  582    VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               E LRS+   +  KLP  M+P  F   E  P++ +GK+D   L
Sbjct  10070  GE-LRSL---LGEKLPNYMVPSYFVQLEHMPLTPNGKIDRKAL  10108


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/232 (29%), Positives = 109/232 (47%), Gaps = 24/232 (10%)
 Frame = +3

Query  30   LVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD  209
            ++K  P   I+N YG TE   + T+    ++  +        VPIG P+ +    ++   
Sbjct  759  VLKAHPSLRIINGYGPTE---NTTFSTTHAITGVQSES----VPIGSPIHNSRAYVVDHS  811

Query  210  DPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFA  374
               +     GE+ V G  ++ GY   P +    +++        S     ++ +RTGD  
Sbjct  812  MQLQPVGAWGELIVGGDGVARGYRNRPDLTAEKFID--------SPFRSGERCYRTGDLV  863

Query  375  RKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAH  554
            R   +G   + GR D  VKI G+RI L EVE  L +   V +A VI R D++    L A+
Sbjct  864  RWNADGTLEYKGRIDAQVKIRGYRIELGEVEAQLLKLEAVREAVVIAREDEQGQKQLCAY  923

Query  555  LIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            ++  E+    E LRS    ++++LP  M+P  F   E  P++ +GKVD   L
Sbjct  924  VVTHEDVVASE-LRSA---LSQELPGYMVPSYFVQLEQLPLTQNGKVDRRAL  971



>ref|WP_019735700.1| thioester reductase [Mycobacterium avium]
Length=1790

 Score =   121 bits (303),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 83/227 (37%), Positives = 116/227 (51%), Gaps = 28/227 (12%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDC---ESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN  218
            + NLYG TE + D T+F C   +S P+I         PIG P+ +  + LL   G+  P 
Sbjct  789  LYNLYGPTEAAIDVTHFHCVRGDSRPVI---------PIGRPIANIAIHLLDTAGNPVPV  839

Query  219  --EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
               GE+C+ G+ ++ GY   P      +       D   +       +RTGD AR L +G
Sbjct  840  GVPGELCIGGVGVARGYLNRPEATAAAF------GDDPFSSEPGALLYRTGDLARYLPDG  893

Query  393  NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLI-MKE  569
            N  +LGR+D  VKI+G RI L EVE  L +HP +A+ AV+ R D   T+ L AHL+ +  
Sbjct  894  NIEYLGRRDDQVKINGFRIELGEVEAALAKHPGIAECAVVARKDASGTTQLIAHLVPVAA  953

Query  570  NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 E+ R + N     LP AM+P  F  T+  P+S SGKVD   L
Sbjct  954  APGTAELRRFLLNL----LPAAMVPAVFRTTDLLPLSPSGKVDRRAL  996



>ref|WP_010073955.1| thioester reductase [Clostridium cellulovorans]
 ref|YP_003845375.1| amino acid adenylation domain-containing protein [Clostridium 
cellulovorans 743B]
 gb|ADL53611.1| amino acid adenylation domain protein [Clostridium cellulovorans 
743B]
Length=4613

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/222 (32%), Positives = 121/222 (55%), Gaps = 22/222 (10%)
 Frame = +3

Query  60    LNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-----G  224
             +N YG TE +   T + C+  P     +  + VPIG P+ + D+ +LG+ +  +     G
Sbjct  1785  INAYGPTEATICSTMWKCQDNP-----EGFTSVPIGKPIYNADIYILGEQNRIQPIGVPG  1839

Query  225   EICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFIF  404
             E+CVSG+ L+ GY        L+  EL+Q    ++  ++ ++ +RTGD+AR L +GN  F
Sbjct  1840  ELCVSGVALARGY--------LNRAELTQEKFVENPFNKSERMYRTGDYARWLPDGNIEF  1891

Query  405   LGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHV  584
             +GR D  VKI G+RI + E+E  L E+ ++ DA  I  +D      + A+ + +E     
Sbjct  1892  VGRIDNQVKIRGYRIEIGEIEKTLLENNKIKDATAIVIDDSNGDKHICAYYVAEEKI---  1948

Query  585   EILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               +  +  ++++ +P  MIP  F   +S P++ SGK+D  LL
Sbjct  1949  -TVSELREFLSKYIPSYMIPSYFIGLDSMPINQSGKIDKKLL  1989


 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 104/224 (46%), Gaps = 27/224 (12%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPN------  218
             + N YG TE +   T +  E        K  S +PIG P+ +  + +L D + N      
Sbjct  3864  VFNNYGPTENTVVTTSYKLE--------KQFSNIPIGKPIYNTSIYIL-DKEKNILPIGV  3914

Query  219   EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNF  398
              GEI +SG  L+ GY   P        EL+      S     +  ++TGD  +   NGN 
Sbjct  3915  VGEIYISGDGLARGYLNKP--------ELTAESFVPSPFEEGKLMYKTGDLGKWNANGNI  3966

Query  399   IFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNE  578
              FLGR D  VKI G RI L E+E  + E   V DA V+ +        L A+ + K+N +
Sbjct  3967  EFLGRVDSQVKIRGLRIELGEIETSIIESAAVKDAVVLLKEKTDGDKYLYAYFVPKDNFD  4026

Query  579   HVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + S+  ++  +LP  MIP  F   E  P++++GKVD   L
Sbjct  4027  ----IDSLRVYLIERLPEYMIPTAFVEIEEIPLTANGKVDKKAL  4066


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/230 (29%), Positives = 110/230 (48%), Gaps = 23/230 (10%)
 Frame = +3

Query  36    KILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP  215
             K  PQ    NLYG TE +   T +D      + + +    VPIG P+Q+    +L     
Sbjct  2828  KRYPQVGFKNLYGPTEATIYTTAYD------LGDFEEGINVPIGKPVQNMKTYVLDKRYK  2881

Query  216   NE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARK  380
              +     GE+ + G+ ++ GY   P    L+Y +   N  +       ++ ++TGD  + 
Sbjct  2882  IQPVGVPGELYIGGIGVAKGYLNRPD---LNYEKFIDNPFAPG-----EKIYKTGDLVKW  2933

Query  381   LQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLI  560
             L +GN  FLGR D  VKI G RI L E+E+++R +P + +A V+   D      L A+ I
Sbjct  2934  LPDGNIEFLGRLDYQVKIRGFRIELGEIESLIRNYPSIQEAIVLAVGDDLKEKYLCAYYI  2993

Query  561   MKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               E       L  +  ++ + +P  MIP  +   +  P++++GK+D   L
Sbjct  2994  SDEELN----LSELKTYLGKNIPEYMIPKHYIKLDKMPLNNNGKIDRKAL  3039


 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 65/234 (28%), Positives = 106/234 (45%), Gaps = 32/234 (14%)
 Frame = +3

Query  33   VKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD  212
            +KI+  + I N+YG TE +            LI E      + IG P+ +  + +L   D
Sbjct  747  LKIITPSKIFNMYGPTETT---------VWSLIKELTFEKEITIGTPISNTRIYIL---D  794

Query  213  PNE--------GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
             NE        GE+C++G  L+ GY   P +    +++ + + DS          ++TGD
Sbjct  795  KNEKLCHLGVYGELCIAGDGLARGYLNKPELTSEKFIKSNLDPDS--------LIYKTGD  846

Query  369  FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
             AR L+NG   F+GR D  VKI G+RI L ++EN L +   + +AA     D      + 
Sbjct  847  VARWLENGEIEFIGRVDHQVKIRGYRIELGDIENNLLKIDGIKEAAARVFEDSNSNKYIC  906

Query  549  AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             +       E    + +I   + ++LP  M+P      E  P++ + KVD   L
Sbjct  907  GYY----TGEQELSISNIKEQLLKELPEYMVPSFIVRLEKLPLTPNKKVDRKAL  956



>ref|WP_003340234.1| gramicidin synthetase [Brevibacillus laterosporus]
 emb|CCF13226.1| amino acid adenylation domain protein [Brevibacillus laterosporus 
GI-9]
Length=2587

 Score =   120 bits (302),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 114/231 (49%), Gaps = 23/231 (10%)
 Frame = +3

Query  36    KILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP  215
             K+ P   + N YG +E S D T    + LP          VPIG PL +  V ++ D+  
Sbjct  1825  KLFPHIPLANAYGPSEASDDVTIHIIDQLP------QSEIVPIGKPLHNFKVYIV-DEKM  1877

Query  216   N------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFAR  377
             N      +GEICVSG+ +  GY   P      ++      D    DH+  + ++TGD  R
Sbjct  1878  NLCPVGIKGEICVSGIGVGRGYLHDPERTAKVFM------DDPFADHKGVRLYKTGDMGR  1931

Query  378   KLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHL  557
              L +G   F GRKD  VKI G RI LEE+EN +  HP + +  V+   D R    L A++
Sbjct  1932  WLSDGTLEFFGRKDYQVKIRGFRIELEEIENQINNHPNILETVVMDIEDARGQKSLCAYV  1991

Query  558   IMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             ++K++      +  + + +A  LP  MIP  F   E  P++++GKVD   L
Sbjct  1992  VLKQDVP----INQLKSHLANTLPDYMIPAFFVKMEKLPLTANGKVDRKAL  2038


 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 110/223 (49%), Gaps = 18/223 (8%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGD-----DDPNE  221
            ++N+YG  E +   T      +P      +LS +PIG P+ +  V +L            
Sbjct  763  LINVYGPAECTTFTTTHHVTQVPA----DALS-IPIGKPIANTQVYVLDQYLQIVPIGVP  817

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            GE+ V G  L+ GY   P +    ++   +N  S +   R+   ++TGD  R L +G   
Sbjct  818  GELYVGGPGLALGYLHRPEITNERFI---KNIFSPNATDRL---YKTGDIVRYLPDGTLS  871

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
            ++GR+D  VKI G RI L E+E VL +HPE+ DA VI R D+     L A+      N+ 
Sbjct  872  YIGRQDDQVKIRGFRIELGEIEAVLGQHPEIRDAVVIMREDQNSNKQLIAYFTTY--NQE  929

Query  582  VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            +     + ++  +KLP  MIP  F + +  P++ +GKVD   L
Sbjct  930  ILSASELRSYAEKKLPVHMIPAAFIYLDHVPVTPNGKVDRKAL  972



>ref|WP_022586906.1| gramicidin synthetase [Brevibacillus laterosporus]
 gb|ERM16001.1| gramicidin synthetase [Brevibacillus laterosporus PE36]
Length=2587

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 114/231 (49%), Gaps = 23/231 (10%)
 Frame = +3

Query  36    KILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP  215
             K+ P   + N YG +E S D T    + LP          VPIG PL +  V ++ D+  
Sbjct  1825  KLFPHIPLANAYGPSEASDDVTIHIIDQLP------QSEIVPIGKPLHNFKVYIV-DEKM  1877

Query  216   N------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFAR  377
             N      +GEICVSG+ +  GY   P      ++      D    DH+  + ++TGD  R
Sbjct  1878  NLCPVGIKGEICVSGIGVGRGYLHDPERTAKVFM------DDPFADHKGVRLYKTGDMGR  1931

Query  378   KLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHL  557
              L +G   F GRKD  VKI G RI LEE+EN +  HP + +  V+   D R    L A++
Sbjct  1932  WLSDGTLEFFGRKDYQVKIRGFRIELEEIENQINNHPNILETVVMDIEDARGQKSLCAYV  1991

Query  558   IMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             ++K++      +  + + +A  LP  MIP  F   E  P++++GKVD   L
Sbjct  1992  VLKQDVP----INQLKSHLANTLPDYMIPAFFVKMEKLPLTANGKVDRKAL  2038


 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 71/223 (32%), Positives = 109/223 (49%), Gaps = 18/223 (8%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGD-----DDPNE  221
            ++N+YG  E +   T      +P      +LS +PIG P+ +  V +L            
Sbjct  763  LINVYGPAECTTFTTTHHVTQVPA----DALS-IPIGKPIANTQVYVLDQYLQIVPIGVP  817

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            GE+ V G  L+ GY   P +    ++   +N  S +   R+   ++TGD  R L +G   
Sbjct  818  GELYVGGPGLALGYLHRPEITNERFI---KNIFSPNATDRL---YKTGDIVRYLPDGTLS  871

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
            ++GRKD  VKI G RI L E+E VL +HPE+ DA VI R D+     L A+      N+ 
Sbjct  872  YIGRKDDQVKIRGFRIELGEIEAVLGQHPEIRDAVVIMREDQNSNKQLIAYFTTY--NQE  929

Query  582  VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            +     + ++   KLP  MIP  F + +  P++ +GKVD   L
Sbjct  930  ILSASELRSYAEMKLPVHMIPAAFIYLDHVPVTPNGKVDRKAL  972



>ref|WP_039275992.1| bacitracin synthetase [Paenibacillus polymyxa]
 gb|AIY11550.1| bacitracin synthetase [Paenibacillus polymyxa]
Length=14084

 Score =   121 bits (303),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 127/240 (53%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDC+        +  + +PIG P+Q+  
Sbjct  5398  HVARFQRLVSSLTGAKLINLYGPTEATVDVSYFDCDP------DEEYTVIPIGKPIQNIR  5451

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +VE +     K+   R+  
Sbjct  5452  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVE-NPFAGGKAGYERM--  5508

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE+ L +   V +A V+ R D++
Sbjct  5509  -YRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVESQLLQVESVREAVVVARTDEK  5567

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               + + A+ +  +  E  E LRS    + R+LP  M+P  F   E  P + +GK+D   L
Sbjct  5568  GQNHMVAYYVAGQVVEASE-LRS---ELGRELPGYMVPSYFVQLEQLPQTPNGKIDRKAL  5623


 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/240 (31%), Positives = 122/240 (51%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  8477  HVARFQRLVSSLAGAKLVNLYGPTEATVDVSYFDCEP------SEEYAVIPIGKPIQNIR  8530

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V+          +   ++
Sbjct  8531  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVK----DPFAGGEAGYER  8586

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+ 
Sbjct  8587  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVETQLLQVESVREAIVMARADET  8646

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E LRS    + ++LP  M+P  F   E  P+S +GK+D   L
Sbjct  8647  GQKHMVAYYVAGQEISASE-LRS---ELGQELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  8702


 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 110/232 (47%), Gaps = 39/232 (17%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
              I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  10732  IINSYGVTEAAIDSSFYDEELSKLP------SSGHVPIGQAWLNARFYIV-DSQLNPVPI  10784

Query  222    ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                 GE+C+ G+ ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  10785  GVLGELCIGGIGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  10836

Query  393    NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL------EAH  554
              N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L      EA 
Sbjct  10837  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQAVVIDRMDERGHKYLCGYITGEAE  10896

Query  555    LIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              L M+E    +E            LP  M+P R    E+ P++S+GK+D   L
Sbjct  10897  LRMEEVQTELEA----------GLPAHMVPARLMRLETIPLTSNGKIDRKAL  10938


 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 109/232 (47%), Gaps = 39/232 (17%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             ++N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  2332  MINSYGVTEAAIDSSFYDEELSKLP------SSGHVPIGQAWLNARFYIV-DSQLNPVPI  2384

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  2385  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  2436

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL------EAH  554
             N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L      EA 
Sbjct  2437  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQAVVIDRTDERGNKYLCGYITGEAE  2496

Query  555   LIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             L M+E    +E            LP  M+P R    E+ P++S+GK+D   L
Sbjct  2497  LRMEEVQTELEA----------GLPAHMVPTRLMRLETIPLTSNGKIDRKAL  2538


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 110/223 (49%), Gaps = 22/223 (10%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN--E  221
             I N+YG TE +   T         + E      + IG P+ +  + ++   G+  P    
Sbjct  3863  IYNMYGPTETTVWST---------VQELTHAQQINIGRPIANTQIFIMNANGELQPVGVP  3913

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+C++G  L+ GY+    +    +V  +        DH  ++ +RTGD AR + +GN  
Sbjct  3914  GELCIAGEGLARGYWKREELTAEKFV--NNPFAGDKADH--ERMYRTGDLARWMPDGNIE  3969

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             +LGR D  VKI G+RI L E+E+ L +   V +A ++ R D+   + L A+ +  +    
Sbjct  3970  YLGRMDHQVKIRGYRIELGEIESQLLQMESVQEAVIMARTDETGQTQLVAYYVASQELGA  4029

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              E+ +     + ++LP  M+P  F + E  P++ +GK+D   L
Sbjct  4030  NELRQE----LGQELPSYMVPSYFIWLEQMPLTPNGKIDRKAL  4068


 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/231 (32%), Positives = 110/231 (48%), Gaps = 20/231 (9%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYF---DCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP----  215
              I N+YG TE + D T +   D ESL ++LE K    V IG P+ +  V +L         
Sbjct  13317  ITNVYGPTEATVDATAYTIEDVESLNVLLE-KGEHTVSIGTPIANQAVYILNTRQQLVPM  13375

Query  216    -NEGEICVSGLCLSAGYFCYPSV-----LPLDYVELSQNHDSKSTDHRVQQYFRTGDFAR  377
                 GE+ + G  ++ GY   P +     +P  + E +    + ST     + +RTGD AR
Sbjct  13376  GIAGELYIGGAGIARGYLNLPELTAEKFVPNPFAEATAADPADST--YANRMYRTGDLAR  13433

Query  378    KLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHL  557
               L +G+  +LGR D  VKI G+RI L EVE  L     +  A V    ++     L A++
Sbjct  13434  WLPDGSIEYLGRIDHQVKIRGYRIELGEVEAQLLTVDGIQKAVVTAWENEDGHKDLCAYI  13493

Query  558    IMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              +  E+      L  + N +  KLP  MIP      + FP++ +GK+D   L
Sbjct  13494  VASESLS----LPELRNALQPKLPDYMIPTYVVQLDRFPLTPNGKIDRKAL  13540


 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 68/220 (31%), Positives = 110/220 (50%), Gaps = 23/220 (10%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN--E  221
            I N+YG TE +   T         + E      + IG P+ +  + +L   G+  P    
Sbjct  743  IYNMYGPTETTVWST---------VQELTHAQEINIGRPIANTQIYILNTSGELQPVGIP  793

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            GE+C++G  L+ GY+    +    +VE +     K+   R+   +RTGD AR   +GN  
Sbjct  794  GELCIAGEGLARGYWNREDLTAEKFVE-NPFAGGKAGYERM---YRTGDLARWTLDGNIE  849

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK-RDTSLLEAHLIMKENNE  578
            +LGR D  VKI G+RI L E+E+ L +   V +A V+ R+D+      + A+ +  +  E
Sbjct  850  YLGRMDHQVKIRGYRIELGEIESQLLQVESVREATVVARSDETTGQKQMIAYYVANQAME  909

Query  579  HVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              E LRS    + ++LP  M+P  F   E  P++ +GK+D
Sbjct  910  ASE-LRS---ELGQELPSYMVPSYFIQLEQMPLTPNGKID  945


 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 117/234 (50%), Gaps = 18/234 (8%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
             +++ K   Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V ++ 
Sbjct  6920  ELVYKWKDQVAYYNGYGPTENSVATSIW-----PVSEDERAGQLISIGRPVPNHRVYMVD  6974

Query  201   --GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
               G   P    GE+ VSG  L+ GY   P +    +V     +   + +   ++ +RTGD
Sbjct  6975  VHGHLAPVGVAGELYVSGPGLARGYLDRPELTAEKFV----ANPFAAGEAGYERMYRTGD  7030

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
              AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  + L 
Sbjct  7031  LARWMPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQNQLV  7090

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ + + +    E LRS   ++  +LP  M+P  F   E  P++ +GK+D   L
Sbjct  7091  AYYVAERDVSAGE-LRS---FLGEELPNYMVPSYFIQLEQMPLTPNGKIDRKAL  7140


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 106/229 (46%), Gaps = 28/229 (12%)
 Frame = +3

Query  45     PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
              P   I N+YG TE     T F      + ++ +S   VPIG P+ +    ++      + 
Sbjct  12244  PSLRISNIYGPTE----NTTFSTVHAIIGVQSES---VPIGRPIHNSTAYVVDHSMRLQP  12296

Query  222    ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                  GE+ V G  ++ GY   P +    +++        S     ++ +RTGD  R   +
Sbjct  12297  VGVWGELWVGGDGVARGYRNRPDLTSEKFID--------SPFRSGERCYRTGDMVRLNAD  12348

Query  390    GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
              G   + GR D  VKI G+RI L EVE  L +   V +A VI R D++    L A+++   
Sbjct  12349  GTLEYKGRIDAQVKIRGYRIELGEVETQLLKLEAVQEAVVIAREDEQGQKQLCAYVVA--  12406

Query  570    NNEHV--EILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               NE V   +LRS  N   +KLP  MIP      E  P++ +GK+D   L
Sbjct  12407  -NEEVVASVLRSTLN---QKLPGYMIPSYLVQLEQMPLTPNGKIDRKAL  12451


 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 106/227 (47%), Gaps = 29/227 (13%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  9626  IMNSYGVTEAAIDSSFYDEELSKLP------SSGHVPIGQAWLNARFYIV-DSQLNPVPI  9678

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  9679  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  9730

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVI-FRNDKRDTSLLEAHLIMKE  569
             N  F+GR D  VKI G RI L EVE  L     +  A V  + N+  D  L  A+++  E
Sbjct  9731  NVDFIGRMDDQVKIRGFRIELGEVEAQLLTVDGIEKAIVTAWENENGDKDLC-AYVVASE  9789

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                  E LRS    +  KLP  MIP      + FP++ +GK+D   L
Sbjct  9790  ALNLPE-LRST---LQPKLPSYMIPTYVVPLDQFPLTPNGKIDRKAL  9832



>ref|WP_036812040.1| hypothetical protein, partial [Photorhabdus luminescens]
Length=6135

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 125/238 (53%), Gaps = 23/238 (10%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
             ++LW+ L    P + I+N YG TE    CT FD   L      + +  VPIG P+ +  +
Sbjct  3703  VALWRTLS---PGSRIINEYGPTETVVGCTVFDTHHL-----SRFVDNVPIGRPISNTQI  3754

Query  192   LLL---GDDDP--NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
              +L   G+  P    GE+ + G+ ++ GY   P +    ++    +  S   D R+   +
Sbjct  3755  YILDTRGEPAPIGVTGELYIGGIAVARGYLNRPELTAERFLP---DPFSNRPDARM---Y  3808

Query  357   RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
             RTGD  R L NGN IF+GR D+ VKI G RI   E+E  L EHPEV  A V+  +D +D 
Sbjct  3809  RTGDLVRYLPNGNLIFVGRNDQQVKIRGFRIEPGEIEARLTEHPEVRGALVLALDDGQDK  3868

Query  537   SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              L+ A++  + N+E V  LR+    ++  LP  M+P  F   ++FP+  +GK+D   L
Sbjct  3869  RLV-AYVEAQANDELVNSLRT---HLSALLPGYMVPTAFVRLDAFPLLPNGKLDRRAL  3922


 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 118/224 (53%), Gaps = 23/224 (10%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPNE--  221
             +LN YG TE +   TY D  SL    + +S     IG P ++  + LL   G+  P    
Sbjct  2640  LLNGYGPTENTVTVTYKDVLSLD---DARS-----IGRPAKNARIYLLDRYGELVPAGCV  2691

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+ + G+ ++ GY   P+   L       +  S+ +  R+   +R+GD AR L +G+  
Sbjct  2692  GEMYIGGVGVARGYLNRPA---LSVERFMPDPFSRLSGERM---YRSGDLARYLPDGDLE  2745

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             FLGR D  VKI G RI L E+E  L EHP V +AAV+  +D ++  L+ A++  + ++E 
Sbjct  2746  FLGRNDEQVKIRGFRIELGEIETRLAEHPAVQEAAVLALDDGQEKRLV-AYVAAQADDEL  2804

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
             V  LR   + I   LP  MIP  F   ++FP + +GK+D   L+
Sbjct  2805  VNSLRIHLSAI---LPDYMIPAAFVRLDTFPQTPNGKLDRRALS  2845


 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 114/221 (52%), Gaps = 22/221 (10%)
 Frame = +3

Query  63   NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPL-QSCDVLLLGDDDPNE----GE  227
            NLYG +E +    +   +    I+E        IG P+  +C  LL     P      GE
Sbjct  501  NLYGPSETTTYSAWLPIQRGDRIIES-------IGRPIANTCLYLLDAYGQPVPLGVVGE  553

Query  228  ICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFIFL  407
            I + G  ++ GYF  P +    ++    +  S   D R+   +RTGD AR L +GN  FL
Sbjct  554  IYIGGAGVARGYFNRPDLTAERFL---IDPFSDVPDARI---YRTGDLARYLPDGNLEFL  607

Query  408  GRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVE  587
            GR D+ VKI G RI   E+E+ L EHP V+++ V+ + D ++  L+ A+++      H  
Sbjct  608  GRNDQQVKIRGFRIEPGEIESRLVEHPAVSESVVLAQGDGQEKRLV-AYVVAA---AHEG  663

Query  588  ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            ++ S+  +++ +LP  M+P  F   ++FP++ +GK+D   L
Sbjct  664  LINSLREYLSIQLPDYMVPSAFVRLDAFPLTPNGKLDRQAL  704


 Score = 90.9 bits (224),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 110/239 (46%), Gaps = 37/239 (15%)
 Frame = +3

Query  30    LVKILPQTAILNLYGSTE--VSGDCTYF-----DCESLPLILEHKSLSGVPIGLPLQSCD  188
              V+ L +  +LN YG TE  V+  C        DC                IG PL++  
Sbjct  4768  FVRELHRPRLLNAYGPTENTVTATCKEVLSPTDDCS---------------IGRPLKNTC  4812

Query  189   VLLL---GDDDP--NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
             V LL   G   P    GE+ + G+ ++ GY   P +    ++      D  S+    + Y
Sbjct  4813  VYLLDKYGQLVPLGGVGEMYIGGVGVARGYLNQPELSAERFIP-----DPFSSVSGARMY  4867

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
               TGD AR L +GN  FLGR D  VKI G RI L E+E  L EHP V +AAV+   D++ 
Sbjct  4868  V-TGDLARYLPDGNLEFLGRNDHQVKIRGFRIELGEIETRLEEHPAVQEAAVLVWEDEQS  4926

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L+    +  E NE + +   +   ++  LP  M+P  F   ++ P + +GK+D   L
Sbjct  4927  KRLVA--YVAAEANEGLAV--RLREHLSAVLPDYMVPAAFVRLDTLPQTPNGKLDRRAL  4981


 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/221 (30%), Positives = 112/221 (51%), Gaps = 22/221 (10%)
 Frame = +3

Query  63    NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDP--NEGE  227
             NLYG +E +    +   +    I+E        IG P+ +  + LL   G   P    GE
Sbjct  5845  NLYGPSETTTYSAWLPIQRGDRIIES-------IGRPIANTRLYLLDEYGQPAPLGVVGE  5897

Query  228   ICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFIFL  407
             I + G  ++ GY   P +    ++    +  S   D R+   +RTGD AR L +GN  FL
Sbjct  5898  IYIGGAGVARGYLNRPDLTAERFL---IDPFSDMPDARM---YRTGDLARYLPDGNLEFL  5951

Query  408   GRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVE  587
             GR D+ VKI G RI   E+E+ L EHP V+++ V+ + + ++  L+ A+++ + +   + 
Sbjct  5952  GRNDQQVKIRGFRIEPGEIESRLVEHPAVSESVVLAQGEGQEKRLV-AYVVAEADEGLIN  6010

Query  588   ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              LR     ++ +LP  M+P  F   ++ P++ +GK+D   L
Sbjct  6011  RLR---EHLSIQLPDYMVPSAFVRLDALPLTPNGKLDRQAL  6048


 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/223 (30%), Positives = 111/223 (50%), Gaps = 20/223 (9%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDP--NE  221
             ++N+YG TE +   TY +    P  +E  +    PIG  +    + LL   G   P    
Sbjct  1559  LVNMYGITETTVHVTYRELN--PHDVEQIT---SPIGTRIPDLTLYLLDKYGQPVPLGVT  1613

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+ V G  ++ GY   P +    ++          +D    + +RTGD AR L  G+ +
Sbjct  1614  GELYVGGGGVARGYLNRPELTAERFLL------DPFSDQPGARMYRTGDLARYLPEGDLV  1667

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             F+GR D+ VKI G RI   E+E  L EHP V+++ V+    ++D  L+ A+++   +   
Sbjct  1668  FVGRNDQQVKIRGFRIEPGEIEARLVEHPAVSESVVLALGQEQDKRLV-AYVVAPADEGL  1726

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                LR+   +++  LP  M+P  F   ++FP++ +GK+D   L
Sbjct  1727  ANSLRT---YLSAILPDYMVPSAFVRLDAFPLTPNGKLDRRAL  1766



>ref|WP_014599760.1| bacitracin synthetase [Paenibacillus polymyxa]
 ref|YP_005960016.1| non-ribosomal peptide synthetase FusAA [Paenibacillus polymyxa 
M1]
 emb|CCC85309.1| non-ribosomal peptide synthetase FusAA [Paenibacillus polymyxa 
M1]
Length=14218

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 127/240 (53%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDC+        +  + +PIG P+Q+  
Sbjct  5533  HVARFQRLVSSLTGAKLINLYGPTEATVDVSYFDCDP------DEEYTVIPIGKPIQNIR  5586

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +VE +     K+   R+  
Sbjct  5587  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVE-NPFAGGKAGYERM--  5643

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE+ L +   V +A V+ R D++
Sbjct  5644  -YRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVESQLLQVESVREAVVVARTDEK  5702

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               + + A+ +  +  E  E LRS    + R+LP  M+P  F   E  P + +GK+D   L
Sbjct  5703  GQNHMVAYYVAGQVVEASE-LRS---ELGRELPGYMVPSYFVQLEQLPQTPNGKIDRKAL  5758


 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/240 (31%), Positives = 122/240 (51%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  8612  HVARFQRLVSSLAGAKLVNLYGPTEATVDVSYFDCEP------SEEYAVIPIGKPIQNIR  8665

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V+          +   ++
Sbjct  8666  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVK----DPFAGGEAGYER  8721

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+ 
Sbjct  8722  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVETQLLQVESVREAIVMARADET  8781

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E LRS    + ++LP  M+P  F   E  P+S +GK+D   L
Sbjct  8782  GQKHMVAYYVAGQEISASE-LRS---ELGQELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  8837


 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 110/232 (47%), Gaps = 39/232 (17%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
              I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  10867  IINSYGVTEAAIDSSFYDEELSKLP------SSGHVPIGQAWLNARFYIV-DSQLNPVPI  10919

Query  222    ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                 GE+C+ G+ ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  10920  GVLGELCIGGIGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  10971

Query  393    NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL------EAH  554
              N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L      EA 
Sbjct  10972  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQAVVIDRMDERGHKYLCGYITGEAE  11031

Query  555    LIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              L M+E    +E            LP  M+P R    E+ P++S+GK+D   L
Sbjct  11032  LRMEEVQTELEA----------GLPAHMVPARLMRLETIPLTSNGKIDRKAL  11073


 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 109/232 (47%), Gaps = 39/232 (17%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             ++N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  2467  MINSYGVTEAAIDSSFYDEELSKLP------SSGHVPIGQAWLNARFYIV-DSQLNPVPI  2519

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  2520  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  2571

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL------EAH  554
             N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L      EA 
Sbjct  2572  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQAVVIDRTDERGNKYLCGYITGEAE  2631

Query  555   LIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             L M+E    +E            LP  M+P R    E+ P++S+GK+D   L
Sbjct  2632  LRMEEVQTELEA----------GLPAHMVPTRLMRLETIPLTSNGKIDRKAL  2673


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 110/223 (49%), Gaps = 22/223 (10%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN--E  221
             I N+YG TE +   T         + E      + IG P+ +  + ++   G+  P    
Sbjct  3998  IYNMYGPTETTVWST---------VQELTHAQQINIGRPIANTQIFIMNANGELQPVGVP  4048

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+C++G  L+ GY+    +    +V  +        DH  ++ +RTGD AR + +GN  
Sbjct  4049  GELCIAGEGLARGYWKREELTAEKFV--NNPFAGDKADH--ERMYRTGDLARWMPDGNIE  4104

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             +LGR D  VKI G+RI L E+E+ L +   V +A ++ R D+   + L A+ +  +    
Sbjct  4105  YLGRMDHQVKIRGYRIELGEIESQLLQMESVQEAVIMARTDETGQTQLVAYYVASQELGA  4164

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              E+ +     + ++LP  M+P  F + E  P++ +GK+D   L
Sbjct  4165  NELRQE----LGQELPSYMVPSYFIWLEQMPLTPNGKIDRKAL  4203


 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 111/231 (48%), Gaps = 20/231 (9%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYF---DCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP----  215
              I N+YG TE + D T +   D ESL ++LE K    V IG P+ +  V +L +       
Sbjct  13451  ITNVYGPTETTVDATAYTIEDVESLHVLLE-KGEHTVSIGTPIANQAVYILNNQQQLVPI  13509

Query  216    -NEGEICVSGLCLSAGYFCYPSV-----LPLDYVELSQNHDSKSTDHRVQQYFRTGDFAR  377
                 GE+ + G  ++ GY   P +     +P  + + +    + ST     + +RTGD AR
Sbjct  13510  GIAGELYIGGAGIARGYLNLPELTAEKFIPNPFGDATAADPADST--FANRMYRTGDLAR  13567

Query  378    KLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHL  557
               L +G+  +LGR D  VKI G+RI L EVE  L     +  A V    ++     L A++
Sbjct  13568  WLPDGSIEYLGRIDHQVKIRGYRIELGEVEAQLLTVDGIQKAVVTAWENEDGHKDLCAYI  13627

Query  558    IMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              +  E+      L  + N +  KLP  MIP      + FP++ +GK+D   L
Sbjct  13628  VASESLS----LPELRNALQPKLPDYMIPTYVVQLDRFPLTPNGKIDRKAL  13674


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 102/219 (47%), Gaps = 21/219 (10%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN--E  221
             I N+YG TE +   T         + E      + IG P+ +  + ++   G+  P    
Sbjct  878   IYNMYGPTETTVWST---------VQELTHAQEINIGRPIANTQIYIINASGELQPVGVP  928

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+C++G  L+ GY+    +    +V    N+         ++ +RTGD AR   +GN  
Sbjct  929   GELCIAGEGLARGYWNLEDLTAEKFV----NNPFAGDKAGYERMYRTGDLARWTLDGNIE  984

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             +LGR D  VKI G+RI L E+E+ L +   V +A+V+ R D+           +      
Sbjct  985   YLGRMDHQVKIRGYRIELGEIESQLLQVESVREASVVARVDETTGQKQMVAYYVASQAME  1044

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                LRS    + R+LP  M+P  F   E  P++ +GK+D
Sbjct  1045  ASKLRS---ELGRELPSYMVPSYFIQLEQMPLTPNGKID  1080


 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 117/234 (50%), Gaps = 18/234 (8%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
             +++ K   Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V ++ 
Sbjct  7055  ELVYKWKDQVAYYNGYGPTENSVATSIW-----PVSEDERAGQLISIGRPVPNHRVYMVD  7109

Query  201   --GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
               G   P    GE+ VSG  L+ GY   P +    +V     +   + +   ++ +RTGD
Sbjct  7110  VHGHLAPVGVAGELYVSGPGLARGYLDRPELTAEKFV----ANPFAAGEAGYERMYRTGD  7165

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
              AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  + L 
Sbjct  7166  LARWMPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQNQLV  7225

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ + + +    E LRS   ++  +LP  M+P  F   E  P++ +GK+D   L
Sbjct  7226  AYYVAERDVSAGE-LRS---FLGEELPNYMVPSYFIQLEQMPLTPNGKIDRKAL  7275


 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 105/227 (46%), Gaps = 24/227 (11%)
 Frame = +3

Query  45     PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
              P   I N+YG TE   + T+    ++  +        VPIG P+ +    ++      + 
Sbjct  12378  PSLRISNIYGPTE---NTTFSTVHAITGVQSES----VPIGRPIHNSTAYVVDRSMRLQP  12430

Query  222    ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                  GE+ V G  ++ GY   P +    +++        S     ++ +RTGD  R   +
Sbjct  12431  VGVWGELLVGGDGVARGYRNRPDLTSEKFID--------SPFRSGERCYRTGDMVRLNAD  12482

Query  390    GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
              G+  + GR D  VKI G+RI L EVE  L +   V +A VI R D++    L A+++  E
Sbjct  12483  GSLEYKGRIDAQVKIRGYRIELGEVETQLLKLEAVREAVVIAREDEQGQKQLCAYVVADE  12542

Query  570    NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                   E LRS    +++KLP  MIP      E  P++ +GK+D   L
Sbjct  12543  EVVASE-LRSA---LSQKLPGYMIPSYVIQLEQMPLTPNGKIDRKAL  12585


 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 106/227 (47%), Gaps = 29/227 (13%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  9761  IMNSYGVTEAAIDSSFYDEELSKLP------SSGHVPIGQAWLNARFYIV-DSQLNPVPI  9813

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  9814  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  9865

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVI-FRNDKRDTSLLEAHLIMKE  569
             N  F+GR D  VKI G RI L EVE  L     +  A V  + N+  D  L  A+++  E
Sbjct  9866  NVDFIGRMDDQVKIRGFRIELGEVEAQLLTVDGIEKAIVTAWENENGDKDLC-AYVVASE  9924

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                  E LRS    +  KLP  MIP      + FP++ +GK+D   L
Sbjct  9925  ALNLPE-LRST---LQPKLPSYMIPTYVVPLDQFPLTPNGKIDRKAL  9967



>ref|WP_015217386.1| amino acid adenylation domain protein [Anabaena cylindrica]
 ref|YP_007159684.1| amino acid adenylation domain protein [Anabaena cylindrica PCC 
7122]
 gb|AFZ60774.1| amino acid adenylation domain protein [Anabaena cylindrica PCC 
7122]
Length=2671

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 116/220 (53%), Gaps = 22/220 (10%)
 Frame = +3

Query  63    NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-GDDDPNE----GE  227
             NLYG TE + D T++ C+       H  L  VPIG P+ +  + +L G   P      GE
Sbjct  1892  NLYGPTEAAIDVTFWQCQP------HSQLPFVPIGRPISNTQIYILDGQGKPTPVGVPGE  1945

Query  228   ICVSGLCLSAGYFCYPSVLPLDYVE--LSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             + + G+ L+ GY   P +    ++    SQ  DS+         ++TGD AR L NG+  
Sbjct  1946  LHIGGVGLARGYLNRPDLTNEKFIPHPFSQELDSR--------LYKTGDLARYLSNGDIE  1997

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK-ENNE  578
             +LGR D  VK+ G RI L E+E+VL +HP+V +  V+ R D      L  ++I   E+++
Sbjct  1998  YLGRVDYQVKLRGFRIELGEIESVLSQHPDVREVVVLAREDLPGEKRLVGYVIRNGEDHK  2057

Query  579   HVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                 L  + +++  KLP  M+P  F   ++ P++++GKVD
Sbjct  2058  TGYFLGELRSFLKEKLPDYMVPSAFVILDALPLTANGKVD  2097


 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/225 (31%), Positives = 112/225 (50%), Gaps = 22/225 (10%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP-----NE  221
             ++N+YG TE +   TY      PL +   + +   IG P+    + LL            
Sbjct  826   LVNMYGITETTVHVTY-----RPLTMVDLNNTASVIGRPIPDLQIYLLDQHFQLVPVGVP  880

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVE--LSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
             GEI V G  ++ GY   P +    ++    SQ  DS+         ++TGD AR L NG+
Sbjct  881   GEIYVGGAGVTRGYLNRPDLTKEKFIPHPFSQKLDSR--------LYKTGDLARYLSNGD  932

Query  396   FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
               +LGR D  VK+ G RI L E+E+VL +HP++ +  VI  +D+ D   L A+L+ +   
Sbjct  933   IEYLGRVDYQVKLRGFRIELGEIESVLSQHPDIREVVVIVHSDQADFQRLVAYLVPRSKQ  992

Query  576   EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             +    +  +  ++  +LP  MIP  FF  E+ P++ +GKV+   L
Sbjct  993   DLA--ISELRQFLELQLPDYMIPNVFFTLEALPLTPNGKVNRKAL  1035



>ref|WP_013371211.1| bacitracin synthetase [Paenibacillus polymyxa]
 ref|YP_003946848.1| bacillorin synthetase b [Paenibacillus polymyxa SC2]
 gb|ADO56607.1| Bacillorin synthetase B [Paenibacillus polymyxa SC2]
Length=14083

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 127/240 (53%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDC+        +  + +PIG P+Q+  
Sbjct  5398  HVARFQRLVSSLTGAKLINLYGPTEATVDVSYFDCDP------DEEYTVIPIGKPIQNIR  5451

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +VE +     K+   R+  
Sbjct  5452  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVE-NPFAGGKAGYERM--  5508

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE+ L +   V +A V+ R D++
Sbjct  5509  -YRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVESQLLQVESVREAVVVARTDEK  5567

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               + + A+ +  +  E  E LRS    + R+LP  M+P  F   E  P + +GK+D   L
Sbjct  5568  GQNHMVAYYVAGQVVEASE-LRS---ELGRELPGYMVPSYFVQLEQLPQTPNGKIDRKAL  5623


 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/240 (31%), Positives = 122/240 (51%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  8477  HVARFQRLVSSLAGAKLVNLYGPTEATVDVSYFDCEP------SEEYAVIPIGKPIQNIR  8530

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V+          +   ++
Sbjct  8531  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVK----DPFAGGEAGYER  8586

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+ 
Sbjct  8587  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVETQLLQVESVREAIVMARADET  8646

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E LRS    + ++LP  M+P  F   E  P+S +GK+D   L
Sbjct  8647  GQKHMVAYYVAGQEISASE-LRS---ELGQELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  8702


 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 109/232 (47%), Gaps = 39/232 (17%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             ++N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  2332  MINSYGVTEAAIDSSFYDEELSKLP------SSGHVPIGQAWLNARFYIV-DSQLNPVPI  2384

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  2385  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  2436

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL------EAH  554
             N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L      EA 
Sbjct  2437  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQAVVIDRTDERGNKYLCGYITGEAE  2496

Query  555   LIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             L M+E    +E            LP  M+P R    E+ P++S+GK+D   L
Sbjct  2497  LRMEEVQTELEA----------GLPAHMVPTRLMRLETIPLTSNGKIDRKAL  2538


 Score = 96.7 bits (239),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 109/232 (47%), Gaps = 39/232 (17%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
              I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  10732  IMNSYGVTEAAIDSSFYDEELSKLP------SSGHVPIGQAWLNARFYIV-DSQLNPVPI  10784

Query  222    ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                 GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  10785  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  10836

Query  393    NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL------EAH  554
              N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L      EA 
Sbjct  10837  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQAVVIDRMDERGHKYLCGYITGEAE  10896

Query  555    LIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              L M+E    +E            LP  M+P R    E+ P++S+GK+D   L
Sbjct  10897  LRMEEVQTELEA----------GLPAHMVPARLMRLETIPLTSNGKIDRKAL  10938


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 110/223 (49%), Gaps = 22/223 (10%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN--E  221
             I N+YG TE +   T         + E      + IG P+ +  + ++   G+  P    
Sbjct  3863  IYNMYGPTETTVWST---------VQELTHAQQINIGRPIANTQIFIMNANGELQPVGVP  3913

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+C++G  L+ GY+    +    +V  +        DH  ++ +RTGD AR + +GN  
Sbjct  3914  GELCIAGEGLARGYWKREELTAEKFV--NNPFAGDKADH--ERMYRTGDLARWMPDGNIE  3969

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             +LGR D  VKI G+RI L E+E+ L +   V +A ++ R D+   + L A+ +  +    
Sbjct  3970  YLGRMDHQVKIRGYRIELGEIESQLLQMESVQEAVIMARTDETGQTQLVAYYVASQELGA  4029

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              E+ +     + ++LP  M+P  F + E  P++ +GK+D   L
Sbjct  4030  NELRQE----LGQELPSYMVPSYFIWLEQMPLTPNGKIDRKAL  4068


 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 111/231 (48%), Gaps = 20/231 (9%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYF---DCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP----  215
              I N+YG TE + D T +   D ESL ++LE K    V IG P+ +  V +L +       
Sbjct  13316  ITNVYGPTETTVDATAYTIEDVESLHVLLE-KGEHTVSIGTPIANQAVYILNNQQQLVPI  13374

Query  216    -NEGEICVSGLCLSAGYFCYPSV-----LPLDYVELSQNHDSKSTDHRVQQYFRTGDFAR  377
                 GE+ + G  ++ GY   P +     +P  + + +    + ST     + +RTGD AR
Sbjct  13375  GIAGELYIGGAGIARGYLNLPELTAEKFIPNPFGDATAADPADST--FANRMYRTGDLAR  13432

Query  378    KLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHL  557
               L +G+  +LGR D  VKI G+RI L EVE  L     +  A V    ++     L A++
Sbjct  13433  WLPDGSIEYLGRIDHQVKIRGYRIELGEVEAQLLTVDGIQKAVVTAWENEDGHKDLCAYI  13492

Query  558    IMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              +  E+      L  + N +  KLP  MIP      + FP++ +GK+D   L
Sbjct  13493  VASESLS----LPELRNALQPKLPDYMIPTYVVQLDRFPLTPNGKIDRKAL  13539


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 102/219 (47%), Gaps = 21/219 (10%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN--E  221
            I N+YG TE +   T         + E      + IG P+ +  + ++   G+  P    
Sbjct  743  IYNMYGPTETTVWST---------VQELTHAQEINIGRPIANTQIYIINASGELQPVGVP  793

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            GE+C++G  L+ GY+    +    +V    N+         ++ +RTGD AR   +GN  
Sbjct  794  GELCIAGEGLARGYWNLEDLTAEKFV----NNPFAGDKAGYERMYRTGDLARWTLDGNIE  849

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
            +LGR D  VKI G+RI L E+E+ L +   V +A+V+ R D+           +      
Sbjct  850  YLGRMDHQVKIRGYRIELGEIESQLLQVESVREASVVARVDETTGQKQMVAYYVASQAME  909

Query  582  VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
               LRS    + R+LP  M+P  F   E  P++ +GK+D
Sbjct  910  ASKLRS---ELGRELPSYMVPSYFIQLEQMPLTPNGKID  945


 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 117/234 (50%), Gaps = 18/234 (8%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
             +++ K   Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V ++ 
Sbjct  6920  ELVYKWKDQVAYYNGYGPTENSVATSIW-----PVSEDERAGQLISIGRPVPNHRVYMVD  6974

Query  201   --GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
               G   P    GE+ VSG  L+ GY   P +    +V     +   + +   ++ +RTGD
Sbjct  6975  VHGHLAPVGVAGELYVSGPGLARGYLDRPELTAEKFV----ANPFAAGEAGYERMYRTGD  7030

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
              AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  + L 
Sbjct  7031  LARWMPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQNQLV  7090

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ + + +    E LRS   ++  +LP  M+P  F   E  P++ +GK+D   L
Sbjct  7091  AYYVAERDVSAGE-LRS---FLGEELPNYMVPSYFIQLEQMPLTPNGKIDRKAL  7140


 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 105/227 (46%), Gaps = 24/227 (11%)
 Frame = +3

Query  45     PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
              P   I N+YG TE   + T+    ++  +        VPIG P+ +    ++      + 
Sbjct  12243  PSLRISNIYGPTE---NTTFSTVHAITGVQSES----VPIGRPIHNSTAYVVDRSMRLQP  12295

Query  222    ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                  GE+ V G  ++ GY   P +    +++        S     ++ +RTGD  R   +
Sbjct  12296  VGVWGELLVGGDGVARGYRNRPDLTSEKFID--------SPFRSGERCYRTGDMVRLNAD  12347

Query  390    GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
              G+  + GR D  VKI G+RI L EVE  L +   V +A VI R D++    L A+++  E
Sbjct  12348  GSLEYKGRIDAQVKIRGYRIELGEVETQLLKLEAVREAVVIAREDEQGQKQLCAYVVADE  12407

Query  570    NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                   E LRS    +++KLP  MIP      E  P++ +GK+D   L
Sbjct  12408  EVVASE-LRSA---LSQKLPGYMIPSYVIQLEQMPLTPNGKIDRKAL  12450


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 106/227 (47%), Gaps = 29/227 (13%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  9626  IMNSYGVTEAAIDSSFYDEELSKLP------SSGHVPIGQAWLNARFYIV-DSQLNPVPI  9678

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  9679  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  9730

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVI-FRNDKRDTSLLEAHLIMKE  569
             N  F+GR D  VKI G RI L EVE  L     +  A V  + N+  D  L  A+++  E
Sbjct  9731  NVDFIGRMDDQVKIRGFRIELGEVEAQLLTVDGIEKAIVTAWENENGDKDLC-AYVVASE  9789

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                  E LRS    +  KLP  MIP      + FP++ +GK+D   L
Sbjct  9790  ALNLPE-LRST---LQPKLPSYMIPTYVVPLDQFPLTPNGKIDRKAL  9832



>gb|AIG26966.1| NRPS domain-containing protein [Brevibacillus laterosporus LMG 
15441]
Length=2587

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 114/231 (49%), Gaps = 23/231 (10%)
 Frame = +3

Query  36    KILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP  215
             K+ P   + N YG +E S D T    + LP          VPIG PL +  V ++ D+  
Sbjct  1825  KLFPHIPLANAYGPSEASDDVTIHIIDQLP------QSEIVPIGKPLHNFKVYIV-DEKM  1877

Query  216   N------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFAR  377
             N      +GEICVSG+ +  GY   P      ++      D    DH+  + ++TGD  R
Sbjct  1878  NLCPVGIKGEICVSGIGVGRGYLHDPERTAKVFM------DDPFADHKGVRLYKTGDMGR  1931

Query  378   KLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHL  557
              L +G   F GRKD  VKI G RI LEE+EN +  HP + +  V+   D R    L A++
Sbjct  1932  WLSDGTLEFFGRKDYQVKIRGFRIELEEIENQINNHPNILETVVMDIEDARGQKSLCAYV  1991

Query  558   IMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             ++K++      +  + + +A  LP  MIP  F   E  P++++GKVD   L
Sbjct  1992  VLKQDVP----INQLKSHLANTLPDYMIPAFFVKMEKLPLTANGKVDRKAL  2038


 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/223 (32%), Positives = 110/223 (49%), Gaps = 18/223 (8%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGD-----DDPNE  221
            ++N+YG  E +   T      +P      +LS +PIG P+ +  V +L            
Sbjct  763  LINVYGPAECTTFTTTHHVTQVPA----DALS-IPIGKPIANTQVYVLDQYLQIVPIGVP  817

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            GE+ V G  L+ GY   P +    ++   +N  S +   R+   ++TGD  R L +G   
Sbjct  818  GELYVGGPGLALGYLHRPEITNERFI---KNIFSPNATDRL---YKTGDIVRYLPDGTLS  871

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
            ++GRKD  VKI G RI L E+E VL +HPE+ DA VI R D+     L A+      N+ 
Sbjct  872  YIGRKDDQVKIRGFRIELGEIEAVLGQHPEIRDAVVIMREDQNSNKQLIAYFTTY--NQE  929

Query  582  VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            +     + ++  +KLP  MIP  F + +  P++ +GKVD   L
Sbjct  930  ILSASELRSYAEKKLPVHMIPAAFIYLDHVPVTPNGKVDRKAL  972



>gb|ABW93503.1| peptide synthetase [Nostoc sp. IO-102-I]
Length=1172

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 119/230 (52%), Gaps = 19/230 (8%)
 Frame = +3

Query  36   KILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD-D  212
            K+L    ++N YG TE +   T+  C+ L        LS VPIG P+ +  + +L  +  
Sbjct  736  KLLTAPQLINAYGPTETTIVATF--CK-LSTYKREDRLSDVPIGRPMANTQIYILNAELQ  792

Query  213  PN----EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARK  380
            P     +GEI + G+ L+ GY   P +    ++   QN   KS     Q+ ++TGD AR 
Sbjct  793  PVAIGVKGEIYIGGVGLARGYLRRPELTTEKFI---QNPFKKS-----QRLYKTGDLARY  844

Query  381  LQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLI  560
            L +GN  +LGR D  VKI G RI L E+E+ L  HP++  A VI R D  +  LL A+L+
Sbjct  845  LPDGNIEYLGRIDNQVKIRGFRIELGEIESALNTHPQLEQAVVILREDTPNNKLLIAYLV  904

Query  561  MKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             K  +     LRS   ++ +KLP   IP  F      P++S+GK+D   L
Sbjct  905  TKNQSLSPSELRS---FLKQKLPDYTIPSAFVILSELPLTSNGKIDRKAL  951



>ref|WP_036775858.1| hypothetical protein [Photorhabdus luminescens]
 gb|EYU16873.1| amino acid adenylation enzyme/thioester reductase family protein 
[Photorhabdus luminescens BA1]
Length=12131

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 125/238 (53%), Gaps = 23/238 (10%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
             ++LW+ L    P + I+N YG TE    CT FD   L      + +  VPIG P+ +  +
Sbjct  7279  VALWRTLS---PGSRIINEYGPTETVVGCTVFDTHHL-----SRFVDNVPIGRPISNTQI  7330

Query  192   LLL---GDDDP--NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
              +L   G+  P    GE+ + G+ ++ GY   P +    ++    +  S   D R+   +
Sbjct  7331  YILDTRGEPAPIGVTGELYIGGIAVARGYLNRPELTAERFLP---DPFSNRPDARM---Y  7384

Query  357   RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
             RTGD  R L NGN IF+GR D+ VKI G RI   E+E  L EHPEV  A V+  +D +D 
Sbjct  7385  RTGDLVRYLPNGNLIFVGRNDQQVKIRGFRIEPGEIEARLTEHPEVRGALVLALDDGQDK  7444

Query  537   SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              L+ A++  + N+E V  LR+    ++  LP  M+P  F   ++FP+  +GK+D   L
Sbjct  7445  RLV-AYVEAQANDELVNSLRT---HLSALLPGYMVPTAFVRLDAFPLLPNGKLDRRAL  7498


 Score =   109 bits (272),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 78/240 (33%), Positives = 123/240 (51%), Gaps = 27/240 (11%)
 Frame = +3

Query  12     LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKS--LSGVPIGLPLQSC  185
              ++LW+ L    P + I+N YG TE    CT FD       + H S     VPIG P+ + 
Sbjct  11535  IALWRTLS---PGSRIINEYGPTETVVGCTVFD-------VNHPSCFADNVPIGRPISNT  11584

Query  186    DVLLL---GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
               + +L   G+  P    GE+ + G+ ++ GY   P +    ++    +  S   D R+  
Sbjct  11585  QIYILDAHGEPVPMGVTGELYIGGVAVARGYLNRPELTAERFL---VDPFSDRPDARM--  11639

Query  351    YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
               +RTGD AR L +GN  FLGR D+ VK+ G RI   E+E  L EHP V +A V+   D +
Sbjct  11640  -YRTGDLARYLPDGNLEFLGRNDQQVKVRGFRIEPGEIETRLIEHPGVREATVLALGDGQ  11698

Query  531    DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              D  L+ A++++  +      LR+    ++  LP  M+P  F   ++FP++ +GK+D   L
Sbjct  11699  DKRLV-AYVVVPADEGLTNNLRT---HLSVTLPDYMVPSAFVRLDAFPLTPNGKLDRRAL  11754


 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 117/229 (51%), Gaps = 24/229 (10%)
 Frame = +3

Query  45    PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDP  215
             P   +LN YG +E +     +   ++        ++ +PIG P+ +  V LL   G   P
Sbjct  880   PPQQLLNGYGPSEGTTFTATYRINAV-----APGMTNIPIGRPVANTRVYLLDAYGQPVP  934

Query  216   --NEGEICVSGLCLSAGYFCYPSVLPLDYVE--LSQNHDSKSTDHRVQQYFRTGDFARKL  383
                 GEI V G  ++ GY   P +    ++    S N D++         +RTGD AR L
Sbjct  935   LGVVGEIYVGGDGVACGYLNRPELTAERFLTDPFSDNPDAR--------LYRTGDLARYL  986

Query  384   QNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIM  563
              +GN  FLGR D+ VKI G R+ L E+E  L EHP V +AAV+ R + +D  L+ A++  
Sbjct  987   PDGNLEFLGRNDQQVKIRGFRVELGEIEARLAEHPTVREAAVLARGEGQDKRLV-AYVAA  1045

Query  564   KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             + ++  V  LR+    I   LP  M+P  F   ++FP++++GK+D   L
Sbjct  1046  EAHDGLVNSLRAHLQAI---LPDYMVPSAFVRLDAFPLTANGKLDRRAL  1091


 Score =   103 bits (257),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 116/229 (51%), Gaps = 24/229 (10%)
 Frame = +3

Query  45     PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDP  215
              P   +LN YG +E +     +   +L         + VPIG P+ +  V LL   G   P
Sbjct  10465  PPQQLLNGYGPSEGTTFTATYRITAL-----ASGAARVPIGRPVANTRVYLLDAYGQPAP  10519

Query  216    --NEGEICVSGLCLSAGYFCYPSVLPLDYV--ELSQNHDSKSTDHRVQQYFRTGDFARKL  383
                  GEI + G  ++ GY   P +    ++    S N D++         +RTGD AR L
Sbjct  10520  LGVVGEIYIGGDGVACGYLNRPELTAERFLIDPFSDNPDAR--------LYRTGDLARYL  10571

Query  384    QNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIM  563
               +GN  FLGR D+ VKI G RI  EE+E  L E+P V +AAV+ R + ++  L+ A++  
Sbjct  10572  PDGNLEFLGRNDQQVKIRGFRIEPEEIEARLAEYPTVREAAVLVRGEGQEKRLV-AYVAA  10630

Query  564    KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              +  +    ILR+  + I   LP  M+P  F   ++FP++ +GK+D+  L
Sbjct  10631  EARDGLASILRAHLSAI---LPDYMVPSAFVRLDAFPLTPNGKLDHQAL  10676


 Score =   100 bits (248),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 118/224 (53%), Gaps = 23/224 (10%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPNE--  221
             +LN YG TE +   TY D  SL    + +S     IG P ++  + LL   G+  P    
Sbjct  6216  LLNGYGPTENTVTVTYKDVLSLD---DARS-----IGRPAKNARIYLLDRYGELVPAGCV  6267

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+ + G+ ++ GY   P+   L       +  S+ +  R+   +R+GD AR L +G+  
Sbjct  6268  GEMYIGGVGVARGYLNRPA---LSVERFMPDPFSRLSGERM---YRSGDLARYLPDGDLE  6321

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             FLGR D  VKI G RI L E+E  L EHP V +AAV+  +D ++  L+ A++  + ++E 
Sbjct  6322  FLGRNDEQVKIRGFRIELGEIETRLAEHPAVQEAAVLALDDGQEKRLV-AYVAAQADDEL  6380

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
             V  LR   + I   LP  MIP  F   ++FP + +GK+D   L+
Sbjct  6381  VNSLRIHLSAI---LPDYMIPAAFVRLDTFPQTPNGKLDRRALS  6421


 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 117/229 (51%), Gaps = 24/229 (10%)
 Frame = +3

Query  45    PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDP  215
             P   +LN YG +E +   T +   ++         + +PIG P+ +  V LL   G   P
Sbjct  1955  PPQQLLNGYGPSEGTTFTTTYRINAV-----APGATNIPIGRPVANTRVYLLDAYGQPVP  2009

Query  216   --NEGEICVSGLCLSAGYFCYPSVLPLDYV--ELSQNHDSKSTDHRVQQYFRTGDFARKL  383
                 GEI V G  ++ GY   P +    ++    S N D++         +R+GD AR L
Sbjct  2010  LGVVGEIYVGGDGVAYGYLNRPELTAECFLVDPFSDNPDAR--------MYRSGDLARYL  2061

Query  384   QNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIM  563
              +GN  FLGR D+ VKI G RI  +E+E  L EHP V + AV+ + + ++  L+ A+++ 
Sbjct  2062  PDGNLEFLGRNDQQVKIRGFRIEPKEIEARLAEHPTVREVAVLVQGEGQNKRLV-AYVVE  2120

Query  564   KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               ++   + L +  + I   LP  M+P  F   ++FP++S+GK+D+  L
Sbjct  2121  SADDGLADSLHTHLSTI---LPDYMVPAAFVRLDAFPLTSNGKLDHRAL  2166


 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 113/221 (51%), Gaps = 22/221 (10%)
 Frame = +3

Query  63    NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPL-QSCDVLLLGDDDPNE----GE  227
             NLYG +E +    +   +    I+E        IG P+  +C  LL     P      GE
Sbjct  4078  NLYGPSETTTYSAWLPIQRGDRIIES-------IGRPIANTCLYLLDAYGQPVPLGVVGE  4130

Query  228   ICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFIFL  407
             I + G  ++ GYF  P +    ++    +  S   D R+   +RTGD AR L +GN  FL
Sbjct  4131  IYIGGAGVARGYFNRPDLTAERFL---IDPFSDVPDARI---YRTGDLARYLPDGNLEFL  4184

Query  408   GRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVE  587
             GR D+ VKI G RI   E+E+ L EHP V+++ V+ + D ++  L+ A+++      H  
Sbjct  4185  GRNDQQVKIRGFRIEPGEIESRLVEHPAVSESVVLAQGDGQEKRLV-AYVVAA---AHEG  4240

Query  588   ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             ++ S+   ++ +LP  M+P  F   ++FP++ +GK+D   L
Sbjct  4241  LINSLREHLSVQLPDYMVPSAFVRLDAFPLTPNGKLDRQAL  4281


 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/221 (30%), Positives = 113/221 (51%), Gaps = 22/221 (10%)
 Frame = +3

Query  63    NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGD-DDPNE----GE  227
             NLYG +E +    +   +    I+E        IG P+ +  + LL +   P      GE
Sbjct  9421  NLYGPSETTTYSAWLPIQRGDRIIES-------IGRPIANTRLYLLDEYSQPVPLGVVGE  9473

Query  228   ICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFIFL  407
             I + G  ++ GY   P +    ++    +  S   D R+   +RTGD AR L +GN  FL
Sbjct  9474  IYIGGAGVARGYLNRPDLTTERFL---IDPFSDMPDARM---YRTGDLARYLSDGNLEFL  9527

Query  408   GRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVE  587
             GR D+ VKI G RI   E+E+ L EHP V+++ V+ + + ++  L+ A+++ + +   + 
Sbjct  9528  GRNDQQVKIRGFRIEPGEIESRLVEHPAVSESVVLAQGEGQEKRLV-AYVVAEADEGLIN  9586

Query  588   ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              LR     ++ +LP  M+P  F   ++FP++ +GK+D   L
Sbjct  9587  RLR---EHLSVQLPDYMVPSAFVRLDAFPLTPNGKLDRQAL  9624


 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 110/239 (46%), Gaps = 37/239 (15%)
 Frame = +3

Query  30    LVKILPQTAILNLYGSTE--VSGDCTYF-----DCESLPLILEHKSLSGVPIGLPLQSCD  188
              V+ L +  +LN YG TE  V+  C        DC                IG PL++  
Sbjct  8344  FVRELHRPRLLNAYGPTENTVTATCKEILSPTDDCS---------------IGRPLKNTC  8388

Query  189   VLLL---GDDDP--NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
             V LL   G   P    GE+ + G+ ++ GY   P +    ++      D  S+    + Y
Sbjct  8389  VYLLDKYGQLVPLGGVGEMYIGGVGVARGYLNQPELSAERFIP-----DPFSSVSGARMY  8443

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
               TGD AR L +G+  FLGR D  VKI G RI L E+E  L EHP V +AAV+   D++ 
Sbjct  8444  V-TGDLARYLPDGSLEFLGRNDHQVKIRGFRIELGEIETRLEEHPAVQEAAVLVWEDEQS  8502

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L+    +  E NE + +   +   ++  LP  M+P  F   ++ P + +GK+D   L
Sbjct  8503  KRLVA--YVAAEANEGLAV--RLREHLSAVLPDYMVPAAFVRLDTLPQTPNGKLDRRAL  8557


 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/223 (30%), Positives = 111/223 (50%), Gaps = 20/223 (9%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDP--NE  221
             ++N+YG TE +   TY +    P  +E  +    PIG  +    + LL   G   P    
Sbjct  5136  LVNMYGITETTVHVTYRELN--PHDVEQIT---SPIGTRIPDLTLYLLDKYGQPVPLGVT  5190

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+ V G  ++ GY   P +    ++          ++    + +RTGD AR L  G+ +
Sbjct  5191  GELYVGGGGVARGYLNRPELTAERFL------IDPFSEQPGARMYRTGDLARYLPEGDLV  5244

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             F+GR D+ VKI G RI   E+E  L EHP V+++ V+    +RD  L+ A+++   +   
Sbjct  5245  FVGRNDQQVKIRGFRIEPGEIEARLVEHPAVSESVVLALGQERDKRLV-AYVVAPADEGL  5303

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                LR+   +++  LP  M+P  F   ++FP++ +GK+D   L
Sbjct  5304  ANSLRA---YLSAILPDYMVPSAFVRLDAFPLTPNGKLDRRAL  5343


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/221 (30%), Positives = 110/221 (50%), Gaps = 22/221 (10%)
 Frame = +3

Query  63    NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDP--NEGE  227
             NLYG +E +    +   +    I+E        IG P+ +  + LL   G   P    GE
Sbjct  3030  NLYGPSETTTYSAWLPIQRGDRIIES-------IGRPIANTCLYLLDEYGQPVPLGVVGE  3082

Query  228   ICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFIFL  407
             I + G  ++ GY   P +    ++    +  S   D R+   +RTGD AR L +GN  FL
Sbjct  3083  IYIGGAGVARGYLNRPDLTAERFL---IDPFSDMPDARM---YRTGDLARYLPDGNLEFL  3136

Query  408   GRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVE  587
             GR D+ VKI G RI   E+E+ L EHP V++A V+ + + ++  L+    +  E +E   
Sbjct  3137  GRNDQQVKIRGFRIEPGEIESRLVEHPAVSEAVVLAQGEGQEKRLVA--YVAAEASEG--  3192

Query  588   ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             ++  +   ++ +LP  M+P  F   ++ P++ +GK+D   L
Sbjct  3193  LINRLREHLSVQLPDYMVPSAFVRLDALPLTPNGKLDRQAL  3233



>gb|AIG28061.1| NRPS domain-containing protein [Brevibacillus laterosporus LMG 
15441]
Length=2544

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 128/242 (53%), Gaps = 22/242 (9%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            + +W+   K+  +  I N YG TE +   T +D   L L  E +S   +PIG PL + ++
Sbjct  749  VRMWQ--RKVGTRILIANAYGPTEATVCKTIYDITEL-LPEEQQS---IPIGKPLANSEI  802

Query  192  LLLGD-------DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             +L         + P  GEI + G+ L+ GY          +V L+  +  +      ++
Sbjct  803  FILNKHGMLCPLNVP--GEIILGGVGLAKGYLNQAEQTKTAFVSLALPNQPE------KR  854

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
            ++RTGD  R L +GN  F+GR D  VKI G+RI L+E+E VL +HP+V D+A++   D  
Sbjct  855  FYRTGDIGRILPDGNLEFMGRIDHQVKIRGYRIELDEIETVLLQHPKVKDSAIVVYKDDH  914

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            D S L A  +  +++  V +   +T ++ ++LP  M+P  F+   S P+S SGKVD   L
Sbjct  915  DRSRLVAFYMTADSDGDVPVDELVT-YLNQRLPVYMVPEHFYTLSSMPLSPSGKVDRKSL  973

Query  711  AN  716
            A 
Sbjct  974  AQ  975


 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 107/232 (46%), Gaps = 39/232 (17%)
 Frame = +3

Query  48    QTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP----  215
             QT I+N YG TE +   T++     P+         VPIG PL +  + +L         
Sbjct  1831  QTLIINEYGPTEATVSATFY-----PIHRIEPEQKNVPIGKPLANTKIHILHSQKTPCPI  1885

Query  216   -NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKS---------TDHRVQQYFRTG  365
                GEI +  + LS GY+               N + K+         T     + +RTG
Sbjct  1886  GAIGEIYIESVGLSPGYW---------------NQEKKNEEVFISNPFTHQFADRLYRTG  1930

Query  366   DFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL  545
             D AR L +GN  F+GR+D  +KI G+R+ L E+E  L +HP +  + V+  +   +  L+
Sbjct  1931  DLARWLPDGNIEFVGRRDDQIKIRGYRVELGEIEETLLQHPLIHQSVVLAVDSGAEKVLV  1990

Query  546   EAHLIMKENNEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
               +      N   EI  S + ++++  LP  M+P  + + E  P++ +GKVD
Sbjct  1991  SYYT----TNSQQEIQASELNSYLSGTLPEYMLPRHYIYLEELPLTPNGKVD  2038



>gb|EEK53290.1| hypothetical protein bcere0004_54390 [Bacillus cereus BGSC 6E1]
Length=3664

 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 119/226 (53%), Gaps = 19/226 (8%)
 Frame = +3

Query  51    TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD-DPNE--  221
             T  +N YG TEV+ D TY DC +L +     +   VPIG P  +  + +L  + +P    
Sbjct  2959  TIFINAYGITEVTIDSTYLDCSTLNI----DNQGFVPIGDPFPNTQIYVLDQELNPTPIG  3014

Query  222   --GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               GE+C+ G  ++ GY   P +    +V    N  S     R+   +RTGD AR L++G 
Sbjct  3015  VPGELCIGGEGVAIGYLNRPELTREKFVP---NPFSDKVGERI---YRTGDLARYLKDGT  3068

Query  396   FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK-EN  572
               FLGR D  +KI G R+ + EVE VL +HP + +A V+ + DK   ++L  + +   E+
Sbjct  3069  IEFLGRMDYQIKIRGLRVEIGEVEEVLMQHPLIKEAVVLAKKDKSGENILIGYYVRSMED  3128

Query  573   NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                +E L++    + RKLP  MIP  F   +  P+S +GK+D  LL
Sbjct  3129  TFSIEELQTS---MLRKLPDYMIPTIFIEVKELPLSPNGKIDRKLL  3171


 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 63/228 (28%), Positives = 115/228 (50%), Gaps = 20/228 (9%)
 Frame = +3

Query  45    PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP---  215
             PQ  ++N+YG TE +   TY      PL L   +     IG P+    + +L D+     
Sbjct  1265  PQ--LVNMYGITETTVHVTY-----RPLSLHDVNSKTSVIGEPIPDLQLYILNDEQDVVP  1317

Query  216   --NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
               + GE+ V G  ++ GY   P +    ++E      +  ++++  + ++TGD   K  N
Sbjct  1318  IGSPGELYVGGAGVARGYLNRPELTDERFIE------NPFSNNKKDKLYKTGDLVMKQSN  1371

Query  390   GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
                ++LGR D  VKI G RI L E+EN L +H  + D AVI ++ + D   + A++I+  
Sbjct  1372  DEIVYLGRIDTQVKIRGFRIELGEIENHLLQHELIDDVAVIVKDQETDDPKITAYIIL--  1429

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
             +N+    ++++  ++  ++P  M+P      + F M+ +GK+D + L 
Sbjct  1430  SNKGNISMKALRQFMRSRVPDYMVPNIIVPVDEFKMTDNGKLDRSALT  1477



>ref|WP_000471551.1| hypothetical protein [Bacillus cereus]
Length=3658

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 119/226 (53%), Gaps = 19/226 (8%)
 Frame = +3

Query  51    TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD-DPNE--  221
             T  +N YG TEV+ D TY DC +L +     +   VPIG P  +  + +L  + +P    
Sbjct  2953  TIFINAYGITEVTIDSTYLDCSTLNI----DNQGFVPIGDPFPNTQIYVLDQELNPTPIG  3008

Query  222   --GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               GE+C+ G  ++ GY   P +    +V    N  S     R+   +RTGD AR L++G 
Sbjct  3009  VPGELCIGGEGVAIGYLNRPELTREKFVP---NPFSDKVGERI---YRTGDLARYLKDGT  3062

Query  396   FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK-EN  572
               FLGR D  +KI G R+ + EVE VL +HP + +A V+ + DK   ++L  + +   E+
Sbjct  3063  IEFLGRMDYQIKIRGLRVEIGEVEEVLMQHPLIKEAVVLAKKDKSGENILIGYYVRSMED  3122

Query  573   NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                +E L++    + RKLP  MIP  F   +  P+S +GK+D  LL
Sbjct  3123  TFSIEELQTS---MLRKLPDYMIPTIFIEVKELPLSPNGKIDRKLL  3165


 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 63/228 (28%), Positives = 115/228 (50%), Gaps = 20/228 (9%)
 Frame = +3

Query  45    PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP---  215
             PQ  ++N+YG TE +   TY      PL L   +     IG P+    + +L D+     
Sbjct  1259  PQ--LVNMYGITETTVHVTY-----RPLSLHDVNSKTSVIGEPIPDLQLYILNDEQDVVP  1311

Query  216   --NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
               + GE+ V G  ++ GY   P +    ++E      +  ++++  + ++TGD   K  N
Sbjct  1312  IGSPGELYVGGAGVARGYLNRPELTDERFIE------NPFSNNKKDKLYKTGDLVMKQSN  1365

Query  390   GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
                ++LGR D  VKI G RI L E+EN L +H  + D AVI ++ + D   + A++I+  
Sbjct  1366  DEIVYLGRIDTQVKIRGFRIELGEIENHLLQHELIDDVAVIVKDQETDDPKITAYIIL--  1423

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
             +N+    ++++  ++  ++P  M+P      + F M+ +GK+D + L 
Sbjct  1424  SNKGNISMKALRQFMRSRVPDYMVPNIIVPVDEFKMTDNGKLDRSALT  1471



>ref|WP_000471552.1| hypothetical protein [Bacillus thuringiensis]
 gb|EEM74001.1| hypothetical protein bthur0010_59310 [Bacillus thuringiensis 
serovar pondicheriensis BGSC 4BA1]
Length=3658

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 119/226 (53%), Gaps = 19/226 (8%)
 Frame = +3

Query  51    TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD-DPNE--  221
             T  +N YG TEV+ D TY DC +L +     +   VPIG P  +  + +L  + +P    
Sbjct  2953  TIFINAYGITEVTIDSTYLDCSTLNI----DNQGFVPIGDPFPNTQIYVLDQELNPTPIG  3008

Query  222   --GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               GE+C+ G  ++ GY   P +    +V    N  S     R+   +RTGD AR L++G 
Sbjct  3009  VPGELCIGGEGVAIGYLNRPELTREKFVP---NPFSDKVGERI---YRTGDLARYLKDGT  3062

Query  396   FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK-EN  572
               FLGR D  +KI G R+ + EVE VL +HP + +A V+ + DK   ++L  + +   E+
Sbjct  3063  IEFLGRMDYQIKIRGLRVEIGEVEEVLMQHPLIKEAVVLAKKDKSGENILIGYYVRSMED  3122

Query  573   NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                +E L++    + RKLP  MIP  F   +  P+S +GK+D  LL
Sbjct  3123  TFSIEELQTS---MLRKLPDYMIPTIFIEVKELPLSPNGKIDRKLL  3165


 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 63/228 (28%), Positives = 115/228 (50%), Gaps = 20/228 (9%)
 Frame = +3

Query  45    PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP---  215
             PQ  ++N+YG TE +   TY      PL L   +     IG P+    + +L D+     
Sbjct  1259  PQ--LVNMYGITETTVHVTY-----RPLSLHDVNSKTSVIGEPIPDLQLYILNDEQDVVP  1311

Query  216   --NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
               + GE+ V G  ++ GY   P +    ++E      +  ++++  + ++TGD   K  N
Sbjct  1312  IGSPGELYVGGAGVARGYLNRPELTDERFIE------NPFSNNKKDKLYKTGDLVMKQSN  1365

Query  390   GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
                ++LGR D  VKI G RI L E+EN L +H  + D AVI ++ + D   + A++I+  
Sbjct  1366  DEIVYLGRIDTQVKIRGFRIELGEIENHLLQHELIDDVAVIVKDQETDDPKITAYIIL--  1423

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
             +N+    ++++  ++  ++P  M+P      + F M+ +GK+D + L 
Sbjct  1424  SNKGNISMKALRQFMRSRVPDYMVPNIIVPVDEFKMTDNGKLDRSALT  1471



>ref|WP_022586513.1| tyrocidine synthase 3 [Brevibacillus laterosporus]
 gb|ERM16351.1| tyrocidine synthase 3 [Brevibacillus laterosporus PE36]
Length=2544

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 127/242 (52%), Gaps = 22/242 (9%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            + +W+   K+  +  I N YG TE +   T +D   L L  E +S   +PIG PL + ++
Sbjct  749  VRMWQ--RKVGTRILIANAYGPTEATVCKTIYDITEL-LPEEQQS---IPIGKPLANSEI  802

Query  192  LLLGD-------DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             +L         + P  GEI + G+ L+ GY          +V L+  +  +      ++
Sbjct  803  FILNKHGMLCPLNVP--GEIILGGVGLAKGYLNQAEQTKAAFVSLALPNQPE------KR  854

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
            ++RTGD  R L +GN  F+GR D  VKI G+RI L+E+E VL +HP+V D+A++   D  
Sbjct  855  FYRTGDIGRILPDGNLEFMGRIDHQVKIRGYRIELDEIETVLLQHPKVKDSAIVVYKDAH  914

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            D S L A  +  ++   V +   +T ++ ++LP  M+P  F+   S P+S SGKVD   L
Sbjct  915  DRSRLVAFYMTADSGGDVPVDELVT-YLNQRLPVYMVPEHFYTLSSMPLSPSGKVDRKSL  973

Query  711  AN  716
            A 
Sbjct  974  AQ  975


 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/223 (29%), Positives = 105/223 (47%), Gaps = 21/223 (9%)
 Frame = +3

Query  48    QTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP----  215
             QT I+N YG TE +   T++     P+         VPIG PL +  + +L         
Sbjct  1831  QTLIINEYGPTEATVSATFY-----PIHRIEPEQKNVPIGKPLANTKIHILHSQKTPCPI  1885

Query  216   -NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GEI +  + LS GY+         ++     H+         + +RTGD AR L +G
Sbjct  1886  GAIGEIYIESVGLSPGYWNQEKKNEEVFISNPFTHEF------ADRLYRTGDLARWLPDG  1939

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
             N  F+GR+D  +KI G+R+ L E+E  L +HP +  + V+  +   +  L+  +      
Sbjct  1940  NIEFVGRRDDQIKIRGYRVELGEIEETLLQHPLIHQSVVLAVDSGAEKVLVSYYT----T  1995

Query  573   NEHVEILRS-ITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
             N   EI  S + ++++  LP  M+P  +   E  P++ +GKVD
Sbjct  1996  NSQQEIQASELNSYLSGTLPEYMLPRHYLHLEELPLTPNGKVD  2038



>ref|WP_007430353.1| Bacitracin synthetase 1, partial [Paenibacillus sp. Aloe-11]
 gb|EHS57408.1| Bacitracin synthetase 1, partial [Paenibacillus sp. Aloe-11]
Length=4464

 Score =   120 bits (301),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 122/240 (51%), Gaps = 16/240 (7%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  2884  HVARFQRLVSSLGGAKLINLYGPTEATVDVSYFDCEP------GEEYAVIPIGKPIQNIR  2937

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V           +   ++
Sbjct  2938  LYIVQEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVA----DPFAVGEAGYER  2993

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE+ L +   V +A V+ R D+ 
Sbjct  2994  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVESQLLKVESVREAVVMARADET  3053

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E+   + + + R+LP  M+P  F   E  P+S +GK+D   L
Sbjct  3054  GQKQMVAYYVAGQELGAGELRNELRSELGRELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  3113


 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 101/228 (44%), Gaps = 26/228 (11%)
 Frame = +3

Query  45    PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPN--  218
             P   I+N YG TE +   T +        +  + L  VPIG P+++    ++ D   N  
Sbjct  1336  PDMNIINGYGPTENTTFSTTYH-------ITEEQLDSVPIGRPIRNSTAYVV-DSAFNLQ  1387

Query  219   ----EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQ  386
                  GE+ V G  ++ GY   P        EL+      +      + + TGD  R  +
Sbjct  1388  PIGAWGELVVGGDGVARGYLNRP--------ELTAERFLSNPWVEGDRLYCTGDLVRWRE  1439

Query  387   NGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK  566
             +G   + GR D+ VKI G+RI L EVE  L     + +A V+ R D+    +L A+    
Sbjct  1440  DGILEYAGRIDQQVKIRGYRIELGEVETQLLNIDSIREAVVLAREDEFGQKVLCAYYTSD  1499

Query  567   ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                   E    + N +A+++P  M+P  F   E  P++ +GKVD   L
Sbjct  1500  REWSTGE----LRNLLAQEIPGYMVPSYFLHLEQIPLTVNGKVDRKAL  1543



>ref|WP_003339349.1| phenylalanine racemase [Brevibacillus laterosporus]
 emb|CCF12682.1| plipastatin synthase subunit D [Brevibacillus laterosporus GI-9]
Length=3168

 Score =   120 bits (301),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 116/222 (52%), Gaps = 23/222 (10%)
 Frame = +3

Query  60    LNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGD-----DDPNEG  224
             +N YG TE S   TY+  E+          + VPIG+P+Q+  V ++            G
Sbjct  1369  INGYGPTETSVCATYWKAEA------ESERTSVPIGIPMQNAHVYIVDQYLQLQGIGEVG  1422

Query  225   EICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFIF  404
             E+CVSG+ L+ GY+  P +    +V++      K         ++TGD A+ L +GN  +
Sbjct  1423  EMCVSGVGLARGYWNRPELTAEKFVDIPFIPGEK--------MYKTGDLAKWLPDGNIEY  1474

Query  405   LGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHV  584
             LGR D  VKI GHR+ L E+E++L +HP + +A V+ R+D +  S L A+++ KE     
Sbjct  1475  LGRMDHQVKIRGHRVELGEIESLLLQHPAIQEAVVLARDDHQGQSYLCAYIVSKEQVTVT  1534

Query  585   EILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             E    +  ++A +LP  MIP  F   +  P++ + K+D   L
Sbjct  1535  E----VREYVANELPNYMIPSYFVHLDKMPLTPNDKIDRRAL  1572


 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 119/251 (47%), Gaps = 34/251 (14%)
 Frame = +3

Query  9     HLSLWKILV------------KILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLS  152
             HLS  +IL+            K   +   +N YG TE S   TY+       I +     
Sbjct  2373  HLSTLRILITAGSATSFGLVDKWKDKVTYINGYGPTETSICATYWKASERSSIAQ-----  2427

Query  153   GVPIGLPLQSCDVLLLGDDDPNEG-----EICVSGLCLSAGYFCYPSVLPLDYVELSQNH  317
              VPIG P+Q+  V +L      +G     E+CV+G+ L+ GY+  P +    +V    N 
Sbjct  2428  SVPIGAPVQNAQVYILNQLHQLQGIGIAGEMCVAGVGLARGYWNRPELTAEKFVTNPFNP  2487

Query  318   DSKSTDHRVQQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVA  497
                      Q+ ++TGD AR L +G   +LGR D  VKI GHR+ L E+E++L  H ++ 
Sbjct  2488  S--------QKMYKTGDLARWLPDGTIEYLGRIDHQVKIRGHRVELGEIESLLLLHHQIK  2539

Query  498   DAAVIFRNDKRDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPM  677
             +AAV+ R D++  S L A+L+  E     E    I  ++A  LP  MIP         P+
Sbjct  2540  EAAVLAREDEQGQSYLCAYLVSDEALSVAE----IRGYLADDLPSYMIPSYVVQLAKMPL  2595

Query  678   SSSGKVDYNLL  710
             + + K+D   L
Sbjct  2596  TPNDKIDRRAL  2606


 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 112/223 (50%), Gaps = 25/223 (11%)
 Frame = +3

Query  48   QTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCDVLLLGDDDPNE-  221
            Q  + N YG +E     TY        I  +  +  +P IG P+ +  V +L  +   + 
Sbjct  331  QVYLHNHYGPSETHVVTTY-------TIDPNHEIPEIPSIGKPISNTGVYILDKEKKLQP  383

Query  222  ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                GE+ +SG  +  GY        +   EL+    S +     ++ +RTGD AR L +
Sbjct  384  HGIAGELFISGANVGRGY--------IHNSELTAEKFSANPFKPKERMYRTGDLARWLPD  435

Query  390  GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
            GN  +LGR D+ VKI GHRI L E+E+ L  H ++ +A VI + D++ T  + A+L++ +
Sbjct  436  GNIEYLGRIDQQVKIRGHRIELGEIESHLLNHKDIKEAVVIDQMDEKQTKHIVAYLVVSK  495

Query  570  NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                ++    + N++ + LP  M+P  F   +  P++ +GK+D
Sbjct  496  KVSDMD----LRNYMGKTLPDYMVPSFFVSVDKIPLTPNGKID  534



>ref|WP_009454436.1| amino acid adenylation domain protein [Fischerella sp. JSC-11]
 gb|EHC19675.1| amino acid adenylation domain protein [Fischerella sp. JSC-11]
Length=1371

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 125/247 (51%), Gaps = 34/247 (14%)
 Frame = +3

Query  9    HLSLW------------KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLS  152
            HL LW            K   ++LP+  ++NLYGS+EVS + TY D   LP       L+
Sbjct  762  HLKLWITSGEVLSVNLAKTFRELLPEAKLINLYGSSEVSANVTYCDLSLLP-----DQLT  816

Query  153  GVPIGLPLQSCDVLLLGD-DDPNE----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNH  317
             +PIG P+ +  V +L     P      GE+ + G  L+ GY   P        EL+Q  
Sbjct  817  TIPIGRPIDNTLVYVLSSCLQPTPIGVVGELYIGGDGLAKGYLHRP--------ELTQER  868

Query  318  DSKSTDHRVQQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVA  497
               +      + ++T D  R L +GN  FLGR+DR VKI G R+ L E+E  + +HP + 
Sbjct  869  FIDNPFVPGTKLYKTDDLVRYLNDGNLEFLGRRDRQVKIRGFRVELGEIEAAIAKHPSIR  928

Query  498  DAAVIFRNDKRDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPM  677
            ++ VI ++       L A+++ K++ +    +  ++N++  KLP  M+P  F   ++ P+
Sbjct  929  ESFVIAQDHNPKDQRLIAYVVTKQDID----IPQLSNYLQEKLPNYMVPSAFVILDALPL  984

Query  678  SSSGKVD  698
            + +GKVD
Sbjct  985  TPNGKVD  991



>ref|WP_012294870.1| polyketide synthase [Lysinibacillus sphaericus]
 ref|YP_001698936.1| polyketide synthase [Lysinibacillus sphaericus C3-41]
 gb|ACA40806.1| putative polyketide synthase [Lysinibacillus sphaericus C3-41]
 gb|EWH32764.1| polyketide synthase [Lysinibacillus sphaericus CBAM5]
Length=2465

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 118/235 (50%), Gaps = 21/235 (9%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
             ++L K L    P   I+N YG TE +    Y +     L   H   S  PIGLP+ +  V
Sbjct  1702  ITLCKTLRDRFPHARIINEYGPTEATVGTIYHEVTEEDL---HSDYSHAPIGLPIHNTSV  1758

Query  192   LLLGDDDP-----NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
              +L + +        GEI +SG  ++ GY   P++    ++    NH       +    +
Sbjct  1759  YILNNQNQLVPSYGVGEIVLSGESVALGYLGEPNLTRNKFIANHINH------LQAGYLY  1812

Query  357   RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAV-IFRNDKRD  533
             +TGD  + L NG  +  GRKD  VKI GHR+ LEE+E  LRE P + DA V +++N+  D
Sbjct  1813  KTGDLGQVLPNGKIVCYGRKDNMVKIRGHRVELEEIERYLREIPSIKDAVVKLYKNE--D  1870

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                L A+L+ +++       R I   + R LP ++IP  +   E  PMS+SGKVD
Sbjct  1871  GEQLCAYLVSQQDINQ----RDIEKHLLRYLPESLIPTYYQKIEQIPMSNSGKVD  1921



>ref|WP_031463547.1| hypothetical protein, partial [Paenibacillus polymyxa]
Length=1866

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 121/240 (50%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  1554  HVARFQRLVSSLAGAKLVNLYGPTEATVDVSYFDCEP------DEEYAAIPIGKPIQNIR  1607

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V           +   ++
Sbjct  1608  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFV----ADPFAGGEAGYER  1663

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+ 
Sbjct  1664  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVETQLLQVESVREAVVMARADET  1723

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E LRS    + R+LP  M+P  F   E  P+S +GK+D   L
Sbjct  1724  GQKQMVAYYVAGQEIRASE-LRSE---LGRELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  1779


 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 115/230 (50%), Gaps = 26/230 (11%)
 Frame = +3

Query  48   QTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN  218
            Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V ++   G   P 
Sbjct  5    QVAYYNGYGPTENSVATSIW-----PVSEDERAGQLISIGRPMPNHRVYMVDVHGHLAPV  59

Query  219  --EGEICVSGLCLSAGYFCYPSVLPLDYVELSQN----HDSKSTDHRVQQYFRTGDFARK  380
               GE+CVSG  L+ GY        LD  EL+      +   + +   ++ +RTGD AR 
Sbjct  60   GVAGELCVSGPGLARGY--------LDRSELTAEKFVPNPFAAGEAGYERMYRTGDLARW  111

Query  381  LQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLI  560
            + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  + L A+ +
Sbjct  112  MPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQNQLVAYYV  171

Query  561  MKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             + +    E LRS+   +  +LP  M+P  F   +  P++ +GK+D   L
Sbjct  172  AERDVSAGE-LRSL---LGEELPNYMVPSYFIQLKQMPLTPNGKIDRKAL  217



>ref|WP_035951842.1| hypothetical protein, partial [Laceyella sacchari]
Length=5015

 Score =   120 bits (301),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 123/227 (54%), Gaps = 27/227 (12%)
 Frame = +3

Query  51    TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             T + NLYG TE + D +Y+DC +     +H   + +PIG P+ +  +L+L  D+ N    
Sbjct  4252  TRLYNLYGPTEATVDVSYYDCPT-----DHDP-AVIPIGKPIANVQLLVL--DERNRLQP  4303

Query  222   ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                 GE+C+SG CL+ GY        L+  +L++     +     +  ++TGD AR + +
Sbjct  4304  IGVPGELCLSGTCLARGY--------LNREDLTREKFVPNPYLPGELMYKTGDLARWMSD  4355

Query  390   GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
             GN  +LGR D  VKI G+RI L+EV   L +HP V D AVI R+D +  + L A+L+ + 
Sbjct  4356  GNIEYLGRMDHQVKIRGYRIELDEVTGQLMKHPAVKDGAVIARHDAQGQAYLCAYLVSEA  4415

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             + +  E+ +     + + LP  MIP  F      P++++GK+D   L
Sbjct  4416  DWDVAELRKH----MGKGLPDYMIPAYFVELPELPLNANGKLDRKAL  4458


 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/231 (32%), Positives = 108/231 (47%), Gaps = 23/231 (10%)
 Frame = +3

Query  39   ILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPN  218
            +L    ++N YG TE S   T +  ++        +  G+PIG P+    V +L   +  
Sbjct  684  VLGDGQLMNAYGPTETSVFTTMYPIKAW------NAQKGIPIGKPINHSRVYVLNRHNQL  737

Query  219  E-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKL  383
            +     GE+C+SG  + AGY   P      +V      D   T    +  +RTGD  R L
Sbjct  738  QPIGVAGELCISGDGVGAGYLNRPDQTAQVFV------DDPFTPG--ETMYRTGDLVRWL  789

Query  384  QNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIM  563
             +GN  FLGR D  VKI GHRI L E+E  L EHP V    V    D+   S L  ++++
Sbjct  790  PDGNLEFLGRMDGQVKIRGHRIELTEIELKLLEHPAVQQTIVTAGKDEDGHSFLSGYVVL  849

Query  564  KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
             +  E  +I R     +A  LP  M+P       + P++++GKVD   L +
Sbjct  850  DKPCEMADIRRH----LATTLPEYMVPTYLVELNALPLTANGKVDKRALPD  896


 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 110/233 (47%), Gaps = 26/233 (11%)
 Frame = +3

Query  30    LVKILPQ-TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGD  206
             LVK+  Q    LN YG TE + D T   C              + IG P+++    +L  
Sbjct  1710  LVKVWGQGRTFLNAYGPTEGTVDATIGVCSP--------EAETITIGTPIRNKKAYVLSP  1761

Query  207   DDPNE-----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDF  371
             +   +     GE+C+ G  L+ GY+  P +    +V         +     ++ ++TGD 
Sbjct  1762  EGQLQPIGVPGELCIGGEGLARGYWNRPDLTAEKFV--------PNPFRPGERMYKTGDL  1813

Query  372   ARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEA  551
              R L  G   +LGR D  VKI GHRI + E+E +L E  +V +A V+ RNDK   + L A
Sbjct  1814  VRWLPTGEIEYLGRIDDQVKIRGHRIEIGEIETMLLEMEQVEEAVVLARNDKGSGAYLCA  1873

Query  552   HLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             +++ K     V+ LR   + I   LP  MIP  F   +  P++ +GKVD   L
Sbjct  1874  YIVWKTPGS-VKTLRDDLSAI---LPHYMIPSYFVEMDKIPLTPNGKVDKKAL  1922


 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 106/223 (48%), Gaps = 27/223 (12%)
 Frame = +3

Query  60    LNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP-IGLPLQSCDVLLLGDDDPNE-----  221
             +N YG TEV+ D T   C         ++    P IG P  +  V +L   +  +     
Sbjct  3211  INAYGPTEVTVDATLGYC---------RAEDDKPTIGTPFPNKKVYILNQHNQLQPIGVP  3261

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+CV G+ L+ GY+    +    +V    N + K         ++TGD AR L NG   
Sbjct  3262  GELCVGGVGLARGYWGRKDLTAEKFVPNPFNPEEK--------MYKTGDLARWLPNGEIE  3313

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             +LGR D  VKI GHR+ L EV   L +   V +A V+   D +  + L A+ ++ E    
Sbjct  3314  YLGRIDDQVKIRGHRVELGEVVERLLQLDGVKEATVVPYLDHQGYAYLCAYTVLAEGM--  3371

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                +  +   +A +LP  M+P +F   ++ P++++GKVD   L
Sbjct  3372  --TVAQVREQLAAQLPNYMVPTQFVEMDALPLNANGKVDRKAL  3412



>ref|WP_015351678.1| non-ribosomal peptide synthetase [Myxococcus stipitatus]
 ref|YP_007363107.1| non-ribosomal peptide synthetase [Myxococcus stipitatus DSM 14675]
 gb|AGC47423.1| non-ribosomal peptide synthetase [Myxococcus stipitatus DSM 14675]
Length=3444

 Score =   120 bits (300),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 80/229 (35%), Positives = 120/229 (52%), Gaps = 19/229 (8%)
 Frame = +3

Query  42    LPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE  221
             LP  ++ NLYG TE S D +++ C            + VPIG P+ +  +L+L D D N 
Sbjct  2866  LPHVSLYNLYGPTEASVDVSHWTCRP------SDKRTTVPIGAPVFNTRLLVL-DSDLNL  2918

Query  222   ------GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKL  383
                   GE+ + G+ L  GY   P +    ++      D  +T+   + Y RTGD AR+L
Sbjct  2919  LPTGALGELYIGGVQLGRGYLGRPGLTAERFIP-----DPCATEPGARLY-RTGDLARRL  2972

Query  384   QNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIM  563
             ++G+  ++GR D  VK+ G RI L E+E VL   P+VA+AAV+ R      SLL A++  
Sbjct  2973  EDGSLEYVGRVDSQVKVRGFRIELGEIEAVLLGLPDVAEAAVVVRTAPGGESLLAAYVAP  3032

Query  564   KENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             +  +       ++   +AR LP  M+P RF   E  P++SSGKVD   L
Sbjct  3033  RGGHAPERWSDTLREAMARVLPEYMVPGRFAVLERLPLTSSGKVDRRAL  3081


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 66/222 (30%), Positives = 98/222 (44%), Gaps = 26/222 (12%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPN------  218
            + NLYG +E   D TY   E +P         G  IG PL++    +L   D +      
Sbjct  758  VYNLYGPSE---DTTYSTWELIP----RGETRGPTIGRPLENTSGYVL---DASWRLMPL  807

Query  219  --EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
               GE+ ++G  L+ GY   P +    +V    +  S+    R+   +RTGD  R + +G
Sbjct  808  GVPGELYLAGDGLARGYLLRPDLTAERFVP---DPFSREPGGRM---YRTGDRVRLMPDG  861

Query  393  NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
               +LGR D  VK+ G RI L EVE  LR   +VADA V+   D    + L   ++  E 
Sbjct  862  RLEYLGRLDHQVKVRGFRIELGEVEARLRALADVADALVMAGEDATGGARLVGFVVPHEG  921

Query  573  NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                         +   LP  M+P R+      P++ +GKVD
Sbjct  922  KTLAPAALRAA--LLEHLPEYMVPSRWSVLPKLPLTPNGKVD  961


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 68/229 (30%), Positives = 100/229 (44%), Gaps = 31/229 (14%)
 Frame = +3

Query  54    AILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVP--IGLPLQSCDVLLLGDDDPNE--  221
             A+ NLYG TE +   T     S          +G P  +G P+ +  V +L  D   E  
Sbjct  1822  ALWNLYGPTETTVWSTVGRVPS----------TGGPLTVGRPILNTPVYVL--DAGLELV  1869

Query  222   -----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQ  386
                  GEI + G  ++ GY    ++    ++      D  ST    + Y  TGD      
Sbjct  1870  PPGVCGEIYIGGTGVATGYVGRAALTAERFIP-----DPFSTVPGARLY-ATGDVGLLRA  1923

Query  387   NGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK  566
             +G     GR+D  VK+ GHRI L EVE  LR  P+V DAAV  R      + L  +++ +
Sbjct  1924  DGLLEVRGREDAQVKVRGHRIELGEVEAALRSIPDVKDAAVAVRGASPGVARLVGYVVAR  1983

Query  567   EN-NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                    + LR +   +A +LP  M+P  F    + P + +GKVD   L
Sbjct  1984  AGARTSPDELRMV---LASRLPAYMVPSTFVVLPTLPTTLNGKVDRKAL  2029



>ref|WP_036216701.1| polyketide synthase [Lysinibacillus sphaericus]
Length=2465

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 120/236 (51%), Gaps = 23/236 (10%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
             ++L K L    P   I+N YG TE +    Y +     L   H   S  PIGLP+ +  V
Sbjct  1702  ITLCKTLRDRFPHARIINEYGPTEATVGTIYHEVTEEDL---HSDYSHAPIGLPIHNTSV  1758

Query  192   LLLGDDDP-----NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY-  353
              +L + +        GEI +SG  ++ GY   P++    ++    NH     +H    Y 
Sbjct  1759  YILNNQNQLVPSYGVGEIVLSGESVALGYLGEPNLTRNKFI---ANH----INHLQSGYL  1811

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAV-IFRNDKR  530
             ++TGD  + L NG  +  GRKD  VKI GHR+ LEE+E  LRE P + DA V +++N+  
Sbjct  1812  YKTGDLGQVLPNGKIVCYGRKDNMVKIRGHRVELEEIERYLREIPSIKDAVVKLYKNE--  1869

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
             D   L A+L+ +++       R I   + R LP ++IP  +   E  PMS+SGKVD
Sbjct  1870  DGEQLCAYLVSQQDINQ----RDIEKHLLRYLPESLIPTYYQKIEQIPMSNSGKVD  1921



>ref|WP_036163982.1| polyketide synthase [Lysinibacillus sphaericus]
Length=2465

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 120/236 (51%), Gaps = 23/236 (10%)
 Frame = +3

Query  12    LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
             ++L K L    P   I+N YG TE +    Y +     L   H   S  PIGLP+ +  V
Sbjct  1702  ITLCKTLRDRFPHARIINEYGPTEATVGTIYHEVTEEDL---HSDYSHAPIGLPIHNTSV  1758

Query  192   LLLGDDDP-----NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY-  353
              +L + +        GEI +SG  ++ GY   P++    ++    NH     +H    Y 
Sbjct  1759  YILNNQNQLVPSYGVGEIVLSGESVALGYLGEPNLTRNKFI---ANH----INHLQSGYL  1811

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAV-IFRNDKR  530
             ++TGD  + L NG  +  GRKD  VKI GHR+ LEE+E  LRE P + DA V +++N+  
Sbjct  1812  YKTGDLGQVLPNGKIVCYGRKDNMVKIRGHRVELEEIERYLREIPSIKDAVVKLYKNE--  1869

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
             D   L A+L+ +++       R I   + R LP ++IP  +   E  PMS+SGKVD
Sbjct  1870  DGEQLCAYLVSQQDINQ----RDIEKHLLRYLPESLIPTYYQKIEQIPMSNSGKVD  1921



>ref|WP_006037690.1| amino acid adenylation domain protein [Paenibacillus curdlanolyticus]
 gb|EFM11233.1| amino acid adenylation domain protein [Paenibacillus curdlanolyticus 
YK9]
Length=3006

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 122/227 (54%), Gaps = 23/227 (10%)
 Frame = +3

Query  51    TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD---PN-  218
             T ++NLYG TE + D +++DC      L +  L  VPIG P+ +  + ++ + D   P  
Sbjct  2493  TRLINLYGPTEAAIDVSFYDC------LPNGELDSVPIGRPIDNIQLYIVNEHDRLQPEG  2546

Query  219   -EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
              +GE+C++G+ L+ GY     +    +V    N     T     + +RTGD AR L +GN
Sbjct  2547  LQGELCIAGIGLARGYRNREELTAEKFV---SNPFVPGT-----RMYRTGDLARWLPDGN  2598

Query  396   FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
               +LGR D  VK+ G+RI L E+E  L +H  +A++AV+ +   +  S L A+++ K++ 
Sbjct  2599  IEYLGRLDHQVKLRGYRIELGEIEAALLKHESIAESAVLVKQAPQGDSRLCAYIVAKQDV  2658

Query  576   EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
                +I R +       LP  MIP  +   E+ P+++SGK +  +LA 
Sbjct  2659  SVADIRRHLGT----MLPDYMIPASYTMLETMPLTASGKANRGMLAK  2701


 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/226 (32%), Positives = 115/226 (51%), Gaps = 23/226 (10%)
 Frame = +3

Query  51    TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD----DPN  218
             T ++NLYG TE + D ++FDC +         L  VPIG P+ +  + ++        P 
Sbjct  1429  TRLINLYGPTEATVDVSHFDCSTA------GKLHAVPIGKPIANTQLYVVDAALRLCPPG  1482

Query  219   -EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               GE+C+ G  L+ GY+        + +EL+      +      + +RTGD A+   +G 
Sbjct  1483  VPGELCIGGAGLARGYW--------ERLELTAERFVPNPFEAGTRMYRTGDLAKLRPDGQ  1534

Query  396   FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
              I++GR D  VKI G R+ L E+E+ L +  EV +A V+   D      L A+L+  +  
Sbjct  1535  VIYMGRLDHQVKIRGFRMELGEIEHHLLQMEEVREAVVLAEPDADGELALHAYLVAVQPL  1594

Query  576   EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLA  713
             +    LR+   ++AR+LP  M+P  F   E  P+S+SGK D + LA
Sbjct  1595  D-ASALRA---YLARRLPEYMVPAYFSQIERMPLSASGKADRHALA  1636



>ref|WP_036636159.1| bacitracin synthetase, partial [Paenibacillus panacisoli]
Length=3211

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/241 (34%), Positives = 120/241 (50%), Gaps = 22/241 (9%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        +S   +PIG P+Q+  
Sbjct  1913  HVARFQRLVSSLTGAKLINLYGPTEATVDVSYFDCEP------GESYGIIPIGKPIQNIR  1966

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHR-VQ  347
             + ++ +           GE+C+ G+ ++ GY   P +    +V      D  S       
Sbjct  1967  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFV-----RDPFSGGRAGFG  2021

Query  348   QYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK  527
             Q +RTGD AR L +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+
Sbjct  2022  QMYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIELGEVEAQLLQVKSVREAVVMARADE  2081

Query  528   RDTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNL  707
                  L A+ +        E LRS    + R+LP  M+P  F   E  P+S +GK+D   
Sbjct  2082  TGQKQLVAYYVASVELGTAE-LRSE---MGRELPSYMVPTYFIQLEQMPLSPNGKIDRKA  2137

Query  708   L  710
             L
Sbjct  2138  L  2138


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 66/278 (24%), Positives = 119/278 (43%), Gaps = 58/278 (21%)
 Frame = +3

Query  24   KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
            +++ K   Q +  N YG TE S   + +     P+  + ++   + IG P+ +  V ++ 
Sbjct  216  ELVYKWKDQVSYYNGYGPTENSVATSIW-----PVSEDRRAGEIISIGRPMPNHRVYIVD  270

Query  201  --GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYV-------ELSQNHDSKS------  329
              G   P    GE+CVSG  L+ GY     +    +V       E+ ++ +++       
Sbjct  271  AHGHLAPVGVAGELCVSGPGLARGYLDRAELTAEKFVPNPFVTGEVRESEEAEGVVGEAG  330

Query  330  ---------------TDHRV----------------QQYFRTGDFARKLQNGNFIFLGRK  416
                           T+ R                 ++ + TGD AR + +GN  +LGR 
Sbjct  331  LADAGSGSEGEGHDMTEGRAASHAASHAASHATSHYERMYHTGDLARWMPDGNIEYLGRI  390

Query  417  DRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVEILR  596
            D  VKI G+RI L EVE  L +   V +  V+ + D++  + L A+ + ++     E+  
Sbjct  391  DHQVKIRGYRIELGEVEAQLLKVEAVQEVIVLAQADEQGQNQLVAYYVAEQEVGAGELRA  450

Query  597  SITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             ++     +LP  M+P      E  P++ +GK+D   L
Sbjct  451  QLSI----ELPNYMVPSHLIQLEQMPLTPNGKIDRKAL  484



>ref|WP_017491075.1| hypothetical protein [gamma proteobacterium WG36]
Length=1163

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 123/236 (52%), Gaps = 23/236 (10%)
 Frame = +3

Query  36    KILPQTAILNLYGSTEVSGDCTYFDC-ESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDD  212
             ++LP TA+ NLYG TE + D T + C + LP      + + VPIG P+ +  + LL    
Sbjct  847   RVLPDTAVHNLYGPTEAAIDVTAWTCPKDLP------ATAIVPIGRPIANLRIYLLDQHQ  900

Query  213   PN-----EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFAR  377
                     GE+ + G+ ++ GY   P +    ++      D  ++D   + Y RTGD AR
Sbjct  901   RPVPLGVAGELYIGGVGVARGYLNRPDLTAERFIR-----DPFASDANARMY-RTGDLAR  954

Query  378   KLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHL  557
              L NG+  +LGR D  VKI G RI L E++  L++ P + +A V+ R+D +    L A++
Sbjct  955   YLHNGDIEYLGRNDNQVKIRGFRIELGEIDAALQKQPAIREAVVVARDDAQGDLRLVAYV  1014

Query  558   IM--KENNEHVEILRSITNW---IARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             ++  + + E +     I  W   +A +LP  M+P  F   +  P++++GK+D   L
Sbjct  1015  VLDARADAEGLSTSERIAQWRNSLAAQLPDYMVPAAFVKLDQLPLTANGKLDRKAL  1070



>ref|WP_011320550.1| amino acid adenylation protein [Anabaena variabilis]
 ref|YP_324355.1| amino acid adenylation protein [Anabaena variabilis ATCC 29413]
 gb|ABA23460.1| Amino acid adenylation [Anabaena variabilis ATCC 29413]
Length=888

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 118/228 (52%), Gaps = 24/228 (11%)
 Frame = +3

Query  48   QTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD-DPNE-  221
            Q  + NLYG TE + D T++ C       +  +L  VPIG P+ +  + +L  D  P   
Sbjct  309  QCELHNLYGPTEAAIDVTFWQCR------KDSNLKSVPIGRPIANTQIYILDADLQPVNI  362

Query  222  ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNH--DSKSTDHRVQQYFRTGDFARKLQ  386
               GEI + G+ ++ GY        L+  EL++     +   +   ++ ++TGD AR L 
Sbjct  363  GVTGEIYIGGVGVARGY--------LNKEELTKEKFIINPFPNSEFKRLYKTGDLARYLP  414

Query  387  NGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK  566
            +GN  +LGR D  VKI G+RI + E+ENVL  HP+V +A VI R+D      + A++   
Sbjct  415  DGNIEYLGRTDYQVKIRGYRIEIGEIENVLSSHPQVREAVVIARDDNAQEKQIIAYITYN  474

Query  567  ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 ++ LR   +++  +LP  MIP  F   E  P++ SGKVD   L
Sbjct  475  SIKPQLDNLR---DFLKARLPDFMIPAAFVMLEHLPLTPSGKVDRKAL  519



>ref|WP_038978246.1| bacitracin synthetase [Paenibacillus polymyxa]
Length=14117

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 121/240 (50%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  8510  HVARFQRLVSSLAGAKLVNLYGPTEATVDVSYFDCEP------DEEYAAIPIGKPIQNIR  8563

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V           +   ++
Sbjct  8564  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFV----ADPFAGGEAGYER  8619

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+ 
Sbjct  8620  IYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVETQLLQVESVREAVVMARADET  8679

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E LRS    + R+LP  M+P  F   E  P+S +GK+D   L
Sbjct  8680  GQKQMVAYYVAGQEIRASE-LRSE---LGRELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  8735


 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 121/240 (50%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  5432  HVARFQRLVSSLAGAKLVNLYGPTEATVDVSYFDCEP------DEEYAVIPIGKPIQNIR  5485

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V           +   ++
Sbjct  5486  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFV----ADPFSGGEAGYER  5541

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+ 
Sbjct  5542  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVETQLLQVESVREAVVMARTDET  5601

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E LRS    + R+LP  M+P  F   E  P+S +GK+D   L
Sbjct  5602  GQKQMVAYYVAGQEIGASE-LRSE---LGRELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  5657


 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 111/226 (49%), Gaps = 27/226 (12%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
              I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  10765  IINSYGVTEAAIDSSFYDEELSKLP------SSGNVPIGQAWLNARFYIV-DSQLNPVPI  10817

Query  222    ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                 GE+C+ G+ ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  10818  GVLGELCIGGIGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  10869

Query  393    NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
              N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L  + I  E 
Sbjct  10870  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQAVVIDRTDERGHKYLCGY-ITGET  10928

Query  573    NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 +E +++    +   LP  M+P R    E+ P++S+GK+D   L
Sbjct  10929  ELRIEEVQAT---LEAGLPAHMVPARLMRLETIPLTSNGKIDRKAL  10971


 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 107/219 (49%), Gaps = 22/219 (10%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN--E  221
             I N+YG TE +   T         + E      + IG P+ +  + +L   G+  P    
Sbjct  3897  IYNMYGPTETTVWST---------VQELTHAQQINIGRPIANTQIYILNANGELQPVGVP  3947

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+C++G  L+ GY+    +    +V    NH         ++ +RTGD AR + +GN  
Sbjct  3948  GELCIAGEGLARGYWKREELTAERFV----NHPFAGDKADQERMYRTGDLARWMPDGNLE  4003

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             +LGR D  VKI G+RI L E+E+ L +   V +A ++ R D+   + L A+ +  +    
Sbjct  4004  YLGRMDHQVKIRGYRIELGEIESQLLQVESVQEAVIMARTDETGQTQLVAYYVASQELGS  4063

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              E+ +     + + LP  M+P  F + E  P++ +GK+D
Sbjct  4064  SELRQE----LGQALPSYMVPSYFIWLEQMPLTPNGKID  4098


 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 70/226 (31%), Positives = 109/226 (48%), Gaps = 27/226 (12%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  2366  IINSYGVTEAAIDSSFYDEELSKLP------SSGNVPIGQAWLNARFYIV-DSQLNPVPI  2418

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  2419  GVLGELCIGGAGVARGY--------LNRADLTAEKFIANPYVPGERLYRTGDLARWMPDG  2470

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
             N  F+GR D  VKI G+RI L E+E  ++  P V    VI R D+R    L  + I  E 
Sbjct  2471  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQVVVIDRTDERGHKYLCGY-ITGET  2529

Query  573   NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                +E +++    +   LP  M+P R    E+ P++S+GK+D   L
Sbjct  2530  ELRIEEVQAA---LEAGLPAHMVPARLMRLETIPLTSNGKIDRKAL  2572


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 117/234 (50%), Gaps = 18/234 (8%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
             +++ K   Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V ++ 
Sbjct  6953  ELVYKWKDQVAYYNGYGPTENSVATSIW-----PVSEDERAGQLISIGRPMPNHRVYMVD  7007

Query  201   --GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
               G   P    GE+CVSG  L+ GY   P +    +V     +   + +   ++ +RTGD
Sbjct  7008  VHGHLAPVGVAGELCVSGPGLARGYLDRPELTAEKFVP----NPFAAGEAGYERMYRTGD  7063

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
              AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  + L 
Sbjct  7064  LARWMPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQNQLV  7123

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ + +      E LRS+   +  +LP  M+P  F   E  P++ +GK+D   L
Sbjct  7124  AYYVAEREVSAGE-LRSL---LGEELPNYMVPSYFIQLEQMPLTPNGKIDRKAL  7173


 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 110/231 (48%), Gaps = 20/231 (9%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYF---DCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP----  215
              I N+YG TE + D T +   D ESL ++LE K    V IG P+ +  V +L         
Sbjct  13350  ITNVYGPTEATVDATAYTIEDVESLNVLLE-KGEHTVSIGTPIANQAVYILNTRQQLVPM  13408

Query  216    -NEGEICVSGLCLSAGYFCYPSV-----LPLDYVELSQNHDSKSTDHRVQQYFRTGDFAR  377
                 GE+ + G  ++ GY   P +     +P  + + +    + ST     + +RTGD AR
Sbjct  13409  GIAGELYIGGAGIARGYLNLPELTAEKFVPNPFADATAADPADST--YANRMYRTGDLAR  13466

Query  378    KLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHL  557
               L +G+  +LGR D  VKI G+RI L EVE  L     +  A V    ++     L A++
Sbjct  13467  WLPDGSIEYLGRIDHQVKIRGYRIELGEVEAQLLTVDGIQKAVVTAWENEDGHKDLCAYI  13526

Query  558    IMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              +  E+      L  + N +  KLP  MIP      + FP++ +GK+D   L
Sbjct  13527  VASESLS----LPELRNALQPKLPDYMIPTYVVQLDRFPLTPNGKIDRKAL  13573


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 117/234 (50%), Gaps = 18/234 (8%)
 Frame = +3

Query  24     KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
              +++ K   Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V ++ 
Sbjct  12264  ELVYKWKDQVAYYNGYGPTENSVATSIW-----PVSKDERAGQLISIGRPVPNHRVYMVD  12318

Query  201    --GDDDP--NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
                G   P    GE+CVSG  L+ GY   P +    +V     +   + +   ++ +RTGD
Sbjct  12319  VHGHLAPIGVAGELCVSGPGLARGYLDRPELTAEKFVP----NPFAAGEAGYERMYRTGD  12374

Query  369    FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
               AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  + L 
Sbjct  12375  LARWMPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQNQLV  12434

Query  549    AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              A+ + + +    E LRS+   +  +LP  M+P      E  P++ +GK+D   L
Sbjct  12435  AYYVAERDVSAGE-LRSL---LGEELPNYMVPSFLVQLEQMPLTPNGKIDRKAL  12484


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 65/227 (29%), Positives = 106/227 (47%), Gaps = 24/227 (11%)
 Frame = +3

Query  45   PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
            P   I+N YG TE   + T+    ++  +        VPIG P+ +    ++      + 
Sbjct  776  PSLRIINGYGPTE---NTTFSTTHAIAGV----QSEAVPIGRPIHNSTAYVVDRSMQLQP  828

Query  222  ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                GE+ V G  ++ GY   P +    +++        S     ++ +RTGD  R  ++
Sbjct  829  VGAWGELIVGGDGVARGYRNRPDLTAEKFID--------SPFRSGERCYRTGDLVRWNED  880

Query  390  GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
            G   + GR D  VKI G+RI L EVE  L +   V +A VI R D++    L A+++   
Sbjct  881  GTLEYKGRIDAQVKIRGYRIELGEVEAQLLKLEAVQEAVVIAREDEQGQKQLCAYVVTLA  940

Query  570  NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            +    E LRS    ++++LP  M+P  F   E  P++ +GKVD   L
Sbjct  941  DITASE-LRSA---LSQELPGYMVPSYFVQMEQLPLTPNGKVDRRAL  983


 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 106/227 (47%), Gaps = 29/227 (13%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  9660  IINSYGVTEAAIDSSFYDEELSKLP------SSGHVPIGQAWLNARFYIV-DSQLNPVPI  9712

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  9713  GVLGELCIGGAGVARGY--------LNRTDLTAEKFVANPYVPGERLYRTGDLARWMPDG  9764

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVI-FRNDKRDTSLLEAHLIMKE  569
             +  F+GR D  VKI G RI L EVE  L     +  A V  + N+  D  L  A+++  E
Sbjct  9765  HVDFIGRMDDQVKIRGFRIELGEVEAQLLTVAGIEKAIVTAWENEDGDKDLC-AYVVASE  9823

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                  E LRS    +  KLP  MIP      + FP++ +GK+D   L
Sbjct  9824  ALNLPE-LRST---LQPKLPGYMIPTYVVPLDQFPLTPNGKIDRKAL  9866



>ref|WP_021728618.1| putative non-ribosomal peptide synthase [Bacillus thuringiensis]
 gb|ETE94385.1| lichenysin synthetase [Bacillus thuringiensis serovar aizawai 
str. Leapi01]
 gb|ETE96912.1| lichenysin synthetase [Bacillus thuringiensis serovar aizawai 
str. Hu4-2]
 gb|AJA23010.1| lichenysin synthetase [Bacillus thuringiensis serovar galleriae]
Length=1907

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 120/227 (53%), Gaps = 18/227 (8%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-----  221
            + N YG TE + D T +  +   L    + ++ +PIG PL +  V ++GD+   +     
Sbjct  560  LTNAYGPTETTVDSTCYHVQHAEL----EFMNQLPIGRPLANQKVYIMGDNQQLQPVGIP  615

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKST-DHRVQQYFRTGDFARKLQNGNF  398
            GE+C+SG  L+ GY   P +    +V +  N +  S  D +V   +RTGD AR L +GN 
Sbjct  616  GELCISGEGLARGYLNQPKLTMEKFVPIQINKEGSSIIDDKV---YRTGDLARWLPDGNL  672

Query  399  IFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK-RDTSLLEAHLIMKENN  575
             +LGR D  VKI G RI L E+E  L  +PE+ +A VI R  +  D  +L A+++M  + 
Sbjct  673  EYLGRMDDQVKIRGLRIELGEIEKQLLRYPEIGEAIVITRKKEGEDAPVLCAYVVMNSSA  732

Query  576  EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            +    +  +  ++   LP  MIP      E FP+SS+GK+D   L +
Sbjct  733  K----VEEVRQFLREYLPFYMIPAYIIPIEQFPISSNGKIDRKALPD  775


 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/221 (28%), Positives = 108/221 (49%), Gaps = 23/221 (10%)
 Frame = +3

Query  51    TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             T I N+YG TE +   + F  +      E ++ + +PIG P+ +  + +L      +   
Sbjct  1609  TQIENMYGPTEATVIASTFSLQ------ESENYNTIPIGKPIPNVRLYILNQKQRLQPIG  1662

Query  222   --GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               GE+ ++G  L+ GY        ++ + L++         + ++ +RTGD +R L +GN
Sbjct  1663  AVGELYIAGEGLARGY--------VNQMRLTEEKFLPDPFVKGEKMYRTGDLSRWLPDGN  1714

Query  396   FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
               FLGR D  +KI G+RI   E+ + L  H  + +A ++   D+     L A+ + K   
Sbjct  1715  IEFLGRNDEQLKIRGYRIEPGEILDALSSHHAIKEAVIVDIQDEDGQKKLVAYFVAKSPV  1774

Query  576   EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                  +  +   +A+ +P  MIP  F   E+ P++SSGKVD
Sbjct  1775  S----ISDLKLHLAKLVPSYMIPTFFVEVENIPLTSSGKVD  1811



>gb|ACM79806.1| ZmaB [Bacillus cereus]
Length=1907

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 119/225 (53%), Gaps = 18/225 (8%)
 Frame = +3

Query  63   NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-----GE  227
            N YG TE + D T +  +   L    + ++ +PIG PL +  V ++GD+   +     GE
Sbjct  562  NAYGPTETTVDSTCYHVQHAEL----EFMNQLPIGRPLANQKVYIMGDNQQLQPVGIPGE  617

Query  228  ICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKST-DHRVQQYFRTGDFARKLQNGNFIF  404
            +C+SG  L+ GY   P +    +V +  N +  S  D +V   +RTGD AR L +GN  +
Sbjct  618  LCISGEGLARGYLNQPKLTMEKFVPIQINKEGSSIIDDKV---YRTGDLARWLPDGNLEY  674

Query  405  LGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK-RDTSLLEAHLIMKENNEH  581
            LGR D  VKI G RI L E+E  L  +PE+ +A VI R  +  D  +L A+++M  + + 
Sbjct  675  LGRMDDQVKIRGLRIELGEIEKQLLRYPEIGEAIVITRKKEGEDAPVLCAYVVMNSSAK-  733

Query  582  VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
               +  +  ++   LP  MIP      E FP+SS+GK+D   L +
Sbjct  734  ---VEEVRQFLREYLPFYMIPAYIIPIEQFPISSNGKIDRKALPD  775


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 107/221 (48%), Gaps = 23/221 (10%)
 Frame = +3

Query  51    TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             T I N+YG TE +   + F  +      E ++ + +PIG P+ +  + +L      +   
Sbjct  1609  TQIENMYGPTEATVIASTFSLQ------ESENYNTIPIGKPIPNVRLYILNHKQRLQPIG  1662

Query  222   --GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               GE+ ++G  L+ GY        ++ + L++         + ++ +RTGD +R L +GN
Sbjct  1663  AVGELYIAGEGLARGY--------VNQMRLTEEKFLPDPFVKGEKMYRTGDLSRWLPDGN  1714

Query  396   FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
               FLGR D  +KI G+RI   E+ + L  H  + +A ++   D+     L A+ + K   
Sbjct  1715  IEFLGRNDEQLKIRGYRIEPGEILDALSSHHAIKEAVIVDIQDEDGQKKLVAYFVAKSPV  1774

Query  576   EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                  +  +   +A+ +P  MIP  F   E+ P++ SGKVD
Sbjct  1775  S----ISDLKLHLAKLVPSYMIPTFFVEVENIPLTPSGKVD  1811



>ref|WP_003301872.1| lichenysin synthetase [Bacillus thuringiensis]
 gb|EEM83084.1| lichenysin synthetase B [Bacillus thuringiensis serovar huazhongensis 
BGSC 4BD1]
Length=1907

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 120/227 (53%), Gaps = 18/227 (8%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-----  221
            + N YG TE + D T +  +   L    + ++ +PIG PL +  V ++GD+   +     
Sbjct  560  LTNAYGPTETTVDSTCYHVQHAEL----EFMNQLPIGRPLANQKVYIMGDNQQLQPVGIP  615

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKST-DHRVQQYFRTGDFARKLQNGNF  398
            GE+C+SG  L+ GY   P +    +V +  N +  S  D +V   +RTGD AR L +GN 
Sbjct  616  GELCISGEGLARGYLNQPKLTMEKFVPIQINKEGSSIIDDKV---YRTGDLARWLPDGNL  672

Query  399  IFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK-RDTSLLEAHLIMKENN  575
             +LGR D  VKI G RI L E+E  L  +PE+ +A VI R  +  D  +L A+++M  + 
Sbjct  673  EYLGRMDDQVKIRGLRIELGEIEKQLLRYPEIGEAIVITRKKEGEDAPVLCAYVVMNSSA  732

Query  576  EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            +    +  +  ++   LP  MIP      E FP+SS+GK+D   L +
Sbjct  733  K----VEEVRQFLREYLPFYMIPAYIIPIEQFPISSNGKIDRKALPD  775


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 107/221 (48%), Gaps = 23/221 (10%)
 Frame = +3

Query  51    TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             T I N+YG TE +   + F  +      E ++ + +PIG P+ +  + +L      +   
Sbjct  1609  TQIENMYGPTEATVIASTFSLQ------ESENYNTIPIGKPIPNVRLYILNQKQRLQPIG  1662

Query  222   --GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               GE+ ++G  L+ GY        ++ + L++         + ++ +RTGD +R L +GN
Sbjct  1663  AVGELYIAGEGLARGY--------VNQMRLTEEKFLPDPFVKGEKMYRTGDLSRWLPDGN  1714

Query  396   FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
               FLGR D  +KI G+RI   E+ + L  H  + +A ++   D+     L A+ + K   
Sbjct  1715  IEFLGRNDEQLKIRGYRIEPGEILDALSSHHAIKEAVIVDIQDEDGQKKLVAYFVAKSPV  1774

Query  576   EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                  +  +   +A+ +P  MIP  F   E+ P++ SGKVD
Sbjct  1775  S----ISDLKLHLAKLVPSYMIPTFFVEVENIPLTPSGKVD  1811



>ref|WP_015149442.1| amino acid adenylation enzyme/thioester reductase family protein 
[Oscillatoria acuminata]
 ref|YP_007086729.1| amino acid adenylation enzyme/thioester reductase family protein 
[Oscillatoria acuminata PCC 6304]
 gb|AFY82809.1| amino acid adenylation enzyme/thioester reductase family protein 
[Oscillatoria acuminata PCC 6304]
Length=1105

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 117/228 (51%), Gaps = 17/228 (7%)
 Frame = +3

Query  42   LPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD-DPN  218
            LP   +LNLYGS+EVS D T +      +I +      V IG P+ +  + +L +   P 
Sbjct  760  LPNRLLLNLYGSSEVSADVTCYASHPGEIIPDK-----VSIGRPIANTQIYILDEAFQPV  814

Query  219  ----EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQ  386
                 GEI V G  L+ GY     +    ++++  N DS        + ++TGD  R L 
Sbjct  815  PIGVRGEIYVGGEGLARGYLNRTELTAERFIKMPGN-DSPGV-----RLYKTGDLGRYLP  868

Query  387  NGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK  566
            +GN  +LGR+D  VKI G RI L EVE  LR HPE+ +A VI R D+     L A+L+ +
Sbjct  869  DGNIQYLGRQDNQVKIRGFRIELAEVEAALRTHPEIQNAVVIVREDEPGNQRLVAYLVCR  928

Query  567  ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            E   ++    +   ++  KLP  M+P  F   E  P++ +GKVD + L
Sbjct  929  ETGRNLSS-NAWREFLLNKLPEYMVPTAFVPLEVLPLNPNGKVDRHAL  975



>ref|WP_015139593.1| amino acid adenylation enzyme/thioester reductase family protein 
[Nostoc sp. PCC 7524]
 ref|YP_007076759.1| amino acid adenylation enzyme/thioester reductase family protein 
[Nostoc sp. PCC 7524]
 gb|AFY49162.1| amino acid adenylation enzyme/thioester reductase family protein 
[Nostoc sp. PCC 7524]
Length=881

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 118/223 (53%), Gaps = 18/223 (8%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGD-----DDPNE  221
            + NLYG TE + D T++ C+      +H +L  VPIG P+ +  + +L +     D    
Sbjct  305  LYNLYGPTEAAIDVTFWQCQ------KHSNLKTVPIGRPIANTQIYILNEHLQPVDVGVI  358

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            GE+ + G+ ++ GY+  P +    ++  +    SK    R+   ++TGD AR L +GN  
Sbjct  359  GEMYIGGVGVARGYWNRPELTNEKFIP-NPFKKSKLVSERL---YKTGDLARYLPDGNLE  414

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
            ++GR D  VKI G+RI + E+EN L  H +V +A +I RN +     L A++     +  
Sbjct  415  YIGRVDYQVKIRGYRIEIGEIENTLCLHSQVREAVIIARNHQNLEKQLVAYITY---DSE  471

Query  582  VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               L S+ +++  KLP  MIP  F   E+ P++ SGKVD   L
Sbjct  472  KPTLNSLRDFLKAKLPDFMIPAAFVMLEALPLTPSGKVDRKAL  514



>gb|EFY08362.1| AMP-binding enzyme [Erysipelothrix rhusiopathiae ATCC 19414]
Length=505

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 117/242 (48%), Gaps = 29/242 (12%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            HL  W+   +  P T  +NLYG TE++ +CTY+  ES     + +    +PIG+P    +
Sbjct  281  HLEKWR---EACPNTEFVNLYGPTEITCNCTYYVLES-----QREYAEELPIGIPFYDDE  332

Query  189  VLLLGD------DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            V LL +      D    GEICV GL L+ GYF         +V+   N   +        
Sbjct  333  VFLLNEKDELVKDSEMLGEICVGGLSLALGYFNNQVQTDRVFVQNPLNPYYRDI------  386

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD     +NG     GRKD  +K  GHRI LEE+E  + EHP V+ A  I+   K 
Sbjct  387  IYRTGDLGYYNKNGELCIRGRKDFQIKHMGHRIELEEIERKIEEHPNVSRACCIYHEKK-  445

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + + I   N +    ++++ +++  KLP  MIP  F      P++ +GK+D  LL
Sbjct  446  ----YKIYGIYHGNLD----VKALISYLETKLPHYMIPNTFIQVHQMPLTKNGKIDRQLL  497

Query  711  AN  716
             +
Sbjct  498  KS  499



>ref|WP_029951781.1| hypothetical protein, partial [Burkholderia sp. A1]
Length=1029

 Score =   119 bits (297),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 74/228 (32%), Positives = 118/228 (52%), Gaps = 14/228 (6%)
 Frame = +3

Query  42   LPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE  221
            LP   + NLYG TE + D T F C   P   + ++   VPIG P+ +  + LL +     
Sbjct  143  LPHAQLHNLYGPTEAAIDVTAFTC---PPDFDAQA---VPIGKPIANTRIYLLDERQAPV  196

Query  222  -----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQ  386
                 GE+ + G+ ++ GY     +    ++    +  +++  H   + +RTGD AR L 
Sbjct  197  PLGAIGELYIGGVGVARGYLNRADLTAQRFL---GDPFARAAGHPEARMYRTGDLARYLP  253

Query  387  NGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK  566
            +GN +FLGR D  VKI G RI L E+E  L +H  V +A VI R D    + L A++ ++
Sbjct  254  DGNIVFLGRNDDQVKIRGFRIELGEIEVQLAKHEAVREAIVIARQDPAGNARLLAYVSLQ  313

Query  567  ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            E     E++R +   +A +LP  M+P  F   ++ P++ +GKVD   L
Sbjct  314  EVAPRAELVRGLREHLAARLPEYMVPAAFVVLDALPLTPNGKVDRRAL  361



>ref|WP_002511955.1| peptide synthetase [Staphylococcus equorum]
 emb|CCI59697.1| putative non-ribosomal siderophore peptide synthetase component 
[Staphylococcus equorum subsp. equorum Mu2]
Length=1257

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/222 (32%), Positives = 120/222 (54%), Gaps = 24/222 (11%)
 Frame = +3

Query  48   QTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDP----  215
             T +LNLYG TE + D T FDCE+      HK+   +PIG P+ +    +L +D+     
Sbjct  733  NTDLLNLYGPTETTVDVTSFDCEN------HKTYDSIPIGKPISNIQAYILNEDNNIMGI  786

Query  216  -NEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
               GE+C++G+ ++AGY   P +    +++   N   K       + +RTGD A+   +G
Sbjct  787  GVSGELCIAGVGVTAGYLNRPELTQEKFID---NPFGKG------KLYRTGDLAKWNGDG  837

Query  393  NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
            N  ++GR D  VKI G+RI L E+E++LR+H  + D A++ R    +   + A+L+  ++
Sbjct  838  NISYIGRIDEQVKIRGYRIELGEIESILRQHTHINDVAIVARPMVDNELSICAYLVSDDS  897

Query  573  NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
             +      S+   + +KLP  MIP      +  P++S+GK++
Sbjct  898  LD----FGSLKTSLGQKLPDYMIPAYMTQLDELPVTSNGKLN  935



>ref|WP_009672437.1| MULTISPECIES: surfactin synthetase, subunit 2 [Paenibacillus]
 gb|EGL19090.1| putative linear gramicidin synthetase subunit A [Paenibacillus 
sp. HGF7]
 gb|EPD81220.1| amino acid adenylation domain-containing protein [Paenibacillus 
sp. HGH0039]
Length=2652

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 118/228 (52%), Gaps = 22/228 (10%)
 Frame = +3

Query  45    PQTAIL-NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE  221
             P  A+L NLYG TE + D TYFDC S       + L  VPIG P+ + ++ ++      +
Sbjct  1870  PGGAVLANLYGPTEATIDVTYFDCPS------GQQLEQVPIGKPIDNTELFIVDAKHQIQ  1923

Query  222   -----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQ  386
                  GE+C++G  L+ GY     +    +V +    ++K         ++TGD AR L 
Sbjct  1924  PIGVPGELCIAGTGLARGYLNRSELTAEKFVPIPHRPEAK--------MYKTGDLARWLP  1975

Query  387   NGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMK  566
             +G+  ++GR D  VKI G+RI L E+E  L    E+ +  V+ R D      L A+L+  
Sbjct  1976  DGSVEYIGRIDHQVKIRGYRIELGEIEARLLNRDEIKETIVMDRTDANGQKYLCAYLVCA  2035

Query  567   ENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             E+ E    +  I   +A +LP  MIP +F F ++ P++S+GK++   L
Sbjct  2036  EDAELT--VSEIRGGLAERLPDYMIPAQFVFLDAMPLTSNGKINRRAL  2081


 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 68/235 (29%), Positives = 104/235 (44%), Gaps = 27/235 (11%)
 Frame = +3

Query  27   ILVKILPQTAILNLYGSTEVSGDCTYFD--CESLPLILEHKSLSGVPIGLPLQS-----C  185
            +L +      I+N YG TE + D ++++   E LP          VPIG PL +      
Sbjct  779  LLSRFAGSMRIMNSYGVTEAAIDSSFYEEAAEKLP------ESGNVPIGKPLGNHRFYIV  832

Query  186  DVLLLGDDDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTG  365
            D  L        GE+C+ G  ++ GY   P        EL+      S      + +RTG
Sbjct  833  DSALRPVPVGVAGELCIGGDSVARGYLNRP--------ELTAEKFVPSPFAEGGRLYRTG  884

Query  366  DFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL  545
            D AR + +G+  F+GR D  VKI G+RI   E+E+ L +   VA A V  R D      L
Sbjct  885  DLARWMPDGSVDFIGRIDYQVKIRGYRIEPGEIESALLKLEGVAQAVVTDRTDSSGHKYL  944

Query  546  EAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A++    +         +   ++ +LP  M+P      ES P++ +GK+D   L
Sbjct  945  CAYVAGHADEAW------LRKRLSAELPGYMVPAHIVRLESLPLTPNGKIDRKAL  993



>ref|WP_002101727.1| lichenysin synthetase [Bacillus cereus]
 gb|EJQ15548.1| amino acid adenylation domain-containing protein [Bacillus cereus 
BAG3X2-2]
Length=1907

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 120/227 (53%), Gaps = 18/227 (8%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-----  221
            + N YG TE + D T +  +   L    + ++ +PIG PL +  V ++GD+   +     
Sbjct  560  LTNAYGPTETTVDSTCYHVQHAEL----EFMNQLPIGRPLANQKVYIMGDNQQLQPVGIP  615

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKST-DHRVQQYFRTGDFARKLQNGNF  398
            GE+C+SG  L+ GY   P +    +V +  N +  S  D +V   +RTGD AR L +GN 
Sbjct  616  GELCISGEGLARGYLNQPKLTMEKFVPIQINKEGSSIIDDKV---YRTGDLARWLPDGNL  672

Query  399  IFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK-RDTSLLEAHLIMKENN  575
             +LGR D  VKI G RI L E+E  L  +PE+ +A VI R  +  D  +L A+++M  + 
Sbjct  673  EYLGRMDDQVKIRGLRIELGEIEKQLLRYPEIGEAIVITRKKEGEDAPVLCAYVVMNSSA  732

Query  576  EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            +    +  +  ++   LP  MIP      E FP+SS+GK+D   L +
Sbjct  733  K----VEEVRQFLREYLPFYMIPAYIIPIEQFPISSNGKIDRKALPD  775


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 107/221 (48%), Gaps = 23/221 (10%)
 Frame = +3

Query  51    TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             T I N+YG TE +   + F  +      E ++ + +PIG P+ +  + +L      +   
Sbjct  1609  TQIENMYGPTEATVIASTFSLQ------ESENYNTIPIGKPIPNVRLYILNQKQRLQPIG  1662

Query  222   --GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               GE+ ++G  L+ GY        ++ + L++         + ++ +RTGD +R L +GN
Sbjct  1663  AVGELYIAGEGLARGY--------VNQMRLTEEKFLPDPFVKGEKMYRTGDLSRWLPDGN  1714

Query  396   FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
               FLGR D  +KI G+RI   E+ + L  H  + +A ++   D+     L A+ + K   
Sbjct  1715  IEFLGRNDEQLKIRGYRIEPGEILDALSSHHAIKEAVIVDIQDEDGQKKLVAYFVAKSPV  1774

Query  576   EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                  +  +   +A+ +P  MIP  F   E+ P++ SGKVD
Sbjct  1775  S----ISDLKLHLAKLVPSYMIPTFFVEVENIPLTPSGKVD  1811



>ref|WP_002182143.1| lichenysin synthetase [Bacillus cereus]
 gb|EJR73162.1| amino acid adenylation domain-containing protein [Bacillus cereus 
VD156]
Length=1907

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 120/227 (53%), Gaps = 18/227 (8%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-----  221
            + N YG TE + D T +  +   L    + ++ +PIG PL +  V ++GD+   +     
Sbjct  560  LTNAYGPTETTVDSTCYHVQHAEL----EFMNQLPIGRPLANQKVYIMGDNQQLQPVGIP  615

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKST-DHRVQQYFRTGDFARKLQNGNF  398
            GE+C+SG  L+ GY   P +    +V +  N +  S  D +V   +RTGD AR L +GN 
Sbjct  616  GELCISGEGLARGYLNQPKLTMEKFVPIQINKEGSSIIDDKV---YRTGDLARWLPDGNL  672

Query  399  IFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK-RDTSLLEAHLIMKENN  575
             +LGR D  VKI G RI L E+E  L  +PE+ +A VI R  +  D  +L A+++M  + 
Sbjct  673  EYLGRMDDQVKIRGLRIELGEIEKQLLRYPEIGEAIVITRKKEGEDAPVLCAYVVMNSSA  732

Query  576  EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            +    +  +  ++   LP  MIP      E FP+SS+GK+D   L +
Sbjct  733  K----VEEVRQFLREYLPFYMIPAYIIPIEQFPISSNGKIDRKALPD  775


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 107/221 (48%), Gaps = 23/221 (10%)
 Frame = +3

Query  51    TAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             T I N+YG TE +   + F  +      E ++ + +PIG P+ +  + +L      +   
Sbjct  1609  TQIENMYGPTEATVIASTFSLQ------ESENYNTIPIGKPIPNVRLYILNQKQRLQPIG  1662

Query  222   --GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGN  395
               GE+ ++G  L+ GY        ++ + L++         + ++ +RTGD +R L +GN
Sbjct  1663  AVGELYIAGEGLARGY--------VNQMRLTEEKFLPDPFVKGEKMYRTGDLSRWLPDGN  1714

Query  396   FIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENN  575
               FLGR D  +KI G+RI   E+ + L  H  + +A ++   D+     L A+ + K   
Sbjct  1715  IEFLGRNDEQLKIRGYRIEPGEILDALSSHHAIKEAVIVDIQDEDGQKKLVAYFVAKSPV  1774

Query  576   EHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                  +  +   +A+ +P  MIP  F   E+ P++ SGKVD
Sbjct  1775  S----ISDLKLHLAKLVPSYMIPTFFVEVENIPLTPSGKVD  1811



>ref|WP_019545185.1| hypothetical protein [Streptomyces sulphureus]
Length=495

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 115/223 (52%), Gaps = 23/223 (10%)
 Frame = +3

Query  63   NLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDD-----DPNEGE  227
            NLYG +E   D TY         L  +  +   IG P+      +LG D     D   GE
Sbjct  288  NLYGPSE---DTTYSTWS-----LVERGAAKPLIGRPVTGTTAHVLGPDGRPVPDGTAGE  339

Query  228  ICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFIFL  407
            + + G  L+ GY   P++    +V    +  S +   R+   +RTGD ARKL  G   +L
Sbjct  340  LHLGGEGLARGYLRRPALTAERFV---PDPFSGTPGARL---YRTGDLARKLPGGELDYL  393

Query  408  GRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEHVE  587
            GR D+ VK+ G RI   E+E+VL EHP V  AAV+ R D  DT+ L A+++ K   +  E
Sbjct  394  GRADQQVKVRGLRIEPGEIESVLAEHPSVRQAAVVARGDTADTARLVAYVVGKAATDPSE  453

Query  588  ILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
            + R ++    ++LPP M+P  F   ++ P++ +GKVD   LA+
Sbjct  454  LRRHLS----KRLPPYMVPEVFLPVKAIPLTVNGKVDVKALAS  492



>ref|WP_039269003.1| bacitracin synthetase [Paenibacillus polymyxa]
 gb|AHM66091.1| bacillorin synthetase b [Paenibacillus polymyxa SQR-21]
Length=13104

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 123/240 (51%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  5398  HVARFQRLVSSLAGAKLVNLYGPTEATVDVSYFDCEP------DEEYAVIPIGKPIQNIR  5451

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V+          +   ++
Sbjct  5452  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVK----DPFAGGEAGYER  5507

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+ 
Sbjct  5508  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVETQLLQVESVREAVVMARTDET  5567

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ + ++     E LRS    + R+LP  M+P  F   E  P+S +GK+D   L
Sbjct  5568  GQKQMVAYYVAEQELGASE-LRSE---LGRELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  5623


 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 123/241 (51%), Gaps = 22/241 (9%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        ++ + +PIG P+Q+  
Sbjct  8476  HVARFQRLVSSLAGAKLVNLYGPTEATVDVSYFDCEP------DEAYAVIPIGKPIQNIR  8529

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V+          +   ++
Sbjct  8530  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVK----DPFAGGEAGYER  8585

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+ 
Sbjct  8586  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVETQLLQVESVREAVVMARADET  8645

Query  531   DTSLLEAHLIMKENNEHVEI-LRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNL  707
                 + A+ +  +     EI  R + + +  +LP  M+P  F   E  P+S +GK+D   
Sbjct  8646  GQKQMVAYYVAGQ-----EISARELRSELGGELPSYMVPSYFVQLEQMPLSPNGKIDRKA  8700

Query  708   L  710
             L
Sbjct  8701  L  8701


 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 110/226 (49%), Gaps = 27/226 (12%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  2332  IINSYGVTEAAIDSSFYDEELSKLP------SSGNVPIGQAWLNARFYIV-DSQLNPVPI  2384

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  2385  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  2436

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
             N  F+GR D  VKI G+RI L E+E V++  P V  A VI R D+R    L  + I  E 
Sbjct  2437  NVDFIGRMDYQVKIRGYRIELGEIETVIQRVPGVRQAVVIDRTDERGHKYLCGY-ITGET  2495

Query  573   NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                +E    +   +   LP  M+PVR    E+ P++S+GK+D   L
Sbjct  2496  ELRIE---EVQAELEAGLPAHMVPVRLMRLETIPLTSNGKIDRKAL  2538


 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 109/232 (47%), Gaps = 39/232 (17%)
 Frame = +3

Query  57     ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
              I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  10732  IMNSYGVTEAAIDSSFYDEELSKLP------SSGHVPIGQAWLNARFYIV-DSQLNPVPI  10784

Query  222    ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                 GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  10785  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  10836

Query  393    NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL------EAH  554
              N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L      EA 
Sbjct  10837  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQAVVIDRMDERGHKYLCGYITGEAE  10896

Query  555    LIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              L M+E    +E            LP  M+P R    E+ P++S+GK+D   L
Sbjct  10897  LRMEEVQTELEA----------GLPAHMVPARLMRLETIPLTSNGKIDRKAL  10938


 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 108/219 (49%), Gaps = 22/219 (10%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN--E  221
             I N+YG TE +   T         + E      + IG P+ +  + +L   G+  P    
Sbjct  3863  IYNMYGPTETTVWST---------VQELTHAQQINIGRPIANTQIYILNANGELQPVGVP  3913

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+C++G  L+ GY+    +    +V    NH   +     ++ +RTGD AR + +GN  
Sbjct  3914  GELCIAGEGLARGYWKREELTAEKFV----NHPFAADKADYERMYRTGDLARWMPDGNIE  3969

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             +LGR D  VKI G+RI L E+E+ L +   V +A ++ R D+   + L A+ +  +    
Sbjct  3970  YLGRMDHQVKIRGYRIELGEIESQLLQVESVQEAVIMARTDETGQTQLVAYYVASQELGA  4029

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              E+ +     + + LP  M+P  F + E  P++ +GK+D
Sbjct  4030  NELRQK----LGQALPSYMVPSYFIWLEQMPLTPNGKID  4064


 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 68/220 (31%), Positives = 110/220 (50%), Gaps = 23/220 (10%)
 Frame = +3

Query  57   ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN--E  221
            I N+YG TE +   T         + E      + IG P+ +  + +L   G+  P    
Sbjct  743  IYNMYGPTETTVWST---------VQELTHAQEINIGRPIANTQIYILNTSGELQPVGIP  793

Query  222  GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
            GE+C++G  L+ GY+    +    +VE +     K+   R+   +RTGD AR   +GN  
Sbjct  794  GELCIAGEGLARGYWNREDLTAEKFVE-NPFAGGKAGYERM---YRTGDLARWTLDGNIE  849

Query  402  FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDK-RDTSLLEAHLIMKENNE  578
            +LGR D  VKI G+RI L E+E+ L +   V +A V+ R+D+      + A+ +  +  E
Sbjct  850  YLGRMDHQVKIRGYRIELGEIESQLLQVESVREATVVARSDETTGQKQMIAYYVANQAME  909

Query  579  HVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              E LRS    + ++LP  M+P  F   E  P++ +GK+D
Sbjct  910  ASE-LRSE---LGQELPSYMVPSYFIQLEQMPLTPNGKID  945


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 119/238 (50%), Gaps = 26/238 (11%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
             +++ K   Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V +L 
Sbjct  6919  ELVYKWKDQVAYYNGYGPTENSVATSIW-----PVSEDERAGQLISIGRPMPNHRVYMLD  6973

Query  201   --GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQN----HDSKSTDHRVQQYF  356
               G   P    GE+CVSG  L+ GY        LD  EL+      +   + +   ++ +
Sbjct  6974  VHGHLAPVGVAGELCVSGPGLARGY--------LDRSELTAEKFVPNPFAAGEAGYERMY  7025

Query  357   RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
             RTGD AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  
Sbjct  7026  RTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQ  7085

Query  537   SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             + L A+ + + +    E LRS+   +  +LP  M+P  F   +  P++ +GK+D   L
Sbjct  7086  NQLVAYYVAERDVSAGE-LRSL---LGEELPNYMVPSYFIQLKQMPLTPNGKIDRKAL  7139


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 106/229 (46%), Gaps = 28/229 (12%)
 Frame = +3

Query  45     PQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE-  221
              P   I N+YG TE     T F      + ++ +S   VPIG P+ +    ++      + 
Sbjct  12243  PSLRISNIYGPTE----NTTFSTVHAIIGVQSES---VPIGRPIHNSTAYVVDHSMRLQP  12295

Query  222    ----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQN  389
                  GE+ V G  ++ GY   P +    +++        S     ++ +RTGD  R   +
Sbjct  12296  VGVWGELWVGGDGVARGYRNRPDLTSEKFID--------SPFRSGERCYRTGDMVRLNAD  12347

Query  390    GNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKE  569
              G   + GR D  VKI G+RI L EVE  L +   V +A VI R D++    L A+++   
Sbjct  12348  GTLEYKGRIDAQVKIRGYRIELGEVETQLLKLEAVQEAVVIAREDEQGQKQLCAYVVA--  12405

Query  570    NNEHV--EILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
               NE V   +LRS  N   +KLP  MIP      E  P++ +GK+D   L
Sbjct  12406  -NEEVVASVLRSTLN---QKLPGYMIPSYLVQLEQMPLTPNGKIDRKAL  12450


 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 106/227 (47%), Gaps = 29/227 (13%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  9626  IMNSYGVTEAAIDSSFYDEELSKLP------SSGHVPIGQAWLNARFYIV-DSQLNPVPI  9678

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  9679  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  9730

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVI-FRNDKRDTSLLEAHLIMKE  569
             N  F+GR D  VKI G RI L EVE  L     +  A V  + N+  D  L  A+++  E
Sbjct  9731  NVDFIGRMDDQVKIRGFRIELGEVEAQLLTVDGIEKAIVTAWENENGDKDLC-AYVVASE  9789

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                  E LRS    +  KLP  MIP      + FP++ +GK+D   L
Sbjct  9790  ALNLPE-LRST---LQPKLPSYMIPTYVVPLDQFPLTPNGKIDRKAL  9832



>ref|WP_034886863.1| AMP-dependent synthetase [Erysipelothrix rhusiopathiae]
Length=504

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 117/242 (48%), Gaps = 29/242 (12%)
 Frame = +3

Query  9    HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
            HL  W+   +  P T  +NLYG TE++ +CTY+  ES     + +    +PIG+P    +
Sbjct  280  HLEKWR---EACPNTEFVNLYGPTEITCNCTYYVLES-----QREYAEELPIGIPFYDDE  331

Query  189  VLLLGD------DDPNEGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
            V LL +      D    GEICV GL L+ GYF         +V+   N   +        
Sbjct  332  VFLLNEKDELVKDSEMLGEICVGGLSLALGYFNNQVQTDRVFVQNPLNPYYRDI------  385

Query  351  YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
             +RTGD     +NG     GRKD  +K  GHRI LEE+E  + EHP V+ A  I+   K 
Sbjct  386  IYRTGDLGYYNKNGELCIRGRKDFQIKHMGHRIELEEIERKIEEHPNVSRACCIYHEKK-  444

Query  531  DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + + I   N +    ++++ +++  KLP  MIP  F      P++ +GK+D  LL
Sbjct  445  ----YKIYGIYHGNLD----VKALISYLETKLPHYMIPNTFIQVHQMPLTKNGKIDRQLL  496

Query  711  AN  716
             +
Sbjct  497  KS  498



>ref|WP_004624905.1| amino acid adenylation domain protein [[Clostridium] termitidis]
 gb|EMS72644.1| amino acid adenylation domain protein [ [[Clostridium] termitidis 
CT1112]
Length=1147

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 128/239 (54%), Gaps = 22/239 (9%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H+ L+K L++    T + NLYG TE + D +YFDC      +  + L G+PIG P+ +  
Sbjct  810   HVRLFKRLLE-KNGTQLANLYGPTEATVDVSYFDC------ITKEDLDGIPIGKPIDNIR  862

Query  189   VLLLGDD-DPN----EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQY  353
             + ++     P      GE+C++G+ L+ GY   P        EL+      +T    Q+ 
Sbjct  863   LYIMDKKMHPQPIGVAGELCIAGVGLARGYLNLP--------ELTDEKFVPNTLEPGQKL  914

Query  354   FRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRD  533
             +RTGD A+  ++GN  +LGR D  VKI G RI L E+E VL+EHP V + +++   +K+ 
Sbjct  915   YRTGDLAKWREDGNIEYLGRMDFQVKIRGLRIELGEIERVLQEHPAVRE-SIVTAWEKQP  973

Query  534   TSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
              ++     ++ E    VE    +  ++ + LP  M+P  + F ++ P+S++GKVD   L
Sbjct  974   GNMHLVGYVVHEKGMEVES-GELQAFLEKALPEYMVPRIYVFLDTMPLSANGKVDRKAL  1031



>ref|WP_014213229.1| amino acid adenylation enzyme/thioester reductase family protein 
[Mycobacterium rhodesiae]
 ref|YP_005002701.1| amino acid adenylation enzyme/thioester reductase family protein 
[Mycobacterium rhodesiae NBB3]
 gb|AEV75486.1| amino acid adenylation enzyme/thioester reductase family protein 
[Mycobacterium rhodesiae NBB3]
Length=2490

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 121/235 (51%), Gaps = 24/235 (10%)
 Frame = +3

Query  18   LWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLL  197
            + K L ++ P   ++N+YG TE +   TY+  + +P     +  + +PIG PL +  +L+
Sbjct  718  MRKALAQLGP-GKLMNVYGPTEATIFTTYYPVDDVP-----EDATNIPIGYPLSNTKILI  771

Query  198  LGDDDPN----EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTG  365
            L    P      GE+C++G  + AGY        LD    SQ   +   D    +++RTG
Sbjct  772  LNGRSPVPVNVAGELCIAGDGVVAGY--------LDKDLTSQRFVNIGGD----RFYRTG  819

Query  366  DFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLL  545
            D A+  ++G   ++GR DR VKI G RI  EE+E VL+ HP V +AAVI R ++R    L
Sbjct  820  DIAKWREDGAIEYVGRLDRQVKIRGQRIEPEEIEAVLQAHPGVKEAAVIVRANERGDKSL  879

Query  546  EAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
            +A      +N        +T  I R LP  MIP      E+ P+ ++GK+D + L
Sbjct  880  QAFCTCAADNSTTP--DELTAHIGRHLPRYMIPASLATIEAMPLDANGKIDRHRL  932


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 88/209 (42%), Gaps = 58/209 (28%)
 Frame = +3

Query  159   PIGLPLQSCDVLLL-GDDDPNE----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDS  323
             PIG PL +  + +L GD  P      GE+ + G  +  GY+                 D+
Sbjct  1780  PIGKPLSNTRLYVLDGDRQPVAVGVVGELYIGGDGVGMGYWG----------------DA  1823

Query  324   KSTDHRV--------QQYFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLR  479
             + T  R            +R+GD  + L  G+ +++GR D  +K+ G RI   E+E  L 
Sbjct  1824  RLTCQRFVPDPWVAGAVMYRSGDMVKWLDTGDLVYVGRVDEQIKLRGFRIEPGEIEARLL  1883

Query  480   EHPEVADAAVIFRNDKR----------DTSLLEAHLIMKENNEHVEILRSITNWIARKLP  629
             EHP V   AVI + D+           D +LL+ HL                      LP
Sbjct  1884  EHPAVGQCAVIVKGDRLVAFYTSDEPVDDTLLKTHL-------------------RTTLP  1924

Query  630   PAMIPVRFFFTESFPMSSSGKVDYNLLAN  716
               M+P RF  T+  P++++GK+D   LA 
Sbjct  1925  YYMVPDRFEHTDRLPLTNNGKIDRQTLAT  1953



>gb|AHM65910.1| bacillorin synthetase b [Paenibacillus polymyxa SQR-21]
Length=10771

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 122/240 (51%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        ++ + +PIG P+Q+  
Sbjct  5913  HVARFQRLVSTLAGAKLVNLYGPTEATVDVSYFDCEP------DEAYAVIPIGKPIQNIR  5966

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V           +   ++
Sbjct  5967  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFV----ADPFAGGEAGYER  6022

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+ 
Sbjct  6023  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVETQLLQVEAVREAVVMARADET  6082

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E LRS    + R+LP  M+P  F   E  P+S +GK+D   L
Sbjct  6083  GQKQMVAYYVAGQEIRASE-LRSE---LGRELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  6138


 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 122/240 (51%), Gaps = 20/240 (8%)
 Frame = +3

Query  9     HLSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCD  188
             H++ ++ LV  L    ++NLYG TE + D +YFDCE        +  + +PIG P+Q+  
Sbjct  2835  HVARFQRLVSTLTGAKLVNLYGPTEATVDVSYFDCEP------DEEYAVIPIGKPIQNIR  2888

Query  189   VLLLGDDDPN------EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQ  350
             + ++ +           GE+C+ G+ ++ GY   P +    +V+          +   ++
Sbjct  2889  LYIVKEGTEQLQPIGVAGELCIGGVGVARGYLNRPELTAEKFVK----DPFAGGEAGYER  2944

Query  351   YFRTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKR  530
              +RTGD AR + +GN  +LGR D  VKI G+RI L EVE  L +   V +A V+ R D+ 
Sbjct  2945  MYRTGDLARWMPDGNIEYLGRIDHQVKIRGYRIELGEVETQLLQVKSVREAVVMARTDET  3004

Query  531   DTSLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                 + A+ +  +     E LRS    + R+LP  M+P  F   E  P+S +GK+D   L
Sbjct  3005  GQKQMVAYYVAGQELGASE-LRSE---LGRELPSYMVPSYFVQLEQMPLSPNGKIDRKAL  3060


 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 111/226 (49%), Gaps = 27/226 (12%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  8168  IINSYGVTEAAIDSSFYDEELSKLP------SSGNVPIGQAWLNARFYIV-DSQLNPVPI  8220

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G+ ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  8221  GVLGELCIGGIGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  8272

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKEN  572
             N  F+GR D  VKI G+RI L E+E  ++  P V  A VI R D+R    L  + I  E 
Sbjct  8273  NVDFIGRMDYQVKIRGYRIELGEIETAIQRVPGVRQAVVIDRTDERGHKYLCGY-ITGET  8331

Query  573   NEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                +E +++    +   LP  M+P R    E+ P++S+GK+D   L
Sbjct  8332  ELRIEEVQAA---LEAGLPAHMVPARLMRLETIPLTSNGKIDRKAL  8374


 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/219 (28%), Positives = 107/219 (49%), Gaps = 22/219 (10%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL---GDDDPN--E  221
             I N+YG TE +   T         + E      + IG P+ +  + ++   G+  P    
Sbjct  1295  IYNMYGPTETTVWST---------VQELTRAQQINIGRPIANTQIYIMNANGELQPVGVP  1345

Query  222   GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNGNFI  401
             GE+C++G  L+ GY+    +    +V    NH         ++ +RTGD AR + +GN  
Sbjct  1346  GELCIAGEGLARGYWKREELTAEKFV----NHPFAGGKADHERMYRTGDLARWMPDGNLE  1401

Query  402   FLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLEAHLIMKENNEH  581
             +LGR D  +KI G+RI L E+E+ L +   V +A ++ R D+   + L A+ +  +    
Sbjct  1402  YLGRMDHQIKIRGYRIELGEIESQLLQVESVQEAVIMARTDETGQTQLVAYYVASQELGA  1461

Query  582   VEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
              E+ +     + + LP  M+P  F + E  P++ +GK+D
Sbjct  1462  GELRQK----LGQALPSYMVPSYFIWLEQMPLTPNGKID  1496


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 116/234 (50%), Gaps = 18/234 (8%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
             +++ K   Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V +L 
Sbjct  4356  ELVYKWKDQVAYYNGYGPTENSVATSIW-----PVSEDERAGQLISIGRPMPNHRVYMLD  4410

Query  201   --GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
               G   P    GE+CVSG  L+ GY   P +    +V     +   + +   ++ +RTGD
Sbjct  4411  VHGHLAPVGVAGELCVSGPGLARGYLDRPELTAEKFVP----NPFAAGEAGYERMYRTGD  4466

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
              AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  + L 
Sbjct  4467  LARWMPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQNQLV  4526

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ + + +    E LR +   +   LP  M+P  F   E  P++ +GK+D   L
Sbjct  4527  AYYVAERDVSASE-LRGL---LGEDLPNYMVPSYFIQLEQMPLTPNGKIDRKAL  4576


 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 116/234 (50%), Gaps = 18/234 (8%)
 Frame = +3

Query  24    KILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDVLLL-  200
             +++ K   Q A  N YG TE S   + +     P+  + ++   + IG P+ +  V ++ 
Sbjct  9667  ELVYKWKDQVAYYNGYGPTENSVATSIW-----PVSKDERAGQLISIGRPVPNHRVYMVD  9721

Query  201   --GDDDPN--EGEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGD  368
               G   P    GE+CVSG  L+ GY   P +    +V     +   + +   ++ +RTGD
Sbjct  9722  VHGHLAPVGVAGELCVSGPGLARGYLDRPELTAEKFVP----NPFAAGEAGYERMYRTGD  9777

Query  369   FARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDTSLLE  548
              AR + +GN  +LGR D  VKI G+RI L EVE  + +  +V +  V+ + D++  + L 
Sbjct  9778  LARWMPDGNIEYLGRIDHQVKIRGYRIELGEVEAQILKVEDVQEVIVLAQADEQGQNQLV  9837

Query  549   AHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
             A+ + +      E LRS+   +  +LP  M+P      E  P++ +GK+D   L
Sbjct  9838  AYYVAEREVSAGE-LRSL---LGEELPNYMVPSFLVQLEQMPLTPNGKIDRKAL  9887


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 106/227 (47%), Gaps = 29/227 (13%)
 Frame = +3

Query  57    ILNLYGSTEVSGDCTYFDCE--SLPLILEHKSLSGVPIGLPLQSCDVLLLGDDDPNE---  221
             I+N YG TE + D +++D E   LP      S   VPIG    +    ++ D   N    
Sbjct  7063  IINSYGVTEAAIDSSFYDEELSKLP------SSGNVPIGQAWLNARFYIV-DSQLNPVPI  7115

Query  222   ---GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYFRTGDFARKLQNG  392
                GE+C+ G  ++ GY        L+  +L+      +     ++ +RTGD AR + +G
Sbjct  7116  GVLGELCIGGAGVARGY--------LNRADLTAEKFVANPYVPGERLYRTGDLARWMPDG  7167

Query  393   NFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVI-FRNDKRDTSLLEAHLIMKE  569
             +  F+GR D  VKI G RI L EVE  L     +  A V  + N+  D  L  A+++  E
Sbjct  7168  HVDFIGRMDDQVKIRGFRIELGEVEAQLLTVAGIEKAIVTAWENEDGDKDLC-AYVVASE  7226

Query  570   NNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVDYNLL  710
                  E LRS    +  KLP  MIP      + FP++ +GK+D   L
Sbjct  7227  ALNLPE-LRST---LQPKLPGYMIPTYVVPLDRFPLTPNGKIDRKAL  7269



>ref|WP_017744607.1| hypothetical protein [Scytonema hofmanni]
Length=1378

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 121/234 (52%), Gaps = 23/234 (10%)
 Frame = +3

Query  12   LSLWKILVKILPQTAILNLYGSTEVSGDCTYFDCESLPLILEHKSLSGVPIGLPLQSCDV  191
            +SL +  ++++P   ++NLYGS+EVS + T++D   LP       L  VPIG P+ +  V
Sbjct  785  VSLTQTFLQLMPGAKLINLYGSSEVSANVTHYDTSLLP-----DKLISVPIGRPIDNTQV  839

Query  192  LLLGDD-DPNE----GEICVSGLCLSAGYFCYPSVLPLDYVELSQNHDSKSTDHRVQQYF  356
             +L     P      GE+ V G  L+ GY   P        EL+Q     +      + +
Sbjct  840  YVLNRHLQPTPVGVVGELYVGGDGLARGYLHRP--------ELTQERFIDNPFVPGTKLY  891

Query  357  RTGDFARKLQNGNFIFLGRKDRTVKISGHRIALEEVENVLREHPEVADAAVIFRNDKRDT  536
            +TGD  R L +GN  +LGR+D  VKI G R+ L E+   + +HP+V ++ VI R+D+ D 
Sbjct  892  KTGDLVRYLIDGNLEYLGRRDDQVKIRGFRVELGEIAAAIAQHPDVKESVVIARDDEGDR  951

Query  537  SLLEAHLIMKENNEHVEILRSITNWIARKLPPAMIPVRFFFTESFPMSSSGKVD  698
                 HLI        +I+  +   + +KLP  M+P  F   ++ P++ +GKVD
Sbjct  952  -----HLIAYVVTPKQDIVAQLLPHLQQKLPNYMLPSAFVVLDAIPLTPNGKVD  1000



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1178898346980