BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c42941_g1_i1 len=1020 path=[1:0-1019]

Length=1020
                                                                      Score     E

ref|XP_009601154.1|  PREDICTED: beta-carotene isomerase D27, chlo...    315   1e-102   
ref|XP_009765814.1|  PREDICTED: beta-carotene isomerase D27, chlo...    311   3e-101   
gb|KDO68594.1|  hypothetical protein CISIN_1g040644mg                   306   3e-99    
ref|XP_009601155.1|  PREDICTED: beta-carotene isomerase D27, chlo...    305   5e-99    
ref|XP_004247333.1|  PREDICTED: beta-carotene isomerase D27, chlo...    303   3e-98    
ref|XP_006443948.1|  hypothetical protein CICLE_v10023937mg             303   3e-98    
gb|AEW07379.1|  dwarf 27                                                300   6e-97    
ref|XP_003634993.1|  PREDICTED: beta-carotene isomerase D27, chlo...    295   3e-95    
emb|CBI25060.3|  unnamed protein product                                295   6e-95    
ref|XP_008449360.1|  PREDICTED: LOW QUALITY PROTEIN: beta-caroten...    293   3e-94    
gb|KHN10698.1|  hypothetical protein glysoja_019129                     291   4e-94    
ref|XP_004495151.1|  PREDICTED: beta-carotene isomerase D27, chlo...    292   4e-94    
ref|XP_004145371.1|  PREDICTED: uncharacterized protein LOC101219340    292   4e-94    
ref|XP_008386409.1|  PREDICTED: beta-carotene isomerase D27, chlo...    291   6e-94    
ref|XP_010038049.1|  PREDICTED: beta-carotene isomerase D27, chlo...    291   1e-93    
ref|XP_004290643.1|  PREDICTED: uncharacterized protein LOC101311145    290   7e-93    
gb|KDP21385.1|  hypothetical protein JCGZ_21856                         288   2e-92    
ref|XP_007162478.1|  hypothetical protein PHAVU_001G155600g             287   3e-92    
ref|XP_008235341.1|  PREDICTED: beta-carotene isomerase D27, chlo...    289   4e-92    
emb|CDP03682.1|  unnamed protein product                                288   6e-92    
ref|XP_008368789.1|  PREDICTED: beta-carotene isomerase D27, chlo...    286   1e-91    
ref|XP_009370743.1|  PREDICTED: beta-carotene isomerase D27, chlo...    285   2e-91    
ref|XP_007200092.1|  hypothetical protein PRUPE_ppa019954mg             283   2e-90    
ref|XP_011026332.1|  PREDICTED: beta-carotene isomerase D27, chlo...    282   5e-90    
ref|XP_003518899.1|  PREDICTED: beta-carotene isomerase D27, chlo...    281   5e-90    
gb|KHN18846.1|  hypothetical protein glysoja_028215                     281   7e-90    
ref|XP_003520579.1|  PREDICTED: beta-carotene isomerase D27, chlo...    281   8e-90    
ref|XP_011079931.1|  PREDICTED: beta-carotene isomerase D27, chlo...    281   9e-90    
ref|XP_007050450.1|  DWARF27, putative isoform 1                        280   2e-89    
ref|XP_006588652.1|  PREDICTED: beta-carotene isomerase D27, chlo...    278   8e-89    
ref|XP_011042448.1|  PREDICTED: beta-carotene isomerase D27, chlo...    278   3e-88    
ref|XP_007050451.1|  DWARF27, putative isoform 2                        276   4e-88    
ref|XP_006575048.1|  PREDICTED: beta-carotene isomerase D27, chlo...    275   3e-87    
ref|XP_007144677.1|  hypothetical protein PHAVU_007G175900g             273   1e-86    
ref|XP_011042447.1|  PREDICTED: beta-carotene isomerase D27, chlo...    274   2e-86    
ref|XP_004493731.1|  PREDICTED: beta-carotene isomerase D27, chlo...    270   3e-85    
ref|XP_008802562.1|  PREDICTED: beta-carotene isomerase D27, chlo...    262   3e-82    
ref|XP_010932838.1|  PREDICTED: beta-carotene isomerase D27, chlo...    260   2e-81    
ref|XP_009389836.1|  PREDICTED: beta-carotene isomerase D27, chlo...    256   4e-80    
gb|EYU46537.1|  hypothetical protein MIMGU_mgv1a012261mg                255   1e-79    
ref|XP_010522757.1|  PREDICTED: beta-carotene isomerase D27, chlo...    255   1e-79    
gb|KEH23841.1|  beta-carotene isomerase D27                             254   4e-79    
ref|XP_006575049.1|  PREDICTED: beta-carotene isomerase D27, chlo...    252   2e-78    
ref|XP_009402431.1|  PREDICTED: beta-carotene isomerase D27, chlo...    251   4e-78    
gb|ABA94460.1|  hypothetical protein LOC_Os11g37650                     246   2e-76    Oryza sativa Japonica Group [Japonica rice]
sp|C7AU21.1|D27_ORYSJ  RecName: Full=Beta-carotene isomerase D27,...    246   6e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010679144.1|  PREDICTED: beta-carotene isomerase D27, chlo...    244   2e-75    
gb|EEC68482.1|  hypothetical protein OsI_36734                          245   2e-75    Oryza sativa Indica Group [Indian rice]
dbj|BAJ90178.1|  predicted protein                                      241   1e-73    
ref|XP_003577412.1|  PREDICTED: beta-carotene isomerase D27, chlo...    240   2e-73    
ref|XP_006418271.1|  hypothetical protein EUTSA_v10008499mg             239   2e-73    
ref|NP_001144840.1|  hypothetical protein precursor                     239   3e-73    Zea mays [maize]
tpg|DAA42209.1|  TPA: hypothetical protein ZEAMMB73_458126              238   3e-73    
ref|XP_008670838.1|  PREDICTED: LOW QUALITY PROTEIN: beta-caroten...    239   3e-73    
ref|XP_004979587.1|  PREDICTED: beta-carotene isomerase D27, chlo...    236   1e-71    
ref|NP_563673.1|  inhibition of secondary bud outgrowth protein D...    229   3e-69    Arabidopsis thaliana [mouse-ear cress]
gb|KFK42667.1|  hypothetical protein AALP_AA1G024100                    228   5e-69    
ref|XP_002892145.1|  hypothetical protein ARALYDRAFT_470283             228   7e-69    
ref|XP_010087115.1|  hypothetical protein L484_012546                   228   8e-69    
ref|XP_009118720.1|  PREDICTED: beta-carotene isomerase D27, chlo...    227   1e-68    
ref|XP_002449767.1|  hypothetical protein SORBIDRAFT_05g022855          228   1e-68    Sorghum bicolor [broomcorn]
emb|CDY32495.1|  BnaA09g51010D                                          227   1e-68    
emb|CDY37443.1|  BnaC08g45810D                                          226   3e-68    
ref|XP_010474908.1|  PREDICTED: beta-carotene isomerase D27, chlo...    224   1e-67    
ref|XP_010457314.1|  PREDICTED: beta-carotene isomerase D27, chlo...    223   7e-67    
ref|XP_007144678.1|  hypothetical protein PHAVU_007G175900g             220   3e-66    
ref|XP_006303275.1|  hypothetical protein CARUB_v10010025mg             218   8e-65    
gb|EMT30070.1|  hypothetical protein F775_05620                         221   9e-65    
ref|XP_010481514.1|  PREDICTED: beta-carotene isomerase D27, chlo...    217   1e-64    
ref|XP_006575050.1|  PREDICTED: beta-carotene isomerase D27, chlo...    209   3e-62    
ref|XP_002520968.1|  hypothetical protein RCOM_0991210                  210   3e-62    Ricinus communis
ref|XP_006349770.1|  PREDICTED: beta-carotene isomerase D27, chlo...    203   1e-60    
ref|XP_001767010.1|  predicted protein                                  195   6e-57    
ref|XP_004979588.1|  PREDICTED: beta-carotene isomerase D27, chlo...    193   3e-55    
ref|XP_010917646.1|  PREDICTED: beta-carotene isomerase D27, chlo...    181   6e-52    
ref|XP_002975730.1|  hypothetical protein SELMODRAFT_103856             181   3e-51    
ref|XP_002973675.1|  hypothetical protein SELMODRAFT_173467             181   4e-51    
ref|XP_010274248.1|  PREDICTED: beta-carotene isomerase D27, chlo...    172   3e-49    
ref|WP_035989675.1|  hypothetical protein                               174   1e-48    
gb|AFI78801.1|  putative D27 family protein                             174   2e-48    
ref|WP_006454034.1|  hypothetical protein                               172   4e-48    
ref|WP_036053421.1|  hypothetical protein                               172   4e-48    
gb|ESA35998.1|  hypothetical protein N836_09250                         172   6e-48    
ref|XP_002973525.1|  hypothetical protein SELMODRAFT_99956              171   7e-47    
ref|WP_039726288.1|  hypothetical protein                               169   1e-46    
gb|AFI78793.1|  putative D27 family protein                             170   1e-46    
ref|WP_015220760.1|  hypothetical protein                               168   1e-46    
ref|WP_026072724.1|  hypothetical protein                               168   2e-46    
gb|EPS65195.1|  hypothetical protein M569_09583                         164   3e-46    
gb|AFI78796.1|  putative D27 protein                                    170   5e-46    
ref|WP_036029921.1|  hypothetical protein                               166   6e-46    
ref|XP_002975556.1|  hypothetical protein SELMODRAFT_103815             168   7e-46    
ref|WP_017713741.1|  hypothetical protein                               165   3e-45    
ref|WP_010468065.1|  hypothetical protein                               164   4e-45    
ref|XP_008808026.1|  PREDICTED: beta-carotene isomerase D27, chlo...    162   4e-45    
ref|WP_026100817.1|  hypothetical protein                               164   7e-45    
ref|WP_017293102.1|  hypothetical protein                               164   7e-45    
ref|WP_012161496.1|  hypothetical protein                               163   1e-44    
ref|XP_006846590.1|  hypothetical protein AMTR_s00018p00255680          164   3e-44    
ref|WP_006515049.1|  hypothetical protein                               162   5e-44    
ref|XP_002518917.1|  conserved hypothetical protein                     163   7e-44    Ricinus communis
ref|XP_001752784.1|  predicted protein                                  163   7e-44    
ref|XP_002990234.1|  hypothetical protein SELMODRAFT_47927              159   1e-43    
gb|AFI78792.1|  putative D27 protein                                    160   1e-43    
ref|XP_006386251.1|  hypothetical protein POPTR_0002s04730g             157   2e-43    
ref|WP_015223224.1|  hypothetical protein                               160   3e-43    
ref|XP_010100206.1|  hypothetical protein L484_015351                   157   2e-42    
ref|XP_002961899.1|  hypothetical protein SELMODRAFT_67943              155   2e-42    
gb|KDO76733.1|  hypothetical protein CISIN_1g0237092mg                  158   2e-42    
gb|EPS62650.1|  hypothetical protein M569_12140                         157   2e-42    
emb|CDY34380.1|  BnaA09g11220D                                          158   2e-42    
ref|XP_006439216.1|  hypothetical protein CICLE_v10021724mg             158   4e-42    
ref|XP_004502060.1|  PREDICTED: beta-carotene isomerase D27, chlo...    157   1e-41    
ref|XP_009784263.1|  PREDICTED: beta-carotene isomerase D27, chlo...    158   1e-41    
gb|AFI78797.1|  putative D27 family protein                             156   1e-41    
ref|XP_006476281.1|  PREDICTED: beta-carotene isomerase D27, chlo...    157   1e-41    
ref|XP_003601450.1|  hypothetical protein MTR_3g080840                  157   1e-41    
ref|XP_006476282.1|  PREDICTED: beta-carotene isomerase D27, chlo...    156   2e-41    
ref|XP_009112920.1|  PREDICTED: beta-carotene isomerase D27, chlo...    156   2e-41    
gb|ELS33194.1|  hypothetical protein Pse7429DRAFT_1458                  155   2e-41    
ref|XP_006391710.1|  hypothetical protein EUTSA_v10023652mg             155   2e-41    
ref|WP_040687789.1|  hypothetical protein                               154   2e-41    
ref|XP_009112776.1|  PREDICTED: beta-carotene isomerase D27, chlo...    155   3e-41    
emb|CDY38220.1|  BnaA09g11690D                                          155   3e-41    
ref|XP_003542154.1|  PREDICTED: beta-carotene isomerase D27, chlo...    155   3e-41    
ref|XP_010430616.1|  PREDICTED: beta-carotene isomerase D27, chlo...    155   4e-41    
ref|XP_010473733.1|  PREDICTED: beta-carotene isomerase D27, chlo...    155   4e-41    
gb|AFK33703.1|  unknown                                                 155   5e-41    
ref|XP_006302733.1|  hypothetical protein CARUB_v10020846mg             155   6e-41    
ref|XP_008448557.1|  PREDICTED: beta-carotene isomerase D27, chlo...    155   7e-41    
gb|KDP25210.1|  hypothetical protein JCGZ_20366                         154   1e-40    
ref|XP_009351108.1|  PREDICTED: beta-carotene isomerase D27, chlo...    154   1e-40    
emb|CDY25531.1|  BnaC09g11560D                                          154   1e-40    
ref|XP_011026780.1|  PREDICTED: beta-carotene isomerase D27, chlo...    153   2e-40    
ref|XP_005648267.1|  hypothetical protein COCSUDRAFT_33175              153   2e-40    
ref|XP_004159751.1|  PREDICTED: uncharacterized LOC101210861            153   3e-40    
ref|XP_002299424.2|  hypothetical protein POPTR_0001s11420g             153   3e-40    Populus trichocarpa [western balsam poplar]
gb|KGN55666.1|  hypothetical protein Csa_3G002850                       153   4e-40    
emb|CDY08324.1|  BnaC09g12720D                                          151   4e-40    
ref|XP_007039378.1|  Uncharacterized protein isoform 1                  152   5e-40    
gb|AFI78798.1|  putative D27 family protein                             150   5e-40    
ref|XP_002887868.1|  hypothetical protein ARALYDRAFT_474875             152   8e-40    
ref|XP_008784871.1|  PREDICTED: beta-carotene isomerase D27, chlo...    152   9e-40    
ref|XP_005849128.1|  hypothetical protein CHLNCDRAFT_57404              152   1e-39    
ref|XP_002279815.1|  PREDICTED: beta-carotene isomerase D27, chlo...    151   1e-39    Vitis vinifera
ref|XP_009391936.1|  PREDICTED: beta-carotene isomerase D27, chlo...    151   1e-39    
ref|XP_006352216.1|  PREDICTED: beta-carotene isomerase D27, chlo...    151   2e-39    
gb|AFI78800.1|  putative D27 family protein                             149   2e-39    
ref|XP_004973014.1|  PREDICTED: beta-carotene isomerase D27, chlo...    150   3e-39    
gb|KHN47227.1|  hypothetical protein glysoja_035018                     150   4e-39    
ref|NP_564838.1|  uncharacterized protein                               150   4e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001697941.1|  hypothetical protein CHLREDRAFT_205884             150   5e-39    Chlamydomonas reinhardtii
dbj|BAJ85620.1|  predicted protein                                      150   6e-39    
gb|ABK23534.1|  unknown                                                 150   6e-39    Picea sitchensis
ref|XP_010544885.1|  PREDICTED: beta-carotene isomerase D27, chlo...    150   7e-39    
ref|XP_003518626.1|  PREDICTED: beta-carotene isomerase D27, chlo...    150   7e-39    
ref|XP_002444917.1|  hypothetical protein SORBIDRAFT_07g001450          149   7e-39    Sorghum bicolor [broomcorn]
ref|XP_004146203.1|  PREDICTED: uncharacterized protein LOC101210861    149   9e-39    
gb|KDO76732.1|  hypothetical protein CISIN_1g0237092mg                  149   1e-38    
ref|XP_005852063.1|  hypothetical protein CHLNCDRAFT_133062             145   1e-38    
ref|XP_001763276.1|  predicted protein                                  146   1e-38    
ref|XP_006659061.1|  PREDICTED: beta-carotene isomerase D27, chlo...    145   2e-38    
ref|XP_011070388.1|  PREDICTED: beta-carotene isomerase D27, chlo...    148   2e-38    
emb|CDP12233.1|  unnamed protein product                                146   2e-38    
ref|XP_007209510.1|  hypothetical protein PRUPE_ppa010428mg             147   3e-38    
ref|XP_010053065.1|  PREDICTED: beta-carotene isomerase D27, chlo...    148   3e-38    
gb|KFK38026.1|  hypothetical protein AALP_AA3G060400                    147   6e-38    
dbj|BAK00540.1|  predicted protein                                      147   7e-38    
ref|NP_001060847.1|  Os08g0114100                                       147   7e-38    Oryza sativa Japonica Group [Japonica rice]
gb|EYU26083.1|  hypothetical protein MIMGU_mgv1a011732mg                147   8e-38    
ref|XP_007151966.1|  hypothetical protein PHAVU_004G090400g             147   8e-38    
ref|XP_008239258.1|  PREDICTED: beta-carotene isomerase D27, chlo...    146   1e-37    
gb|KDO76735.1|  hypothetical protein CISIN_1g0237092mg                  145   1e-37    
ref|XP_010676912.1|  PREDICTED: beta-carotene isomerase D27, chlo...    145   2e-37    
ref|XP_010267423.1|  PREDICTED: beta-carotene isomerase D27, chlo...    144   5e-37    
ref|XP_006826723.1|  hypothetical protein AMTR_s00264p00017830          139   5e-37    
ref|XP_010909506.1|  PREDICTED: beta-carotene isomerase D27, chlo...    143   2e-36    
gb|AFI78795.1|  putative D27 protein                                    139   4e-36    
ref|XP_006302732.1|  hypothetical protein CARUB_v10020846mg             142   4e-36    
emb|CBI34593.3|  unnamed protein product                                139   4e-36    
ref|XP_004309536.1|  PREDICTED: uncharacterized protein LOC101303472    141   1e-35    
ref|WP_015124291.1|  hypothetical protein                               139   3e-35    
ref|XP_003573300.1|  PREDICTED: beta-carotene isomerase D27, chlo...    140   3e-35    
ref|XP_004244658.1|  PREDICTED: beta-carotene isomerase D27, chlo...    139   6e-35    
ref|XP_002949674.1|  hypothetical protein VOLCADRAFT_80804              136   2e-34    
ref|XP_009625569.1|  PREDICTED: beta-carotene isomerase D27, chlo...    137   4e-34    
ref|XP_005648951.1|  hypothetical protein COCSUDRAFT_61832              130   9e-33    
gb|ACG26781.1|  hypothetical protein                                    132   2e-32    Zea mays [maize]
ref|NP_001143054.1|  uncharacterized protein LOC100275523               132   2e-32    Zea mays [maize]
gb|EWM30570.1|  protein of unknown function DUF4033                     134   2e-32    
gb|AFW74330.1|  hypothetical protein ZEAMMB73_058801                    133   2e-32    
ref|XP_001755220.1|  predicted protein                                  127   9e-31    
ref|XP_006352836.1|  PREDICTED: beta-carotene isomerase D27, chlo...    127   1e-30    
ref|NP_973748.1|  inhibition of secondary bud outgrowth protein D...    124   6e-30    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010323016.1|  PREDICTED: beta-carotene isomerase D27, chlo...    124   8e-30    
ref|XP_010069831.1|  PREDICTED: beta-carotene isomerase D27, chlo...    125   1e-29    
ref|XP_004242308.1|  PREDICTED: beta-carotene isomerase D27, chlo...    124   1e-29    
ref|XP_010679400.1|  PREDICTED: beta-carotene isomerase D27, chlo...    125   1e-29    
gb|KCW58315.1|  hypothetical protein EUGRSUZ_H01003                     125   1e-29    
ref|XP_010679399.1|  PREDICTED: beta-carotene isomerase D27, chlo...    124   2e-29    
ref|XP_003591385.1|  hypothetical protein MTR_1g086840                  124   2e-29    
ref|XP_004289540.1|  PREDICTED: uncharacterized protein LOC101314896    124   3e-29    
ref|XP_011079540.1|  PREDICTED: beta-carotene isomerase D27, chlo...    123   5e-29    
ref|XP_009796847.1|  PREDICTED: beta-carotene isomerase D27, chlo...    122   6e-29    
ref|XP_005647503.1|  hypothetical protein COCSUDRAFT_15824              121   8e-29    
gb|KCW77312.1|  hypothetical protein EUGRSUZ_D01676                     121   9e-29    
gb|AFI78794.1|  putative D27 family protein                             118   1e-28    
ref|XP_002302776.2|  hypothetical protein POPTR_0002s19530g             122   1e-28    Populus trichocarpa [western balsam poplar]
ref|XP_008781127.1|  PREDICTED: beta-carotene isomerase D27, chlo...    122   1e-28    
gb|KCW58314.1|  hypothetical protein EUGRSUZ_H01003                     122   2e-28    
ref|XP_009592742.1|  PREDICTED: beta-carotene isomerase D27, chlo...    121   2e-28    
ref|WP_024124978.1|  hypothetical protein                               119   2e-28    
ref|XP_011042273.1|  PREDICTED: beta-carotene isomerase D27, chlo...    121   4e-28    
emb|CDX90961.1|  BnaA03g26410D                                          120   4e-28    
ref|XP_006492348.1|  PREDICTED: beta-carotene isomerase D27, chlo...    120   4e-28    
ref|XP_002271003.1|  PREDICTED: beta-carotene isomerase D27, chlo...    120   6e-28    Vitis vinifera
ref|XP_002440529.1|  hypothetical protein SORBIDRAFT_09g002570          120   6e-28    Sorghum bicolor [broomcorn]
ref|XP_010921474.1|  PREDICTED: beta-carotene isomerase D27, chlo...    120   7e-28    
gb|KHG05677.1|  Chorismate synthase                                     119   1e-27    
ref|XP_007145139.1|  hypothetical protein PHAVU_007G213300g             119   2e-27    
ref|XP_009360308.1|  PREDICTED: beta-carotene isomerase D27, chlo...    117   2e-27    
ref|XP_001702558.1|  predicted protein                                  119   2e-27    Chlamydomonas reinhardtii
ref|WP_011057777.1|  hypothetical protein                               117   2e-27    
gb|KHN16202.1|  hypothetical protein glysoja_046728                     118   2e-27    
ref|XP_008227877.1|  PREDICTED: beta-carotene isomerase D27, chlo...    118   3e-27    
ref|XP_010267970.1|  PREDICTED: beta-carotene isomerase D27, chlo...    118   3e-27    
emb|CBJ29265.1|  conserved unknown protein                              116   4e-27    
ref|XP_007051131.1|  Uncharacterized protein TCM_004827                 117   5e-27    
ref|XP_005705238.1|  hypothetical protein Gasu_37700                    117   6e-27    
gb|EYU46818.1|  hypothetical protein MIMGU_mgv1a011827mg                117   6e-27    
ref|XP_007221575.1|  hypothetical protein PRUPE_ppa026536mg             117   6e-27    
gb|KHN08627.1|  hypothetical protein glysoja_024536                     117   9e-27    
ref|XP_011042274.1|  PREDICTED: beta-carotene isomerase D27, chlo...    117   9e-27    
ref|XP_010267973.1|  PREDICTED: beta-carotene isomerase D27, chlo...    116   1e-26    
ref|XP_001419261.1|  predicted protein                                  114   1e-26    Ostreococcus lucimarinus CCE9901
ref|NP_001242708.1|  uncharacterized protein LOC100788939               116   2e-26    
ref|XP_010087223.1|  hypothetical protein L484_009732                   116   2e-26    
ref|XP_010267972.1|  PREDICTED: beta-carotene isomerase D27, chlo...    115   3e-26    
ref|XP_010267969.1|  PREDICTED: beta-carotene isomerase D27, chlo...    116   3e-26    
gb|KDO86967.1|  hypothetical protein CISIN_1g047235mg                   115   4e-26    
emb|CDP17059.1|  unnamed protein product                                115   5e-26    
ref|XP_010231820.1|  PREDICTED: beta-carotene isomerase D27, chlo...    114   6e-26    
ref|XP_008667720.1|  PREDICTED: hypothetical protein isoform X1         113   7e-26    
ref|XP_002986676.1|  hypothetical protein SELMODRAFT_47788              112   1e-25    
ref|XP_006840469.1|  hypothetical protein AMTR_s00045p00181910          113   1e-25    
ref|XP_008381421.1|  PREDICTED: beta-carotene isomerase D27, chlo...    113   2e-25    
ref|XP_004135988.1|  PREDICTED: uncharacterized protein LOC101220175    113   2e-25    
ref|XP_004163139.1|  PREDICTED: uncharacterized LOC101220175            113   2e-25    
ref|XP_010456098.1|  PREDICTED: beta-carotene isomerase D27, chlo...    112   3e-25    
ref|XP_008661817.1|  PREDICTED: hypothetical protein isoform X1         112   5e-25    
ref|XP_003058791.1|  predicted protein                                  110   5e-25    
ref|XP_009134457.1|  PREDICTED: beta-carotene isomerase D27, chlo...    111   5e-25    
ref|NP_001237955.1|  uncharacterized protein LOC100499918               112   5e-25    
emb|CEG01330.1|  Domain of unknown function DUF4033                     112   6e-25    
ref|NP_001054553.1|  Os05g0131100                                       111   6e-25    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003064400.1|  predicted protein                                  112   6e-25    
gb|KDP28273.1|  hypothetical protein JCGZ_14044                         111   7e-25    
ref|XP_006593829.1|  PREDICTED: beta-carotene isomerase D27, chlo...    110   7e-25    
ref|XP_002973480.1|  hypothetical protein SELMODRAFT_99098              111   8e-25    
ref|XP_002515266.1|  conserved hypothetical protein                     111   9e-25    Ricinus communis
gb|KFK30784.1|  hypothetical protein AALP_AA6G025500                    111   1e-24    
gb|EYU46817.1|  hypothetical protein MIMGU_mgv1a011827mg                110   1e-24    
emb|CDX91821.1|  BnaC03g31230D                                          110   1e-24    
ref|XP_008451473.1|  PREDICTED: beta-carotene isomerase D27, chlo...    110   1e-24    
ref|XP_004960390.1|  PREDICTED: beta-carotene isomerase D27, chlo...    110   2e-24    
ref|XP_006574836.1|  PREDICTED: beta-carotene isomerase D27, chlo...    109   2e-24    
ref|XP_005717080.1|  unnamed protein product                            110   2e-24    
ref|XP_009383547.1|  PREDICTED: beta-carotene isomerase D27, chlo...    110   2e-24    
ref|XP_003080599.1|  unnamed protein product                            111   2e-24    
dbj|BAJ89408.1|  predicted protein                                      110   3e-24    
gb|EMT11717.1|  hypothetical protein F775_21767                         108   4e-24    
ref|XP_009349930.1|  PREDICTED: beta-carotene isomerase D27, chlo...    109   4e-24    
ref|XP_001421321.1|  predicted protein                                  106   1e-23    Ostreococcus lucimarinus CCE9901
gb|EWM28615.1|  protein of unknown function DUF4033                     107   1e-23    
ref|XP_007039379.1|  Uncharacterized protein isoform 2                  107   2e-23    
ref|XP_006654959.1|  PREDICTED: solute carrier family 40 member 3...    112   2e-23    
gb|EMS49216.1|  hypothetical protein TRIUR3_07382                       106   2e-23    
emb|CBJ33737.1|  conserved unknown protein                              107   5e-23    
ref|XP_002500714.1|  predicted protein                                  103   7e-23    Micromonas commoda
ref|XP_010429022.1|  PREDICTED: beta-carotene isomerase D27, chlo...    105   8e-23    
gb|KCW58316.1|  hypothetical protein EUGRSUZ_H01003                     105   2e-22    
ref|XP_010422658.1|  PREDICTED: beta-carotene isomerase D27, chlo...    104   2e-22    
ref|XP_003064988.1|  predicted protein                                  104   2e-22    
ref|XP_005847526.1|  hypothetical protein CHLNCDRAFT_134573             103   4e-22    
ref|NP_001146228.1|  hypothetical protein                               101   5e-22    
emb|CBJ33899.1|  conserved unknown protein                              102   5e-22    
ref|XP_002502957.1|  predicted protein                                  103   7e-22    
ref|XP_002874948.1|  hypothetical protein ARALYDRAFT_912030             102   8e-22    
ref|XP_006288488.1|  hypothetical protein CARUB_v10001747mg             102   8e-22    
ref|NP_680560.1|  uncharacterized protein                               102   1e-21    
ref|XP_005819831.1|  hypothetical protein GUITHDRAFT_56235              100   2e-21    
ref|XP_007513532.1|  predicted protein                                  101   3e-21    
ref|XP_006396397.1|  hypothetical protein EUTSA_v10028897mg             100   3e-21    
ref|XP_010543065.1|  PREDICTED: beta-carotene isomerase D27, chlo...    100   6e-21    
gb|EWM27994.1|  protein of unknown function DUF4033                   99.8    9e-21    
ref|XP_003083364.1|  F1N19.25 (ISS)                                   99.4    1e-20    
ref|XP_001763362.1|  predicted protein                                97.4    1e-20    
gb|ABK22858.1|  unknown                                               98.6    3e-20    
ref|XP_002180091.1|  predicted protein                                99.4    7e-20    
ref|XP_002176663.1|  predicted protein                                97.1    1e-19    
gb|EJK55179.1|  hypothetical protein THAOC_25114                      95.9    3e-19    
ref|XP_005828489.1|  hypothetical protein GUITHDRAFT_164374           96.3    4e-19    
ref|XP_007514986.1|  predicted protein                                95.1    4e-19    
ref|XP_003061427.1|  predicted protein                                95.5    8e-19    
gb|EMT14815.1|  hypothetical protein F775_08130                       93.2    1e-18    
ref|XP_010274249.1|  PREDICTED: beta-carotene isomerase D27, chlo...  90.1    1e-18    
gb|EMS47906.1|  hypothetical protein TRIUR3_05963                     92.8    1e-18    
ref|XP_005853551.1|  hypothetical protein NGA_0357502                 93.6    2e-18    
ref|XP_001420448.1|  predicted protein                                91.7    3e-18    
emb|CBZ39517.1|  td6ITP3 protein                                      89.0    3e-18    
ref|XP_010422660.1|  PREDICTED: beta-carotene isomerase D27, chlo...  90.5    7e-18    
ref|XP_002502998.1|  predicted protein                                92.0    2e-17    
ref|XP_005855116.1|  hypothetical protein NGA_2097720                 89.7    3e-17    
emb|CBN79781.1|  conserved unknown protein                            89.4    6e-17    
gb|EWM26601.1|  protein of unknown function DUF4033                   89.4    7e-17    
ref|XP_003081915.1|  unnamed protein product                          87.8    2e-16    
ref|XP_002295256.1|  predicted protein                                89.4    2e-16    
ref|XP_010323017.1|  PREDICTED: beta-carotene isomerase D27, chlo...  86.7    2e-16    
gb|EJK64149.1|  hypothetical protein THAOC_15145                      89.4    3e-16    
ref|XP_009037919.1|  hypothetical protein AURANDRAFT_64975            84.3    2e-15    
ref|XP_010679401.1|  PREDICTED: beta-carotene isomerase D27, chlo...  83.6    3e-15    
ref|XP_001420823.1|  predicted protein                                83.6    3e-15    
ref|XP_003082356.1|  unnamed protein product                          84.7    4e-15    
ref|XP_002287084.1|  predicted protein                                80.9    6e-15    
ref|XP_007511863.1|  predicted protein                                84.7    8e-15    
ref|XP_008343275.1|  PREDICTED: LOW QUALITY PROTEIN: beta-caroten...  79.7    1e-14    
gb|KEH43195.1|  D27 family protein, putative                          80.5    2e-14    
ref|XP_006604474.1|  PREDICTED: beta-carotene isomerase D27, chlo...  78.6    2e-14    
ref|XP_002501321.1|  predicted protein                                81.6    6e-14    
gb|KHN02545.1|  hypothetical protein glysoja_002569                   77.0    2e-13    
ref|XP_007509484.1|  predicted protein                                79.7    2e-13    
ref|XP_002509333.1|  predicted protein                                79.3    4e-13    
ref|XP_010911145.1|  PREDICTED: beta-carotene isomerase D27, chlo...  73.6    2e-12    
gb|KHN03832.1|  hypothetical protein glysoja_011061                   71.6    6e-12    
ref|XP_002955823.1|  hypothetical protein VOLCADRAFT_106966           73.6    9e-12    
gb|EEC78459.1|  hypothetical protein OsI_18326                        72.0    2e-11    
gb|EAZ41303.1|  hypothetical protein OsJ_25811                        71.6    4e-11    
gb|KDO76736.1|  hypothetical protein CISIN_1g0237092mg                70.9    4e-11    
gb|KFM25025.1|  hypothetical protein F751_1904                        69.7    7e-11    
tpg|DAA42221.1|  TPA: hypothetical protein ZEAMMB73_436579            65.1    3e-09    
ref|WP_006348913.1|  hypothetical protein                             65.1    3e-09    
ref|XP_005759170.1|  hypothetical protein EMIHUDRAFT_218780           64.3    1e-08    
ref|XP_005759603.1|  hypothetical protein EMIHUDRAFT_198494           63.2    3e-08    
ref|XP_010267971.1|  PREDICTED: uncharacterized protein LOC104605...  63.5    4e-08    
ref|XP_002303694.1|  hypothetical protein POPTR_0003s14730g           58.2    2e-07    
gb|AFK37308.1|  unknown                                               58.2    6e-07    
ref|NP_001174204.1|  Os05g0131300                                     50.4    2e-04    
gb|EPS57899.1|  hypothetical protein M569_16918                       50.1    3e-04    
emb|CDY38019.1|  BnaCnng08800D                                        50.1    0.001    



>ref|XP_009601154.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=272

 Score =   315 bits (806),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 166/199 (83%), Gaps = 0/199 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFDRLAINHLS  ++A TG+R++KSGY+GL E  + V+ NF+ST+Q +L+++AL 
Sbjct  62   VYKDNWFDRLAINHLSQSIQATTGLRNNKSGYEGLAEAAKMVYTNFNSTRQVNLVVEALQ  121

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            KA P PIL LM MVLPQS+  REYCAAFT +FF+WLVGPC+VKE+EFNGR+E NVVHI+K
Sbjct  122  KAFPKPILSLMKMVLPQSKWAREYCAAFTRVFFSWLVGPCEVKESEFNGRKENNVVHIKK  181

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMCTNLCKMPSQ FIK+++GMPVNMVPNF++MSCEMIFGQD P    DPA
Sbjct  182  CRFLEETNCVGMCTNLCKMPSQLFIKDTLGMPVNMVPNFDDMSCEMIFGQDAPPPDTDPA  241

Query  269  MMQPCYKLCNSKKKHHNNC  213
             +QPCYKLC    KH  +C
Sbjct  242  FVQPCYKLCKLGNKHQQDC  260



>ref|XP_009765814.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009765815.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=272

 Score =   311 bits (797),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFDRLAINHLS  ++A TG+R++KSGY+GL E    V+ NF+S +Q ++++ AL 
Sbjct  62   VYKDNWFDRLAINHLSQSIQATTGLRNNKSGYEGLAEAATMVYSNFNSRRQVNIVVDALQ  121

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P PIL LM MVLPQS+  REYCAAFTT+FFAWLVGPC+VKE+EF GR+E  VVHI+K
Sbjct  122  RAFPMPILSLMKMVLPQSKWAREYCAAFTTVFFAWLVGPCEVKESEFKGRKENTVVHIKK  181

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMCTNLCKMPSQ FIK+++GMPVNMVPNF++MSCEMIFGQDPP    DPA
Sbjct  182  CRFLEETNCVGMCTNLCKMPSQLFIKDTLGMPVNMVPNFDDMSCEMIFGQDPPQPDTDPA  241

Query  269  MMQPCYKLCNSKKKHHNNC  213
             +QPCYKLC    KH  +C
Sbjct  242  FVQPCYKLCKLSNKHQRDC  260



>gb|KDO68594.1| hypothetical protein CISIN_1g040644mg [Citrus sinensis]
Length=267

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 191/262 (73%), Gaps = 4/262 (2%)
 Frame = -2

Query  989  MDAKLV-QRFETPTIIVhrhhrtttkrhHLPLL--IRAVVAKPADnnnnn-sntkttlss  822
            M+AKL+ Q + TP I      R    R   P    + AV+A+PA+  N      +     
Sbjct  1    MEAKLLPQTYRTPFISTVLVPRRHRVRIIKPETSCVVAVLARPAETRNAKPKQLERKAEV  60

Query  821  sssNVYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLII  642
                VY+D WFD++AINHLS  V+  TG++++K GY+G+VE  +AV  NFD  QQ++++I
Sbjct  61   VQKTVYNDGWFDQIAINHLSQSVQDATGIKNNKGGYEGMVEAAKAVLRNFDQAQQRAIVI  120

Query  641  QALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVV  462
            QAL +A P PIL ++  VLP+S++ RE+ A FTTIFFAWLVGPC+V+E+E NG+ EKNVV
Sbjct  121  QALERAFPRPILTMVRAVLPESKLAREFFAVFTTIFFAWLVGPCEVRESEVNGKTEKNVV  180

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            HI+KCRFLEE+NCVGMCTNLCKMPSQTFIK+S+GMPVNMVPNF++MSCEMIFGQ+P ++S
Sbjct  181  HIKKCRFLEESNCVGMCTNLCKMPSQTFIKDSLGMPVNMVPNFDDMSCEMIFGQEPLASS  240

Query  281  HDPAMMQPCYKLCNSKKKHHNN  216
             DPA  QPCYKLC   ++H  N
Sbjct  241  DDPAFKQPCYKLCKESRRHTLN  262



>ref|XP_009601155.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=262

 Score =   305 bits (781),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFDRLAINHLS  ++A TG+R++KSGY+GL E  + V+ NF+ST+Q +L+++AL 
Sbjct  62   VYKDNWFDRLAINHLSQSIQATTGLRNNKSGYEGLAEAAKMVYTNFNSTRQVNLVVEALQ  121

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            KA P PIL LM MVLPQS+  REYCAAFT +FF+WLVGPC+VKE+EFNGR+E NVVHI+K
Sbjct  122  KAFPKPILSLMKMVLPQSKWAREYCAAFTRVFFSWLVGPCEVKESEFNGRKENNVVHIKK  181

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMCTNLCKMPSQ FIK+++GMPVNMVPNF++MSCEMIFGQD P    DPA
Sbjct  182  CRFLEETNCVGMCTNLCKMPSQLFIKDTLGMPVNMVPNFDDMSCEMIFGQDAPPPDTDPA  241

Query  269  MMQPCYK  249
             +QPCYK
Sbjct  242  FVQPCYK  248



>ref|XP_004247333.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Solanum 
lycopersicum]
Length=265

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 161/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFD LAINHLS  ++A TG+R+ KSGY+G VE  R V+ NF+ST Q +L+I++L 
Sbjct  54   VYKDNWFDHLAINHLSQSIQATTGLRNKKSGYEGFVEAARVVYVNFNSTHQANLVIESLQ  113

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P PIL L+ M+LP+S+  REYCA FTTIFF WLVGPC+VKE+EFNGR+E NVVHI+K
Sbjct  114  RAFPKPILSLVKMLLPESKWAREYCAIFTTIFFPWLVGPCEVKESEFNGRKENNVVHIKK  173

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMCTNLCKMPSQ FIK+++G+ VNMVPNF++MSCEMIFGQDPP    DPA
Sbjct  174  CRFLEETNCVGMCTNLCKMPSQLFIKDTLGISVNMVPNFDDMSCEMIFGQDPPPLDKDPA  233

Query  269  MMQPCYKLCNSKKKHHNNC  213
              QPCYKLC    KH  +C
Sbjct  234  FRQPCYKLCKLNNKHQADC  252



>ref|XP_006443948.1| hypothetical protein CICLE_v10023937mg [Citrus clementina]
 ref|XP_006480095.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Citrus 
sinensis]
 gb|ESR57188.1| hypothetical protein CICLE_v10023937mg [Citrus clementina]
Length=259

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 188/254 (74%), Gaps = 4/254 (2%)
 Frame = -2

Query  989  MDAKLV-QRFETPTIIVhrhhrtttkrhHLPLL--IRAVVAKPADnnnnn-sntkttlss  822
            M+AKL+ Q + TP I      R    R   P    + AV+A+PA+  N      +     
Sbjct  1    MEAKLLPQTYRTPFISTVLVPRRHRVRIIKPETSCVVAVLARPAETRNAKPKQLERKAEV  60

Query  821  sssNVYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLII  642
                VY+D WFD++AINHLS  V+  TG++++K GY+G+VE  +AV  NFD  QQ++++I
Sbjct  61   VQKTVYNDGWFDQIAINHLSQSVQDATGIKNNKGGYEGMVEAAKAVLRNFDQAQQRAIVI  120

Query  641  QALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVV  462
            QAL +A P PIL ++  VLP+S++ RE+ A FTTIFFAWLVGPC+V+E+E NG+ EKNVV
Sbjct  121  QALERAFPRPILTMVRAVLPESKLAREFFAVFTTIFFAWLVGPCEVRESEVNGKTEKNVV  180

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            HI+KCRFLEE+NCVGMCTNLCKMPSQTFIK+S+GMPVNMVPNF++MSCEMIFGQ+P ++S
Sbjct  181  HIKKCRFLEESNCVGMCTNLCKMPSQTFIKDSLGMPVNMVPNFDDMSCEMIFGQEPLASS  240

Query  281  HDPAMMQPCYKLCN  240
             DPA  QPCYKLCN
Sbjct  241  DDPAFKQPCYKLCN  254



>gb|AEW07379.1| dwarf 27 [Medicago truncatula]
 gb|KEH42623.1| beta-carotene isomerase D27 [Medicago truncatula]
Length=252

 Score =   300 bits (767),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 162/201 (81%), Gaps = 0/201 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFD+LAINHLS  V+A TG+ ++KSG+D LVE        F++TQQQ +I+ AL 
Sbjct  52   VYKDNWFDKLAINHLSKSVQAATGISNNKSGFDSLVEAATVASQKFNTTQQQGIILDALD  111

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P PIL ++  V+P S++ REY A FTTIFFAWL+GP +V+E+E NGRREKN+VHI+K
Sbjct  112  RAFPKPILSVIRRVMPPSKLAREYFAVFTTIFFAWLLGPSEVRESEINGRREKNIVHIKK  171

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMC NLCKMPSQ FIK+S GMPVNMVPNF++MSCEMIFGQ+PP+++ DPA
Sbjct  172  CRFLEETNCVGMCINLCKMPSQLFIKDSFGMPVNMVPNFDDMSCEMIFGQEPPASTDDPA  231

Query  269  MMQPCYKLCNSKKKHHNNCIT  207
            + QPCYKLC +KK H   C++
Sbjct  232  LKQPCYKLCKAKKNHATQCLS  252



>ref|XP_003634993.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Vitis 
vinifera]
Length=247

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 172/227 (76%), Gaps = 10/227 (4%)
 Frame = -2

Query  893  IRAVVAKPADnnnnnsntkttlsssssNVYHDTWFDRLAINHLSHCVKAVTGVRSSKSGY  714
            I AV+A+PADN      T +        +  D WFDR+AINHLS  V+A TG+R+SKSGY
Sbjct  29   ILAVLARPADNLTLVKETPS--------LLTDNWFDRIAINHLSQSVQATTGLRNSKSGY  80

Query  713  DGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIF  534
            + LVE    V  NFD  QQ  L+I+AL+KA P+PIL L+  ++PQS+  REY AAFTT+F
Sbjct  81   ESLVEAAAMVSRNFDPIQQCELVIEALNKAFPSPILSLIRTLMPQSKFTREYFAAFTTLF  140

Query  533  FAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMP  354
            FAWLVGPC+V E+E NGRREKNVVHI+KCRFLEE+NCVGMC NLCK PSQ FIK+S+GMP
Sbjct  141  FAWLVGPCKVIESEINGRREKNVVHIKKCRFLEESNCVGMCLNLCKNPSQKFIKDSLGMP  200

Query  353  VNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKKKHHNNC  213
            VNMVPNF++MSC+MIFGQDPP    DP + QPCYKLC +KK H  NC
Sbjct  201  VNMVPNFDDMSCQMIFGQDPP--GDDPVLRQPCYKLCKAKKNHSVNC  245



>emb|CBI25060.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   295 bits (756),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 172/227 (76%), Gaps = 10/227 (4%)
 Frame = -2

Query  893  IRAVVAKPADnnnnnsntkttlsssssNVYHDTWFDRLAINHLSHCVKAVTGVRSSKSGY  714
            I AV+A+PADN      T +        +  D WFDR+AINHLS  V+A TG+R+SKSGY
Sbjct  61   ILAVLARPADNLTLVKETPS--------LLTDNWFDRIAINHLSQSVQATTGLRNSKSGY  112

Query  713  DGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIF  534
            + LVE    V  NFD  QQ  L+I+AL+KA P+PIL L+  ++PQS+  REY AAFTT+F
Sbjct  113  ESLVEAAAMVSRNFDPIQQCELVIEALNKAFPSPILSLIRTLMPQSKFTREYFAAFTTLF  172

Query  533  FAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMP  354
            FAWLVGPC+V E+E NGRREKNVVHI+KCRFLEE+NCVGMC NLCK PSQ FIK+S+GMP
Sbjct  173  FAWLVGPCKVIESEINGRREKNVVHIKKCRFLEESNCVGMCLNLCKNPSQKFIKDSLGMP  232

Query  353  VNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKKKHHNNC  213
            VNMVPNF++MSC+MIFGQDPP    DP + QPCYKLC +KK H  NC
Sbjct  233  VNMVPNFDDMSCQMIFGQDPP--GDDPVLRQPCYKLCKAKKNHSVNC  277



>ref|XP_008449360.1| PREDICTED: LOW QUALITY PROTEIN: beta-carotene isomerase D27, 
chloroplastic [Cucumis melo]
Length=253

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 159/200 (80%), Gaps = 0/200 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFD++AI+HLS  V+A +G RS KSGY+ L+E+T     NF+  +Q+ ++IQAL 
Sbjct  53   VYTDNWFDKIAIDHLSQAVQATSGWRSKKSGYESLLEVTTMASRNFNHIKQKEVVIQALG  112

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P PIL L+  +LPQS+  REY AAFTT+FFAWLVGPC+VKE+EF G+REKNVV I K
Sbjct  113  RAFPKPILSLIKALLPQSKFAREYFAAFTTVFFAWLVGPCEVKESEFKGKREKNVVQIHK  172

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE+TNC GMC NLCK P Q FIK+S+GMPV MVPNF++MSCEMIFG++PP++  DPA
Sbjct  173  CRFLEQTNCAGMCINLCKFPCQDFIKDSLGMPVTMVPNFDDMSCEMIFGKEPPASIDDPA  232

Query  269  MMQPCYKLCNSKKKHHNNCI  210
            + QPCYKLC +K+KH  NC 
Sbjct  233  LKQPCYKLCKTKEKHTTNCF  252



>gb|KHN10698.1| hypothetical protein glysoja_019129 [Glycine soja]
Length=219

 Score =   291 bits (745),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 161/201 (80%), Gaps = 0/201 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             Y D  FDRLAI+HLS  V+  TG+ ++KSGY+ LVE        FD  QQQ +IIQALH
Sbjct  18   AYKDNLFDRLAIHHLSKSVQEATGLGNNKSGYESLVEAATVAKMKFDPIQQQEVIIQALH  77

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P PIL L+  +LP S++ REY A FTT+FFAWLVGP +V+E+E NGRREKNVV++ K
Sbjct  78   RAFPKPILSLIKTLLPPSKLSREYFAVFTTLFFAWLVGPSEVRESEVNGRREKNVVYVTK  137

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMC NLCKMPSQ+FIK+++GMPVNMVPNF++MSCEMIFGQ+PP+++ DPA
Sbjct  138  CRFLEETNCVGMCINLCKMPSQSFIKDTLGMPVNMVPNFDDMSCEMIFGQEPPASTDDPA  197

Query  269  MMQPCYKLCNSKKKHHNNCIT  207
            + QPCYKLC + KKH  +C++
Sbjct  198  LKQPCYKLCKAYKKHGTDCLS  218



>ref|XP_004495151.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Cicer 
arietinum]
Length=252

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/267 (53%), Positives = 184/267 (69%), Gaps = 23/267 (9%)
 Frame = -2

Query  989  MDAKLVQRFETPTIIVhrhhrtttkrhHLPLLIR-------AVVAKPADnnnnnsntktt  831
            MDAK++     PT  +             P LI+        V+A+P+DN    +  KT 
Sbjct  1    MDAKMISHKINPTPTIAHSK---------PRLIKPKQNFVVGVLARPSDNIGEETLKKTN  51

Query  830  lsssssNVYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQS  651
                   VY D WFD+LAINHLS  V+A TG+ ++KSG+D LVE        F S QQ  
Sbjct  52   -------VYKDNWFDKLAINHLSKSVQAATGISNNKSGFDSLVEAATVASQKFSSVQQHE  104

Query  650  LIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREK  471
            ++++AL +A P PIL ++  V+P S++ REY A FTT+FFAWL+GP +V+E+E +G+REK
Sbjct  105  VVLEALDRAFPRPILSMIRKVMPPSKLAREYFAVFTTLFFAWLLGPSEVRESEVDGKREK  164

Query  470  NVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPP  291
            N+V+I+KCRFLEETNCVGMC NLCKMPSQ FIK+S GMPVNMVPNF++MSCEMIFGQ+PP
Sbjct  165  NIVYIKKCRFLEETNCVGMCINLCKMPSQMFIKDSFGMPVNMVPNFDDMSCEMIFGQEPP  224

Query  290  STSHDPAMMQPCYKLCNSKKKHHNNCI  210
             ++HDPA+ QPCYKLC +KK H  NC+
Sbjct  225  LSTHDPALNQPCYKLCKAKKNHGTNCL  251



>ref|XP_004145371.1| PREDICTED: uncharacterized protein LOC101219340 [Cucumis sativus]
 ref|XP_004153712.1| PREDICTED: uncharacterized protein LOC101218896 [Cucumis sativus]
 ref|XP_004163561.1| PREDICTED: uncharacterized protein LOC101223880 [Cucumis sativus]
 gb|KGN61698.1| hypothetical protein Csa_2G226860 [Cucumis sativus]
Length=253

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 159/200 (80%), Gaps = 0/200 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFD++AI+HLS  V+A +G RS KSGY+ LVE+T     NF+  +Q+ ++IQAL 
Sbjct  53   VYTDNWFDKIAIDHLSQAVQATSGWRSKKSGYESLVEVTTMASRNFNHIKQKEVVIQALG  112

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
             A P PIL L+  +LPQS++ REY AAFTT+FFAWLVGPC+VKE+EF G+REKNVV I K
Sbjct  113  MAFPKPILSLIKALLPQSKLAREYFAAFTTVFFAWLVGPCEVKESEFKGKREKNVVQIHK  172

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE+TNC GMC NLCK P Q FIK+S+GMPV MVPNF++MSCEMIFG++PP++  DPA
Sbjct  173  CRFLEQTNCAGMCINLCKFPCQDFIKDSLGMPVTMVPNFDDMSCEMIFGKEPPASIDDPA  232

Query  269  MMQPCYKLCNSKKKHHNNCI  210
            + QPCYKLC +K+KH  NC 
Sbjct  233  LKQPCYKLCKTKEKHTTNCF  252



>ref|XP_008386409.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Malus 
domestica]
Length=220

 Score =   291 bits (744),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFDR+AINHLS  V+A TG+R++KSGY+ LV+        F+  +Q+ L++QAL 
Sbjct  19   VYKDNWFDRMAINHLSQNVQAATGLRNNKSGYESLVKAATVASRKFNPAKQRELVLQALD  78

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
             A P P+  L+  +LP S+  REY A FTTIFFAWLVGPC+VKE E NGR+EKNVV+I+K
Sbjct  79   TAFPKPVFSLLRTILPDSKFAREYFAVFTTIFFAWLVGPCEVKELELNGRKEKNVVYIKK  138

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMC N+CK+PSQ+FIK S+G PVNMVPNF++MSCEMIFGQDPP  S+DPA
Sbjct  139  CRFLEETNCVGMCLNMCKVPSQSFIKTSLGTPVNMVPNFDDMSCEMIFGQDPPDISNDPA  198

Query  269  MMQPCYKLCNSKKKHHNN  216
            + QPCYKLC   K+H++N
Sbjct  199  LKQPCYKLCKVNKRHNSN  216



>ref|XP_010038049.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Eucalyptus 
grandis]
 gb|KCW49847.1| hypothetical protein EUGRSUZ_K03319 [Eucalyptus grandis]
Length=265

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D WFD +A NHLS  V+A  G+R+ KSGY+GLVE   A + +F+ T+Q+ L+I AL +
Sbjct  66   YEDNWFDLMATNHLSRSVQAAIGIRNKKSGYEGLVEAASAAYRSFNPTEQRDLVISALDR  125

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
            A P PIL ++  +LP+S+  REY AAFTT+FF+WLVG C+V+E+E +GRREKNVVHI+KC
Sbjct  126  AFPKPILNMIRTLLPRSKFTREYFAAFTTVFFSWLVGKCEVRESELDGRREKNVVHIKKC  185

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            RFLEETNCVGMC NLCKMP QTFIK+S+G+PVNMVPNF++MSC+M+FGQDPP+ S DPA 
Sbjct  186  RFLEETNCVGMCLNLCKMPCQTFIKDSLGVPVNMVPNFDDMSCQMVFGQDPPAISDDPAF  245

Query  266  MQPCYKLCNSKKKHHNNC  213
             QPC KLC +K+KH   C
Sbjct  246  KQPCIKLCKAKQKHSATC  263



>ref|XP_004290643.1| PREDICTED: uncharacterized protein LOC101311145 [Fragaria vesca 
subsp. vesca]
Length=263

 Score =   290 bits (741),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 164/199 (82%), Gaps = 1/199 (1%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY+D WFD+LAI+HLS  V+A +G+R+ KSG++ LVE   A   NF+  +Q+ +++QAL 
Sbjct  64   VYNDNWFDKLAIDHLSQNVQAASGLRNRKSGFESLVEAASAASLNFNPEKQREIVVQALE  123

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
             A P PIL L+  +LP+S++ REY A FTTIFFAWLVGPC+V+E+EFNG +EKNVVHI K
Sbjct  124  GAFPRPILSLIKALLPESKLAREYFAVFTTIFFAWLVGPCEVRESEFNGSKEKNVVHIPK  183

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMC N+CKMPSQ+FIK++MGMPVNMVPNF++MSC+MIFG++PP   +DPA
Sbjct  184  CRFLEETNCVGMCINMCKMPSQSFIKDTMGMPVNMVPNFDDMSCQMIFGEEPPELLNDPA  243

Query  269  MMQPCYKLCNSKKKHHNNC  213
            + QPC+KLC  K++ HNNC
Sbjct  244  LKQPCFKLCKVKQR-HNNC  261



>gb|KDP21385.1| hypothetical protein JCGZ_21856 [Jatropha curcas]
Length=264

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY+D WFD+LAINHLS  V+A TG+R+ K+GY+ LV+        F+  QQ+ L++QAL 
Sbjct  64   VYNDNWFDQLAINHLSRSVQAATGLRNKKTGYESLVQAAMDASQKFNLLQQRDLVLQALE  123

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
              IP  +L L+  VLPQ +  REY AAFTT+FF WL+GPC+V+E+EFNGR+EKNVV I+K
Sbjct  124  NTIPRIVLDLIKTVLPQCKFTREYFAAFTTLFFVWLIGPCEVRESEFNGRKEKNVVRIKK  183

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEE+NCVGMCTNLCK+P+QTFIK+S+GMPVNMVPNF++MSCEMIFGQDPP  + DPA
Sbjct  184  CRFLEESNCVGMCTNLCKIPTQTFIKHSLGMPVNMVPNFDDMSCEMIFGQDPPMLTEDPA  243

Query  269  MMQPCYKLCNSKKKHHNNC  213
              QPCYKLC SK+KH   C
Sbjct  244  FNQPCYKLCKSKRKHVMKC  262



>ref|XP_007162478.1| hypothetical protein PHAVU_001G155600g [Phaseolus vulgaris]
 gb|ESW34472.1| hypothetical protein PHAVU_001G155600g [Phaseolus vulgaris]
Length=251

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 158/201 (79%), Gaps = 0/201 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             Y D  FDRLAINHLS  V+  TG+ ++KSGY+ LVE      H FD  QQQ +IIQAL+
Sbjct  51   AYKDNLFDRLAINHLSKSVQEATGLSNNKSGYESLVEAATVAKHKFDPIQQQEVIIQALN  110

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P PIL  +  VLP S++ REY A FTT+FFAWLVGPC+V+E++ NGR EKNVV+I K
Sbjct  111  RAFPRPILSFIKTVLPSSKLAREYFAVFTTLFFAWLVGPCEVRESKVNGRSEKNVVYIPK  170

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEET+CVGMC NLCKMPSQTFIK+S+GM VNMVPNF++MSCEMIFGQDPP+++ DPA
Sbjct  171  CRFLEETSCVGMCNNLCKMPSQTFIKDSLGMSVNMVPNFDDMSCEMIFGQDPPASTDDPA  230

Query  269  MMQPCYKLCNSKKKHHNNCIT  207
            + QPCYKLC + K H  N ++
Sbjct  231  LNQPCYKLCKAYKNHGTNFLS  251



>ref|XP_008235341.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Prunus 
mume]
Length=315

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            +Y+D WFDR+AINHLS  V+A TG++++KSG++ LVE   A    F+  +Q+ L+IQAL 
Sbjct  114  IYNDNWFDRMAINHLSQNVQAATGLKNNKSGFESLVEAATAASRKFNPAKQRELVIQALD  173

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
             A P PI  L+  +LPQS+  REY A FTTIFFAWLVGPC+V+E+E +GR+EKNVV+I+K
Sbjct  174  SAFPKPIFSLLRAILPQSKFAREYFAIFTTIFFAWLVGPCEVRESELDGRKEKNVVYIKK  233

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEET+CVGMC N+CKMPSQ+FIK+S+G PVNMVPNF++MSCEMIFGQDPP  S+DPA
Sbjct  234  CRFLEETSCVGMCINMCKMPSQSFIKSSLGTPVNMVPNFDDMSCEMIFGQDPPELSNDPA  293

Query  269  MMQPCYKLCNSKKKHHNN  216
            + QPC+KLC   ++H+ N
Sbjct  294  LKQPCFKLCKVNQRHNTN  311



>emb|CDP03682.1| unnamed protein product [Coffea canephora]
Length=303

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 156/196 (80%), Gaps = 3/196 (2%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFDR AINHLS  ++  TG+RSSKSGYDGLVE     +  F+S+QQQ LIIQ L 
Sbjct  105  VYKDNWFDRAAINHLSQRLQETTGLRSSKSGYDGLVEAAGVAYRKFNSSQQQDLIIQTLE  164

Query  629  KAIPNPIL---MLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVH  459
            KA P PIL   M +  +LPQS+  RE+ A FTTIFFAWLVGPC+V+E+EF+G +EKNVVH
Sbjct  165  KAFPRPILSAAMQIRALLPQSKFAREFFAVFTTIFFAWLVGPCEVRESEFDGTKEKNVVH  224

Query  458  IQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSH  279
            I+KCRFLE TNCVGMCTNLCKM SQ FIK+S+GMP+NMVPNF++MSC+MIFGQ+PP   +
Sbjct  225  IKKCRFLEGTNCVGMCTNLCKMSSQEFIKDSLGMPLNMVPNFDDMSCDMIFGQEPPLVIN  284

Query  278  DPAMMQPCYKLCNSKK  231
            DPA +QPCYK+C   K
Sbjct  285  DPAFVQPCYKICKDLK  300



>ref|XP_008368789.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Malus 
domestica]
 ref|XP_008355427.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Malus 
domestica]
Length=248

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFDR+AINHLS  V+A T +R++KSGY+ LVE        F+  +Q+ L++QAL 
Sbjct  47   VYKDNWFDRMAINHLSQNVQAATRLRNNKSGYESLVEAATVASRKFNPEKQRELVLQALD  106

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
             A P P+  L+  +LP+S+  REY A FTTIFFAWLVGPC+VKE+E NGR+EKNVV+I+K
Sbjct  107  TAFPKPVFSLVRTILPESKFAREYFAIFTTIFFAWLVGPCEVKESEINGRKEKNVVYIKK  166

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEE+NCVGMC N+CK+PSQ+FIK S+G PVNMVPNF++MSCEMIFGQ+PP  S+DPA
Sbjct  167  CRFLEESNCVGMCLNMCKVPSQSFIKTSLGTPVNMVPNFDDMSCEMIFGQNPPEISNDPA  226

Query  269  MMQPCYKLCNSKKKHHNN  216
            + QPCYKLC   K+H++N
Sbjct  227  LKQPCYKLCKVNKRHNSN  244



>ref|XP_009370743.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Pyrus 
x bretschneideri]
Length=248

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFDR+AINHLS  V+A T +R++KSGY+ LVE        F+  +Q+ L++QAL 
Sbjct  47   VYKDNWFDRMAINHLSQNVQAATRLRNNKSGYESLVEAATVASRKFNPEKQRELVLQALD  106

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
             A P P+  L+  +LP+S+  REY A FTTIFFAWLVGPC+VKE+E NGR+EKNVV+I+K
Sbjct  107  TAFPKPVFSLLRTILPESKFAREYFAIFTTIFFAWLVGPCEVKESEINGRKEKNVVYIKK  166

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEE+NCVGMC N+CK+PSQ+FIK S+G PVNMVPNF++MSCEMIFGQ+PP  S+DPA
Sbjct  167  CRFLEESNCVGMCLNMCKVPSQSFIKTSLGTPVNMVPNFDDMSCEMIFGQNPPEISNDPA  226

Query  269  MMQPCYKLCNSKKKHHNN  216
            + QPCYKLC   ++H++N
Sbjct  227  LKQPCYKLCKVNRRHNSN  244



>ref|XP_007200092.1| hypothetical protein PRUPE_ppa019954mg, partial [Prunus persica]
 gb|EMJ01291.1| hypothetical protein PRUPE_ppa019954mg, partial [Prunus persica]
Length=258

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY+D WFDR+AINHLS  V+A TG++++KSG++ L E   A    F+  +Q+ L+IQAL 
Sbjct  71   VYNDNWFDRMAINHLSQNVQAATGLKNNKSGFESLAEAATAASRKFNPAKQRELVIQALD  130

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
             A P PI  L+  +LPQS+  REY A FTTIFFAWLVGPC+V+E+E +GR+EKNVV+I+K
Sbjct  131  SAFPKPIFSLLRAILPQSKFAREYFAIFTTIFFAWLVGPCEVRESELDGRKEKNVVYIKK  190

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMC N+CKMPSQ+FIK+S+G PVNMVPNF++MSCEMIFGQDPP  S+DPA
Sbjct  191  CRFLEETNCVGMCINMCKMPSQSFIKSSLGTPVNMVPNFDDMSCEMIFGQDPPELSNDPA  250

Query  269  MMQPCYKL  246
            + QPC+KL
Sbjct  251  LKQPCFKL  258



>ref|XP_011026332.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Populus 
euphratica]
Length=267

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 157/199 (79%), Gaps = 0/199 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY+D+WF +LAIN+LS   +  TG+R+SK  Y+ L +  R  +  F+ TQQ  L++Q+L+
Sbjct  67   VYNDSWFAKLAINYLSQRFQDATGMRNSKRDYESLTQTARDTWRKFNPTQQHELVLQSLN  126

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +AIP  I  L  M+LPQ    REY AAFTT+FF WLVGPC+V+E++FNGR+EKNVVHI+K
Sbjct  127  RAIPATISTLAKMMLPQCTFTREYFAAFTTLFFVWLVGPCEVRESDFNGRKEKNVVHIKK  186

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEET+C+GMCTNLCK+PSQTFIK+S GMPVNMVPNFE+MSCEMI+GQ+PP+ + DPA
Sbjct  187  CRFLEETDCIGMCTNLCKVPSQTFIKHSFGMPVNMVPNFEDMSCEMIYGQEPPAITEDPA  246

Query  269  MMQPCYKLCNSKKKHHNNC  213
              QPCYKLC   +KH   C
Sbjct  247  FKQPCYKLCKENRKHSMQC  265



>ref|XP_003518899.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X1 [Glycine max]
Length=249

 Score =   281 bits (720),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 182/260 (70%), Gaps = 14/260 (5%)
 Frame = -2

Query  989  MDAKLVQRFETPTIIVhrhhrtttkrhHLPLLIRAVVAKPADnnnnnsntkttlsssssN  810
            M+AKLV +  +PT+ +             P ++  V+A+PAD+ +  +            
Sbjct  1    MEAKLVAQCNSPTLTLAHWKLKQ------PCVV-GVLARPADDISGEARKTNH-------  46

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D  FDR+AIN+LS CV+  TG+++SKSGY+ LVE        F   +Q  L+IQ+L 
Sbjct  47   VYKDGLFDRIAINYLSKCVQEATGLKNSKSGYESLVEAATLASQRFSPIEQHQLVIQSLD  106

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P P+L+L+  +LP S+  R+  A FTT+FFAWLVGP +V+E+E  GRRE+NVVHI+K
Sbjct  107  RAFPKPMLLLIRTLLPPSKFARKLFAIFTTLFFAWLVGPSEVRESEVEGRRERNVVHIKK  166

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMC NLCK+PSQ+FIK+S+GM VNMVPNF++MSCEMIFG+DPP ++ DPA
Sbjct  167  CRFLEETNCVGMCINLCKLPSQSFIKDSLGMSVNMVPNFDDMSCEMIFGEDPPESTDDPA  226

Query  269  MMQPCYKLCNSKKKHHNNCI  210
            + QPC+KLC +K+ H  NC+
Sbjct  227  LNQPCFKLCKAKRSHGTNCL  246



>gb|KHN18846.1| hypothetical protein glysoja_028215 [Glycine soja]
Length=249

 Score =   281 bits (719),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 182/260 (70%), Gaps = 14/260 (5%)
 Frame = -2

Query  989  MDAKLVQRFETPTIIVhrhhrtttkrhHLPLLIRAVVAKPADnnnnnsntkttlsssssN  810
            M+AKLV +  +PT+ +             P ++  V+A+PAD+ +  +            
Sbjct  1    MEAKLVAQCNSPTLTLAHWKPKQ------PCVV-GVLARPADDISGEARKTNH-------  46

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D  FDR+AIN+LS CV+  TG+++SKSGY+ LVE        F   +Q  L+IQ+L 
Sbjct  47   VYKDGLFDRIAINYLSKCVQEATGLKNSKSGYESLVEAATLASQRFSPIEQHQLVIQSLD  106

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P P+L+L+  +LP S+  R+  A FTT+FFAWLVGP +V+E+E  GRRE+NVVHI+K
Sbjct  107  RAFPKPMLLLIRTLLPPSKFARKLFAIFTTLFFAWLVGPSEVRESEVEGRRERNVVHIKK  166

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMC NLCK+PSQ+FIK+S+GM VNMVPNF++MSCEMIFG+DPP ++ DPA
Sbjct  167  CRFLEETNCVGMCINLCKLPSQSFIKDSLGMSVNMVPNFDDMSCEMIFGEDPPESTDDPA  226

Query  269  MMQPCYKLCNSKKKHHNNCI  210
            + QPC+KLC +K+ H  NC+
Sbjct  227  LNQPCFKLCKAKRSHGTNCL  246



>ref|XP_003520579.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Glycine 
max]
Length=253

 Score =   281 bits (719),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 159/201 (79%), Gaps = 0/201 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             Y D  FDRLAI+HLS  V+  TG+ ++KSGY+ LVE        FD  QQQ +IIQALH
Sbjct  52   AYKDNLFDRLAIHHLSKSVQEATGLGNNKSGYESLVEAATVAKMKFDPIQQQEVIIQALH  111

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P PIL L+  +LP S++ REY A FTT+FFAWLVGP +V+E+E NGRREKN+++   
Sbjct  112  RAFPKPILSLIKTLLPPSKLSREYFAVFTTLFFAWLVGPSEVRESEVNGRREKNLLNNNL  171

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMC NLCKMPSQ+FIK+++GMPVNMVPNF++MSCEMIFGQ+PP+++ DPA
Sbjct  172  CRFLEETNCVGMCINLCKMPSQSFIKDTLGMPVNMVPNFDDMSCEMIFGQEPPASTDDPA  231

Query  269  MMQPCYKLCNSKKKHHNNCIT  207
            + QPCYKLC + KKH  +C++
Sbjct  232  LKQPCYKLCKAYKKHGTDCLS  252



>ref|XP_011079931.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Sesamum 
indicum]
Length=260

 Score =   281 bits (720),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 153/201 (76%), Gaps = 2/201 (1%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY+D WFDRLAINHLS+ ++A  G+RS KSGYDGL+E        F   +Q+ ++I+ L 
Sbjct  58   VYNDNWFDRLAINHLSNSLQASAGLRSKKSGYDGLIEAATMASRRFSPVEQREIVIRTLE  117

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
             A P PIL L+  V+P+S+  REY A FTT+FFAWLVGPCQVKE+E +GR EKNVVHI K
Sbjct  118  TAFPKPILSLIRRVVPRSKFAREYFAVFTTVFFAWLVGPCQVKESEIDGRIEKNVVHIPK  177

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE TNCVGMCTNLCKMPSQ FIK+S+G+P+NMVPNFE+MSCEMIFG++PP  S DPA
Sbjct  178  CRFLEGTNCVGMCTNLCKMPSQAFIKDSLGVPINMVPNFEDMSCEMIFGEEPPDQSLDPA  237

Query  269  MMQPCYKLCNSK--KKHHNNC  213
               PCYK C  K  ++ H  C
Sbjct  238  FTHPCYKQCKGKSIQRQHKTC  258



>ref|XP_007050450.1| DWARF27, putative isoform 1 [Theobroma cacao]
 gb|EOX94607.1| DWARF27, putative isoform 1 [Theobroma cacao]
Length=263

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 158/196 (81%), Gaps = 0/196 (0%)
 Frame = -2

Query  800  DTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAI  621
            D WF+ +AI+HLS  ++A TG++  KSGY+ LVE    +   F+ ++QQ L+IQAL+ AI
Sbjct  66   DNWFELMAISHLSQSLQAATGLKIRKSGYESLVEAAAMMSKKFNPSRQQELVIQALNSAI  125

Query  620  PNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRF  441
            P  IL ++  +LPQS+  REY AAFTT+FFAWL+GP +V+ +E NGRREKNVVH++KCRF
Sbjct  126  PRIILNMIKTLLPQSQFTREYFAAFTTVFFAWLIGPSEVRASELNGRREKNVVHVRKCRF  185

Query  440  LEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQ  261
            LE++NCVGMC NLCKMPSQ FIK+S+GMPVNMVPNF++MSCEMIFGQDPP+++ DPA+ Q
Sbjct  186  LEQSNCVGMCINLCKMPSQAFIKDSLGMPVNMVPNFDDMSCEMIFGQDPPASNDDPALKQ  245

Query  260  PCYKLCNSKKKHHNNC  213
            PCYKLC + +KH   C
Sbjct  246  PCYKLCRANQKHAVKC  261



>ref|XP_006588652.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Glycine 
max]
Length=250

 Score =   278 bits (712),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 129/260 (50%), Positives = 179/260 (69%), Gaps = 13/260 (5%)
 Frame = -2

Query  989  MDAKLVQRFETPTIIVhrhhrtttkrhHLPLLIRAVVAKPADnnnnnsntkttlsssssN  810
            M+AKLV + ++PT+ +             P ++  V+A+P D  +  +            
Sbjct  1    MEAKLVAQCKSPTLSLAHRKPKH------PCVVVGVLARPVDEISGEARKTNH-------  47

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D  FDR+ IN+LS CV+  TG+R++KSGY+ LV+        F   +Q  L+IQ+L 
Sbjct  48   VYKDGLFDRITINYLSKCVQEATGLRNNKSGYESLVDAATVASQRFSPVEQHQLVIQSLD  107

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P P+L+L+  +LP S+  R+  A FTT+FFAWLVGP +V+E+E  GRRE+NVVHI+K
Sbjct  108  RAFPKPMLLLIRKLLPPSKFARKLFAVFTTLFFAWLVGPSEVRESEVEGRRERNVVHIKK  167

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE TNCVGMC NLCK+PSQ+FIK+S+G+ VNMVPNF++MSCEMIFGQDPP ++ DPA
Sbjct  168  CRFLEGTNCVGMCINLCKLPSQSFIKDSLGISVNMVPNFDDMSCEMIFGQDPPESTDDPA  227

Query  269  MMQPCYKLCNSKKKHHNNCI  210
            + QPC+KLC +K+ H  NC+
Sbjct  228  LKQPCFKLCKAKRSHGTNCL  247



>ref|XP_011042448.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X2 [Populus euphratica]
Length=268

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            +Y+D+WF  LAIN+LS   +  TG+R+SK GY+ L +     +  F   QQ  L++Q+L+
Sbjct  68   IYNDSWFAELAINYLSQQFQDATGLRNSKRGYESLAQTATDTWQKFSPIQQHGLVLQSLN  127

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +AIP  IL ++ ++LP+S   REY AAFTT+FFAWLVGP +V+E+EFNG++EKNVVHI+K
Sbjct  128  RAIPRLILNMIKIMLPESTFKREYFAAFTTLFFAWLVGPSEVRESEFNGKKEKNVVHIKK  187

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMCTNLCK+PSQTFIK+S+GMPV+MVPNF++MSCEMIFGQ+PP  + DPA
Sbjct  188  CRFLEETNCVGMCTNLCKIPSQTFIKHSLGMPVDMVPNFDDMSCEMIFGQEPPVITEDPA  247

Query  269  MMQPCYKLCNSKKKHHNNC  213
              QPCYKLC + +KH   C
Sbjct  248  FKQPCYKLCKANRKHIMKC  266



>ref|XP_007050451.1| DWARF27, putative isoform 2, partial [Theobroma cacao]
 gb|EOX94608.1| DWARF27, putative isoform 2, partial [Theobroma cacao]
Length=229

 Score =   276 bits (705),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = -2

Query  800  DTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAI  621
            D WF+ +AI+HLS  ++A TG++  KSGY+ LVE    +   F+ ++QQ L+IQAL+ AI
Sbjct  38   DNWFELMAISHLSQSLQAATGLKIRKSGYESLVEAAAMMSKKFNPSRQQELVIQALNSAI  97

Query  620  PNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRF  441
            P  IL ++  +LPQS+  REY AAFTT+FFAWL+GP +V+ +E NGRREKNVVH++KCRF
Sbjct  98   PRIILNMIKTLLPQSQFTREYFAAFTTVFFAWLIGPSEVRASELNGRREKNVVHVRKCRF  157

Query  440  LEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQ  261
            LE++NCVGMC NLCKMPSQ FIK+S+GMPVNMVPNF++MSCEMIFGQDPP+++ DPA+ Q
Sbjct  158  LEQSNCVGMCINLCKMPSQAFIKDSLGMPVNMVPNFDDMSCEMIFGQDPPASNDDPALKQ  217

Query  260  PCYKLCNS  237
            PCYKLCN+
Sbjct  218  PCYKLCNN  225



>ref|XP_006575048.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X2 [Glycine max]
Length=254

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 182/265 (69%), Gaps = 19/265 (7%)
 Frame = -2

Query  989  MDAKLVQRFETPTIIVhrhhrtttkrhHLPLLIRAVVAKPADnnnnnsntkttlsssssN  810
            M+AKLV +  +PT+ +             P ++  V+A+PAD+ +  +            
Sbjct  1    MEAKLVAQCNSPTLTLAHWKLKQ------PCVV-GVLARPADDISGEARKTNH-------  46

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D  FDR+AIN+LS CV+  TG+++SKSGY+ LVE        F   +Q  L+IQ+L 
Sbjct  47   VYKDGLFDRIAINYLSKCVQEATGLKNSKSGYESLVEAATLASQRFSPIEQHQLVIQSLD  106

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQ-----VKEAEFNGRREKNV  465
            +A P P+L+L+  +LP S+  R+  A FTT+FFAWLVGP +     V+E+E  GRRE+NV
Sbjct  107  RAFPKPMLLLIRTLLPPSKFARKLFAIFTTLFFAWLVGPSEFHHVKVRESEVEGRRERNV  166

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            VHI+KCRFLEETNCVGMC NLCK+PSQ+FIK+S+GM VNMVPNF++MSCEMIFG+DPP +
Sbjct  167  VHIKKCRFLEETNCVGMCINLCKLPSQSFIKDSLGMSVNMVPNFDDMSCEMIFGEDPPES  226

Query  284  SHDPAMMQPCYKLCNSKKKHHNNCI  210
            + DPA+ QPC+KLC +K+ H  NC+
Sbjct  227  TDDPALNQPCFKLCKAKRSHGTNCL  251



>ref|XP_007144677.1| hypothetical protein PHAVU_007G175900g [Phaseolus vulgaris]
 gb|ESW16671.1| hypothetical protein PHAVU_007G175900g [Phaseolus vulgaris]
Length=270

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 177/260 (68%), Gaps = 16/260 (6%)
 Frame = -2

Query  989  MDAKLVQRFETPTIIVhrhhrtttkrhHLPLLIRAVVAKPADnnnnnsntkttlsssssN  810
            MDAKLV    +PT+                  + AV+ + AD  +  ++           
Sbjct  1    MDAKLVALCRSPTLTSAHWKPKYH-------CVVAVLPRSADEISGETSKTK--------  45

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY DT+F  +AINH+S C++  TG+R+SKSGY+ LVE       NF   QQ  ++ ++L 
Sbjct  46   VYKDTFFGHIAINHISKCLQEATGLRNSKSGYESLVEAATMASQNFSPIQQHQVVTKSLD  105

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFN-GRREKNVVHIQ  453
            +A P P+L+L+  VLP+S+  R   A FTT+FFAWLVGP +V+E++ + GRREKNVVHI+
Sbjct  106  RAFPKPMLLLIKKVLPESKFTRTLFAIFTTLFFAWLVGPSEVRESDIDEGRREKNVVHIK  165

Query  452  KCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDP  273
            KCRFLEE NCVGMC NLCK+P+Q+F+K S+GMPVNMVPNF++MSCEMIFGQ+PP +++DP
Sbjct  166  KCRFLEEANCVGMCINLCKLPTQSFVKGSLGMPVNMVPNFDDMSCEMIFGQEPPESTNDP  225

Query  272  AMMQPCYKLCNSKKKHHNNC  213
            A+ QPCYKLC +KK H  NC
Sbjct  226  ALKQPCYKLCKAKKSHGTNC  245



>ref|XP_011042447.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X1 [Populus euphratica]
Length=300

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            +Y+D+WF  LAIN+LS   +  TG+R+SK GY+ L +     +  F   QQ  L++Q+L+
Sbjct  68   IYNDSWFAELAINYLSQQFQDATGLRNSKRGYESLAQTATDTWQKFSPIQQHGLVLQSLN  127

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +AIP  IL ++ ++LP+S   REY AAFTT+FFAWLVGP +V+E+EFNG++EKNVVHI+K
Sbjct  128  RAIPRLILNMIKIMLPESTFKREYFAAFTTLFFAWLVGPSEVRESEFNGKKEKNVVHIKK  187

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMCTNLCK+PSQTFIK+S+GMPV+MVPNF++MSCEMIFGQ+PP  + DPA
Sbjct  188  CRFLEETNCVGMCTNLCKIPSQTFIKHSLGMPVDMVPNFDDMSCEMIFGQEPPVITEDPA  247

Query  269  MMQPCYKLCNSKKKHH  222
              QPCYKLCN+    H
Sbjct  248  FKQPCYKLCNNSSHPH  263



>ref|XP_004493731.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Cicer 
arietinum]
Length=255

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 153/200 (77%), Gaps = 0/200 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D+WFD LAINHLS  V+A TG R++KSGY+ LVE        F+  QQQ +IIQAL 
Sbjct  55   VYKDSWFDLLAINHLSKSVQAATGFRNNKSGYESLVEAAIMTKQKFNPIQQQEVIIQALD  114

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
             A P  I  L+   LP S+  RE+ A F+++FF WLVG  +VKE++ NGRREKNVV+I+K
Sbjct  115  TAFPKIIFSLIKKHLPPSKFTREHFAIFSSLFFTWLVGTSEVKESDVNGRREKNVVYIKK  174

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMC NLCK+P+Q+F+KNS+GMPVNMVPNF++MSCEMIFGQDPP+++ DP+
Sbjct  175  CRFLEETNCVGMCINLCKIPTQSFVKNSLGMPVNMVPNFDDMSCEMIFGQDPPASTDDPS  234

Query  269  MMQPCYKLCNSKKKHHNNCI  210
            +  PCYK C + K H  NC+
Sbjct  235  LKTPCYKQCKAYKSHGTNCL  254



>ref|XP_008802562.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Phoenix 
dactylifera]
Length=264

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 152/200 (76%), Gaps = 3/200 (2%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFDRLAI+HLS  ++  TG+R+ K GY+ LVE    V  ++D+ +QQ L+IQAL+
Sbjct  65   VYKDNWFDRLAIHHLSEMLQVTTGMRNKKKGYESLVEAASMVMRSYDAKRQQELVIQALN  124

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            KA P  +L ++  VLP S+  REY A FTTIFF+WLVG C+V+E+E  G+ EK+VV+I K
Sbjct  125  KAFPGFMLKMIKFVLPSSKFSREYFATFTTIFFSWLVGRCEVRESEVQGKIEKSVVYIYK  184

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CR LE TNCVGMCTNLCK+PSQ FIK+S+GMP+NMVPNFE+MSCEMIFGQ+PP    DPA
Sbjct  185  CRLLESTNCVGMCTNLCKIPSQRFIKDSLGMPINMVPNFEDMSCEMIFGQNPP--EDDPA  242

Query  269  MMQPCYKL-CNSKKKHHNNC  213
            + QPCY+  C +K+ H   C
Sbjct  243  LKQPCYRTSCIAKQTHGVKC  262



>ref|XP_010932838.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Elaeis 
guineensis]
Length=264

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 151/200 (76%), Gaps = 3/200 (2%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WF RLAI+HLS  ++  TG+ + K GY+ LVE    V  ++D+ +QQ L+IQ+L+
Sbjct  65   VYKDNWFGRLAIHHLSDSLQVTTGMGNKKKGYESLVEAASMVMRSYDAKRQQELVIQSLN  124

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            KA P  IL ++  +LP S+  REY A FTTIFF+WLVG C+V+E+E  G+ EKNVV+I K
Sbjct  125  KAFPGFILKMIKFLLPPSKFAREYFATFTTIFFSWLVGCCEVRESEVQGKMEKNVVYISK  184

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE TNCVGMCTNLCK+PSQ FIK+S+GMPVNMVPNFE+MSCEMIFGQ PP    DPA
Sbjct  185  CRFLESTNCVGMCTNLCKIPSQRFIKDSLGMPVNMVPNFEDMSCEMIFGQHPP--EDDPA  242

Query  269  MMQPCYKL-CNSKKKHHNNC  213
            + QPCY+  C +K+ H  NC
Sbjct  243  LKQPCYRTSCTAKQIHGVNC  262



>ref|XP_009389836.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=258

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 150/199 (75%), Gaps = 3/199 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D WFDRLAI +LS  ++A TG+ ++K GY+ LVE    +    D+  QQ L+IQ+LH 
Sbjct  59   YKDNWFDRLAIRYLSRSLQATTGISNNKEGYESLVEAAIMICKKVDAKAQQDLVIQSLHS  118

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
            A+P  IL ++ ++LPQS   RE  AAFTT+FF WLVGPCQV+++E  G+ EKNVV+I KC
Sbjct  119  ALPVIILTMIKILLPQSTFTREIFAAFTTLFFPWLVGPCQVRKSEVKGKTEKNVVYIPKC  178

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            RFLE TNCVGMCTNLCK+PSQ FI++S+GMPV MVPNFE++SCEM+FGQ PP   HDP +
Sbjct  179  RFLESTNCVGMCTNLCKVPSQKFIQDSLGMPVYMVPNFEDLSCEMVFGQQPP--LHDPTL  236

Query  266  MQPCY-KLCNSKKKHHNNC  213
             QPCY K C +K+KH  NC
Sbjct  237  KQPCYHKSCITKQKHGVNC  255



>gb|EYU46537.1| hypothetical protein MIMGU_mgv1a012261mg [Erythranthe guttata]
Length=256

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 154/200 (77%), Gaps = 2/200 (1%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY+D WFDRLAINHLS+ ++A TG +S KSGY+GL+E        F   +Q+ +++Q L 
Sbjct  56   VYNDNWFDRLAINHLSNALQASTGFKSEKSGYEGLIEAATMASQKFSPIKQREVVMQTLD  115

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
             A P PIL LM  +LP S+  RE+ AAFTTIFFAWLVGPCQVKE+EF GR EKNVVHI K
Sbjct  116  -AYPKPILSLMKKLLPPSKFSREFFAAFTTIFFAWLVGPCQVKESEFEGRIEKNVVHIPK  174

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE TNCVGMCTNLCKMPSQ FIK  +G+PVNMVPNF++MSCEMIFG++PP  S DPA
Sbjct  175  CRFLEGTNCVGMCTNLCKMPSQAFIKEFVGVPVNMVPNFDDMSCEMIFGEEPPPQSLDPA  234

Query  269  MMQPCYKLCNSK-KKHHNNC  213
              QPCYK C +  K++H NC
Sbjct  235  FAQPCYKQCKATIKRNHKNC  254



>ref|XP_010522757.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Tarenaya 
hassleriana]
Length=259

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSS---KSGYDGLVEITRAVFHNFDSTQQQSLIIQ  639
             Y D  F ++AI +LS  ++   GV SS   K GY  LVE    V  NF+  QQ  LI++
Sbjct  58   AYDDNGFAKMAIGYLSKTLQKTAGVSSSSSTKGGYGSLVEAAAMVARNFEPKQQHELILR  117

Query  638  ALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVH  459
            AL +AIP  IL L+ ++LPQS++ RE  A FTTIFFAWLVGP +V+E EFNG REK VVH
Sbjct  118  ALERAIPRTILSLIRILLPQSKLTREVFAVFTTIFFAWLVGPSEVRETEFNGGREKRVVH  177

Query  458  IQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSH  279
            I+KCRFLE++NCVGMCT+LCK+PSQTFIKNS+GMPV M PNF++MSCEM+FGQDPP    
Sbjct  178  IRKCRFLEQSNCVGMCTHLCKIPSQTFIKNSLGMPVYMNPNFDDMSCEMVFGQDPPELED  237

Query  278  DPAMMQPCYKLCNSKKKH  225
            DPA  QPCY  C S +K+
Sbjct  238  DPATKQPCYTSCKSNRKY  255



>gb|KEH23841.1| beta-carotene isomerase D27 [Medicago truncatula]
Length=248

 Score =   254 bits (648),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 147/200 (74%), Gaps = 0/200 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFD +AINHLS  V+A TG+R++KSGY+ LVE        F++ QQQ + IQAL 
Sbjct  49   VYKDNWFDLIAINHLSKTVQAATGLRNNKSGYESLVEAATMAKQKFNAIQQQEVTIQALD  108

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            K  P  +  L+       +  RE+ A  TT+FF WL+GP +V+E+E NGR E+N V+I+K
Sbjct  109  KLFPQFVFALIKKQPLPPKFTREFFALITTMFFTWLLGPSEVRESEINGRIERNAVYIKK  168

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMC N+CK+P+Q+FIKN++GMPVNMVPNF++MSCEMIFGQDPP++  DP+
Sbjct  169  CRFLEETNCVGMCVNMCKLPTQSFIKNTLGMPVNMVPNFDDMSCEMIFGQDPPASIDDPS  228

Query  269  MMQPCYKLCNSKKKHHNNCI  210
            + QPCYK C   + H  +C+
Sbjct  229  LKQPCYKQCKVYRSHGADCL  248



>ref|XP_006575049.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X3 [Glycine max]
Length=246

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 175/265 (66%), Gaps = 27/265 (10%)
 Frame = -2

Query  989  MDAKLVQRFETPTIIVhrhhrtttkrhHLPLLIRAVVAKPADnnnnnsntkttlsssssN  810
            M+AKLV +  +PT+ +             P ++  V+A+PAD+ +  +            
Sbjct  1    MEAKLVAQCNSPTLTLAHWKLKQ------PCVV-GVLARPADDISGEARKTNH-------  46

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D  FDR+AIN+LS CV+  TG+++SKSGY+ LVE        F   +Q  L+IQ+L 
Sbjct  47   VYKDGLFDRIAINYLSKCVQEATGLKNSKSGYESLVEAATLASQRFSPIEQHQLVIQSLD  106

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQ-----VKEAEFNGRREKNV  465
            +A P P+L+L+  +LP S+  R+  A FTT+FFAWLVGP +     V+E+E  GRRE+NV
Sbjct  107  RAFPKPMLLLIRTLLPPSKFARKLFAIFTTLFFAWLVGPSEFHHVKVRESEVEGRRERNV  166

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            VHI+KCRFLEETNCVGMC NLCK+PSQ+FIK+S+        +F++MSCEMIFG+DPP +
Sbjct  167  VHIKKCRFLEETNCVGMCINLCKLPSQSFIKDSL--------DFDDMSCEMIFGEDPPES  218

Query  284  SHDPAMMQPCYKLCNSKKKHHNNCI  210
            + DPA+ QPC+KLC +K+ H  NC+
Sbjct  219  TDDPALNQPCFKLCKAKRSHGTNCL  243



>ref|XP_009402431.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=238

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 149/200 (75%), Gaps = 3/200 (2%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WF+RLAI+HLS  ++A TG+ + K GY+ LV     +   FD+  QQ L+I++L 
Sbjct  39   VYKDNWFERLAIHHLSSAIEATTGMTNKKEGYESLVAAAIMISKKFDTKAQQGLVIRSLQ  98

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P+ IL ++ ++LP S   REY AAFTT+FF WL+G C+V+++E  G+ EKNVV+I K
Sbjct  99   EAFPSAILTMIKILLPPSTFSREYFAAFTTMFFPWLIGRCEVRKSEIKGKSEKNVVYIPK  158

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE TNCVGMCTNLCK+PSQ FI++S+GMP+ MVPNFE+MSCEMIFGQ PP    DPA
Sbjct  159  CRFLESTNCVGMCTNLCKIPSQKFIQDSLGMPIYMVPNFEDMSCEMIFGQQPP--LDDPA  216

Query  269  MMQPCY-KLCNSKKKHHNNC  213
            + QPCY K C +K++H   C
Sbjct  217  LKQPCYHKSCIAKQRHSMKC  236



>gb|ABA94460.1| hypothetical protein LOC_Os11g37650 [Oryza sativa Japonica Group]
 gb|EAZ18968.1| hypothetical protein OsJ_34503 [Oryza sativa Japonica Group]
Length=236

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 148/200 (74%), Gaps = 3/200 (2%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D+WFD+LAI +LS  ++  +G+++ K GY+ L++   A+   F   +Q  ++ QAL 
Sbjct  37   VYRDSWFDKLAIGYLSRNLQEASGLKNEKDGYESLIDAALAISRIFSLDKQSEIVTQALE  96

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A+P+ IL ++ +++P SR  REY AAFTTIFF WLVGPC+V E+E  GR+EKNVV+I K
Sbjct  97   RALPSYILTMIKVMMPPSRFSREYFAAFTTIFFPWLVGPCEVMESEVEGRKEKNVVYIPK  156

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE TNCVGMCTNLCK+P Q FI++S+GM V M PNFE+MSCEMIFGQ PP    DPA
Sbjct  157  CRFLESTNCVGMCTNLCKIPCQKFIQDSLGMKVYMSPNFEDMSCEMIFGQQPP--EDDPA  214

Query  269  MMQPCYKL-CNSKKKHHNNC  213
            + QPC++  C +K+ H  NC
Sbjct  215  LKQPCFRTKCVAKQNHGVNC  234



>sp|C7AU21.1|D27_ORYSJ RecName: Full=Beta-carotene isomerase D27, chloroplastic; AltName: 
Full=Protein DWARF-27; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ACT91266.1| DWARF27 [Oryza sativa Japonica Group]
Length=278

 Score =   246 bits (629),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 148/200 (74%), Gaps = 3/200 (2%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D+WFD+LAI +LS  ++  +G+++ K GY+ L++   A+   F   +Q  ++ QAL 
Sbjct  79   VYRDSWFDKLAIGYLSRNLQEASGLKNEKDGYESLIDAALAISRIFSLDKQSEIVTQALE  138

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A+P+ IL ++ +++P SR  REY AAFTTIFF WLVGPC+V E+E  GR+EKNVV+I K
Sbjct  139  RALPSYILTMIKVMMPPSRFSREYFAAFTTIFFPWLVGPCEVMESEVEGRKEKNVVYIPK  198

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE TNCVGMCTNLCK+P Q FI++S+GM V M PNFE+MSCEMIFGQ PP    DPA
Sbjct  199  CRFLESTNCVGMCTNLCKIPCQKFIQDSLGMKVYMSPNFEDMSCEMIFGQQPP--EDDPA  256

Query  269  MMQPCYKL-CNSKKKHHNNC  213
            + QPC++  C +K+ H  NC
Sbjct  257  LKQPCFRTKCVAKQNHGVNC  276



>ref|XP_010679144.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=256

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 141/194 (73%), Gaps = 0/194 (0%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y DTW D +AINHLSH ++AV G+   K GYDGL+E  + V   FD  QQ  L ++ L +
Sbjct  57   YRDTWLDLMAINHLSHNLQAVAGIEIEKDGYDGLLEACKVVILKFDPVQQSQLGLEGLKR  116

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
            +IP  I  LM  ++P S+  RE  A F  +FFAWL+G  ++KE+EFNG+REKNVVHI+KC
Sbjct  117  SIPKQIFPLMKALIPPSKFTRELFAKFAGLFFAWLIGSSELKESEFNGKREKNVVHIKKC  176

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            RFLE +NC GMC NLCK P+QTFIKNS+GMPV MVPNFE+MSCEMIFG +PP    DPA 
Sbjct  177  RFLEGSNCAGMCINLCKFPTQTFIKNSLGMPVTMVPNFEDMSCEMIFGVEPPPPDVDPAT  236

Query  266  MQPCYKLCNSKKKH  225
             QPCYKLC   ++H
Sbjct  237  KQPCYKLCKMSRRH  250



>gb|EEC68482.1| hypothetical protein OsI_36734 [Oryza sativa Indica Group]
Length=274

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 147/200 (74%), Gaps = 3/200 (2%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFD+LAI +LS  ++  +G+++ K GY+ L++   A+   F   +Q  ++ QAL 
Sbjct  75   VYRDNWFDKLAIGYLSRNLQEASGLKNEKDGYESLIDAALAISRIFSLDKQSEIVTQALE  134

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A+P+ IL ++ +++P SR  REY AAFTTIFF WLVGPC+V E+E  GR+EKNVV+I K
Sbjct  135  RALPSYILTMIKVMMPPSRFSREYFAAFTTIFFPWLVGPCEVMESEVEGRKEKNVVYIPK  194

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE TNCVGMCTNLCK+P Q FI++S+GM V M PNFE+MSCEMIFGQ PP    DPA
Sbjct  195  CRFLESTNCVGMCTNLCKIPCQKFIQDSLGMKVYMSPNFEDMSCEMIFGQQPP--EDDPA  252

Query  269  MMQPCYKL-CNSKKKHHNNC  213
            + QPC++  C +K+ H  NC
Sbjct  253  LKQPCFRTKCVAKQNHGVNC  272



>dbj|BAJ90178.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 147/200 (74%), Gaps = 3/200 (2%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VYHDTWFD LAI +LS  ++  +G+++ K GY GL+E   A+   F    Q  ++  AL 
Sbjct  78   VYHDTWFDNLAIGYLSRKLQEASGIKNGKHGYQGLIEAAVAISRIFRLDTQCEIVAGALE  137

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A+P+ I+ ++ +++P SR  REY AAFTTIFF WLVGPC+V+E+E +G REKNVV+I K
Sbjct  138  RAMPSYIVTMIKVMMPPSRFSREYFAAFTTIFFPWLVGPCEVRESEVDGTREKNVVYIPK  197

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE TNCVGMCTNLCK+PSQ F+++S+G+ V M PNFE+MSCEMIFGQ PP    DPA
Sbjct  198  CRFLESTNCVGMCTNLCKIPSQKFMQDSLGVSVYMSPNFEDMSCEMIFGQQPP--EDDPA  255

Query  269  MMQPCYKL-CNSKKKHHNNC  213
            + QPC+   C +K+ +  +C
Sbjct  256  LKQPCFSTKCIAKQDYGVSC  275



>ref|XP_003577412.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Brachypodium 
distachyon]
Length=277

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 148/199 (74%), Gaps = 3/199 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            YHD+WFD LAI +LS  ++  +G+R+ K GY+GL+E   A+   F    Q  ++  AL +
Sbjct  81   YHDSWFDNLAIGYLSRALQNASGIRNRKPGYEGLIEAAVAISRIFRLDTQCEIVASALEQ  140

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
            A+P+ I+ ++ +++P SR  REY AAFTTIFF WLVGPC+V+E+E +G REKNVV+I KC
Sbjct  141  AMPSYIITMIKVMMPPSRFSREYFAAFTTIFFPWLVGPCEVRESEVDGTREKNVVYIPKC  200

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            RFLE TNCVGMCTNLCK+PSQ F+++S+G+ V M PNF++MSCEMIFGQ PP    DPA+
Sbjct  201  RFLESTNCVGMCTNLCKIPSQKFMQDSLGVSVYMSPNFDDMSCEMIFGQQPP--EDDPAL  258

Query  266  MQPCYKL-CNSKKKHHNNC  213
             QPC++  C +K+ +  NC
Sbjct  259  KQPCFRTKCIAKQNYGVNC  277



>ref|XP_006418271.1| hypothetical protein EUTSA_v10008499mg [Eutrema salsugineum]
 gb|ESQ36624.1| hypothetical protein EUTSA_v10008499mg [Eutrema salsugineum]
Length=264

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 143/196 (73%), Gaps = 3/196 (2%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSKS---GYDGLVEITRAVFHNFDSTQQQSLIIQAL  633
             D +  ++AIN+LS  ++   G+ S+ S   GYD LV+    V  N D+ QQ  L++ AL
Sbjct  65   EDNFLSKIAINYLSKTLQDTAGMSSNSSKSTGYDSLVDTATKVARNLDTKQQHELVLIAL  124

Query  632  HKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQ  453
             +A P  IL L+ M+LP S++ RE  A FTTIFFAWLVGP +V+E E NGR+EK+VV I+
Sbjct  125  DRAFPTVILSLIKMLLPPSKLSRELFALFTTIFFAWLVGPSEVRETEVNGRKEKSVVFIE  184

Query  452  KCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDP  273
            KCRFLE+TNCVGMCT+LCK+PSQ FIKNS+GMP+ M+P+F+++SC+M+FGQDPP    DP
Sbjct  185  KCRFLEQTNCVGMCTHLCKIPSQIFIKNSLGMPIYMMPDFDDLSCKMMFGQDPPEIKDDP  244

Query  272  AMMQPCYKLCNSKKKH  225
             M QPC++ C S + +
Sbjct  245  VMKQPCFQFCKSNRSY  260



>ref|NP_001144840.1| hypothetical protein precursor [Zea mays]
 gb|ACG43331.1| hypothetical protein [Zea mays]
 tpg|DAA42220.1| TPA: hypothetical protein ZEAMMB73_436579 [Zea mays]
Length=262

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D WFD+LAI +LS  ++  +G+++ K GY+GL+E   A+   F   QQ   +  AL +
Sbjct  64   YRDNWFDKLAIGYLSRNLQEASGMKNGKDGYEGLIEAALAISALFRVDQQWDTVASALQR  123

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
            A P+ IL ++ +++P SR  REY AAFTT+FF WLVGPC+V+E++ +GR E+NVV+I KC
Sbjct  124  AFPSYILTMIKVMMPPSRFSREYFAAFTTVFFPWLVGPCEVRESQVDGREERNVVYIPKC  183

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            RFLE TNCVGMCTNLCK+P Q FI++S+G  V M PNFE+MSCEMIFGQ PP    DPA+
Sbjct  184  RFLESTNCVGMCTNLCKIPCQRFIQDSLGTAVYMSPNFEDMSCEMIFGQQPP--EDDPAL  241

Query  266  MQPCYKL-CNSKKKHHNNC  213
             QPC++  C +K+ H  NC
Sbjct  242  KQPCFRTKCIAKQNHQVNC  260



>tpg|DAA42209.1| TPA: hypothetical protein ZEAMMB73_458126 [Zea mays]
Length=216

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D WFD+LAI +LS  ++  +G+++ K GY+GL+E   A+   F   QQ   +  AL +
Sbjct  18   YRDNWFDKLAIGYLSRNLQEASGMKNRKDGYEGLIEAALAISALFRVDQQWDTVASALQR  77

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
            A P+ IL ++ +++P SR  REY AAFTT+FF WLVGPC+V+E++ +GR E+NVV+I KC
Sbjct  78   AFPSYILTMIKVMMPPSRFSREYFAAFTTVFFPWLVGPCEVRESQVDGREERNVVYIPKC  137

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            RFLE TNCVGMCTNLCK+P Q FI++S+G  V M PNFE+MSCEMIFGQ PP    DPA+
Sbjct  138  RFLESTNCVGMCTNLCKIPCQRFIQDSLGTAVYMSPNFEDMSCEMIFGQQPP--EDDPAL  195

Query  266  MQPCYKL-CNSKKKHHNNC  213
             QPC++  C +K+ H  NC
Sbjct  196  KQPCFRTKCIAKQNHQVNC  214



>ref|XP_008670838.1| PREDICTED: LOW QUALITY PROTEIN: beta-carotene isomerase D27, 
chloroplastic-like [Zea mays]
Length=260

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D WFD+LAI +LS  ++  +G+++ K GY+GL+E   A+   F   QQ   +  AL +
Sbjct  62   YRDNWFDKLAIGYLSRNLQEASGMKNRKDGYEGLIEAALAISALFRVDQQWDTVASALQR  121

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
            A P+ IL ++ +++P SR  REY AAFTT+FF WLVGPC+V+E++ +GR E+NVV+I KC
Sbjct  122  AFPSYILTMIKVMMPPSRFSREYFAAFTTVFFPWLVGPCEVRESQVDGREERNVVYIPKC  181

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            RFLE TNCVGMCTNLCK+P Q FI++S+G  V M PNFE+MSCEMIFGQ PP    DPA+
Sbjct  182  RFLESTNCVGMCTNLCKIPCQRFIQDSLGTAVYMSPNFEDMSCEMIFGQQPP--EDDPAL  239

Query  266  MQPCYKL-CNSKKKHHNNC  213
             QPC++  C +K+ H  NC
Sbjct  240  KQPCFRTKCIAKQNHQVNC  258



>ref|XP_004979587.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X1 [Setaria italica]
Length=289

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 142/197 (72%), Gaps = 3/197 (2%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFD LAI +LS  ++  +G+++ K GY+GL+E   A+   F   QQ   +  AL 
Sbjct  93   VYRDNWFDNLAIGYLSRSLQEASGMKNGKDGYEGLIEAALAISGLFRVEQQWQTVATALE  152

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P+ IL ++ +++P SR  REY AAFTTIFF WLVGPC+V+E+E +GR+EKNVV++ K
Sbjct  153  RAFPSYILTMIKVMMPPSRFSREYFAAFTTIFFPWLVGPCEVRESEVDGRKEKNVVYVPK  212

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE TNCVGMCTNLCK+P + FI++S+G  V M PNFE+MSCEMIFGQ PP    DPA
Sbjct  213  CRFLESTNCVGMCTNLCKIPCEKFIQDSLGTAVYMSPNFEDMSCEMIFGQQPP--EDDPA  270

Query  269  MMQPCYKL-CNSKKKHH  222
            + QPC++  C +K+   
Sbjct  271  LKQPCFRTKCIAKQNRQ  287



>ref|NP_563673.1| inhibition of secondary bud outgrowth protein D27-like protein 
[Arabidopsis thaliana]
 sp|Q7XA78.1|D27_ARATH RecName: Full=Beta-carotene isomerase D27, chloroplastic; AltName: 
Full=Protein DWARF-27 homolog; Short=AtD27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAQ22624.1| At1g03051 [Arabidopsis thaliana]
 gb|AEE27521.1| inhibition of secondary bud outgrowth protein D27-like protein 
[Arabidopsis thaliana]
Length=264

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 141/195 (72%), Gaps = 2/195 (1%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSK--SGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             D++F ++AIN+LS  ++   G+ SS   + YD LV+    V  NFD+ QQ   ++ +L 
Sbjct  66   EDSFFSKIAINYLSKNLQDAAGISSSSKSTDYDRLVDTATRVSRNFDTKQQHEFVLSSLD  125

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A+P  I  L+ M  P S++ RE  A FTTI FAWLVGP +V+E E NGR+EK+VV+I+K
Sbjct  126  RALPTVISSLIKMAFPPSKVSRELFALFTTISFAWLVGPSEVRETEVNGRKEKSVVYIEK  185

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE++NCVGMCT++CK+PSQ FIKNS+GMP+ M P+F ++SC+M+FG++PP    DPA
Sbjct  186  CRFLEQSNCVGMCTHICKIPSQIFIKNSLGMPIYMEPDFNDLSCKMMFGREPPEIEDDPA  245

Query  269  MMQPCYKLCNSKKKH  225
            M QPC++ C S K +
Sbjct  246  MKQPCFEFCKSNKSY  260



>gb|KFK42667.1| hypothetical protein AALP_AA1G024100 [Arabis alpina]
Length=264

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 140/196 (71%), Gaps = 3/196 (2%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSK---SGYDGLVEITRAVFHNFDSTQQQSLIIQAL  633
             D++F ++AIN+LS  ++   G+ SS     GYD LV+    V  N ++ QQ  L++ AL
Sbjct  65   EDSFFSKIAINYLSKTIQDTAGMSSSSIKSDGYDSLVDTASRVASNLNTKQQHELVLIAL  124

Query  632  HKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQ  453
             +A P  IL L+ M+ P S++ RE  A  TTIFFAWLVGP +V E E +G++EK+VV I+
Sbjct  125  DRAFPTVILSLVKMLFPPSKLSRELFALTTTIFFAWLVGPSEVMETEVDGKKEKSVVFIE  184

Query  452  KCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDP  273
            KCRFLE+TNCVGMCT+LCK+PSQ FIK+S+GMP+ M+P+F ++SC+M+FGQDPP    DP
Sbjct  185  KCRFLEQTNCVGMCTHLCKIPSQIFIKDSLGMPIYMMPDFNDLSCKMMFGQDPPEIQDDP  244

Query  272  AMMQPCYKLCNSKKKH  225
             M QPC++ C S K +
Sbjct  245  VMKQPCFQFCKSNKTY  260



>ref|XP_002892145.1| hypothetical protein ARALYDRAFT_470283 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68404.1| hypothetical protein ARALYDRAFT_470283 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 140/195 (72%), Gaps = 2/195 (1%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSK--SGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             D++F ++AIN+LS  ++   G+ SS   + YD LV+    V  NFD+ QQ   ++ +L 
Sbjct  66   QDSFFSKIAINYLSKNLQDAAGISSSSKSTDYDRLVDTATRVARNFDTKQQHEFVLSSLD  125

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A+P  I  L+ M  P S++ RE  A FTTI F WLVGP +V+E E NGR+EK+VV+I+K
Sbjct  126  RALPTVISSLIKMAFPPSKLSRELFALFTTISFVWLVGPSEVRETEVNGRKEKSVVYIEK  185

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLE++NCVGMCT++CK+PSQ FIKNS+GMP+ M P+F ++SC+M+FG++PP    DPA
Sbjct  186  CRFLEQSNCVGMCTHICKIPSQIFIKNSLGMPIYMEPDFNDLSCKMMFGREPPEIEDDPA  245

Query  269  MMQPCYKLCNSKKKH  225
            M QPC++ C S K +
Sbjct  246  MKQPCFEFCKSNKSY  260



>ref|XP_010087115.1| hypothetical protein L484_012546 [Morus notabilis]
 gb|EXB26555.1| hypothetical protein L484_012546 [Morus notabilis]
Length=274

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 156/233 (67%), Gaps = 8/233 (3%)
 Frame = -2

Query  887  AVVAKPADnnnnnsntkttlsssssNVYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDG  708
            AV+ +PAD+         T+ +  +  Y+D+WFDR+A +HLS  V+A TG+R+SKSGY+ 
Sbjct  34   AVLTQPADSIGIRPLAIPTVVTEKAGPYNDSWFDRIATHHLSQSVQAATGLRNSKSGYES  93

Query  707  LVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSR--IGREYCAAFTTIF  534
            LVE   AV  NFD+T+Q+ L+IQAL KA P PIL L N  +  +     R  C     +F
Sbjct  94   LVEAATAVSRNFDATKQRELVIQALEKAFPRPILSLANKNIAAAIEICKRVLCCLHHLVF  153

Query  533  --FAWLVGPC---QVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKN  369
                W +      +V+E+E NGRREKNVVHI+KCRFLE+TNCVGMC+NLCK+PSQTFIK+
Sbjct  154  CVAGWTLSHLMNDKVRESELNGRREKNVVHIKKCRFLEQTNCVGMCSNLCKIPSQTFIKD  213

Query  368  SMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKK-KHHNNC  213
            S+G+PVNMVPNFE+MSCEMIFGQ PP+   DP        +C++   K   NC
Sbjct  214  SLGVPVNMVPNFEDMSCEMIFGQHPPALLDDPVTDGVLALVCSAAALKSGKNC  266



>ref|XP_009118720.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Brassica 
rapa]
Length=265

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 142/196 (72%), Gaps = 3/196 (2%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSK---SGYDGLVEITRAVFHNFDSTQQQSLIIQAL  633
             D +  ++AIN+LS  ++   G+ SS    +GYD LV+    V  N D  QQ  L++ AL
Sbjct  66   EDNFLSKIAINYLSKTLQDTAGMSSSSSKSTGYDSLVDTATRVAGNLDIKQQHELVLVAL  125

Query  632  HKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQ  453
             +A P  IL L+ M+LP S++ RE  A FTT+FFAWLVGP +V+E E NG++EK++V I+
Sbjct  126  DRAFPAVILSLIKMLLPPSKLSREMFALFTTVFFAWLVGPSEVRETEVNGKKEKSMVFIK  185

Query  452  KCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDP  273
            KCRFLE+TNCVGMCT+LCK+PSQ FIKNS+GMP+ M+P+F+++SC+M+FGQ+PP    DP
Sbjct  186  KCRFLEQTNCVGMCTHLCKIPSQIFIKNSLGMPIYMMPDFDDLSCKMMFGQEPPEIKDDP  245

Query  272  AMMQPCYKLCNSKKKH  225
             M QPC++ C S + +
Sbjct  246  VMKQPCFQFCKSNRSY  261



>ref|XP_002449767.1| hypothetical protein SORBIDRAFT_05g022855 [Sorghum bicolor]
 gb|EES08755.1| hypothetical protein SORBIDRAFT_05g022855 [Sorghum bicolor]
Length=301

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 141/209 (67%), Gaps = 24/209 (11%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             YHD+WFD+LAI +LS  ++  +G+++ K GY+GL+E   A+   F   QQ   + +AL 
Sbjct  93   TYHDSWFDKLAIGYLSRNLQEASGMKNGKDGYEGLIEAALAISALFRVDQQLETVAKALE  152

Query  629  KAIPNPILML----------------------MNMVLPQSRIGREYCAAFTTIFFAWLVG  516
            +A P+ IL +                      + +++P SR  REY AAFTTIFF WLVG
Sbjct  153  QAFPSYILTMARDKHKVSIIDGLESRLFFEYKIKIMMPPSRFSREYFAAFTTIFFPWLVG  212

Query  515  PCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPN  336
            PC+V+E+E +GR+EKNVV+I KCRFLE TNCVGMCTNLCK+P Q FI++S+G  V M PN
Sbjct  213  PCEVRESEVDGRKEKNVVYIPKCRFLESTNCVGMCTNLCKIPCQKFIQDSLGTAVYMSPN  272

Query  335  FENMSCEMIFGQDPPSTSHDPAMMQPCYK  249
            FE+MSCEMIFGQ PP    DPA+ QPC++
Sbjct  273  FEDMSCEMIFGQQPP--EDDPALKQPCFR  299



>emb|CDY32495.1| BnaA09g51010D [Brassica napus]
Length=264

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 142/196 (72%), Gaps = 3/196 (2%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSK---SGYDGLVEITRAVFHNFDSTQQQSLIIQAL  633
             D +  ++AIN+LS  ++   G+ SS    +GYD LV+    V  N D  QQ  L++ AL
Sbjct  65   EDNFLSKIAINYLSKTLQDTAGMSSSSSKSTGYDSLVDTATRVAGNLDIKQQHELVLVAL  124

Query  632  HKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQ  453
             +A P  IL L+ M+LP S++ RE  A FTT+FFAWLVGP +V+E E NG++EK++V I+
Sbjct  125  DRAFPAVILSLIKMLLPPSKLSREMFALFTTVFFAWLVGPSEVRETEVNGKKEKSMVFIK  184

Query  452  KCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDP  273
            KCRFLE+TNCVGMCT+LCK+PSQ FIKNS+GMP+ M+P+F+++SC+M+FGQ+PP    DP
Sbjct  185  KCRFLEQTNCVGMCTHLCKIPSQIFIKNSLGMPIYMMPDFDDLSCKMMFGQEPPEIKDDP  244

Query  272  AMMQPCYKLCNSKKKH  225
             M QPC++ C S + +
Sbjct  245  VMKQPCFQFCKSNRSY  260



>emb|CDY37443.1| BnaC08g45810D [Brassica napus]
Length=266

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 140/197 (71%), Gaps = 4/197 (2%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSK----SGYDGLVEITRAVFHNFDSTQQQSLIIQA  636
             D +  ++AIN+LS  ++   G+ SS     +GYD LV+    V  N    QQ  L++ A
Sbjct  66   EDNFLSKIAINYLSKTLRDTAGISSSSSSKSTGYDSLVDTATRVAGNLSIKQQHELVLVA  125

Query  635  LHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHI  456
            L +A P  IL L+ M+LP S++ RE  A FTT+FFAWLVGP +V+E E NGR+EK++V I
Sbjct  126  LDRAFPAVILSLIKMLLPPSKLSREMFALFTTVFFAWLVGPSEVRETEVNGRKEKSLVFI  185

Query  455  QKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHD  276
            +KCRFLE+TNCVGMCT+LCK+PSQ FIKNS+GMP+ M+P+F ++SC+M+FGQ+PP    D
Sbjct  186  EKCRFLEQTNCVGMCTHLCKIPSQIFIKNSLGMPIYMMPDFNDLSCKMMFGQEPPEIKDD  245

Query  275  PAMMQPCYKLCNSKKKH  225
            P M QPC++ C S + +
Sbjct  246  PVMKQPCFQFCKSNRSY  262



>ref|XP_010474908.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Camelina 
sativa]
Length=269

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 141/196 (72%), Gaps = 3/196 (2%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSKS---GYDGLVEITRAVFHNFDSTQQQSLIIQAL  633
             D++F +LAIN+LS  ++   G+ SS +    YD LV+    V  NFD+ QQ  L++ +L
Sbjct  70   EDSFFSKLAINYLSKNLQDAAGMSSSSTKSTDYDRLVDTATRVARNFDTKQQHELVLSSL  129

Query  632  HKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQ  453
             +A+P  I  L+ ++ P S++ RE  A FTTI FAWLVGP +V+E E NGR+EK+VV I+
Sbjct  130  DRALPAEISSLIKVLFPPSKLSRELFALFTTISFAWLVGPSEVRETEVNGRKEKSVVFIE  189

Query  452  KCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDP  273
            KCRFLE++NCVGMCT++CK+PSQ F+KNS+GMPV M P+F ++SC+M+FG++PP    DP
Sbjct  190  KCRFLEQSNCVGMCTHICKIPSQIFMKNSLGMPVYMEPDFNDLSCKMMFGREPPEIQDDP  249

Query  272  AMMQPCYKLCNSKKKH  225
             M QPC++ C S K +
Sbjct  250  VMKQPCFEFCKSNKSY  265



>ref|XP_010457314.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Camelina 
sativa]
Length=269

 Score =   223 bits (568),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 141/196 (72%), Gaps = 3/196 (2%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSKS---GYDGLVEITRAVFHNFDSTQQQSLIIQAL  633
             D++F ++AIN+LS  ++   G+ SS +    YD LV+    V  NFD+ QQ  L++ +L
Sbjct  70   EDSFFSKIAINYLSKNLQDAAGMSSSSTKSTDYDRLVDTATRVARNFDTKQQHELVLSSL  129

Query  632  HKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQ  453
             +A+P  I  L+ ++ P S++ RE  A FTTI FAWLVGP +V+E E NGR+EK+VV I+
Sbjct  130  DRALPAEISSLIKVLFPPSKLSRELFALFTTISFAWLVGPSEVRETEVNGRKEKSVVFIK  189

Query  452  KCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDP  273
            KCRFLE++NCVGMCT++CK+PSQ F+KNS+GMP+ M P+F ++SC+M+FG++PP    DP
Sbjct  190  KCRFLEQSNCVGMCTHICKIPSQIFMKNSLGMPIYMEPDFNDLSCKMMFGREPPEIQDDP  249

Query  272  AMMQPCYKLCNSKKKH  225
             M QPC++ C S K +
Sbjct  250  VMKQPCFEFCKSNKSY  265



>ref|XP_007144678.1| hypothetical protein PHAVU_007G175900g [Phaseolus vulgaris]
 gb|ESW16672.1| hypothetical protein PHAVU_007G175900g [Phaseolus vulgaris]
Length=239

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/260 (44%), Positives = 155/260 (60%), Gaps = 47/260 (18%)
 Frame = -2

Query  989  MDAKLVQRFETPTIIVhrhhrtttkrhHLPLLIRAVVAKPADnnnnnsntkttlsssssN  810
            MDAKLV    +PT+                  + AV+ + AD  +  ++           
Sbjct  1    MDAKLVALCRSPTLTSAHWKPKYH-------CVVAVLPRSADEISGETSKTK--------  45

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY DT+F  +AINH+S C++  TG+R+SKSGY+ LVE       NF   QQ  ++ ++L 
Sbjct  46   VYKDTFFGHIAINHISKCLQEATGLRNSKSGYESLVEAATMASQNFSPIQQHQVVTKSLD  105

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFN-GRREKNVVHIQ  453
            +A P P+L+L                               V+E++ + GRREKNVVHI+
Sbjct  106  RAFPKPMLLL-------------------------------VRESDIDEGRREKNVVHIK  134

Query  452  KCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDP  273
            KCRFLEE NCVGMC NLCK+P+Q+F+K S+GMPVNMVPNF++MSCEMIFGQ+PP +++DP
Sbjct  135  KCRFLEEANCVGMCINLCKLPTQSFVKGSLGMPVNMVPNFDDMSCEMIFGQEPPESTNDP  194

Query  272  AMMQPCYKLCNSKKKHHNNC  213
            A+ QPCYKLC +KK H  NC
Sbjct  195  ALKQPCYKLCKAKKSHGTNC  214



>ref|XP_006303275.1| hypothetical protein CARUB_v10010025mg [Capsella rubella]
 gb|EOA36173.1| hypothetical protein CARUB_v10010025mg [Capsella rubella]
Length=266

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 139/196 (71%), Gaps = 3/196 (2%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSK---SGYDGLVEITRAVFHNFDSTQQQSLIIQAL  633
             D++F ++AIN+LS  ++   G+ SS    + YD LV+    V  NFD+ QQ  L++ +L
Sbjct  67   EDSFFSKVAINYLSKNLQDAAGMSSSSSKSTDYDRLVDTATRVASNFDTKQQHELVLSSL  126

Query  632  HKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQ  453
             KA+P  I   + M+ P S++ RE  A FTTI FAWLVGP +V E E NGR+EK+VV I+
Sbjct  127  EKALPAVISSSIKMLFPPSKLSRELFALFTTISFAWLVGPSEVMETEINGRKEKSVVFIE  186

Query  452  KCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDP  273
            KCRFLE++NCVGMCT++CK+PSQ FIKNS+GMP+ M P+F ++SC+M+FG++PP    DP
Sbjct  187  KCRFLEQSNCVGMCTHICKIPSQIFIKNSLGMPIYMEPDFNDLSCKMMFGREPPEIQDDP  246

Query  272  AMMQPCYKLCNSKKKH  225
             M QPC++ C S K +
Sbjct  247  VMKQPCFEFCKSNKSY  262



>gb|EMT30070.1| hypothetical protein F775_05620 [Aegilops tauschii]
Length=371

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 144/223 (65%), Gaps = 30/223 (13%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VYHDTWFD LAI +LS  ++  +G+++ K GY GL+E    +   F    Q  ++  AL 
Sbjct  83   VYHDTWFDNLAIGYLSRKLQQASGIKNGKHGYQGLIEAAVTISRIFRLDTQCEIVASALE  142

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A+P+ I+ ++ +++P SR  REY AAFTTIFF WLVGPC+V+E+E +G REKNVV+I K
Sbjct  143  RAMPSYIVTMIKVMMPPSRFSREYFAAFTTIFFPWLVGPCEVRESEVDGTREKNVVYIPK  202

Query  449  CR---------------------------FLEETNCVGMCTNLCKMPSQTFIKNSMGMPV  351
            CR                           FLE TNCVGMCTNLCK+PSQ F+++S+G+ V
Sbjct  203  CRLMFLLTLHKLPMRIGEKYLLKIRRNEKFLESTNCVGMCTNLCKIPSQKFMQDSLGVSV  262

Query  350  NMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKL-CNSKKKH  225
             M PNFE+MSCEMIFGQ PP    DPA+ QPC+   C +K+ +
Sbjct  263  YMSPNFEDMSCEMIFGQQPP--EDDPALKQPCFSTKCIAKQDY  303



>ref|XP_010481514.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Camelina 
sativa]
Length=269

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 140/196 (71%), Gaps = 3/196 (2%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSKS---GYDGLVEITRAVFHNFDSTQQQSLIIQAL  633
             D++F ++AI +LS  ++   G+ SS +    YD LV+    V  NFD+ QQ  L++ +L
Sbjct  70   EDSFFSKIAIKYLSKNLQDAAGMSSSSTMSTDYDRLVDTATRVARNFDTKQQHELVLSSL  129

Query  632  HKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQ  453
             +A+P  I  L+ M+ P S++ RE  A FTTI FAWLVGP +V+E E NGR+EK+VV I+
Sbjct  130  DRALPAEISSLIKMLFPPSKLSRELFALFTTISFAWLVGPSEVRETEVNGRKEKSVVFIE  189

Query  452  KCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDP  273
            KCRFLE++NCVGMCT++CK+PSQ F+KNS+GMP+ M P+F ++SC+M+FG++PP    DP
Sbjct  190  KCRFLEQSNCVGMCTHICKIPSQIFMKNSLGMPIYMEPDFNDLSCKMMFGREPPEIQDDP  249

Query  272  AMMQPCYKLCNSKKKH  225
             M QPC++ C S K +
Sbjct  250  VMKQPCFEFCKSNKSY  265



>ref|XP_006575050.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X4 [Glycine max]
Length=225

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 146/222 (66%), Gaps = 19/222 (9%)
 Frame = -2

Query  989  MDAKLVQRFETPTIIVhrhhrtttkrhHLPLLIRAVVAKPADnnnnnsntkttlsssssN  810
            M+AKLV +  +PT+ +             P ++  V+A+PAD+ +  +            
Sbjct  1    MEAKLVAQCNSPTLTLAHWKLKQ------PCVV-GVLARPADDISGEARKTNH-------  46

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D  FDR+AIN+LS CV+  TG+++SKSGY+ LVE        F   +Q  L+IQ+L 
Sbjct  47   VYKDGLFDRIAINYLSKCVQEATGLKNSKSGYESLVEAATLASQRFSPIEQHQLVIQSLD  106

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQ-----VKEAEFNGRREKNV  465
            +A P P+L+L+  +LP S+  R+  A FTT+FFAWLVGP +     V+E+E  GRRE+NV
Sbjct  107  RAFPKPMLLLIRTLLPPSKFARKLFAIFTTLFFAWLVGPSEFHHVKVRESEVEGRRERNV  166

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVP  339
            VHI+KCRFLEETNCVGMC NLCK+PSQ+FIK+S+GM VNMVP
Sbjct  167  VHIKKCRFLEETNCVGMCINLCKLPSQSFIKDSLGMSVNMVP  208



>ref|XP_002520968.1| hypothetical protein RCOM_0991210 [Ricinus communis]
 gb|EEF41385.1| hypothetical protein RCOM_0991210 [Ricinus communis]
Length=244

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 128/191 (67%), Gaps = 37/191 (19%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            +Y D+WFD+LAINHLS  V+A TG+        G + I+             +L I+ L 
Sbjct  62   IYRDSWFDQLAINHLSQSVQAATGI--------GCISIS------------TNLPIKTL-  100

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
                          LPQSR  REY AAFTT+FF WL+GPCQV+E+EFNGR+EKNVVHI+K
Sbjct  101  --------------LPQSRFTREYFAAFTTLFFVWLIGPCQVRESEFNGRKEKNVVHIKK  146

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPA  270
            CRFLEETNCVGMCTNLCK+P+QTFIK S+GMPVNMVP+    S   +  QDPP  + DPA
Sbjct  147  CRFLEETNCVGMCTNLCKVPTQTFIKQSLGMPVNMVPSKYPRS--TLLKQDPPIPTEDPA  204

Query  269  MMQPCYKLCNS  237
              QPCYKLCN+
Sbjct  205  FRQPCYKLCNA  215



>ref|XP_006349770.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Solanum 
tuberosum]
Length=168

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  593  MVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGM  414
            M+LP+S+  REYCA FTTIFF WLVGPC+VKE+EFNGR+E NVVHI+KCRFLEETNCVGM
Sbjct  29   MLLPESKWAREYCAIFTTIFFPWLVGPCEVKESEFNGRKENNVVHIKKCRFLEETNCVGM  88

Query  413  CTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSK  234
            CTNLCKMPSQ FIK+++GM VNMVPNF++MSCEMIFGQDPP    DPA MQPCYKLC   
Sbjct  89   CTNLCKMPSQLFIKDTLGMSVNMVPNFDDMSCEMIFGQDPPPPDTDPAFMQPCYKLCKLN  148

Query  233  KKHHNNC  213
             KH  +C
Sbjct  149  NKHQTDC  155



>ref|XP_001767010.1| predicted protein [Physcomitrella patens]
 gb|EDQ68176.1| predicted protein [Physcomitrella patens]
Length=213

 Score =   195 bits (496),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 123/185 (66%), Gaps = 1/185 (1%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D+W D   ++     +  VTGV ++K GYDG VE+TR V        Q++  ++ LH 
Sbjct  22   YKDSWLDNTILSICMRRLGNVTGVSTTKKGYDGFVELTRKVMETRSPLLQRASSMRVLHS  81

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
            AIP  +L ++   LP ++   E  AA  T++  WLVGPC+VKE E NG  +K+ V I+KC
Sbjct  82   AIPPWLLKIIRRFLPNNQKTAETFAA-ATLYAEWLVGPCEVKEVEVNGTMQKSGVLIKKC  140

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            R+LE +NCVGMC NLCK+P+Q F  NS+G+P+ M PNFE+MSCEMI+GQ PPS   DPA+
Sbjct  141  RYLESSNCVGMCVNLCKIPTQDFFTNSLGVPLTMTPNFEDMSCEMIYGQTPPSIEEDPAL  200

Query  266  MQPCY  252
             QPC+
Sbjct  201  QQPCF  205



>ref|XP_004979588.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X2 [Setaria italica]
Length=270

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 121/175 (69%), Gaps = 0/175 (0%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFD LAI +LS  ++  +G+++ K GY+GL+E   A+   F   QQ   +  AL 
Sbjct  93   VYRDNWFDNLAIGYLSRSLQEASGMKNGKDGYEGLIEAALAISGLFRVEQQWQTVATALE  152

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A P+ IL ++ +++P SR  REY AAFTTIFF WLVGPC+V+E+E +GR+EKNVV++ K
Sbjct  153  RAFPSYILTMIKVMMPPSRFSREYFAAFTTIFFPWLVGPCEVRESEVDGRKEKNVVYVPK  212

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            CRFLE TNCVGMCTNLCK+P + FI++S+G  V M P+   ++ ++      P T
Sbjct  213  CRFLESTNCVGMCTNLCKIPCEKFIQDSLGTAVYMSPSCRAIALKLYRENGVPPT  267



>ref|XP_010917646.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Elaeis 
guineensis]
Length=174

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = -2

Query  611  ILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEE  432
            I + +  +LPQS+  REY A FTTIFF+WLVG C+V+E+E  G+ EKNVV I KCRFLE 
Sbjct  41   ITIEIKFLLPQSKFSREYFANFTTIFFSWLVGYCEVRESEVQGKMEKNVVCIPKCRFLES  100

Query  431  TNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY  252
            TNCVGMCTNLCK+P+Q FIK+S+GMP+NMVPNFE+MSCEMIFGQ PP  + DP + QPC 
Sbjct  101  TNCVGMCTNLCKIPTQRFIKDSLGMPINMVPNFEDMSCEMIFGQHPP--ADDPTLKQPCL  158

Query  251  KL-CNSKKKHHNNC  213
            +  C +K+ H  NC
Sbjct  159  RTSCIAKQTHGVNC  172



>ref|XP_002975730.1| hypothetical protein SELMODRAFT_103856 [Selaginella moellendorffii]
 gb|EFJ23359.1| hypothetical protein SELMODRAFT_103856 [Selaginella moellendorffii]
Length=230

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 117/189 (62%), Gaps = 0/189 (0%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D+ FDR  ++  +  ++  TG  S K+GYDG V+++R V    +  +Q++L+ + L  
Sbjct  32   YKDSIFDRAFMSLFARKMENATGRASKKTGYDGFVDVSRGVLQGRNPVEQRALVREVLLS  91

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
             +P         + P ++   E+ AA T  FF WLVGPC+  E E NG ++ + V I KC
Sbjct  92   IMPPGAPETFRKLFPPTKWACEFNAAITVPFFQWLVGPCERFEVEVNGVKQNSGVKILKC  151

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            R+LE +NCVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEMI+G  P S   DPA+
Sbjct  152  RYLENSNCVGMCVNMCKIPTQDFFTNDFGLPLTMTPNFEDMSCEMIYGLQPTSLEEDPAL  211

Query  266  MQPCYKLCN  240
             QPC +LC 
Sbjct  212  KQPCLQLCK  220



>ref|XP_002973675.1| hypothetical protein SELMODRAFT_173467 [Selaginella moellendorffii]
 gb|EFJ25335.1| hypothetical protein SELMODRAFT_173467 [Selaginella moellendorffii]
Length=220

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 117/187 (63%), Gaps = 0/187 (0%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D+ FDR  ++  +  ++  TG  S K+GYDG V+++R V    +  +Q++L+ + L  
Sbjct  34   YKDSIFDRAFMSLFARKMENATGRASKKTGYDGFVDVSRGVLQGRNPVEQRALVREVLLS  93

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
             +P         + P ++   E+ AA T  FF WLVGPC+  E E NG ++K+ V I KC
Sbjct  94   IMPPGAPETFRKLFPPTKWACEFNAAITVPFFQWLVGPCERFEVEVNGVKQKSGVKILKC  153

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            R+LE +NCVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEMI+G  P S   DPA+
Sbjct  154  RYLENSNCVGMCVNMCKIPTQDFFTNDFGLPLTMTPNFEDMSCEMIYGLQPTSLEEDPAL  213

Query  266  MQPCYKL  246
             QPC +L
Sbjct  214  KQPCLQL  220



>ref|XP_010274248.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Nelumbo 
nucifera]
Length=140

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 104/127 (82%), Gaps = 1/127 (1%)
 Frame = -2

Query  590  VLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMC  411
            +LPQS+  RE  A FTT  FAWLVGPC+VKE+E  G  EKNVVH++KCRFLEET+C GMC
Sbjct  8    LLPQSKFTRELYAVFTTFLFAWLVGPCEVKESEMEGEGEKNVVHVKKCRFLEETSCAGMC  67

Query  410  TNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYK-LCNSK  234
             NLCKMP+Q FIK+++GMP NMVPNF++MSC+MI GQDPP+ + DPA+ QPCY+ +C +K
Sbjct  68   INLCKMPTQRFIKDTLGMPTNMVPNFDDMSCDMIIGQDPPAPADDPALKQPCYRIICKAK  127

Query  233  KKHHNNC  213
            +KH  +C
Sbjct  128  QKHSTDC  134



>ref|WP_035989675.1| hypothetical protein [Leptolyngbya sp. KIOST-1]
Length=210

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 116/190 (61%), Gaps = 5/190 (3%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            +YHD   DRL I   S  +    G  +++SGYDG V+++  +    ++ QQQ+L+   L 
Sbjct  1    MYHDGLGDRLFIWLFSRKMAQAVGKDTARSGYDGFVDLSSQIMQGRNAQQQQALVAVVLK  60

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKNV  465
              +P  +L L+  +   +R+  E  A F T  F WLVGPC+VK  EF       R++++ 
Sbjct  61   SLVPAQVLWLIRTLFSPTRVVCELNAWFATRLFEWLVGPCEVKTVEFTDQQGRVRQQRSG  120

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            VHI+KCR+L+E+ CVGMC N+CK+P+Q F     G+P+ MVPNFE+ SCEM+FGQ PP  
Sbjct  121  VHIKKCRYLDESRCVGMCVNMCKLPTQRFFTEDFGIPLTMVPNFEDFSCEMVFGQPPPPL  180

Query  284  SHDPAMMQPC  255
              + A  QPC
Sbjct  181  ETEDAYHQPC  190



>gb|AFI78801.1| putative D27 family protein, partial [Spirogyra pratensis]
Length=237

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 116/199 (58%), Gaps = 1/199 (1%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y+D+ FDR  +   +  +  VTG RS   GY+G V+ +R V    ++  Q+  + + L  
Sbjct  30   YNDSIFDRAFMALFAAKMATVTGKRSDIGGYEGFVDTSRKVMQGRNAQGQREAVAKVLLS  89

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
             +P         + P ++   E  AA T  FF WLVGP ++KE E NG ++ + V I+KC
Sbjct  90   LLPPNAPAQFRKIFPPTKWSAEMNAAITVPFFQWLVGPAELKEVEVNGVKQMSGVQIKKC  149

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            R+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEMIFGQ       DPA+
Sbjct  150  RYLEYSGCVGMCVNMCKLPTQDFFTNEFGLPLTMNPNFEDMSCEMIFGQLSQPLEEDPAL  209

Query  266  MQPCYK-LCNSKKKHHNNC  213
             QPCY  LCN     + +C
Sbjct  210  KQPCYAMLCNVATPENQSC  228



>ref|WP_006454034.1| hypothetical protein [Synechococcus sp. PCC 7335]
 gb|EDX84287.1| hypothetical protein S7335_1984 [Synechococcus sp. PCC 7335]
Length=214

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 119/203 (59%), Gaps = 5/203 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            + D   DRL I   S  +    G  ++ +GY+G V++++ +    ++ +QQ+ + + L  
Sbjct  7    HKDNLLDRLFIWLFSRKMANAIGSTTAATGYEGFVDLSKQIMQGRNAQEQQAAVARVLQS  66

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKNVV  462
             +P P+L ++  V   +R+     A F T  F WLVGPC+V +AE  G     R + + V
Sbjct  67   LVPAPVLWVIRTVFSPTRLVCVLNAWFATQMFEWLVGPCEVAQAEVKGLDGEVRSQPSAV  126

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            HI+KCR+LEE+ CVGMC N+CK+P+QTF     G+P+ M+PNFE++SCEM+FG+ PP+  
Sbjct  127  HIKKCRYLEESQCVGMCVNMCKLPTQTFFTEKFGIPLTMIPNFEDLSCEMVFGRVPPAAD  186

Query  281  HDPAMMQPCYKLCNSKKKHHNNC  213
             D  M Q C   C++       C
Sbjct  187  EDEVMTQSCLSECSTGTLSVGRC  209



>ref|WP_036053421.1| hypothetical protein [Leptolyngbya sp. Heron Island J]
Length=212

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 119/194 (61%), Gaps = 5/194 (3%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             YHD++FD+L I   +  +    G R+ +SGYDG VE+++ +    +S QQQ L+   L 
Sbjct  5    TYHDSFFDQLFIRLFARKMSNAVGERNHQSGYDGFVELSQKIMQGRNSQQQQQLVAIVLQ  64

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKNV  465
              +P P+L  +      +++  E  A F T  F WLVGPC+V+ AE        R++K+ 
Sbjct  65   SLVPAPVLWGIRTFFSPTQLVCELNAWFATQLFEWLVGPCRVESAEVTTESGQVRQQKSA  124

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            VHI+KCR+LE++ CVGMC N+CK+P+Q F     G+P+ M PNFE++SC+M+FGQ PP  
Sbjct  125  VHIEKCRYLEQSGCVGMCVNMCKLPTQQFFTEKFGIPLTMTPNFEDLSCDMVFGQMPPPL  184

Query  284  SHDPAMMQPCYKLC  243
              + A  QPC + C
Sbjct  185  ETEAAYQQPCLQAC  198



>gb|ESA35998.1| hypothetical protein N836_09250 [Leptolyngbya sp. Heron Island 
J]
Length=235

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 119/194 (61%), Gaps = 5/194 (3%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             YHD++FD+L I   +  +    G R+ +SGYDG VE+++ +    +S QQQ L+   L 
Sbjct  28   TYHDSFFDQLFIRLFARKMSNAVGERNHQSGYDGFVELSQKIMQGRNSQQQQQLVAIVLQ  87

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKNV  465
              +P P+L  +      +++  E  A F T  F WLVGPC+V+ AE        R++K+ 
Sbjct  88   SLVPAPVLWGIRTFFSPTQLVCELNAWFATQLFEWLVGPCRVESAEVTTESGQVRQQKSA  147

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            VHI+KCR+LE++ CVGMC N+CK+P+Q F     G+P+ M PNFE++SC+M+FGQ PP  
Sbjct  148  VHIEKCRYLEQSGCVGMCVNMCKLPTQQFFTEKFGIPLTMTPNFEDLSCDMVFGQMPPPL  207

Query  284  SHDPAMMQPCYKLC  243
              + A  QPC + C
Sbjct  208  ETEAAYQQPCLQAC  221



>ref|XP_002973525.1| hypothetical protein SELMODRAFT_99956 [Selaginella moellendorffii]
 gb|EFJ25185.1| hypothetical protein SELMODRAFT_99956 [Selaginella moellendorffii]
Length=285

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 113/195 (58%), Gaps = 4/195 (2%)
 Frame = -2

Query  797  TWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIP  618
            TWF    I+ L    K+  G  ++K GYDG V+++R V       +Q++L+ Q     +P
Sbjct  63   TWF----ISSLYDLKKSDVGRATNKPGYDGFVDVSRGVLKGRTPVEQRALVRQVFLSIMP  118

Query  617  NPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFL  438
                     + P ++   E+ AA T  FF WLVGPC+  E E NG ++ + V I KCR+L
Sbjct  119  PGAPETFRKLFPPTKWACEFNAAITVPFFQWLVGPCERFEVEVNGVKQNSGVKILKCRYL  178

Query  437  EETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQP  258
            E ++C GMC N+CK+P+Q    N  G+P+ M PNFE+MSCEMI+G  PPS   DPA+ QP
Sbjct  179  ENSSCAGMCVNVCKIPTQDLFTNDFGLPLTMTPNFEDMSCEMIYGLQPPSLEEDPALKQP  238

Query  257  CYKLCNSKKKHHNNC  213
            C +LC    +   NC
Sbjct  239  CLELCKFLYQLLTNC  253



>ref|WP_039726288.1| hypothetical protein [Lyngbya confervoides]
 gb|KIF14521.1| hypothetical protein QP59_27830 [Aphanocapsa montana BDHKU210001]
 gb|KIF39449.1| hypothetical protein QQ91_20770 [Lyngbya confervoides BDU141951]
Length=218

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 114/189 (60%), Gaps = 5/189 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D  FDRL I   S  +    G +++  GYDG V++++ +    ++ +QQ+L+   L  
Sbjct  10   YQDGLFDRLFIRLFSRKMAHAVGQKTALQGYDGFVDLSQKIMKGRNAEEQQALVAVVLKS  69

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKE---AEFNG--RREKNVV  462
             +P P L L+  +   +R+  E  A F T+ F WLVGPC+V E    + NG  R++ + V
Sbjct  70   LVPAPALWLIRTLFSPTRLVCELNAWFATVLFEWLVGPCEVTEVTVTDANGEPRQQTSGV  129

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            HIQKCR+LE++ CVGMC N+CK+P+Q F     G+P+ M PNFE+ SCEM+FG  PP+  
Sbjct  130  HIQKCRYLEQSRCVGMCVNMCKLPTQRFFTEDFGIPLTMTPNFEDFSCEMVFGAPPPALE  189

Query  281  HDPAMMQPC  255
             +    QPC
Sbjct  190  TEDCYQQPC  198



>gb|AFI78793.1| putative D27 family protein [Chaetosphaeridium globosum]
Length=273

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 119/199 (60%), Gaps = 1/199 (1%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y+D WFD L ++  +  ++  TG ++  +GY+G V+I++ V       +QQ+ + + L  
Sbjct  70   YNDNWFDLLFMSLFAKKMEIETGKKTRLTGYEGFVDISKRVMQGRSPAEQQASVRRVLLS  129

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
             +P         + P +++  E  A  T  FFAWLVGP ++ E E NG ++ + V I+KC
Sbjct  130  MLPPEAPASFRKLFPPTKLSAEINAWITVPFFAWLVGPAKLYEVEVNGVKQWSGVKIEKC  189

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            R+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEM++GQ  P    DPA 
Sbjct  190  RYLENSGCVGMCVNMCKVPTQDFFTNEFGLPLTMTPNFEDMSCEMVYGQLAPPVEEDPAY  249

Query  266  MQPCY-KLCNSKKKHHNNC  213
             QPC+  LC+  +    +C
Sbjct  250  KQPCFAALCSIAQGDLPSC  268



>ref|WP_015220760.1| hypothetical protein [Cyanobacterium aponinum]
 ref|YP_007163085.1| hypothetical protein Cyan10605_2981 [Cyanobacterium aponinum 
PCC 10605]
 gb|AFZ55041.1| hypothetical protein Cyan10605_2981 [Cyanobacterium aponinum 
PCC 10605]
Length=216

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 112/191 (59%), Gaps = 5/191 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D WFDRL I   S  +    G +S K GY+G V+++  +    +S QQQ L+   L  
Sbjct  9    YKDNWFDRLFIALFSRKMAKAVGKKSQKKGYEGFVDLSMQIMEGRNSQQQQELVAIVLQS  68

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRRE-----KNVV  462
             +P+P+L L+  +   ++   E  A F T+ F WLVG  +++EAE           K+ V
Sbjct  69   LVPSPVLFLIRNLFSPTKWVCESNAWFATVLFEWLVGESEIREAEIVTEDNQVTILKSGV  128

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            +I+KCR+LE + CVGMC N+CK+P+Q F   S G+P+ M PNF++ SCEM+FGQ PP+  
Sbjct  129  YIKKCRYLEASGCVGMCVNMCKLPTQEFFTKSFGIPLTMTPNFDDFSCEMVFGQVPPAFE  188

Query  281  HDPAMMQPCYK  249
             + A  Q C K
Sbjct  189  DEEASRQSCLK  199



>ref|WP_026072724.1| hypothetical protein [Nodosilinea nodulosa]
Length=205

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 114/183 (62%), Gaps = 5/183 (3%)
 Frame = -2

Query  788  DRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPI  609
            DRL I   S  +    G  +++SGYDG V+++  +    ++ QQQ+L+   L   +P+ +
Sbjct  3    DRLFIWLFSRKMAKALGKDTARSGYDGFVDLSTQIMQGRNAQQQQALVAVVLKSLVPSQV  62

Query  608  LMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKNVVHIQKCR  444
            L L+  +   +++  E  A F T+ F WLVGPC+VK  EF       R++++ VHI+KCR
Sbjct  63   LWLIRQLFSPTQLVCELNAWFATLLFEWLVGPCEVKAVEFTDEQGRLRQQRSGVHIKKCR  122

Query  443  FLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMM  264
            +L+E+ CVGMC N+CK+P+Q F     G+P+ MVPNFE+ SCEM+FGQ PP    + A  
Sbjct  123  YLDESRCVGMCVNMCKLPTQRFFTEDFGIPLTMVPNFEDFSCEMVFGQPPPPLETEDAYN  182

Query  263  QPC  255
            QPC
Sbjct  183  QPC  185



>gb|EPS65195.1| hypothetical protein M569_09583, partial [Genlisea aurea]
Length=117

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = -2

Query  593  MVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGM  414
            M +P ++  R+  A FT  FF WLVGPC+V E EF G  E+NVVHI KCR LE T C+G+
Sbjct  1    MTMPPTKFSRQLFALFTVTFFRWLVGPCEVVEREFGGHMERNVVHITKCRVLEGTKCIGI  60

Query  413  CTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLC  243
            CTN+CKMP Q+FIK S+GMP+N+VPNF+ MSCEM+FG+DPP  S DPA   PCY+ C
Sbjct  61   CTNMCKMPCQSFIKESLGMPINIVPNFDEMSCEMVFGEDPPPESSDPAFSAPCYERC  117



>gb|AFI78796.1| putative D27 protein [Klebsormidium flaccidum]
Length=328

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 118/199 (59%), Gaps = 1/199 (1%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D   DRLA+N     ++ VTG R+ ++GYD  V++++A+     + +QQ+ + + L  
Sbjct  116  YKDGLIDRLAMNLFRRKMQTVTGARTKETGYDAFVDVSKALMRGKSAQEQQAAVSRVLLS  175

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
             IP  +  ++      +R+  E  A FT   F+WLVGP +V E E NG ++K  V I+KC
Sbjct  176  LIPRHLPYIIRTFFKPTRLSLELNALFTPSIFSWLVGPAEVVEVEVNGVKQKTGVKIKKC  235

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            R+LE + CVGMC N+CK+P+Q F     G+P+ M PNF++MSCEM+FGQ PP    D A 
Sbjct  236  RYLEASGCVGMCVNVCKVPTQDFFTKEFGLPLTMNPNFDDMSCEMVFGQVPPPIEEDKAF  295

Query  266  MQPCYK-LCNSKKKHHNNC  213
             QPC+  LC+        C
Sbjct  296  QQPCFATLCSMAADEKPKC  314



>ref|WP_036029921.1| hypothetical protein, partial [Leptolyngbya sp. PCC 6406]
Length=208

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 113/189 (60%), Gaps = 4/189 (2%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D + DR+ I   S  +    G  ++  GYDG V++++ +    ++ +QQ+L+   L 
Sbjct  1    VYQDGFVDRVFIWLFSRKMSRALGQSTNLQGYDGFVDLSKKIMQGRNAQEQQALVAIVLK  60

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG----RREKNVV  462
              +P+P+L L+  V   +R+  E  A F    F WLVGPC+V   E  G    R +++ V
Sbjct  61   SLVPSPVLWLIRTVFSPTRLVCELNAWFAARLFEWLVGPCEVTAVEVPGQTSQRTQRSGV  120

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            HI++CR+LE++ CVGMC N+CK+P+Q F     G+P+ M PNFE+ SCEM+FGQ PP   
Sbjct  121  HIERCRYLEQSRCVGMCINMCKLPTQDFFTQEFGIPLTMTPNFEDFSCEMVFGQPPPPLE  180

Query  281  HDPAMMQPC  255
             + A  QPC
Sbjct  181  TEDAYHQPC  189



>ref|XP_002975556.1| hypothetical protein SELMODRAFT_103815 [Selaginella moellendorffii]
 gb|EFJ23185.1| hypothetical protein SELMODRAFT_103815 [Selaginella moellendorffii]
Length=275

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 111/195 (57%), Gaps = 4/195 (2%)
 Frame = -2

Query  797  TWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIP  618
            TWF    I+ L    K+  G  ++K GYDG V+++R V       +Q++L+ Q     +P
Sbjct  63   TWF----ISSLYDLKKSDVGRATNKPGYDGFVDVSRGVLKGRTPVEQRALVRQVFLSIMP  118

Query  617  NPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFL  438
                     + P ++   E+ AA T  FF WLVGPC+  E E NG ++ + V I KCR+L
Sbjct  119  PGAPETFRKLFPPTKWACEFNAAITVPFFQWLVGPCETFEVEVNGVKQNSGVKILKCRYL  178

Query  437  EETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQP  258
            E ++C GMC N+CK+P+Q    N  G+P+ M PNFE+MSCEMI+G  PPS   DPA+ QP
Sbjct  179  ENSSCAGMCVNVCKIPTQDLFTNDFGLPLTMTPNFEDMSCEMIYGLQPPSLEEDPALKQP  238

Query  257  CYKLCNSKKKHHNNC  213
            C + C        NC
Sbjct  239  CLERCKFLYHLLTNC  253



>ref|WP_017713741.1| hypothetical protein [Prochlorothrix hollandica]
Length=215

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 109/190 (57%), Gaps = 5/190 (3%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             Y + W DRL I   S  + A  G+ + + GYDG VE+++ +    ++  QQ L+   L 
Sbjct  6    TYRNNWLDRLFIWFFSRQMAAAMGIAAPQRGYDGFVELSQEMMQGRNAQAQQDLVTIVLR  65

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKNV  465
              IP P+L  +      S+   E  A F T+ F WLVGPC+V+  E        R +++ 
Sbjct  66   SLIPAPVLQGVRHFFSPSQWVCELNAWFATLLFEWLVGPCEVRPVEVTDSTGALRTQRSG  125

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            VHIQKCR+L+++ CV +C NLCK+P+Q F     G+PV + PNFE+ SCEM+FGQ PP  
Sbjct  126  VHIQKCRYLDQSRCVSLCINLCKVPTQNFFTQDFGIPVTLTPNFEDFSCEMVFGQVPPPL  185

Query  284  SHDPAMMQPC  255
              +P   QPC
Sbjct  186  ETEPYYNQPC  195



>ref|WP_010468065.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=214

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 111/191 (58%), Gaps = 7/191 (4%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFDR  I   S  +  V G +S  +GY+GLV+++  +    ++ QQQ  +   L 
Sbjct  4    VYKDNWFDRAFIWLFSEKMAQVAGQKSELAGYEGLVDLSVQIMRGRNAKQQQEALATVLR  63

Query  629  KAIPNPILMLMNMVL-PQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKN  468
              IP+ +L+ +  +  P  RI  E+ A F +  F WLVGPC + E E  G     R +++
Sbjct  64   SLIPSFVLLGIRTLFNPTQRI-LEWNAWFASRMFTWLVGPCDLTEVEVVGENGQLRTQRS  122

Query  467  VVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPS  288
             +HIQKCR+LEE+ CVGMC N+CK+P+Q F     G P+ + PNFE+MSCEM+FG   P 
Sbjct  123  GLHIQKCRYLEESGCVGMCVNMCKLPTQDFFAKEFGFPLTLTPNFEDMSCEMVFGHSAPP  182

Query  287  TSHDPAMMQPC  255
               +    QPC
Sbjct  183  IEEEAVYNQPC  193



>ref|XP_008808026.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Phoenix 
dactylifera]
Length=137

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = -2

Query  599  MNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCV  420
            +  +LP S+  REY A FTT FF+WLVG C+V+E+E  G+ EKNVV+I KCRFLE TNC+
Sbjct  8    IKFLLPPSKFSREYFATFTTTFFSWLVGYCEVRESEVQGKIEKNVVYIPKCRFLESTNCI  67

Query  419  GMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKL-C  243
            GMCTNLCK+P+Q FIK+S+GMP+NMVPNFE+MSCEMIFGQ PP  + DP + QPC++  C
Sbjct  68   GMCTNLCKIPTQRFIKDSLGMPINMVPNFEDMSCEMIFGQHPP--ADDPTLKQPCFRTSC  125

Query  242  NSKKKHHNNC  213
             +K+ H  NC
Sbjct  126  IAKQTHGVNC  135



>ref|WP_026100817.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=223

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 117/204 (57%), Gaps = 6/204 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D+ FD+L I  LS  +    G  +   GYDG V++++ +    ++ +Q+ +++  L  
Sbjct  15   YDDSPFDQLLIWLLSRRMAETIGRETHLDGYDGFVDLSQKIVQGRNANEQKQVVMGVLRS  74

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKNVV  462
             +P   L  +      +++  E  A   T+ F WLVGPC+VKE E        RR+K+ V
Sbjct  75   LVPEVALQAIRTFFSPTQLVCELNAWSATLLFEWLVGPCEVKEVEIAAADGSVRRQKSGV  134

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            HI+KCR+LE++ CVGMC N+CK+P+Q F     G+P+ M PNFE+MSCEM FGQ P +  
Sbjct  135  HIKKCRYLEQSQCVGMCVNMCKLPTQDFFYKDFGIPLTMTPNFEDMSCEMAFGQLPAAIE  194

Query  281  HDPAMMQPCY-KLCNSKKKHHNNC  213
             DPA  +PC  + C    +   +C
Sbjct  195  DDPACREPCLARKCEIANEQAKSC  218



>ref|WP_017293102.1| hypothetical protein [Geminocystis herdmanii]
Length=217

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 112/190 (59%), Gaps = 5/190 (3%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D  FDR+ I   S  +    G + +  GY G V++++ +    ++ QQQ L+   L 
Sbjct  8    VYKDNLFDRVFIAIFSQKMAQAVGKKITSKGYQGFVDLSQEIMKGRNAQQQQELVSIVLK  67

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-----NGRREKNV  465
              IP+P+L L+   +P ++   E  A F T+ F WLVG   +KE E        R++K+ 
Sbjct  68   SLIPSPVLYLVRTFVPPNKWVCESNAWFATVLFEWLVGKSIIKEVEIVTENNEIRKQKSG  127

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            V I+KCR+LE++ CVGMC N+CK+P+Q F   S G+P+ M PNFE+ SCEM+FGQ PP  
Sbjct  128  VTIEKCRYLEDSGCVGMCINMCKLPTQKFFTESFGIPLTMTPNFEDFSCEMVFGQYPPPL  187

Query  284  SHDPAMMQPC  255
              + A  QPC
Sbjct  188  ETEEASTQPC  197



>ref|WP_012161496.1| hypothetical protein [Acaryochloris marina]
 ref|YP_001515237.1| hypothetical protein AM1_0881 [Acaryochloris marina MBIC11017]
 gb|ABW25923.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
Length=214

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 110/190 (58%), Gaps = 5/190 (3%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D WFDR  I   S  +  V G +S  +GY+GLV+++  +    ++ QQQ  +   L 
Sbjct  4    VYKDNWFDRAFIWLFSEKMAQVAGQKSELAGYEGLVDLSVQIMRGRNAKQQQEALATVLR  63

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKNV  465
              IP+ +L+ +  +   ++   E+ A F +  F WLVGPC + E E  G     R +++ 
Sbjct  64   SLIPSFVLLGIRTLFNPTKRILEWNAWFASRMFTWLVGPCDLTEVEVVGENGQLRTQRSG  123

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            +HIQKCR+LEE+ CVGMC N+CK+P+Q F     G P+ + PNFE+MSCEM+FG   P  
Sbjct  124  LHIQKCRYLEESGCVGMCVNMCKLPTQDFFAKEFGFPLTLTPNFEDMSCEMVFGHPAPPI  183

Query  284  SHDPAMMQPC  255
              +    QPC
Sbjct  184  EEEAVYNQPC  193



>ref|XP_006846590.1| hypothetical protein AMTR_s00018p00255680 [Amborella trichopoda]
 gb|ERN08265.1| hypothetical protein AMTR_s00018p00255680 [Amborella trichopoda]
Length=262

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 109/193 (56%), Gaps = 8/193 (4%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVK----AVTGVRSSKSG----YDGLVEITRAVFHNFDSTQQQS  651
            Y D  F+R  +   +H +     + +G    + G    Y+G V +++ V       QQQ 
Sbjct  50   YKDGLFERAFMTLFAHKMDKFAASSSGGEKKRGGGLYDYEGFVGVSKTVMQGRSRKQQQE  109

Query  650  LIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREK  471
            ++ + L   +P         + P ++   E+ AA T  FF WLVGP QV E E NG ++K
Sbjct  110  VVREVLLSMLPPGAPAKFRKLFPPTKWAAEFNAALTVPFFHWLVGPSQVVEVEVNGVKQK  169

Query  470  NVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPP  291
            + VHI KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSC+M++GQ PP
Sbjct  170  SGVHITKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMTPNFEDMSCDMVYGQAPP  229

Query  290  STSHDPAMMQPCY  252
                DP   QPCY
Sbjct  230  PFEEDPVSTQPCY  242



>ref|WP_006515049.1| hypothetical protein [Leptolyngbya sp. PCC 7375]
 gb|EKV00643.1| hypothetical protein Lepto7375DRAFT_2774 [Leptolyngbya sp. PCC 
7375]
Length=217

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 116/194 (60%), Gaps = 5/194 (3%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             YHD++FD+L I   +  +    G  SS+ GYDG VE+++ +     S QQQ L+   L 
Sbjct  10   TYHDSFFDQLFIRLFASKMSNAVGECSSRPGYDGFVELSQKIMQGRSSQQQQQLVAVVLQ  69

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKNV  465
              +P P+L  +      +++  E  A F T  F WLVGPC V+ AE        R++K+ 
Sbjct  70   SLVPAPVLWGIRTFFSPTQLVCELNAWFATQLFEWLVGPCTVQLAEVTTASGETRQQKSA  129

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            VHI+KCR+LE++ CVGMC N+CK+P+Q F     G+P+ M PNFE++SC+M+FGQ PP  
Sbjct  130  VHIEKCRYLEQSGCVGMCVNMCKLPTQQFFTEKFGIPLTMTPNFEDLSCDMVFGQMPPPL  189

Query  284  SHDPAMMQPCYKLC  243
              + A  QPC + C
Sbjct  190  ETEDAYQQPCLQDC  203



>ref|XP_002518917.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43450.1| conserved hypothetical protein [Ricinus communis]
Length=277

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 117/202 (58%), Gaps = 11/202 (5%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVT-----GVRSSKSG-----YDGLVEITRAVFHNFDSTQQ  657
            Y D  F+++ ++  +  ++        G  S K G     Y+  V+++R V    +  QQ
Sbjct  49   YTDGLFEKVFMSLFARKMEKFAAPVKNGNDSKKKGWLDSDYETFVDVSRRVMQGRNRLQQ  108

Query  656  QSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRR  477
            Q ++ + L   +P         + P +R   E+ AA T  FF WLVGP +V E E NG +
Sbjct  109  QEVVREVLLSMLPPGAPEQFKKLFPPTRWAAEFNAALTVPFFQWLVGPSEVIEVEVNGVK  168

Query  476  EKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQD  297
            +K+ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M+PNFE+MSCEM++GQ 
Sbjct  169  QKSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMIPNFEDMSCEMVYGQA  228

Query  296  PPSTSHDPAMMQPCY-KLCNSK  234
            PP    DPA  QPCY  +C S+
Sbjct  229  PPPFDEDPASKQPCYADICKSQ  250



>ref|XP_001752784.1| predicted protein [Physcomitrella patens]
 gb|EDQ82288.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 112/199 (56%), Gaps = 1/199 (1%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y+D   D+  I      ++A  G  S   GY+G V++++ +     + +Q++++   L  
Sbjct  56   YNDNILDKAFIALFRRKMEANLGKTSKMQGYEGFVDVSKKIMQGRTAVEQRAVVRDVLLS  115

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
             +P         + P ++   E+ AA T  FF WLVGP ++ E E NG ++ + V I KC
Sbjct  116  LLPPGAPAQFRKLFPPTKWSAEFNAAVTVPFFQWLVGPAELMEIEVNGVKQMSGVKITKC  175

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            R+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEM +GQ PP    DPA+
Sbjct  176  RYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMTPNFEDMSCEMFYGQSPPPIEEDPAL  235

Query  266  MQPCY-KLCNSKKKHHNNC  213
             QPC+  +C+        C
Sbjct  236  KQPCFLNMCSIAPPQSTAC  254



>ref|XP_002990234.1| hypothetical protein SELMODRAFT_47927, partial [Selaginella moellendorffii]
 gb|EFJ08649.1| hypothetical protein SELMODRAFT_47927, partial [Selaginella moellendorffii]
Length=160

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 101/156 (65%), Gaps = 1/156 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            +DG V++ R +       QQ  ++++ L   +P  I  ++  +LP SR   E+ A  TT+
Sbjct  1    FDGFVDVARKMMQGRTPVQQHEMVLRVLESLMPWWIGAMIRTILPASRATAEFYAHGTTL  60

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCR-FLEETNCVGMCTNLCKMPSQTFIKNSMG  360
            F +WL+GP +V E E +G ++K  VHIQKCR  LE + CVG+CTN+CK+PSQ F    +G
Sbjct  61   FTSWLIGPSEVIEVEVDGVKQKTGVHIQKCRHILESSACVGLCTNMCKVPSQRFFAKELG  120

Query  359  MPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY  252
            +P+ MVPNFE+MSC+ I+GQ PP    DPA  QPCY
Sbjct  121  VPMTMVPNFEDMSCDFIYGQTPPPLEEDPASRQPCY  156



>gb|AFI78792.1| putative D27 protein [Chlorokybus atmophyticus]
Length=187

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 104/174 (60%), Gaps = 5/174 (3%)
 Frame = -2

Query  734  RSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYC  555
            RS K GY G+VE++ ++  N  + QQ   ++Q   K +P         V   ++ G E  
Sbjct  15   RSFKEGYLGMVEVSHSLMRNKAAKQQHEAVLQGFPK-VPE----WFRKVFAYTKWGAELN  69

Query  554  AAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFI  375
            A  T  FF WLVGP +V++ + NG  +++ VHI+KCR+LE + CVGMC NLCK P+Q F 
Sbjct  70   AWVTPTFFKWLVGPMEVRDVDINGVTQRSQVHIKKCRYLETSGCVGMCVNLCKFPTQKFF  129

Query  374  KNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKKKHHNNC  213
               MGMP+ M PNF+++SCEMIFGQ PP    D A  QPC+  C + +    NC
Sbjct  130  TEEMGMPLTMKPNFDDLSCEMIFGQVPPPIEEDEARAQPCFATCPTARTVAPNC  183



>ref|XP_006386251.1| hypothetical protein POPTR_0002s04730g, partial [Populus trichocarpa]
 gb|ERP64048.1| hypothetical protein POPTR_0002s04730g, partial [Populus trichocarpa]
Length=135

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 97/157 (62%), Gaps = 45/157 (29%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY+D+W  +LAIN+LS   +  TG                                    
Sbjct  24   VYNDSWLAKLAINYLSQRFQDATG------------------------------------  47

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
                     L+ ++LPQ    REY AAFTT+FF WLVGPC+V+E++FNGR+EKNVVHI+K
Sbjct  48   ---------LVKIMLPQCTFTREYFAAFTTLFFVWLVGPCEVRESDFNGRKEKNVVHIKK  98

Query  449  CRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVP  339
            CRFLEET+C+GMCTNLCK+PSQTFIK+S GMPVNMVP
Sbjct  99   CRFLEETDCIGMCTNLCKVPSQTFIKHSFGMPVNMVP  135



>ref|WP_015223224.1| hypothetical protein [Cyanobacterium stanieri]
 ref|YP_007165557.1| hypothetical protein Cyast_1955 [Cyanobacterium stanieri PCC 
7202]
 gb|AFZ47908.1| hypothetical protein Cyast_1955 [Cyanobacterium stanieri PCC 
7202]
Length=229

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 113/197 (57%), Gaps = 6/197 (3%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            +Y D   DRL I      ++   G +++  GYDG V++++ +    +  QQQ L+   L 
Sbjct  13   IYKDNIIDRLFIALFCRKMEKALGAKTNLKGYDGFVDLSQKIMKGRNPQQQQDLVAVILK  72

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNV-----  465
              +P+P+L L    +P ++   E  A F  + F WLVG C+++E E      +       
Sbjct  73   SLVPSPVLYLTRTFVPANKWVCEANAWFAKVLFPWLVGICELREVEIETENNQKTIQNSG  132

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            VHI+KCR+LE + CV MC N+CK+P+Q F   S G+PV M PNFE+ SCEM+FGQ+PP  
Sbjct  133  VHIKKCRYLENSGCVAMCINMCKLPTQKFFTESFGIPVTMTPNFEDFSCEMVFGQNPPPL  192

Query  284  SHDPAMMQPCYK-LCNS  237
            + +    QPC + +C++
Sbjct  193  NQEECSRQPCLQEICDT  209



>ref|XP_010100206.1| hypothetical protein L484_015351 [Morus notabilis]
 gb|EXB81877.1| hypothetical protein L484_015351 [Morus notabilis]
Length=196

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 106/180 (59%), Gaps = 6/180 (3%)
 Frame = -2

Query  734  RSSKSG-----YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRI  570
            R  K G     Y+  V++++ V       QQQ ++ + L   +P         + P ++ 
Sbjct  12   REKKKGLWDYDYESFVDVSKRVMQGRSRMQQQEVVREVLLSMLPPGAPAQFRKLFPPTKW  71

Query  569  GREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMP  390
              E+ AA T  FF WLVGP +V E E NG ++++ VHI+KCR+LEE+ CVGMC N+CK+P
Sbjct  72   AAEFNAALTVPFFHWLVGPSEVIEVEVNGEKQRSGVHIKKCRYLEESGCVGMCVNMCKIP  131

Query  389  SQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCNSKKKHHNNC  213
            +Q F  N  G+P+ M+P FE+MSCEM++GQ PP    DP   QPC+ ++C+      + C
Sbjct  132  TQDFFTNEFGLPLTMIPKFEDMSCEMVYGQVPPPFEEDPVAKQPCFSEICSMANPSSSVC  191



>ref|XP_002961899.1| hypothetical protein SELMODRAFT_67943, partial [Selaginella moellendorffii]
 gb|EFJ37159.1| hypothetical protein SELMODRAFT_67943, partial [Selaginella moellendorffii]
Length=160

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 101/156 (65%), Gaps = 1/156 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            +DG V++ R +       QQ  ++++ L   +P  I  ++  +LP SR   E+ A  TT+
Sbjct  1    FDGFVDVARKMMQGRTPVQQHEMVLRVLESLMPWWIGAMVRTILPVSRATAEFYAHGTTL  60

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCR-FLEETNCVGMCTNLCKMPSQTFIKNSMG  360
            F +WL+GP +V E E +G ++K+ VHIQKCR  LE + CVG+CTN+CK+PSQ F    +G
Sbjct  61   FTSWLIGPSEVIEVEVDGVKQKSGVHIQKCRHILERSACVGLCTNMCKVPSQRFFAKELG  120

Query  359  MPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY  252
            +P+ MVPNFE+MSC+ I+GQ PP    D A  QPCY
Sbjct  121  VPMTMVPNFEDMSCDFIYGQTPPPLEEDSASRQPCY  156



>gb|KDO76733.1| hypothetical protein CISIN_1g0237092mg, partial [Citrus sinensis]
 gb|KDO76734.1| hypothetical protein CISIN_1g0237092mg, partial [Citrus sinensis]
Length=248

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 111/197 (56%), Gaps = 12/197 (6%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKS----------GYD--GLVEITRAVFHNFDST  663
            Y+D +F++  +   +  ++       SK+          GYD    V++++ V       
Sbjct  49   YNDGFFEKAFMTLFARKMEKFASPAKSKTETKKKRWFDFGYDYESFVDVSKRVMEGRSRQ  108

Query  662  QQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG  483
            QQQ ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG
Sbjct  109  QQQEVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVVEVEING  168

Query  482  RREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFG  303
             ++++ VHI+KCR+LE + CVGMC N+CK P+Q F     G+P+ M+PNFE+MSCEM++G
Sbjct  169  EKQRSGVHIKKCRYLENSGCVGMCVNMCKFPTQDFFTREFGLPLTMIPNFEDMSCEMVYG  228

Query  302  QDPPSTSHDPAMMQPCY  252
            Q PPS   DP   QPC+
Sbjct  229  QVPPSFEDDPVSTQPCF  245



>gb|EPS62650.1| hypothetical protein M569_12140, partial [Genlisea aurea]
Length=214

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 110/196 (56%), Gaps = 8/196 (4%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKS------GYDGLVEITRAVFHNFDSTQQQSLI  645
            Y D  F++  ++  +  ++   G  ++K+       Y+  V  +R V       QQQ ++
Sbjct  6    YKDGLFEKAFMSLFARKMEKFAGESATKAKGLLDYDYESFVHASRRVMVGRSPLQQQQIV  65

Query  644  IQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNV  465
             + L   +P         + P +R   E+ AA T  FF WLVGP QV E E NG ++K+ 
Sbjct  66   REVLLSILPPGAPAQFRKLFPPTRWAAEFNAALTVPFFQWLVGPSQVVEVEVNGVKQKSG  125

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEM +GQ PPS 
Sbjct  126  VLIKKCRYLETSGCVGMCVNMCKIPTQDFFTNEFGLPLTMTPNFEDMSCEMKYGQVPPSI  185

Query  284  SHDPAMMQPCYKLCNS  237
              DP   QPC  L NS
Sbjct  186  EEDPTFKQPC--LANS  199



>emb|CDY34380.1| BnaA09g11220D [Brassica napus]
Length=252

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 99/154 (64%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V    + +QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  79   YESFVEVSKRVMQGRNRSQQQEVVREVLLSMLPPGAPEQFRKLFPPTKWAAEFNAALTVP  138

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E NG ++++ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  139  FFHWLVGPSQVIEVEVNGVKQRSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  198

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNF++MSCEMI+GQ PPS   DPA  QPC
Sbjct  199  PLTMNPNFDDMSCEMIYGQVPPSFEDDPATKQPC  232



>ref|XP_006439216.1| hypothetical protein CICLE_v10021724mg [Citrus clementina]
 gb|ESR52456.1| hypothetical protein CICLE_v10021724mg [Citrus clementina]
Length=264

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 111/197 (56%), Gaps = 12/197 (6%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKS----------GYD--GLVEITRAVFHNFDST  663
            Y+D +F++  +   +  ++       SK+          GYD    V++++ V       
Sbjct  49   YNDGFFEKAFMTLFARKMEKFASPAKSKTETKKKRWFDFGYDYESFVDVSKRVMEGRSRQ  108

Query  662  QQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG  483
            QQQ ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG
Sbjct  109  QQQEVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVVEVEING  168

Query  482  RREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFG  303
             ++++ VHI+KCR+LE + CVGMC N+CK P+Q F     G+P+ M+PNFE+MSCEM++G
Sbjct  169  EKQRSGVHIKKCRYLENSGCVGMCVNMCKFPTQDFFTREFGLPLTMIPNFEDMSCEMVYG  228

Query  302  QDPPSTSHDPAMMQPCY  252
            Q PPS   DP   QPC+
Sbjct  229  QVPPSFEDDPVSTQPCF  245



>ref|XP_004502060.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Cicer 
arietinum]
Length=268

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 103/169 (61%), Gaps = 1/169 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V++++ V       QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  95   YESFVDVSKRVMLRRSRLQQQQVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVP  154

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++K+ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  155  FFHWLVGPSEVVEVEINGVKQKSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  214

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCNSKKKHHNNC  213
            P+ M+PNFE+MSCEM++GQ PPS   DP   QPCY ++C+      + C
Sbjct  215  PLTMIPNFEDMSCEMVYGQTPPSFEDDPVSKQPCYAEICSVANPSSSVC  263



>ref|XP_009784263.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Nicotiana 
sylvestris]
Length=290

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 110/198 (56%), Gaps = 14/198 (7%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSG--------------YDGLVEITRAVFHNFD  669
            Y+D  F++  +   +  ++      +SK+G              YD  V+++R V     
Sbjct  73   YNDGLFEKAFMTLFARKMENFAAKSASKNGSQKEEKKKGWFEYDYDSFVDVSRKVMQGRS  132

Query  668  STQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF  489
              QQQ ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E 
Sbjct  133  RLQQQQVVREVLMSMLPPGAPAQFRKLFPPTKWAAEFNAAITVPFFFWLVGPSEVVEVEI  192

Query  488  NGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMI  309
            +G ++K+ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEM+
Sbjct  193  DGVKQKSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMNPNFEDMSCEMV  252

Query  308  FGQDPPSTSHDPAMMQPC  255
            +GQ PP    DP   QPC
Sbjct  253  YGQVPPPFEEDPVAKQPC  270



>gb|AFI78797.1| putative D27 family protein [Nitella hyalina]
Length=239

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 112/185 (61%), Gaps = 0/185 (0%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D+  DR+     S  +  +TG ++  +GYD  V+I+RAV +     + Q ++ + L  
Sbjct  38   YKDSLIDRIFQWLFSRKMAQITGRKAGFNGYDEFVDISRAVMNGRSPKKTQEVVREVLMS  97

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKC  447
             +P         + P ++   E  A  TT FFAWLVGP +V E E  GR++ + V I+KC
Sbjct  98   LLPPNAPQTFRKLFPPTQKSAELNALITTYFFAWLVGPSKVIEVEVEGRKQMSGVKIEKC  157

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            R+LE + CVGMC N+CK+P+Q F  N  G+P+ M P++E+MSCEMIFGQ PP    DPA+
Sbjct  158  RYLENSGCVGMCINMCKLPTQDFFTNDFGLPLTMNPDYEDMSCEMIFGQAPPPPEEDPAL  217

Query  266  MQPCY  252
             QPCY
Sbjct  218  KQPCY  222



>ref|XP_006476281.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=265

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 111/197 (56%), Gaps = 12/197 (6%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKS----------GYD--GLVEITRAVFHNFDST  663
            Y+D +F++  +   +  ++       SK+          GYD    V++++ V       
Sbjct  49   YNDGFFEKAFMTLFARKMEKFASPAKSKTETKKKHWFDFGYDYESFVDVSKRVMEGRSRQ  108

Query  662  QQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG  483
            QQQ ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E + NG
Sbjct  109  QQQEVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVVEVDING  168

Query  482  RREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFG  303
             ++++ VHI+KCR+LE + CVGMC N+CK P+Q F     G+P+ M+PNFE+MSCEM++G
Sbjct  169  EKQRSGVHIKKCRYLENSGCVGMCVNMCKFPTQDFFTREFGLPLTMIPNFEDMSCEMVYG  228

Query  302  QDPPSTSHDPAMMQPCY  252
            Q PPS   DP   QPC+
Sbjct  229  QVPPSFEDDPVSTQPCF  245



>ref|XP_003601450.1| hypothetical protein MTR_3g080840 [Medicago truncatula]
 ref|XP_003628826.1| hypothetical protein MTR_8g067370 [Medicago truncatula]
 gb|AES71701.1| D27 family protein, putative [Medicago truncatula]
Length=266

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 97/155 (63%), Gaps = 0/155 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V++++ V       QQQ ++ + L   +P         + P +R   E+ AA T  
Sbjct  93   YESFVDVSKRVMLRRSRLQQQQVVREVLLSMLPPGAPAQFRKLFPPTRWAAEFNAALTVP  152

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++K+ VHI+KCR+LE + CVG C N+CK+P+Q F  N  G+
Sbjct  153  FFHWLVGPSEVIEVEINGVKQKSGVHIKKCRYLENSGCVGQCVNMCKIPTQDFFTNEFGL  212

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY  252
            P+ M+PNFE+MSC+M++GQ PPS   DP   QPCY
Sbjct  213  PLTMIPNFEDMSCDMVYGQTPPSFEDDPVSKQPCY  247



>ref|XP_006476282.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=264

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 111/197 (56%), Gaps = 12/197 (6%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKS----------GYD--GLVEITRAVFHNFDST  663
            Y+D +F++  +   +  ++       SK+          GYD    V++++ V       
Sbjct  49   YNDGFFEKAFMTLFARKMEKFASPAKSKTETKKKHWFDFGYDYESFVDVSKRVMEGRSRQ  108

Query  662  QQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG  483
            QQQ ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E + NG
Sbjct  109  QQQEVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVVEVDING  168

Query  482  RREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFG  303
             ++++ VHI+KCR+LE + CVGMC N+CK P+Q F     G+P+ M+PNFE+MSCEM++G
Sbjct  169  EKQRSGVHIKKCRYLENSGCVGMCVNMCKFPTQDFFTREFGLPLTMIPNFEDMSCEMVYG  228

Query  302  QDPPSTSHDPAMMQPCY  252
            Q PPS   DP   QPC+
Sbjct  229  QVPPSFEDDPVSTQPCF  245



>ref|XP_009112920.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Brassica 
rapa]
Length=252

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 98/154 (64%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V    + +QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  79   YESFVEVSKRVMQGRNRSQQQEVVREVLLSMLPPGAPEQFRKLFPPTKWAAEFNAALTVP  138

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E NG ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  139  FFHWLVGPSQVIEVEVNGVKQRSGVRIKKCRYLESSGCVGMCVNMCKIPTQDFFTNEFGL  198

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNF++MSCEMI+GQ PPS   DPA  QPC
Sbjct  199  PLTMNPNFDDMSCEMIYGQVPPSFEDDPATKQPC  232



>gb|ELS33194.1| hypothetical protein Pse7429DRAFT_1458 [Pseudanabaena biceps 
PCC 7429]
Length=221

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 109/191 (57%), Gaps = 5/191 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y+D + DR+ I   S  +    G  ++  GY+G VE+++ +    ++ +QQ L+ + L  
Sbjct  14   YNDNFIDRMFIWLFSRKMSEALGKGTTIGGYEGFVELSKQIMQGRNAQEQQILVAKVLQS  73

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKNVV  462
             +P+P L  +      +R+     A F    F WLVGPC+V EAE N      R + + V
Sbjct  74   LVPSPALWAIRTFFSPTRLVCVLNAWFAAQMFEWLVGPCEVIEAEINLEDGTLRSQPSAV  133

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            HI+KCR+L ++ CVGMC N+CK+P+Q F     G+P+ M PNFE++SC+MIFGQ P    
Sbjct  134  HIKKCRYLVDSGCVGMCVNMCKVPTQVFFTEKFGIPLTMTPNFEDLSCKMIFGQMPTDPE  193

Query  281  HDPAMMQPCYK  249
             D A  Q C K
Sbjct  194  LDEAFTQSCLK  204



>ref|XP_006391710.1| hypothetical protein EUTSA_v10023652mg [Eutrema salsugineum]
 gb|ESQ28996.1| hypothetical protein EUTSA_v10023652mg [Eutrema salsugineum]
Length=250

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 96/154 (62%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V      +QQQ  + + L   +P         + P ++   E+ AA T  
Sbjct  77   YESFVEVSKRVMQGRSRSQQQEAVREVLLSMLPPGAPQQFRKLFPPTKWSAEFNAALTVP  136

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E NG ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  137  FFHWLVGPSQVIEVEVNGVKQRSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  196

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNFE+MSCEMI+GQ PP+   DPA  QPC
Sbjct  197  PLTMNPNFEDMSCEMIYGQAPPAFEEDPATKQPC  230



>ref|WP_040687789.1| hypothetical protein [Pseudanabaena biceps]
Length=213

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 109/191 (57%), Gaps = 5/191 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y+D + DR+ I   S  +    G  ++  GY+G VE+++ +    ++ +QQ L+ + L  
Sbjct  6    YNDNFIDRMFIWLFSRKMSEALGKGTTIGGYEGFVELSKQIMQGRNAQEQQILVAKVLQS  65

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKNVV  462
             +P+P L  +      +R+     A F    F WLVGPC+V EAE N      R + + V
Sbjct  66   LVPSPALWAIRTFFSPTRLVCVLNAWFAAQMFEWLVGPCEVIEAEINLEDGTLRSQPSAV  125

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            HI+KCR+L ++ CVGMC N+CK+P+Q F     G+P+ M PNFE++SC+MIFGQ P    
Sbjct  126  HIKKCRYLVDSGCVGMCVNMCKVPTQVFFTEKFGIPLTMTPNFEDLSCKMIFGQMPTDPE  185

Query  281  HDPAMMQPCYK  249
             D A  Q C K
Sbjct  186  LDEAFTQSCLK  196



>ref|XP_009112776.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Brassica 
rapa]
Length=252

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 97/154 (63%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V      TQQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  79   YESFVEVSKRVMQGRSRTQQQEVVREVLLSMLPPGAPEQFRKLFPPTKWAAEFNAALTVP  138

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E NG ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  139  FFHWLVGPSQVIEVEVNGVKQRSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  198

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNF++MSCEMI+GQ PP+   DPA  QPC
Sbjct  199  PLTMNPNFDDMSCEMIYGQAPPAFEDDPATRQPC  232



>emb|CDY38220.1| BnaA09g11690D [Brassica napus]
Length=252

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 97/154 (63%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V      TQQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  79   YESFVEVSKRVMQGRSRTQQQEVVREVLLSMLPPGAPEQFRKLFPPTKWAAEFNAALTVP  138

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E NG ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  139  FFHWLVGPSQVIEVEVNGVKQRSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  198

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNF++MSCEMI+GQ PP+   DPA  QPC
Sbjct  199  PLTMNPNFDDMSCEMIYGQAPPAFEDDPATRQPC  232



>ref|XP_003542154.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X1 [Glycine max]
 gb|KHN31622.1| hypothetical protein glysoja_045548 [Glycine soja]
Length=266

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 118/210 (56%), Gaps = 12/210 (6%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKS---------GYD--GLVEITRAVFHNFDSTQ  660
            YHD  F++  +   +  ++  +   + K+         GYD    V+++R V       Q
Sbjct  52   YHDGIFEKAFMTLFARKMEKFSDPPAGKARENKGWWDWGYDYESFVDVSRRVMQRRSRIQ  111

Query  659  QQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGR  480
            QQ ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG 
Sbjct  112  QQQVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFDWLVGPSEVVEVEINGV  171

Query  479  REKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQ  300
            ++K+ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSC+M++GQ
Sbjct  172  KQKSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMTPNFEDMSCDMVYGQ  231

Query  299  DPPSTSHDPAMMQPCY-KLCNSKKKHHNNC  213
             PP+   DP   QPCY  +C+  K   + C
Sbjct  232  SPPTFEEDPVSKQPCYADICSMAKPSSSVC  261



>ref|XP_010430616.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Camelina 
sativa]
Length=250

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V       QQQ  + + L   +P         + P ++   E+ AA T  
Sbjct  77   YESFVEVSKRVMQGRSRVQQQEAVREVLLSMLPPGAPQQFRKLFPPTKWAAEFNAALTVP  136

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E NG ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  137  FFHWLVGPSQVIEVEVNGVKQRSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  196

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNFE+MSCEMI+GQ PP+   DPA  QPC
Sbjct  197  PLTMNPNFEDMSCEMIYGQAPPAFEEDPATKQPC  230



>ref|XP_010473733.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Camelina 
sativa]
 ref|XP_010496629.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Camelina 
sativa]
Length=253

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V       QQQ  + + L   +P         + P ++   E+ AA T  
Sbjct  80   YESFVEVSKRVMQGRSRVQQQEAVREVLLSMLPPGAPQQFRKLFPPTKWAAEFNAALTVP  139

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E NG ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  140  FFHWLVGPSQVIEVEVNGVKQRSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  199

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNFE+MSCEMI+GQ PP+   DPA  QPC
Sbjct  200  PLTMNPNFEDMSCEMIYGQAPPAFEEDPATKQPC  233



>gb|AFK33703.1| unknown [Medicago truncatula]
Length=266

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 97/155 (63%), Gaps = 0/155 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V++++ V       +QQ ++ + L   +P         + P +R   E+ AA T  
Sbjct  93   YESFVDVSKRVMLRRSRLRQQQVVREVLLSMLPPGAPAQFRKLFPPTRWAAEFNAALTVP  152

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++K+ VHI+KCR+LE + CVG C N+CK+P+Q F  N  G+
Sbjct  153  FFHWLVGPSEVIEVEINGVKQKSGVHIKKCRYLENSGCVGQCVNMCKIPTQDFFTNEFGL  212

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY  252
            P+ M+PNFE+MSC+M++GQ PPS   DP   QPCY
Sbjct  213  PLTMIPNFEDMSCDMVYGQTPPSFEDDPVSKQPCY  247



>ref|XP_006302733.1| hypothetical protein CARUB_v10020846mg [Capsella rubella]
 gb|EOA35631.1| hypothetical protein CARUB_v10020846mg [Capsella rubella]
Length=251

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V       QQQ  + + L   +P         + P ++   E+ AA T  
Sbjct  78   YESFVEVSKRVMQGRSRLQQQEAVREVLLSMLPPGAPQQFRKLFPPTKWAAEFNAALTVP  137

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E NG ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  138  FFHWLVGPSQVIEVEVNGVKQRSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  197

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNFE+MSCEMI+GQ PP+   DPA  QPC
Sbjct  198  PLTMNPNFEDMSCEMIYGQAPPAFEDDPATKQPC  231



>ref|XP_008448557.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Cucumis 
melo]
Length=263

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 112/196 (57%), Gaps = 10/196 (5%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGV---RSSKSG-------YDGLVEITRAVFHNFDSTQQ  657
            Y+D  F+++ +   +  ++        R  K G       Y+  V++++ V    +  QQ
Sbjct  50   YNDGPFEKVFMTLFARKMEKFANAKEQRKKKEGFWDFLYDYERFVDVSKRVMQGKNRMQQ  109

Query  656  QSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRR  477
            Q ++ + L   +P         + P ++   E+ A+ T  FF WLVGP +V E E NG +
Sbjct  110  QLVVREVLLSMLPPGAPAQFRKLFPPTKWACEFNASITVPFFQWLVGPSEVVEVEVNGIK  169

Query  476  EKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQD  297
            +++ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEMI+GQ 
Sbjct  170  QRSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMNPNFEDMSCEMIYGQV  229

Query  296  PPSTSHDPAMMQPCYK  249
            PP    DP   QPCYK
Sbjct  230  PPPFEEDPVSKQPCYK  245



>gb|KDP25210.1| hypothetical protein JCGZ_20366 [Jatropha curcas]
Length=263

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 110/195 (56%), Gaps = 10/195 (5%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSH-----CVKAVTGVRSSKSG-----YDGLVEITRAVFHNFDSTQQ  657
            Y+D++F++  +   +         A  G  S + G     Y+  V+ ++ V    +  QQ
Sbjct  50   YNDSFFEKAFMTLFARKMEKFAAPAKNGNASKEKGWFGYDYESFVDASKRVMQGRNRLQQ  109

Query  656  QSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRR  477
            Q ++ + L   +P         + P +R   E+ AA T  FF WLVGP +V E E NG +
Sbjct  110  QQVVREVLLSMLPPGAPEQFKKLFPPTRWAAEFNAALTVPFFQWLVGPSKVVEVEVNGVK  169

Query  476  EKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQD  297
            +++ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEM++GQ 
Sbjct  170  QRSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMNPNFEDMSCEMVYGQA  229

Query  296  PPSTSHDPAMMQPCY  252
            PP    DP   Q C+
Sbjct  230  PPPFEEDPVSKQSCF  244



>ref|XP_009351108.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like, partial 
[Pyrus x bretschneideri]
Length=255

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 97/155 (63%), Gaps = 0/155 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V++++ V      +QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  89   YESFVDVSKRVMQGRSRSQQQKVVREVLLSMLPPGAPEQFKKLFPPTKWAAEFNAALTVP  148

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E +G ++++ VHI+KCR+LE + CVGMC N+CK P+Q F  N  G+
Sbjct  149  FFHWLVGPSEVVEVEIDGVKQRSGVHIKKCRYLENSGCVGMCVNMCKFPTQDFFTNEFGL  208

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY  252
            P+ M+PNFE+MSCEM++GQ PP    DP   QPC+
Sbjct  209  PLTMIPNFEDMSCEMVYGQVPPPFEEDPVSKQPCF  243



>emb|CDY25531.1| BnaC09g11560D [Brassica napus]
Length=252

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 97/154 (63%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V      +QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  79   YESFVEVSKRVMQGRSRSQQQEVVREVLLSMLPPGAPEQFRKLFPPTKWAAEFNAALTVP  138

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E +G ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  139  FFHWLVGPSQVIEVEVDGVKQRSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  198

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNF++MSCEMI+GQ PPS   DPA  QPC
Sbjct  199  PLTMNPNFDDMSCEMIYGQVPPSFEDDPATKQPC  232



>ref|XP_011026780.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Populus 
euphratica]
Length=262

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 111/194 (57%), Gaps = 10/194 (5%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSH-----CVKAVTGVRSSKSG-----YDGLVEITRAVFHNFDSTQQ  657
            Y D +F++  +   +         A  G  S + G     Y+  V++++ V    +  QQ
Sbjct  49   YMDGFFEKAFMTLFARKMEKFAAPAKNGSASKEKGWFDYDYESFVDVSKRVMQGRNRKQQ  108

Query  656  QSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRR  477
            Q ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG +
Sbjct  109  QEVVREVLLSMLPPGAPEQFKKLFPPTKWAAEFNAALTVPFFQWLVGPSEVVEVEVNGEK  168

Query  476  EKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQD  297
            +K+ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M+PNFE+MSCEM++GQ 
Sbjct  169  QKSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMIPNFEDMSCEMVYGQV  228

Query  296  PPSTSHDPAMMQPC  255
            PP    DP + QPC
Sbjct  229  PPPFEEDPVVKQPC  242



>ref|XP_005648267.1| hypothetical protein COCSUDRAFT_33175 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23723.1| hypothetical protein COCSUDRAFT_33175 [Coccomyxa subellipsoidea 
C-169]
Length=246

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 107/190 (56%), Gaps = 4/190 (2%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             Y+D+  D+  +++ +  +    G R    GY+G VE++R +    +S QQQ  +   L 
Sbjct  26   TYNDSPLDKFMVSYFAGRMSQQLGGREYVPGYEGFVELSREMMKGRNSKQQQQAVSGVLG  85

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAE--FNGRREK--NVV  462
              +P           P S+   E  A  T + F WLVGP + KE E  F G ++K  + V
Sbjct  86   SLMPPQASERFRKWFPVSKWSAETNALITVLGFKWLVGPLETKEVEVEFEGEKQKWKSGV  145

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             I+KCR+LE++ C+GMC N+CK+P++ F  N  G+P+ M PNFE++SCEMIFGQ  P   
Sbjct  146  QIKKCRYLEQSGCIGMCVNMCKIPTEDFFTNQFGLPLTMNPNFEDLSCEMIFGQKAPPIE  205

Query  281  HDPAMMQPCY  252
             DP   QPC+
Sbjct  206  QDPLYNQPCF  215



>ref|XP_004159751.1| PREDICTED: uncharacterized LOC101210861 [Cucumis sativus]
Length=263

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 111/197 (56%), Gaps = 11/197 (6%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGL-----------VEITRAVFHNFDSTQ  660
            Y+D  F+++ +   +  ++     +  +   +GL           V++++ V    +  Q
Sbjct  49   YNDGPFEKVFMTLFARKMEKFANAKEQRKKKEGLWWDFLYDYERFVDVSKRVMQGKNRMQ  108

Query  659  QQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGR  480
            QQ ++ + L   +P         + P ++   E+ A  T  FF WLVGP +V E E NG 
Sbjct  109  QQIVVREVLLSMLPPGAPAQFRKLFPPTKWACEFNALITVPFFQWLVGPSEVVEVEVNGI  168

Query  479  REKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQ  300
            ++++ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEMI+GQ
Sbjct  169  KQRSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMNPNFEDMSCEMIYGQ  228

Query  299  DPPSTSHDPAMMQPCYK  249
             PP    DP   QPCYK
Sbjct  229  VPPPFEEDPVSEQPCYK  245



>ref|XP_002299424.2| hypothetical protein POPTR_0001s11420g [Populus trichocarpa]
 gb|EEE84229.2| hypothetical protein POPTR_0001s11420g [Populus trichocarpa]
Length=262

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 110/194 (57%), Gaps = 10/194 (5%)
 Frame = -2

Query  806  YHDTWFDR-----LAINHLSHCVKAVTGVRSSKSG-----YDGLVEITRAVFHNFDSTQQ  657
            Y D +F++      A         A  G  S + G     Y+  V++++ V    +  QQ
Sbjct  49   YMDGFFEKAFMTLFARKMEKFAAPAKNGSASKEKGWFDYDYESFVDVSKRVMQGRNRKQQ  108

Query  656  QSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRR  477
            Q ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG +
Sbjct  109  QEVVREVLLSMLPPGAPEQFKKLFPPTKWAAEFNAALTVPFFQWLVGPSEVVEVEVNGEK  168

Query  476  EKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQD  297
            +K+ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M+PNFE+MSCEM++GQ 
Sbjct  169  QKSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMIPNFEDMSCEMVYGQV  228

Query  296  PPSTSHDPAMMQPC  255
            PP    DP + QPC
Sbjct  229  PPPFEEDPVVKQPC  242



>gb|KGN55666.1| hypothetical protein Csa_3G002850 [Cucumis sativus]
Length=263

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 110/197 (56%), Gaps = 11/197 (6%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGL-----------VEITRAVFHNFDSTQ  660
            Y+D  F+++ +   +  ++     +  +   +GL           V++++ V       Q
Sbjct  49   YNDGPFEKVFMTLFARKMEKFANAKEQRKKKEGLWWDFLYDYERFVDVSKRVMQGKTRMQ  108

Query  659  QQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGR  480
            QQ ++ + L   +P         + P ++   E+ A  T  FF WLVGP +V E E NG 
Sbjct  109  QQIVVREVLLSMLPPGAPAQFRKLFPPTKWACEFNALITVPFFQWLVGPSEVVEVEVNGI  168

Query  479  REKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQ  300
            ++++ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEMI+GQ
Sbjct  169  KQRSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMNPNFEDMSCEMIYGQ  228

Query  299  DPPSTSHDPAMMQPCYK  249
             PP    DP   QPCYK
Sbjct  229  VPPPFEEDPVSKQPCYK  245



>emb|CDY08324.1| BnaC09g12720D [Brassica napus]
Length=202

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V      TQQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  29   YESFVEVSKRVMQGRSRTQQQEVVREVLLSMLPPGAPEQFRKLFPPTKWAAEFNAALTVP  88

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E NG ++ + V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  89   FFHWLVGPSQVIEVEVNGVKQISGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  148

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNF++MSCEMI+ Q PP+   DPA  QPC
Sbjct  149  PLTMNPNFDDMSCEMIYSQAPPAFEDDPATKQPC  182



>ref|XP_007039378.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY23879.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=261

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 109/194 (56%), Gaps = 9/194 (5%)
 Frame = -2

Query  806  YHDTWFDRLAIN----HLSHCVKAVTGVRSSKSG-----YDGLVEITRAVFHNFDSTQQQ  654
            Y+D  F++  I      +     A      +K G     Y+  VE+++ V       QQQ
Sbjct  49   YNDGLFEKAFITLFARKMEKFATAPKAGEEAKKGWFVYDYESFVEVSQRVMQGRSRLQQQ  108

Query  653  SLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRRE  474
             ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG ++
Sbjct  109  QVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFNWLVGPSEVVEVEVNGVKQ  168

Query  473  KNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDP  294
            K+ VHI+KCR+LE + C GMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEMI+GQ P
Sbjct  169  KSGVHIKKCRYLENSGCAGMCVNMCKIPTQDFFTNEFGLPLTMTPNFEDMSCEMIYGQVP  228

Query  293  PSTSHDPAMMQPCY  252
            P+   DPA  QPC+
Sbjct  229  PAFEEDPASKQPCF  242



>gb|AFI78798.1| putative D27 family protein, partial [Penium margaritaceum]
Length=198

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 100/179 (56%), Gaps = 2/179 (1%)
 Frame = -2

Query  737  VRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREY  558
            V S   GYD LV+  R V       QQ+ ++   L   +P         + P +++  E 
Sbjct  15   VSSKLEGYDALVDAARRVMQGRTPEQQRQVVANVLMSMLPPNAPATFRRLFPPTKLSAEI  74

Query  557  CAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTF  378
             AA T   F WLVGP ++ E E NG ++ + V I KCR+LE + CVGMC N+CK+P+Q F
Sbjct  75   NAAITVPLFQWLVGPAKLTEVEVNGVKQWSGVKITKCRYLESSGCVGMCVNMCKLPTQDF  134

Query  377  IKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQ-PCYK-LCNSKKKHHNNCIT  207
              N  G+P+ M PNFE+MSCEM+FGQ PP+ + DPA+    C+K  C   K     C T
Sbjct  135  FTNDFGLPLTMTPNFEDMSCEMVFGQMPPALADDPALQNTXCFKDTCPMAKPELPRCPT  193



>ref|XP_002887868.1| hypothetical protein ARALYDRAFT_474875 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64127.1| hypothetical protein ARALYDRAFT_474875 [Arabidopsis lyrata subsp. 
lyrata]
Length=250

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V       QQQ  + + L   +P         + P ++   E+ AA T  
Sbjct  77   YESFVEVSKRVMQGRSRVQQQEAVREVLLSMLPPGAPQQFRKLFPPTKWAAEFNAALTVP  136

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E NG ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  137  FFHWLVGPSQVIEVEVNGVKQRSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  196

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNFE+MSCEMI+GQ PP+   D A  QPC
Sbjct  197  PLTMNPNFEDMSCEMIYGQAPPAFEEDVATKQPC  230



>ref|XP_008784871.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Phoenix 
dactylifera]
 ref|XP_008784872.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Phoenix 
dactylifera]
Length=257

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 109/193 (56%), Gaps = 8/193 (4%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCV-KAVTGVRSSKS-------GYDGLVEITRAVFHNFDSTQQQS  651
            Y D  F++  ++  +  + K   G    KS        Y+  V++++ V       QQQ 
Sbjct  46   YRDGLFEKAFMSLFARKMEKFAEGGGEGKSKRSMWGWDYESFVDVSKRVMIRRSRKQQQE  105

Query  650  LIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREK  471
            ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG +++
Sbjct  106  VVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVIEVEVNGVKQR  165

Query  470  NVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPP  291
            + VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSC+M++GQ PP
Sbjct  166  SGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMNPNFEDMSCDMVYGQVPP  225

Query  290  STSHDPAMMQPCY  252
                DP   QPCY
Sbjct  226  PFEEDPVSKQPCY  238



>ref|XP_005849128.1| hypothetical protein CHLNCDRAFT_57404 [Chlorella variabilis]
 gb|EFN57026.1| hypothetical protein CHLNCDRAFT_57404 [Chlorella variabilis]
Length=277

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 108/195 (55%), Gaps = 5/195 (3%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            VY D   DR  I + S  +    G +     +DG V+++R +    +S +QQ  +   L 
Sbjct  37   VYRDNVLDRAMIYYFSSVMSKQLGGKPFDGSWDGFVDLSREIMRGRNSAEQQETVAGVLA  96

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAE--FNGRREK--NVV  462
              +P           P ++   E  A  T + FAWLVG  ++KE E  F GR +K  + V
Sbjct  97   GLLPPQAPERFRRWFPLNKFNAETNAFITVLGFAWLVGASELKEVEVEFEGRTQKWMSGV  156

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             I+KCR+LE + CVGMCTN+CK+P+Q F   + G+P+ M PNFE++SCEM+FG+ PP   
Sbjct  157  KIKKCRYLESSGCVGMCTNMCKLPTQKFFTETFGLPLTMDPNFEDLSCEMVFGRAPPPVE  216

Query  281  HDPAMMQPCY-KLCN  240
             D    QPC+ K CN
Sbjct  217  LDKVYSQPCFTKQCN  231



>ref|XP_002279815.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Vitis 
vinifera]
Length=266

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 119/210 (57%), Gaps = 12/210 (6%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSH-----CVKAVTGVRSSKS------GYDGLVEITRAVFHNFDSTQ  660
            Y+D +F+++ +   +         A +G+ + K        Y+  V++++ V       Q
Sbjct  52   YNDGFFEKVFMTLFARKMGRFAAPAKSGIEAEKKRSWWDCDYERFVDVSKRVMQGRSRMQ  111

Query  659  QQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGR  480
            QQ ++ + L   +P         + P +R   E+ AAFT  FFAWLVGP +V E E NG 
Sbjct  112  QQEVVREVLLSMLPPGAPDQFRKLFPPTRWAAEFNAAFTVPFFAWLVGPSEVVEVEVNGV  171

Query  479  REKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQ  300
            ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEM++GQ
Sbjct  172  KQRSGVLIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMTPNFEDMSCEMVYGQ  231

Query  299  DPPSTSHDPAMMQPCYK-LCNSKKKHHNNC  213
             PP    DP   QPC+  +C+    + + C
Sbjct  232  VPPPFEEDPVSKQPCFSDICSMANPNSSIC  261



>ref|XP_009391936.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=254

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 107/192 (56%), Gaps = 7/192 (4%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSG-------YDGLVEITRAVFHNFDSTQQQSL  648
            Y D  F++L ++  +  ++       SK         Y+  V++++ V       QQQ +
Sbjct  45   YKDGLFEKLFMSLFARKMEKFATSEVSKKNNALWDMDYERFVDVSKRVMIGRSRKQQQEV  104

Query  647  IIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKN  468
            + + L   +P         + P +R   E+ AA T  FF WLVGP +V E E NG ++++
Sbjct  105  VREVLLSMLPPGAPAQFRKLFPPTRWAAEFNAALTVPFFHWLVGPSEVIEVEVNGVKQRS  164

Query  467  VVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPS  288
             V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEM++GQ PP 
Sbjct  165  GVQIKKCRYLENSGCVGMCVNMCKLPTQDFFTNEFGLPLTMNPNFEDMSCEMVYGQVPPL  224

Query  287  TSHDPAMMQPCY  252
               D    QPCY
Sbjct  225  FEEDAVSKQPCY  236



>ref|XP_006352216.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Solanum 
tuberosum]
Length=270

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 100/169 (59%), Gaps = 1/169 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            YD  V+++R V       QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  96   YDSFVDVSRKVMQGRSRLQQQQVVREVLMSMLPPGAPAQFRKLFPPTQWAAEFNAAITVP  155

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E +G ++K+ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  156  FFFWLVGPSEVVEVEVDGVKQKSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  215

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCNSKKKHHNNC  213
            P+ M PNFE+MSCEMI+GQ PP    DP   QPCY  +C       N C
Sbjct  216  PLTMNPNFEDMSCEMIYGQVPPPFEEDPVSKQPCYASICTIANPSSNVC  264



>gb|AFI78800.1| putative D27 family protein, partial [Penium margaritaceum]
Length=188

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 102/181 (56%), Gaps = 3/181 (2%)
 Frame = -2

Query  740  GVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGRE  561
            GV S   GYD LV+  R V       QQ+ ++   L   +P     L   + P +++  E
Sbjct  3    GVSSKLEGYDALVDAARRVMQGRTPEQQRQVVANVLMSMLPPNAPPLFXRLFPPTKLSAE  62

Query  560  YCAAFTTIFFA-WLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQ  384
              AA T    + WLVGP ++ E E NG ++ + V I KCR+LE + CVGMC N+CK+P+Q
Sbjct  63   INAAITVPLLSQWLVGPAKLTEVEVNGVKQWSGVKITKCRYLESSGCVGMCVNMCKLPTQ  122

Query  383  TFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQ-PCYK-LCNSKKKHHNNCI  210
             F  N  G+P+ M PNFE+MSCEM+FGQ PP+ + DPA+    C+K  C   K     C 
Sbjct  123  DFFTNDFGLPLTMTPNFEDMSCEMVFGQMPPALADDPALQNTTCFKDTCPMAKPELPRCP  182

Query  209  T  207
            T
Sbjct  183  T  183



>ref|XP_004973014.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X1 [Setaria italica]
Length=271

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 97/160 (61%), Gaps = 1/160 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V+++R V       QQQ  + + L   +P         + P +R   E+ AA T  
Sbjct  98   YESFVDVSRRVMVGRTRAQQQEAVREVLLSMLPPGAPEQFRKLFPPTRWACEFNAALTVP  157

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E +G ++K+ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  158  FFHWLVGPSEVIEVEVDGVKQKSGVLIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  217

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCN  240
            P+ M PNFE+MSCEMI+GQ PP    DP   QPCY  LC+
Sbjct  218  PLTMNPNFEDMSCEMIYGQVPPPLEEDPVSKQPCYPNLCS  257



>gb|KHN47227.1| hypothetical protein glysoja_035018 [Glycine soja]
Length=270

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 102/169 (60%), Gaps = 1/169 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V+++R V       QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  97   YESFVDVSRRVMQRRSRIQQQQVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVP  156

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++K+ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  157  FFDWLVGPSEVMEVEINGVKQKSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  216

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCNSKKKHHNNC  213
            P+ M PNFE+MSC+M++GQ PP+   DP   Q CY  +C+  K   + C
Sbjct  217  PLTMTPNFEDMSCDMVYGQAPPTFEEDPVSKQACYANICSMAKPSSSVC  265



>ref|NP_564838.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF19681.1|AC009519_15 F1N19.25 [Arabidopsis thaliana]
 gb|AAQ22663.1| At1g64680 [Arabidopsis thaliana]
 dbj|BAE98453.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34273.1| uncharacterized protein AT1G64680 [Arabidopsis thaliana]
Length=250

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V       QQQ  + + L   +P         + P ++   E+ AA T  
Sbjct  77   YESFVEVSKRVMQGRSRVQQQEAVREVLLSMLPPGAPEQFRKLFPPTKWAAEFNAALTVP  136

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E NG ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  137  FFHWLVGPSQVIEVEVNGVKQRSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  196

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PN+E+MSCEMI+GQ PP+   D A  QPC
Sbjct  197  PLTMNPNYEDMSCEMIYGQAPPAFEEDVATKQPC  230



>ref|XP_001697941.1| hypothetical protein CHLREDRAFT_205884 [Chlamydomonas reinhardtii]
 gb|EDO99824.1| predicted protein [Chlamydomonas reinhardtii]
Length=290

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 111/197 (56%), Gaps = 11/197 (6%)
 Frame = -2

Query  809  VYHDTWFDRLAIN----HLSHCVKAVTGVR-SSKSGYDGLVEITRAVFHNFDSTQQQSLI  645
            VY+D W D L I      ++ C+ A  GV    +  YD  V I+  +     S +Q+ ++
Sbjct  49   VYNDNWLDLLFIKLYSKKMADCLPASQGVHVPEQPVYDDFVRISNEIMRGRGSKEQRLVV  108

Query  644  IQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF------NG  483
               L+  +P     +   + P ++   E+ A   ++ F WLVG  ++KE +         
Sbjct  109  RDVLNSLMPKEAPPVFRALFPPTKFSAEFNALIASLSFFWLVGASELKEEDVVVGPDGEK  168

Query  482  RREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFG  303
            RR+++VVHI+KCR+LE + CVGMC N+CK+P+QT+     G+P+ M PNFE++SC+MIFG
Sbjct  169  RRQRSVVHIKKCRYLEASGCVGMCVNMCKVPTQTYFTEEFGLPLTMNPNFEDLSCDMIFG  228

Query  302  QDPPSTSHDPAMMQPCY  252
            Q PP    DP   QPC+
Sbjct  229  QMPPPVHLDPVYTQPCF  245



>dbj|BAJ85620.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=264

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 98/160 (61%), Gaps = 1/160 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V+++R V       QQQ  + + L   +P         + P +R   E+ AA T  
Sbjct  91   YESFVDVSRRVMVGRSRAQQQEAVREVLLSMLPPGAPEQFKKLFPPTRWACEFNAALTVP  150

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E +G ++++ V I+KCR+LE + CVGMC N+CK+P+Q+F  +  G+
Sbjct  151  FFHWLVGPSEVIEVEVDGVKQRSGVLIKKCRYLENSGCVGMCVNMCKIPTQSFFTDEFGL  210

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCN  240
            P+ M PNFE+MSCEMI+GQ PP    DP   QPCY  LC+
Sbjct  211  PLTMNPNFEDMSCEMIYGQVPPPLEEDPVSKQPCYPSLCS  250



>gb|ABK23534.1| unknown [Picea sitchensis]
Length=275

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSS--KSGYDGLVEITRAVFHNFDSTQQQSLIIQAL  633
            Y+D  FD++ +   +  +  + G +S+  + GY+  VE +R+V       QQQ  + Q L
Sbjct  62   YNDNLFDKVFMALFARKMNNIAGGKSTGREEGYERFVETSRSVMLGRTPKQQQEAVRQVL  121

Query  632  HKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQ  453
               +P         + P ++   E+ AA T  FF WLVGP +V E E NG ++K+ VHI+
Sbjct  122  LSMLPPGAPERFRKLFPPTKWAAEFNAAVTAPFFHWLVGPSEVVEVEVNGVKQKSGVHIK  181

Query  452  KCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDP  273
            KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSC+M++GQ PP    DP
Sbjct  182  KCRYLENSGCVGMCVNMCKLPTQDFFTNEFGLPLTMTPNFEDMSCDMVYGQPPPPPEEDP  241

Query  272  AMMQPCY  252
            A  QPCY
Sbjct  242  AFKQPCY  248



>ref|XP_010544885.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Tarenaya 
hassleriana]
Length=269

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 97/156 (62%), Gaps = 0/156 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            YD  V+++R V       QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  96   YDSFVDVSRRVMKGRSRLQQQQVVREVLLSMLPPGAPEQFRKLFPPTKWAAEFNAALTVP  155

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++++ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  156  FFHWLVGPSEVVEVEVNGVKQRSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  215

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYK  249
            P+ M PNFE+MSCEMI+GQ PP+   DP   QPC K
Sbjct  216  PLTMNPNFEDMSCEMIYGQAPPAFEDDPVSRQPCLK  251



>ref|XP_003518626.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006574835.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like isoform 
X2 [Glycine max]
Length=270

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 102/169 (60%), Gaps = 1/169 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V+++R V       QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  97   YESFVDVSRRVMQRRSRIQQQQVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVP  156

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++K+ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  157  FFDWLVGPSEVMEVEINGVKQKSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  216

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCNSKKKHHNNC  213
            P+ M PNFE+MSC+M++GQ PP+   DP   Q CY  +C+  K   + C
Sbjct  217  PLTMTPNFEDMSCDMVYGQVPPTFEEDPVSKQACYANICSMAKPSSSVC  265



>ref|XP_002444917.1| hypothetical protein SORBIDRAFT_07g001450 [Sorghum bicolor]
 gb|EES14412.1| hypothetical protein SORBIDRAFT_07g001450 [Sorghum bicolor]
Length=262

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 97/160 (61%), Gaps = 1/160 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V+++R V       QQQ  + + L   +P         + P +R   E+ AA T  
Sbjct  89   YESFVDVSRRVMVGRTHAQQQEAVREVLLSMLPPGAPEQFRKLFPPTRWACEFNAALTVP  148

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E +G ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  149  FFRWLVGPSEVIEVEVDGVKQRSGVLIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  208

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCN  240
            P+ M PNFE+MSCEMI+GQ PP    DP   QPCY  LC+
Sbjct  209  PLTMNPNFEDMSCEMIYGQVPPPLEEDPVSKQPCYPNLCS  248



>ref|XP_004146203.1| PREDICTED: uncharacterized protein LOC101210861 [Cucumis sativus]
Length=263

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 109/197 (55%), Gaps = 11/197 (6%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGL-----------VEITRAVFHNFDSTQ  660
            Y+D  F+++ +   +  ++     +  +   +GL           V++++ V       Q
Sbjct  49   YNDGPFEKVFMTLFARKMEKFANAKEQRKKKEGLWWDFLYDYERFVDVSKRVMQGKTRMQ  108

Query  659  QQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGR  480
            QQ ++ + L   +P         + P ++   E+ A  T  FF WLVGP +V E E NG 
Sbjct  109  QQIVVREVLLSMLPPGAPAQFRKLFPPTKWACEFNALITVPFFQWLVGPSEVVEVEVNGI  168

Query  479  REKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQ  300
            ++++ VHI+K R+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEMI+GQ
Sbjct  169  KQRSGVHIKKLRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMNPNFEDMSCEMIYGQ  228

Query  299  DPPSTSHDPAMMQPCYK  249
             PP    DP   QPCYK
Sbjct  229  VPPPFEEDPVSKQPCYK  245



>gb|KDO76732.1| hypothetical protein CISIN_1g0237092mg, partial [Citrus sinensis]
Length=262

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/211 (35%), Positives = 111/211 (53%), Gaps = 26/211 (12%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKS----------GYD--GLVEITRAVFHNFDST  663
            Y+D +F++  +   +  ++       SK+          GYD    V++++ V       
Sbjct  49   YNDGFFEKAFMTLFARKMEKFASPAKSKTETKKKRWFDFGYDYESFVDVSKRVMEGRSRQ  108

Query  662  QQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG  483
            QQQ ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG
Sbjct  109  QQQEVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVVEVEING  168

Query  482  RREKNVVHIQKC--------------RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNM  345
             ++++ VHI+KC              R+LE + CVGMC N+CK P+Q F     G+P+ M
Sbjct  169  EKQRSGVHIKKCSKAEMLIAIFDNRLRYLENSGCVGMCVNMCKFPTQDFFTREFGLPLTM  228

Query  344  VPNFENMSCEMIFGQDPPSTSHDPAMMQPCY  252
            +PNFE+MSCEM++GQ PPS   DP   QPC+
Sbjct  229  IPNFEDMSCEMVYGQVPPSFEDDPVSTQPCF  259



>ref|XP_005852063.1| hypothetical protein CHLNCDRAFT_133062 [Chlorella variabilis]
 gb|EFN59961.1| hypothetical protein CHLNCDRAFT_133062 [Chlorella variabilis]
Length=164

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 95/165 (58%), Gaps = 5/165 (3%)
 Frame = -2

Query  707  LVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFA  528
            +VE++R++     + +Q+  +IQ   + +P         V P S+ G E  A  T  FF 
Sbjct  1    MVEVSRSMMKGRSAAEQREAVIQGFPE-VPE----WFRRVFPYSKWGAELNAKITPAFFT  55

Query  527  WLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVN  348
            WLVGP Q    E +G+++ + V I++CR+L E+ C GMC NLCK P+Q F    +GMP+ 
Sbjct  56   WLVGPMQTAVTEVDGQQQMSAVKIERCRYLAESGCTGMCINLCKSPTQAFFTEQLGMPLT  115

Query  347  MVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKKKHHNNC  213
            M PNFE++SCEM+FG+ PP  S DPA  QPC   C +       C
Sbjct  116  MTPNFEDLSCEMVFGKRPPPLSEDPAAQQPCLASCATAVVGAARC  160



>ref|XP_001763276.1| predicted protein [Physcomitrella patens]
 gb|EDQ71806.1| predicted protein [Physcomitrella patens]
Length=175

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 97/158 (61%), Gaps = 4/158 (3%)
 Frame = -2

Query  725  KSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPIL-MLMNMVLPQSRIGREYCAA  549
            + GY+G+VE++ A+  N ++ +QQ+ +++  H     PIL      + P S  G E  A 
Sbjct  2    EEGYEGMVEVSHALARNKNAAEQQAAVLRVRHNL---PILPDWFRKLFPYSDWGAELNAR  58

Query  548  FTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKN  369
             T +FF+WLVGPC+V E   N +  K+ V IQKCR+LE + C G+C N CKMP+Q F   
Sbjct  59   ITPLFFSWLVGPCEVVEVSVNDKPMKSGVQIQKCRYLETSGCTGLCVNSCKMPTQYFFTK  118

Query  368  SMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
             +GMP+ M PNFE+MSC MIFGQ PP+   D    Q C
Sbjct  119  ELGMPLTMEPNFEDMSCLMIFGQTPPAFEDDLVFKQKC  156



>ref|XP_006659061.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Oryza 
brachyantha]
Length=163

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 92/143 (64%), Gaps = 1/143 (1%)
 Frame = -2

Query  665  TQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFN  486
             QQQ+ + + L   +P         + P +R   E+ AA T  FF WLVGP QV E E N
Sbjct  7    AQQQAAVREVLLSMLPPGAPEQFRKLFPPTRWACEFNAALTVPFFHWLVGPSQVIEVEVN  66

Query  485  GRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIF  306
            G ++K+ V I+KCR+LE + CVGMC N+CK+P+Q+F  +  G+P+ M PNFE+MSCEMI+
Sbjct  67   GVKQKSGVLIKKCRYLENSGCVGMCVNMCKIPTQSFFTDEFGLPLTMNPNFEDMSCEMIY  126

Query  305  GQDPPSTSHDPAMMQPCY-KLCN  240
            GQ PP    DPA  QPCY  LC+
Sbjct  127  GQVPPPLEEDPASQQPCYANLCS  149



>ref|XP_011070388.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Sesamum 
indicum]
Length=259

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 112/208 (54%), Gaps = 10/208 (5%)
 Frame = -2

Query  806  YHDTWFDR----LAINHLSHCVKAVTGVRSSKSG-----YDGLVEITRAVFHNFDSTQQQ  654
            Y+D  F++    L    +    +        K G     Y+  VE+++ V       QQQ
Sbjct  47   YNDALFEKAFMTLFARKMEKFARGTGEEEGRKKGWFDYDYESFVEVSKRVMVGRSRLQQQ  106

Query  653  SLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRRE  474
             ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG ++
Sbjct  107  QVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVVEVEVNGVKQ  166

Query  473  KNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDP  294
            K+ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEM++GQ P
Sbjct  167  KSGVLIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMTPNFEDMSCEMVYGQVP  226

Query  293  PSTSHDPAMMQPCYK-LCNSKKKHHNNC  213
            P    DPA MQPC    C+  K   + C
Sbjct  227  PKFEDDPASMQPCLSDFCSIAKPSSSVC  254



>emb|CDP12233.1| unnamed protein product [Coffea canephora]
Length=198

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 97/155 (63%), Gaps = 0/155 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V++++ V    + TQQQ ++ + L   +P         + P +R   E+ A  T  
Sbjct  25   YESFVDVSKRVIQGRNRTQQQQVVREVLLSMLPPGAPAQFRKLFPPTRWACEFNATITVP  84

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  +  G+
Sbjct  85   FFDWLVGPSEVVEVEVNGVKQRSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTDEFGL  144

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY  252
            P+ M PNFE+MSCEM++GQ PP    DPA  QPC+
Sbjct  145  PLTMTPNFEDMSCEMVYGQAPPPFEDDPASKQPCF  179



>ref|XP_007209510.1| hypothetical protein PRUPE_ppa010428mg [Prunus persica]
 gb|EMJ10709.1| hypothetical protein PRUPE_ppa010428mg [Prunus persica]
Length=250

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 111/195 (57%), Gaps = 10/195 (5%)
 Frame = -2

Query  806  YHDTWFDR-------LAINHLSHCVKAVTGVRSS---KSGYDGLVEITRAVFHNFDSTQQ  657
            Y+D +F++         +   +  VKA T  +     +  Y+  V++++ V       QQ
Sbjct  49   YNDGFFEKGFMTLFARKMKKFAAPVKARTETKEKAWWEYDYESFVDVSKRVMQGRSRVQQ  108

Query  656  QSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRR  477
            Q ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG +
Sbjct  109  QQVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVVEVEINGVK  168

Query  476  EKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQD  297
            +++ VHI+KCR+LE + CVGMC N+CK P+Q F  N  G+P+ M+PNFE+MSCEM++GQ 
Sbjct  169  QRSGVHIKKCRYLENSGCVGMCVNMCKFPTQDFFTNEFGLPLTMIPNFEDMSCEMVYGQV  228

Query  296  PPSTSHDPAMMQPCY  252
            PP    DP   QPC+
Sbjct  229  PPPFEEDPVSKQPCF  243



>ref|XP_010053065.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Eucalyptus 
grandis]
 gb|KCW77313.1| hypothetical protein EUGRSUZ_D01676 [Eucalyptus grandis]
Length=269

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 97/155 (63%), Gaps = 0/155 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V++++ V       +QQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  96   YESFVDVSKRVTQGRSRARQQEVVREVLMSMLPPGAPAQFKKLFPPTKWAAEFNAALTVP  155

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++K+ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  156  FFHWLVGPSEVVEVEVNGVKQKSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  215

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY  252
            P+ M+PNFE+MSCEM++GQ PP    DP   QPC+
Sbjct  216  PLTMIPNFEDMSCEMVYGQAPPPFEEDPVSKQPCF  250



>gb|KFK38026.1| hypothetical protein AALP_AA3G060400 [Arabis alpina]
Length=249

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 95/154 (62%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V    +  QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  76   YESFVEVSKRVMQGRNRLQQQEVVREVLMSMLPPGAPEQFRKLFPPTKWAAEFNAALTVP  135

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG  +++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  136  FFHWLVGPSEVIEVEVNGVIQRSGVRIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  195

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNF++MSCEMI+GQ PP+   D A  QPC
Sbjct  196  PLTMNPNFDDMSCEMIYGQAPPAFEDDIATKQPC  229



>dbj|BAK00540.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=264

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 97/160 (61%), Gaps = 1/160 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V+++R V       QQQ  + + L   +P         + P +R   E+ AA T  
Sbjct  91   YESFVDVSRRVMVGRSRAQQQEAVREVLLSMLPPGAPEQFKKLFPPTRWACEFNAALTVP  150

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLV P +V E E +G ++++ V I+KCR+LE + CVGMC N+CK+P+Q+F  +  G+
Sbjct  151  FFHWLVDPSEVIEVEVDGVKQRSGVLIKKCRYLENSGCVGMCVNMCKIPTQSFFTDEFGL  210

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCN  240
            P+ M PNFE+MSCEMI+GQ PP    DP   QPCY  LC+
Sbjct  211  PLTMNPNFEDMSCEMIYGQVPPPLEEDPVSKQPCYPSLCS  250



>ref|NP_001060847.1| Os08g0114100 [Oryza sativa Japonica Group]
 dbj|BAD10553.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22761.1| Os08g0114100 [Oryza sativa Japonica Group]
 gb|EAZ05383.1| hypothetical protein OsI_27588 [Oryza sativa Indica Group]
Length=261

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 98/160 (61%), Gaps = 1/160 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V+++R V       QQQ  + + L   +P         + P +R   E+ AA T  
Sbjct  88   YESFVDVSRRVMVGRTRAQQQEAVREVLLSMLPPGAPEQFKKLFPPTRWACEFNAALTVP  147

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++K+ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  148  FFHWLVGPSEVVEVEVNGVKQKSGVLIKKCRYLENSGCVGMCVNMCKIPTQNFFTNEFGL  207

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCN  240
            P+ M PNFE+MSCEMI+GQ PP    DPA  QPCY  LC+
Sbjct  208  PLTMNPNFEDMSCEMIYGQVPPPLEEDPASKQPCYANLCS  247



>gb|EYU26083.1| hypothetical protein MIMGU_mgv1a011732mg [Erythranthe guttata]
Length=272

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 93/154 (60%), Gaps = 0/154 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V       QQQ ++ + L   +P         + P +R   E+ AA T  
Sbjct  99   YEAFVEVSKRVMQGRTRLQQQQVVREVLISMLPPGAPAQFRKLFPPTRWAAEFNAALTVP  158

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  159  FFHWLVGPSEVVEIEVNGVKQRSGVLIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  218

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNFE+MSCEM +GQ P     DPA  QPC
Sbjct  219  PLTMTPNFEDMSCEMAYGQVPVRFEDDPASKQPC  252



>ref|XP_007151966.1| hypothetical protein PHAVU_004G090400g [Phaseolus vulgaris]
 gb|ESW23960.1| hypothetical protein PHAVU_004G090400g [Phaseolus vulgaris]
Length=264

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 104/169 (62%), Gaps = 1/169 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V+++R V       QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  91   YESFVDVSRRVMQRRSRYQQQQVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVP  150

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++K+ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  151  FFDWLVGPSEVVEVEVNGVKQKSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  210

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYK-LCNSKKKHHNNC  213
            P+ M PNFE+MSC+M++GQ PP+   DP   QPCY+ +C+  K   + C
Sbjct  211  PLTMTPNFEDMSCDMVYGQAPPTFEEDPVSKQPCYEDICSMAKSSSSVC  259



>ref|XP_008239258.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Prunus 
mume]
Length=262

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 110/195 (56%), Gaps = 10/195 (5%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKS----------GYDGLVEITRAVFHNFDSTQQ  657
            Y+D +F++  +   +  +K       +++           Y+  V++++ V       QQ
Sbjct  49   YNDGFFEKGFMTLFARKMKKFASPAKARTETKEKAWWEYDYESFVDVSKRVMQGRSRVQQ  108

Query  656  QSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRR  477
            Q ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG +
Sbjct  109  QQVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVVEVEINGVK  168

Query  476  EKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQD  297
            +++ VHI+KCR+LE + CVGMC N+CK P+Q F  N  G+P+ M+PNFE+MSCEM++GQ 
Sbjct  169  QRSGVHIKKCRYLENSGCVGMCVNMCKFPTQDFFTNEFGLPLTMIPNFEDMSCEMVYGQV  228

Query  296  PPSTSHDPAMMQPCY  252
            PP    DP   QPC+
Sbjct  229  PPPFEEDPVSKQPCF  243



>gb|KDO76735.1| hypothetical protein CISIN_1g0237092mg, partial [Citrus sinensis]
Length=243

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 107/197 (54%), Gaps = 17/197 (9%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKS----------GYD--GLVEITRAVFHNFDST  663
            Y+D +F++  +   +  ++       SK+          GYD    V++++ V       
Sbjct  49   YNDGFFEKAFMTLFARKMEKFASPAKSKTETKKKRWFDFGYDYESFVDVSKRVMEGRSRQ  108

Query  662  QQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG  483
            QQQ ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG
Sbjct  109  QQQEVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVVEVEING  168

Query  482  RREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFG  303
             ++++ VHI+KC     + CVGMC N+CK P+Q F     G+P+ M+PNFE+MSCEM++G
Sbjct  169  EKQRSGVHIKKC-----SGCVGMCVNMCKFPTQDFFTREFGLPLTMIPNFEDMSCEMVYG  223

Query  302  QDPPSTSHDPAMMQPCY  252
            Q PPS   DP   QPC+
Sbjct  224  QVPPSFEDDPVSTQPCF  240



>ref|XP_010676912.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=268

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 110/198 (56%), Gaps = 10/198 (5%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVK---AVTGVRSS------KSGYDGLVEITRAVFHNFDSTQQQ  654
            Y D +F+ + +N  +  ++   +  G R        K  Y+  V++++ V       QQQ
Sbjct  56   YKDGFFEMIFMNLFARKMEKFASSAGQRKQENDGWFKYDYERFVDVSKRVMQGRSRPQQQ  115

Query  653  SLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRRE  474
             ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E NG ++
Sbjct  116  QVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVIEVEVNGVKQ  175

Query  473  KNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDP  294
            ++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M P FE+MSCEM++GQ P
Sbjct  176  RSGVLIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMNPKFEDMSCEMVYGQVP  235

Query  293  PSTSHDPAMMQPCYK-LC  243
            P    D    Q CYK LC
Sbjct  236  PPFEEDEVSKQACYKDLC  253



>ref|XP_010267423.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Nelumbo 
nucifera]
Length=263

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 95/155 (61%), Gaps = 0/155 (0%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V +++ V       QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  90   YESFVNVSKRVMQGRSRKQQQQVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVP  149

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++++ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  150  FFHWLVGPSEVVEVEVNGVKQRSGVHIKKCRYLENSGCVGMCVNMCKVPTQDFFTNEFGL  209

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY  252
            P+ M PNFE+MSC+M++GQ PP    DP   QPCY
Sbjct  210  PLTMNPNFEDMSCDMVYGQVPPPFEEDPVSKQPCY  244



>ref|XP_006826723.1| hypothetical protein AMTR_s00264p00017830, partial [Amborella 
trichopoda]
 gb|ERM93960.1| hypothetical protein AMTR_s00264p00017830, partial [Amborella 
trichopoda]
Length=87

 Score =   139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  500  EAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMS  321
            E E  GR+EKNVVHI+KCRFLE T+C GMC N+CK+PSQ F+K+S G+PVNMVPNFE+MS
Sbjct  2    ETEVEGRKEKNVVHIKKCRFLETTHCAGMCVNMCKLPSQKFLKDSFGIPVNMVPNFEDMS  61

Query  320  CEMIFGQDPPSTSHDPAMMQPCYK  249
            CEMIFGQ PP+   DPA+ QPCYK
Sbjct  62   CEMIFGQQPPAAMDDPALKQPCYK  85



>ref|XP_010909506.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Elaeis 
guineensis]
 ref|XP_010909507.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Elaeis 
guineensis]
Length=257

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 101/169 (60%), Gaps = 1/169 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V++++ V       QQQ ++ + L   +P         + P ++   E+ AA T  
Sbjct  84   YESFVDVSKRVMIGRSRKQQQQVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVP  143

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E NG ++++ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  144  FFHWLVGPSEVVEVEVNGVKQRSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  203

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCNSKKKHHNNC  213
            P+ M PNFE+MSC+M++GQ PP    DP  +Q CY  +C+      N C
Sbjct  204  PLTMNPNFEDMSCDMVYGQVPPPFEEDPVCVQACYADMCSMANPSSNVC  252



>gb|AFI78795.1| putative D27 protein [Klebsormidium flaccidum]
Length=165

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 97/166 (58%), Gaps = 6/166 (4%)
 Frame = -2

Query  707  LVEITRAVFHNFDSTQQQ-SLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFF  531
            +V+++ A+  +  + ++Q + I+Q   K     +        P S  G E  A  T  FF
Sbjct  1    MVDVSLALMRSRPNVKEQRAAILQGFPK-----VPQWFRKAFPYSNWGAELNARITPAFF  55

Query  530  AWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPV  351
             WLVGP ++ E E +G ++++ V I++CR+LEE+ C GMC NLCK P+QTF    +GMP+
Sbjct  56   TWLVGPMEIFEVEIDGVKQRSGVQIERCRYLEESGCTGMCVNLCKFPTQTFFTEELGMPL  115

Query  350  NMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKKKHHNNC  213
            +M P FE++SC+MIFG+ PP    D  M QPC+ LC +       C
Sbjct  116  SMEPKFEDLSCQMIFGKKPPDIEDDEVMKQPCFALCPTANVQAPAC  161



>ref|XP_006302732.1| hypothetical protein CARUB_v10020846mg [Capsella rubella]
 gb|EOA35630.1| hypothetical protein CARUB_v10020846mg [Capsella rubella]
Length=246

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 91/154 (59%), Gaps = 5/154 (3%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  VE+++ V       QQQ  + + L   +P         + P ++   E+ AA T  
Sbjct  78   YESFVEVSKRVMQGRSRLQQQEAVREVLLSMLPPGAPQQFRKLFPPTKWAAEFNAALTVP  137

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP QV E E NG ++++ V I+KC     + CVGMC N+CK+P+Q F  N  G+
Sbjct  138  FFHWLVGPSQVIEVEVNGVKQRSGVRIKKC-----SGCVGMCVNMCKIPTQDFFTNEFGL  192

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            P+ M PNFE+MSCEMI+GQ PP+   DPA  QPC
Sbjct  193  PLTMNPNFEDMSCEMIYGQAPPAFEDDPATKQPC  226



>emb|CBI34593.3| unnamed protein product [Vitis vinifera]
Length=157

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 95/151 (63%), Gaps = 1/151 (1%)
 Frame = -2

Query  662  QQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG  483
            QQQ ++ + L   +P         + P +R   E+ AAFT  FFAWLVGP +V E E NG
Sbjct  2    QQQEVVREVLLSMLPPGAPDQFRKLFPPTRWAAEFNAAFTVPFFAWLVGPSEVVEVEVNG  61

Query  482  RREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFG  303
             ++++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEM++G
Sbjct  62   VKQRSGVLIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMTPNFEDMSCEMVYG  121

Query  302  QDPPSTSHDPAMMQPCYK-LCNSKKKHHNNC  213
            Q PP    DP   QPC+  +C+    + + C
Sbjct  122  QVPPPFEEDPVSKQPCFSDICSMANPNSSIC  152



>ref|XP_004309536.1| PREDICTED: uncharacterized protein LOC101303472 [Fragaria vesca 
subsp. vesca]
Length=264

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 108/195 (55%), Gaps = 10/195 (5%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKS----------GYDGLVEITRAVFHNFDSTQQ  657
            Y+D +F++  +   +  +K       SK+           Y+  V++++ V       QQ
Sbjct  51   YNDGFFEKAFMTLFARKMKRFAAPVKSKNEIEEKKWWEYDYESFVDVSKRVMQGRSRIQQ  110

Query  656  QSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRR  477
            Q ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E  G +
Sbjct  111  QEVVREVLLSMLPPGAPAQFRKLFPPTKWAAEFNAALTVPFFHWLVGPSEVIEVEVEGVK  170

Query  476  EKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQD  297
            +++ V I+KCR+LE + CVGMC N+CK P+Q F  N  G+P+ M+PNFE+MSC+M++GQ 
Sbjct  171  QRSGVRIKKCRYLENSGCVGMCVNMCKFPTQDFFTNEFGLPLTMIPNFEDMSCDMVYGQV  230

Query  296  PPSTSHDPAMMQPCY  252
            PP    DP   QPC+
Sbjct  231  PPPFEEDPVSKQPCF  245



>ref|WP_015124291.1| hypothetical protein [Synechococcus sp. PCC 6312]
 ref|YP_007061290.1| hypothetical protein Syn6312_1586 [Synechococcus sp. PCC 6312]
 gb|AFY60747.1| hypothetical protein Syn6312_1586 [Synechococcus sp. PCC 6312]
Length=214

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 103/190 (54%), Gaps = 5/190 (3%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
            +Y D  FDRLA+  ++  +     +      Y   V +++ V     + +QQ+LI + L 
Sbjct  10   IYTDNAFDRLALGLINRKIAQALDLTPPSPTYANFVWLSQQVMQGRTAQEQQALIAEVLA  69

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNG-----RREKNV  465
              IP  +L  +      + +  E  A F T  F WLVGPC+ +     G     R +++ 
Sbjct  70   SVIPRWVLWGIRNFFSPAPLVCELNAWFATRLFQWLVGPCEWQSTLVAGPDQAFRWQRSR  129

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            V I+KCR+LEE+ CVGMC NLCK+P+Q F     G+P+ M P+F+++SC M+FGQ P   
Sbjct  130  VQIKKCRYLEESGCVGMCVNLCKLPTQKFFTEQFGIPLTMTPDFQDLSCAMVFGQMPLPF  189

Query  284  SHDPAMMQPC  255
            + + A  QPC
Sbjct  190  TEEEAAQQPC  199



>ref|XP_003573300.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Brachypodium 
distachyon]
Length=275

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 103/170 (61%), Gaps = 2/170 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQ-QQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTT  540
            Y+  V+++R V  +  + + QQ+ + + L   +P         + P +R   E+ AA T 
Sbjct  101  YESFVDVSRRVMVSCGTRERQQAAVREVLLSMLPAGAPAQFRKLFPPTRWACEFNAALTV  160

Query  539  IFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMG  360
             FF WLVGP +V E E  G ++++ V I+KCR+LE + CVGMC N+CK+P+Q+F  +  G
Sbjct  161  PFFHWLVGPSEVVEVEVAGVKQRSGVLIKKCRYLENSGCVGMCVNMCKIPTQSFFTDEFG  220

Query  359  MPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCNSKKKHHNNC  213
            +P+ M PNFE+MSCEMI+GQ PP    DPA  QPCY  LC+  K     C
Sbjct  221  LPLTMNPNFEDMSCEMIYGQVPPPLEEDPASKQPCYASLCSIAKPAAPIC  270



>ref|XP_004244658.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Solanum 
lycopersicum]
Length=268

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 100/169 (59%), Gaps = 1/169 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            YD  V+++R V       QQQ ++ Q L   +P         + P ++   E+ AA T  
Sbjct  94   YDSFVDVSRKVMQGRSRLQQQQVVRQVLMSMLPPGAPAQFRKLFPPTQWAAEFNAAITVP  153

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E +G ++K+ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  154  FFFWLVGPSEVVEVEVDGVKQKSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  213

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCNSKKKHHNNC  213
            P+ M PNFE+MSCEMI+GQ PP    DP   QPCY  +C       N C
Sbjct  214  PLTMNPNFEDMSCEMIYGQVPPPFEEDPVSKQPCYANICTIANPSSNVC  262



>ref|XP_002949674.1| hypothetical protein VOLCADRAFT_80804 [Volvox carteri f. nagariensis]
 gb|EFJ49226.1| hypothetical protein VOLCADRAFT_80804 [Volvox carteri f. nagariensis]
Length=210

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 99/166 (60%), Gaps = 6/166 (4%)
 Frame = -2

Query  725  KSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAF  546
            K  YD  V I+  +    +S QQ+ ++   L   +P         + P ++   E+ A  
Sbjct  13   KPTYDDFVRISSEIMKGRNSVQQRVVVRDVLMSLLPPEAPPAFRKLFPPTQFSAEFNALI  72

Query  545  TTIFFAWLVGPCQVKEAEF----NG--RREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQ  384
             ++ F WLVG  +VKE +     NG  RR+++VV I+KCR+LE + CVGMC N+CK+P+Q
Sbjct  73   ASLGFYWLVGESEVKEDDVVVGPNGEKRRQRSVVQIKKCRYLESSGCVGMCVNMCKIPTQ  132

Query  383  TFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKL  246
            TF  +  G+P+ M PNFE++SC MIFGQ PP  + DPA  QPC+ +
Sbjct  133  TFFTDEFGLPLTMNPNFEDLSCSMIFGQAPPPMTEDPAYTQPCFAV  178



>ref|XP_009625569.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Nicotiana 
tomentosiformis]
Length=282

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 109/198 (55%), Gaps = 14/198 (7%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSG--------------YDGLVEITRAVFHNFD  669
            Y+D  F++  +   +  ++      +SK+G              YD  V+++R V     
Sbjct  65   YNDGLFEKAFMTLFARKMENFAAKSASKNGSQKEEKKKGWFEYDYDSFVDVSRKVMQGRS  124

Query  668  STQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF  489
              QQQ ++ + L   +P         + P ++   E+ AA T  FF WLVGP +V E E 
Sbjct  125  RLQQQQVVREVLMSMLPPGAPAQFRKLFPPTKWAAEFNAAITVPFFFWLVGPSEVVEVEV  184

Query  488  NGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMI  309
             G ++K+ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+P+ M PNFE+MSCEM+
Sbjct  185  GGVKQKSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGLPLTMNPNFEDMSCEMV  244

Query  308  FGQDPPSTSHDPAMMQPC  255
            +GQ PP    DP   QPC
Sbjct  245  YGQIPPPFEEDPVAKQPC  262



>ref|XP_005648951.1| hypothetical protein COCSUDRAFT_61832 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24407.1| hypothetical protein COCSUDRAFT_61832 [Coccomyxa subellipsoidea 
C-169]
Length=165

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 85/166 (51%), Gaps = 6/166 (4%)
 Frame = -2

Query  707  LVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFA  528
            +VE++RA+     + QQ+  +I       P           P S+ G    A  T  FF 
Sbjct  1    MVEVSRALMKGRSAAQQREAVIAGFPSVPP-----WFRKAFPYSKWGAGLNARITPAFFT  55

Query  527  WLVGPCQVKEAEF-NGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPV  351
            WLVGP Q  EA   +G  +K+ VHI++CR+L E+ C GMC NLCK P QTF    +GMP+
Sbjct  56   WLVGPMQTVEATLSDGTVQKSGVHIERCRYLAESKCAGMCVNLCKAPVQTFFTEELGMPL  115

Query  350  NMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKKKHHNNC  213
             M PNFE+ SCEM+FG  P     D  M   C K C +       C
Sbjct  116  TMKPNFEDFSCEMVFGLTPAPLQEDEVMQAACLKECATGVLDRPKC  161



>gb|ACG26781.1| hypothetical protein [Zea mays]
Length=265

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 1/160 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V+++R V       QQQ  + + L   +P         + P +R   E+ AA T  
Sbjct  93   YESFVDVSRRVMLGRTRAQQQQAVREVLLSMLPPGAPAQFRRLFPPTRWACEFNAALTVP  152

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E  G R+++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  153  FFRWLVGPSEVVEVEVGGVRQRSGVRIEKCRYLESSGCVGMCVNMCKVPTQDFFTNEFGL  212

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCN  240
            P+ M PNFE+MSCEMI+GQ PP    DPA  Q CY  LC+
Sbjct  213  PLTMNPNFEDMSCEMIYGQVPPPLEEDPASKQACYPSLCS  252



>ref|NP_001143054.1| uncharacterized protein LOC100275523 [Zea mays]
 gb|ACG28622.1| hypothetical protein [Zea mays]
Length=265

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 1/160 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V+++R V       QQQ  + + L   +P         + P +R   E+ AA T  
Sbjct  93   YESFVDVSRRVMLGRTRAQQQQAVREVLLSMLPPGAPAQFRRLFPPTRWACEFNAALTVP  152

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E  G R+++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  153  FFRWLVGPSEVVEVEVGGVRQRSGVRIEKCRYLESSGCVGMCVNMCKVPTQDFFTNEFGL  212

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCN  240
            P+ M PNFE+MSCEMI+GQ PP    DPA  Q CY  LC+
Sbjct  213  PLTMNPNFEDMSCEMIYGQVPPPLEEDPASKQACYPSLCS  252



>gb|EWM30570.1| protein of unknown function DUF4033 [Nannochloropsis gaditana]
 gb|EWM30571.1| protein of unknown function DUF4033 [Nannochloropsis gaditana]
Length=357

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 110/207 (53%), Gaps = 10/207 (5%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKS--GYDGLVEITRAVFHNFDSTQQQSLIIQAL  633
            Y+D  F ++ I   +  + AV G  S ++   Y+  V ++R +     ST+ +S ++  L
Sbjct  142  YNDDIFAKIWIFLFTGKIAAVVGAPSPRNFIPYEEYVRLSRLLLRG-GSTKAKSAVLSVL  200

Query  632  HK-AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF----NGRRE--  474
               A P    +   +    SR+  E+ A  T IFF+WLVGP +V+ +E      G RE  
Sbjct  201  RSIAFPGFSSIFRALFPGSSRLACEFNARVTPIFFSWLVGPAKVETSEMLNPVTGARELW  260

Query  473  KNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDP  294
             N V I++CR+LE   C G C ++CK+P+QTF    +GMPV M PNFE++SC M FG  P
Sbjct  261  SNSVKIERCRYLESVQCKGACVSICKLPTQTFFTEDLGMPVTMTPNFEDLSCTMTFGTAP  320

Query  293  PSTSHDPAMMQPCYKLCNSKKKHHNNC  213
               + DP   + CYK C++       C
Sbjct  321  LPIASDPVCSEGCYKECSTAVTSKRVC  347



>gb|AFW74330.1| hypothetical protein ZEAMMB73_058801 [Zea mays]
Length=305

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 97/169 (57%), Gaps = 1/169 (1%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V+++R V       QQQ  + + L   +P         + P +R   E+ AA T  
Sbjct  133  YESFVDVSRRVMLGRTRAQQQQAVREVLLSMLPPGAPAQFRRLFPPTRWACEFNAALTVP  192

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
            FF WLVGP +V E E  G R+++ V I+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  193  FFRWLVGPSEVVEVEVGGVRQRSGVRIEKCRYLESSGCVGMCVNMCKVPTQDFFTNEFGL  252

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY-KLCNSKKKHHNNC  213
            P+ M PNFE+MSCEMI+GQ PP    DPA  Q CY  LC+        C
Sbjct  253  PLTMNPNFEDMSCEMIYGQVPPPLEEDPASKQACYPSLCSMSTPSAPAC  301



>ref|XP_001755220.1| predicted protein [Physcomitrella patens]
 gb|EDQ80164.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 98/179 (55%), Gaps = 5/179 (3%)
 Frame = -2

Query  740  GVRSSKSGYDGLVEITRAVFHNFDSTQQ-QSLIIQALHKAIPNPILMLMNMVLPQSRIGR  564
            G  S K GYDGLV+I + +   + S ++ +   ++ L    P+ +L L   ++     G+
Sbjct  38   GWDSPKPGYDGLVDIAKKLLLQYRSGEETERATVRVLRSLFPSWLLPLFKQIVAPFGDGK  97

Query  563  E---YCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKCRFLEETNCVGMCTNLCK  396
                 CA  T     WL+G C + E E  +G +  + V +QKC++L+ET C G+C + CK
Sbjct  98   PAAMLCAQVTIATCQWLMGKCTITEVELADGSKIPSGVLVQKCKYLDETKCAGICIHTCK  157

Query  395  MPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKKKHHN  219
            +P+Q F+   MG+ + M PN+EN SC+  FG DPP  + DPA+  PC  +C +     +
Sbjct  158  LPTQAFMNGDMGVRLTMEPNYENFSCQFNFGVDPPPAAEDPALKTPCLAVCPTAASRGS  216



>ref|XP_006352836.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Solanum 
tuberosum]
Length=272

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 108/199 (54%), Gaps = 8/199 (4%)
 Frame = -2

Query  791  FDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNP  612
            FD L ++   + +   TG  S K GY GL+E+   +    D+++ +   ++ L    P  
Sbjct  65   FDNLFLSLFRNKMVQETGWDSEKPGYQGLIEVAHRLTVGQDNSKTRDAAVRILKSLFPPL  124

Query  611  ILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKCR  444
            +L L  M++      +      A  T +   WL+GPC V   +  NG    + V ++KC+
Sbjct  125  LLELYRMLVAPIHSGKFAALMVARVTALSCQWLMGPCAVNSVDLPNGSSLMSGVFVEKCK  184

Query  443  FLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMM  264
            +LEE+ CVG+C N CK+P+QTF K+ MG+P+ M PNF + SC+  FG  PP    D A+ 
Sbjct  185  YLEESKCVGVCINTCKLPTQTFFKDHMGVPLLMEPNFTDYSCQFKFGILPPQQEVDDALK  244

Query  263  QPCYKLCNS----KKKHHN  219
            +PC ++C S    K+ +HN
Sbjct  245  EPCLEICPSSVRRKEMNHN  263



>ref|NP_973748.1| inhibition of secondary bud outgrowth protein D27-like protein 
[Arabidopsis thaliana]
 gb|AEE27522.1| inhibition of secondary bud outgrowth protein D27-like protein 
[Arabidopsis thaliana]
Length=200

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 81/122 (66%), Gaps = 2/122 (2%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSK--SGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             D++F ++AIN+LS  ++   G+ SS   + YD LV+    V  NFD+ QQ   ++ +L 
Sbjct  66   EDSFFSKIAINYLSKNLQDAAGISSSSKSTDYDRLVDTATRVSRNFDTKQQHEFVLSSLD  125

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQK  450
            +A+P  I  L+ M  P S++ RE  A FTTI FAWLVGP +V+E E NGR+EK+VV+I+K
Sbjct  126  RALPTVISSLIKMAFPPSKVSRELFALFTTISFAWLVGPSEVRETEVNGRKEKSVVYIEK  185

Query  449  CR  444
            CR
Sbjct  186  CR  187



>ref|XP_010323016.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X2 [Solanum lycopersicum]
Length=243

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 105/191 (55%), Gaps = 6/191 (3%)
 Frame = -2

Query  791  FDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNP  612
            FD L ++   + +   TG  S K GY GL+E+   +  + D+++ +   ++ L    P  
Sbjct  44   FDNLFLSLFRNKMVQETGWDSEKPGYQGLIEVAHRLTVSQDNSKTRDASVRILKSLFPPL  103

Query  611  ILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKCRFLE  435
            +L L  M+     I   + A  T +   WL+GPC V      NG    + V ++KC++LE
Sbjct  104  LLELYRML-----IAPIHSARVTALSCQWLMGPCTVNSVHLPNGSSLMSGVFVEKCKYLE  158

Query  434  ETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPC  255
            E+ CVG+C N CK+P+QTF K+ MG+P+ M PNF + SC+  FG  PP    D A+ +PC
Sbjct  159  ESKCVGVCINTCKLPTQTFFKDHMGVPLLMEPNFIDYSCQFKFGILPPQQEVDDALKEPC  218

Query  254  YKLCNSKKKHH  222
             ++C S  + +
Sbjct  219  LEICPSSVRRN  229



>ref|XP_010069831.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Eucalyptus 
grandis]
Length=264

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 104/193 (54%), Gaps = 5/193 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALH  630
            Y    FD L +N     +    G  S K GYDGL+E+  R +     ++  +   I+ L 
Sbjct  51   YKPGVFDDLFLNLFRSKMVKEVGWDSEKPGYDGLIEVAHRLMMKGSSNSDTRDAAIRILR  110

Query  629  KAIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  +++    + ++     A  T +   WL+G C V   +  +G   ++ V
Sbjct  111  SLFPPFLLELYQLLIAPIGEGKLAAVMVARVTALTCQWLMGKCTVNSVDLLDGTSCQSGV  170

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             +++C++LEE+ CVG+C N CK+P+Q+F K+ MG+P+ M PNFE+ SC+  FG  PP   
Sbjct  171  FVERCKYLEESKCVGICVNTCKLPTQSFFKDYMGVPLLMEPNFEDYSCQFKFGIHPPQPQ  230

Query  281  HDPAMMQPCYKLC  243
             D A+ +PC ++C
Sbjct  231  EDAALKEPCLEIC  243



>ref|XP_004242308.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=251

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 106/194 (55%), Gaps = 4/194 (2%)
 Frame = -2

Query  791  FDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNP  612
            FD L ++   + +   TG  S K GY GL+E+   +  + D+++ +   ++ L    P  
Sbjct  44   FDNLFLSLFRNKMVQETGWDSEKPGYQGLIEVAHRLTVSQDNSKTRDASVRILKSLFPPL  103

Query  611  ILMLMNMVLPQSRIGR---EYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKCR  444
            +L L  M++     G+      A  T +   WL+GPC V      NG    + V ++KC+
Sbjct  104  LLELYRMLIAPIHSGKFAALMVARVTALSCQWLMGPCTVNSVHLPNGSSLMSGVFVEKCK  163

Query  443  FLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMM  264
            +LEE+ CVG+C N CK+P+QTF K+ MG+P+ M PNF + SC+  FG  PP    D A+ 
Sbjct  164  YLEESKCVGVCINTCKLPTQTFFKDHMGVPLLMEPNFIDYSCQFKFGILPPQQEVDDALK  223

Query  263  QPCYKLCNSKKKHH  222
            +PC ++C S  + +
Sbjct  224  EPCLEICPSSVRRN  237



>ref|XP_010679400.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=273

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 97/192 (51%), Gaps = 4/192 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y   W D    N     +    G  S K+GYDG++E+   +     + Q     +  L  
Sbjct  59   YKPNWLDDFFQNSFRKKLVEEVGWDSEKAGYDGMMELVNGLMIGRTTQQTNQAAVGILKS  118

Query  626  AIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVH  459
              P  +L L  M++      RI     A  T     WL+GPC +   +  +G   ++ V 
Sbjct  119  LFPPFLLELYRMLITPIGGGRIAAMMVARVTVFTCQWLMGPCSINSIKLPDGSSCQSGVL  178

Query  458  IQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSH  279
            +++C++LEE+ CVG+C N CK+P+QTF KN MG+P+ M PNF + SC+  FG  PP   +
Sbjct  179  VERCKYLEESKCVGICVNTCKLPTQTFFKNHMGIPLLMEPNFSDYSCQFNFGIPPPLPEN  238

Query  278  DPAMMQPCYKLC  243
            D A+ +PC   C
Sbjct  239  DNALKEPCLDGC  250



>gb|KCW58315.1| hypothetical protein EUGRSUZ_H01003 [Eucalyptus grandis]
Length=283

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 104/193 (54%), Gaps = 5/193 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALH  630
            Y    FD L +N     +    G  S K GYDGL+E+  R +     ++  +   I+ L 
Sbjct  70   YKPGVFDDLFLNLFRSKMVKEVGWDSEKPGYDGLIEVAHRLMMKGSSNSDTRDAAIRILR  129

Query  629  KAIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  +++    + ++     A  T +   WL+G C V   +  +G   ++ V
Sbjct  130  SLFPPFLLELYQLLIAPIGEGKLAAVMVARVTALTCQWLMGKCTVNSVDLLDGTSCQSGV  189

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             +++C++LEE+ CVG+C N CK+P+Q+F K+ MG+P+ M PNFE+ SC+  FG  PP   
Sbjct  190  FVERCKYLEESKCVGICVNTCKLPTQSFFKDYMGVPLLMEPNFEDYSCQFKFGIHPPQPQ  249

Query  281  HDPAMMQPCYKLC  243
             D A+ +PC ++C
Sbjct  250  EDAALKEPCLEIC  262



>ref|XP_010679399.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=274

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 99/193 (51%), Gaps = 5/193 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y   W D    N     +    G  S K+GYDG++E+   +     + Q     +  L  
Sbjct  59   YKPNWLDDFFQNSFRKKLVEEVGWDSEKAGYDGMMELVNGLMIGRTTQQTNQAAVGILKS  118

Query  626  AIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFA-WLVGPCQVKEAEF-NGRREKNVV  462
              P  +L L  M++      RI      A  T+F   WL+GPC +   +  +G   ++ V
Sbjct  119  LFPPFLLELYRMLITPIGGGRIAAMMVEARVTVFTCQWLMGPCSINSIKLPDGSSCQSGV  178

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             +++C++LEE+ CVG+C N CK+P+QTF KN MG+P+ M PNF + SC+  FG  PP   
Sbjct  179  LVERCKYLEESKCVGICVNTCKLPTQTFFKNHMGIPLLMEPNFSDYSCQFNFGIPPPLPE  238

Query  281  HDPAMMQPCYKLC  243
            +D A+ +PC   C
Sbjct  239  NDNALKEPCLDGC  251



>ref|XP_003591385.1| hypothetical protein MTR_1g086840 [Medicago truncatula]
 gb|AES61636.1| D27 family protein, putative [Medicago truncatula]
Length=260

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 99/193 (51%), Gaps = 5/193 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALH  630
            Y     D L +N     +    G  S K GYDGL+E+  R +     ++      ++ L 
Sbjct  47   YKPGVIDDLFLNLFRTKLVQEVGWESKKPGYDGLIEVANRLMMKGTTNSDTIEATVRILR  106

Query  629  KAIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  M++      ++     A  T +   WL+GPC+V   E  NG    + V
Sbjct  107  SLFPPFLLELYKMLIAPIGGGKVAAIMVARVTALTCQWLMGPCKVNSVELPNGTSWNSGV  166

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            H+++C++LEE+ CVG+C N CK P+QTF K+ MG+P+ M PNF + SC+  FG  PP   
Sbjct  167  HVERCKYLEESKCVGICLNTCKFPTQTFFKDHMGVPLLMKPNFADYSCQFKFGVLPPLPE  226

Query  281  HDPAMMQPCYKLC  243
             D  + +PC + C
Sbjct  227  DDTVLKEPCLEAC  239



>ref|XP_004289540.1| PREDICTED: uncharacterized protein LOC101314896 [Fragaria vesca 
subsp. vesca]
Length=266

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 106/201 (53%), Gaps = 6/201 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALH  630
            Y     D+L +N   + +    G  S K GYDGL+E+  R +  N  ++  +   ++ L 
Sbjct  53   YKGGVVDKLLLNVFRNKMVQQVGWDSDKPGYDGLIEVANRMMLQNPTNSHTKEAAVRVLI  112

Query  629  KAIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  +++      +I     A  T I   WL+GPC V   +  +G    + V
Sbjct  113  SLFPPFLLELYKLLIAPIQGGKIAALMVARVTAISCQWLMGPCTVNSVDLPDGNSWASGV  172

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             ++KC++LEE+ CVG+C N CK+P+Q+F K+ MG+P+ M PNF + SC+  FG  PP   
Sbjct  173  FVEKCKYLEESKCVGICVNTCKLPTQSFFKDYMGVPLLMEPNFNDYSCQFKFGVLPPLPE  232

Query  281  HDPAMMQPCYKLC-NSKKKHH  222
             D  + +PC  +C N+ ++  
Sbjct  233  DDATLKEPCLAICPNATRRRE  253



>ref|XP_011079540.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Sesamum 
indicum]
 ref|XP_011079541.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Sesamum 
indicum]
 ref|XP_011079542.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Sesamum 
indicum]
Length=260

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 93/177 (53%), Gaps = 4/177 (2%)
 Frame = -2

Query  743  TGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVL---PQSR  573
            TG  S K GYDGL++    +     +++     ++ L    P  +L L  M++      +
Sbjct  69   TGWDSEKPGYDGLIDAAHRLMVGRSNSEATKASVRILRSLFPPLLLDLYKMLISPIAGGK  128

Query  572  IGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKCRFLEETNCVGMCTNLCK  396
            +  E  A  T I   WL+G C V   +  NG    + V ++KC++LEE+ CVG+C N CK
Sbjct  129  VAAEMVARVTAISCQWLMGTCTVNSVDLPNGSSWSSGVFVEKCKYLEESKCVGVCINTCK  188

Query  395  MPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKKKH  225
            +P+QTF    MG+P+ M PNF + SC+  FG  PP    D A+ +PC  +C +  + 
Sbjct  189  LPTQTFFNEYMGVPLVMEPNFSDYSCQFKFGVSPPRPEDDSALREPCLHICPTANRR  245



>ref|XP_009796847.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Nicotiana 
sylvestris]
Length=256

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 107/205 (52%), Gaps = 8/205 (4%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             Y    FD L ++   + +   T   S K GY+GL+E+   +    ++++ +   ++ L 
Sbjct  43   AYKPGVFDNLFLSLFRNKMVQETRWDSDKPGYEGLIEVAHRLTVGQNNSETRDAAVRILR  102

Query  629  KAIPNPILMLMNMV---LPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  M+   +   +      A  T +   WL+GPC V   +  NG    + V
Sbjct  103  SLFPPLLLELYRMLVAPIDSGKFAALMVARVTALSCQWLMGPCAVNSVDLPNGSSLMSGV  162

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             ++KC++LEE+ CVG+C N CK+P+QTF K+ MG+P+ M PNF + SC+  FG  PP   
Sbjct  163  FVEKCKYLEESKCVGVCINTCKLPTQTFFKDYMGVPLVMEPNFTDYSCQFKFGILPPQPE  222

Query  281  HDPAMMQPCYKLC----NSKKKHHN  219
             D  + +PC ++C      K+ +HN
Sbjct  223  DDNTLKEPCLEICPNAVRRKEMNHN  247



>ref|XP_005647503.1| hypothetical protein COCSUDRAFT_15824 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22959.1| hypothetical protein COCSUDRAFT_15824 [Coccomyxa subellipsoidea 
C-169]
Length=234

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 96/184 (52%), Gaps = 7/184 (4%)
 Frame = -2

Query  749  AVTGVRSSKSGYDGLVEITRAVFHNF----DSTQQQSLIIQALHKAIPNPILMLMNMVLP  582
            A  G  S K GYD +V++TR +        D+  +   I+ +L  +   P   +M    P
Sbjct  39   AAIGKNSDKEGYDAIVDLTRLLNSKSSNPRDTQVKTRQILLSLFPSWLPPAFKVM-FSKP  97

Query  581  QSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRR--EKNVVHIQKCRFLEETNCVGMCT  408
               +  +  A  T +   WL+GPC+V + E +G R      V +++CR+LEET C  +C 
Sbjct  98   MPEVSCQLNAWVTMLTCQWLMGPCKVNDVELDGGRIGSGQGVLVERCRYLEETGCASVCL  157

Query  407  NLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKKK  228
            N CK+P+Q F    MG+P+ M PN+E+ SC+  FG  P   + D A   PC+  C SK++
Sbjct  158  NSCKIPTQEFFAKDMGLPLTMTPNYEDFSCQFSFGLTPKPAAIDEAFATPCFSQCPSKQR  217

Query  227  HHNN  216
            H  +
Sbjct  218  HRGD  221



>gb|KCW77312.1| hypothetical protein EUGRSUZ_D01676 [Eucalyptus grandis]
Length=238

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 87/155 (56%), Gaps = 31/155 (20%)
 Frame = -2

Query  716  YDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTI  537
            Y+  V++++ V       +QQ ++ +           +LM+M+ P +             
Sbjct  96   YESFVDVSKRVTQGRSRARQQEVVRE-----------VLMSMLPPGA-------------  131

Query  536  FFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGM  357
                   P QV E E NG ++K+ VHI+KCR+LE + CVGMC N+CK+P+Q F  N  G+
Sbjct  132  -------PAQVVEVEVNGVKQKSGVHIKKCRYLENSGCVGMCVNMCKIPTQDFFTNEFGL  184

Query  356  PVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCY  252
            P+ M+PNFE+MSCEM++GQ PP    DP   QPC+
Sbjct  185  PLTMIPNFEDMSCEMVYGQAPPPFEEDPVSKQPCF  219



>gb|AFI78794.1| putative D27 family protein, partial [Chaetosphaeridium globosum]
Length=133

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 71/123 (58%), Gaps = 1/123 (1%)
 Frame = -2

Query  590  VLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFN-GRREKNVVHIQKCRFLEETNCVGM  414
            + P S  G E  A  T  FF WLVGP +V   E   G+  ++ V I++CR+L  + C GM
Sbjct  2    LFPYSEWGAEVNATITPAFFKWLVGPAKVVAVELEPGKELRSGVQIERCRYLATSGCAGM  61

Query  413  CTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSK  234
            C NLCK+P QTF    +GMP+ M PN+++ SC M+FG+ PP    DPA   PC   C++ 
Sbjct  62   CVNLCKLPCQTFFTEELGMPLTMEPNYQDQSCLMVFGKLPPPREEDPAFASPCLSACSAA  121

Query  233  KKH  225
               
Sbjct  122  TSQ  124



>ref|XP_002302776.2| hypothetical protein POPTR_0002s19530g [Populus trichocarpa]
 gb|EEE82049.2| hypothetical protein POPTR_0002s19530g [Populus trichocarpa]
Length=268

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 106/202 (52%), Gaps = 12/202 (6%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            ++D WF  L  N +   VK V G  S K+GYDGL+E+   +      +      ++ L  
Sbjct  60   FYDDWFLDLFRNKM---VKEV-GWDSEKAGYDGLIEVASRLMLRRTPSDTTDAAVRILRS  115

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAF-----TTIFFAWLVGPCQVKEAEF-NGRREKNV  465
              P  +L L   ++  S IG    AA      T I   WL+G C+V   +  +G   ++ 
Sbjct  116  LFPPFLLHLYKSLV--SPIGGGKLAAMMVARVTVITCQWLMGICKVNSVDLPDGSSWESG  173

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            V +++C++LEE+ CVG+C N CK+P+QTF K+ MG+P+ M PNF + SC+  FG  PP  
Sbjct  174  VFVERCKYLEESKCVGICVNTCKLPTQTFFKDYMGIPLLMEPNFNDYSCQFKFGVLPPLP  233

Query  284  SHDPAMMQPCYKLCNSKKKHHN  219
              D  + +PC ++C    K   
Sbjct  234  EDDGTLKEPCLEVCPIASKRRG  255



>ref|XP_008781127.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Phoenix 
dactylifera]
Length=264

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 104/204 (51%), Gaps = 11/204 (5%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVF----HNFDSTQQQSLIIQ  639
            Y    FD L +      +    G  S K GY GL+E+   +      N ++ Q    I+Q
Sbjct  51   YKPGIFDGLLLKVFRKKMVEEVGWDSEKPGYGGLIEVANRLMMKGKSNLETEQSAVRILQ  110

Query  638  ALHKAIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREK  471
            +L    P  +L+L  M +      RI     A  T +   WL+GPC V   +  +G    
Sbjct  111  SL---FPPFLLILFKMFIAPIGGGRIASMMVARATALSCQWLMGPCSVNLVDLPDGSSCT  167

Query  470  NVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPP  291
            + V + +C++LEE+ C+G+C N CK+P+QTF K  MG+P++M PNF + SC+  FG  PP
Sbjct  168  SGVFVDRCKYLEESKCIGICINTCKLPTQTFFKECMGVPLHMEPNFSDHSCQFNFGILPP  227

Query  290  STSHDPAMMQPCYKLCNSKKKHHN  219
              + D A+ +PC  +C +  +  +
Sbjct  228  PPATDKALQEPCLAICPNASRRRD  251



>gb|KCW58314.1| hypothetical protein EUGRSUZ_H01003 [Eucalyptus grandis]
Length=287

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 105/199 (53%), Gaps = 13/199 (7%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALH  630
            Y    FD L +N     +    G  S K GYDGL+E+  R +     ++  +   I+ L 
Sbjct  70   YKPGVFDDLFLNLFRSKMVKEVGWDSEKPGYDGLIEVAHRLMMKGSSNSDTRDAAIRILR  129

Query  629  KAIPNPILMLMNMVLPQSRIGREYCAAF---------TTIFFAWLVGPCQVKEAEF-NGR  480
               P  +L L  +++  + IG    AA          T +   WL+G C V   +  +G 
Sbjct  130  SLFPPFLLELYQLLI--APIGEGKLAAVMVGKSFSIVTALTCQWLMGKCTVNSVDLLDGT  187

Query  479  REKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQ  300
              ++ V +++C++LEE+ CVG+C N CK+P+Q+F K+ MG+P+ M PNFE+ SC+  FG 
Sbjct  188  SCQSGVFVERCKYLEESKCVGICVNTCKLPTQSFFKDYMGVPLLMEPNFEDYSCQFKFGI  247

Query  299  DPPSTSHDPAMMQPCYKLC  243
             PP    D A+ +PC ++C
Sbjct  248  HPPQPQEDAALKEPCLEIC  266



>ref|XP_009592742.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Nicotiana 
tomentosiformis]
Length=268

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 106/205 (52%), Gaps = 8/205 (4%)
 Frame = -2

Query  809  VYHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALH  630
             Y    FD L ++   + +   T   S K GY+GL+E+   +    ++++ +   ++ L 
Sbjct  55   AYKPGVFDNLFLSLFRNKMVQETRWDSDKHGYEGLIEVAHRLTVGQNNSETRDAAVRILR  114

Query  629  KAIPNPILMLMNMV---LPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  M+   +   +      A  T +   WL+GPC +   +  NG    + V
Sbjct  115  SLFPPLLLELYRMLVVPIDSGKFAALMVARVTALSCPWLMGPCAINSVDLPNGSSLMSGV  174

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             ++KC++LEE+ CVG+C N CK+P+QTF K+ MG+P+ M PNF + SC+  FG  PP   
Sbjct  175  FVEKCKYLEESKCVGVCINTCKLPTQTFFKDHMGVPLVMEPNFTDYSCQFKFGILPPQPE  234

Query  281  HDPAMMQPCYKLC----NSKKKHHN  219
             D  + +PC ++C      K+  HN
Sbjct  235  ADDTLKEPCLEICPNAVRRKEMSHN  259



>ref|WP_024124978.1| hypothetical protein [Thermosynechococcus sp. NK55a]
 ref|YP_008900099.1| hypothetical protein NK55_06410 [Thermosynechococcus sp. NK55a]
 gb|AHB88586.1| hypothetical protein NK55_06410 [Thermosynechococcus sp. NK55a]
Length=203

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 90/175 (51%), Gaps = 17/175 (10%)
 Frame = -2

Query  794  WFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPN  615
            W +R  +  L   + +  GV   +  Y G VEITR +       QQQ+++     + IP 
Sbjct  9    WLERWCLARLIRAIASAIGVEPQRWDYVGFVEITRQLKRGRSPAQQQAIVATVFDRLIPP  68

Query  614  PILMLMNMVLPQSRIGREYCAAFTTIFFAWLVG-----------PCQVKEAEFNGRREKN  468
             +  L+  +   SR   E+ A F T    WLVG           P Q+ + +++G     
Sbjct  69   MMSTLIRTLFRPSRWICEWNAWFATRLTGWLVGASDRYWVEVMPPDQLPQWQYSG-----  123

Query  467  VVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFG  303
             V IQKCR+L E+ C+ +C NLCK P++ F +  +G+P+ M PNF + SCEM+FG
Sbjct  124  -VRIQKCRYLAESQCMALCMNLCKKPTEQFFRQRLGIPLTMTPNFRDYSCEMVFG  177



>ref|XP_011042273.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X1 [Populus euphratica]
Length=298

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 105/202 (52%), Gaps = 12/202 (6%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            ++D WF  L  N +   VK V G  S K+GYDGL+E+   +      +      ++ L  
Sbjct  60   FYDDWFLALFRNKM---VKEV-GWDSEKAGYDGLIEVASRLMLRRTPSDTTDAAVRILRS  115

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAF-----TTIFFAWLVGPCQVKEAEF-NGRREKNV  465
              P  +L L   ++  S IG    AA      T I   WL+G C+V   +  +G   ++ 
Sbjct  116  LFPPFLLHLYKSLV--SPIGGGKLAAIMVARVTVITCQWLMGICKVNSVDLPDGSSWESG  173

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            V +++C++LEE+ CVG+C N CK+P+QTF K+ MG+P+ M PNF + SC+  FG  PP  
Sbjct  174  VFVERCKYLEESKCVGICVNTCKLPTQTFFKDYMGIPLLMEPNFNDYSCQFKFGVLPPLP  233

Query  284  SHDPAMMQPCYKLCNSKKKHHN  219
              D  + +PC + C    K   
Sbjct  234  EDDGTLKEPCLEACPIASKRRG  255



>emb|CDX90961.1| BnaA03g26410D [Brassica napus]
Length=256

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 106/202 (52%), Gaps = 7/202 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITR-AVFHNFDSTQQQSLIIQALH  630
            Y     D   +    + +    G  S K GY GL+E+ +  +  +   ++     ++ L 
Sbjct  50   YRPGVLDDFFMQSFRNKLVEEVGSDSDKPGYVGLIELVKFLLLKSRTRSETNDAAVRILK  109

Query  629  KAIPNPILMLMNMV---LPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  IL L  ++   L Q +I     A  T +   WL+GPC+V   E  NG   ++ V
Sbjct  110  SLFPPLILELYKLLIAPLAQGKIAALMVARVTVLTCQWLMGPCKVNTIELPNGESWESGV  169

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             ++KC++LEE+ CVG+C N CK+P+QTF K+ MG+P+ M P+F++ SC+  FG  PP   
Sbjct  170  FVEKCQYLEESKCVGVCINTCKLPTQTFFKDYMGVPLLMEPDFKDYSCQFKFGVAPP--E  227

Query  281  HDPAMMQPCYKLCNSKKKHHNN  216
             D ++ +PC++ C+   +   N
Sbjct  228  DDGSVNEPCFETCSIASRRKLN  249



>ref|XP_006492348.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Citrus 
sinensis]
Length=275

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 103/201 (51%), Gaps = 5/201 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVE-ITRAVFHNFDSTQQQSLIIQALH  630
            Y     D L ++   + +    G+ S K GYDGL+E +   +     S+  +   I+ L 
Sbjct  62   YKPGVLDDLFLSSFRNKLVQEVGLDSEKPGYDGLIELVNHLMMKGKSSSDARDAAIRILV  121

Query  629  KAIPNPILMLMNMV---LPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  ++   L   +I     A  T +   WL+GPC V   +  +G   ++ V
Sbjct  122  SLFPPLVLKLYKILISPLAGGKIAAMMVARVTALTCQWLMGPCTVNSVDLPDGTSCQSGV  181

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             +++C++LEE+ CVG+C N CK+P+QTF K+ MG+P+ M PNF + SC+  FG  PP   
Sbjct  182  FVERCKYLEESKCVGVCINTCKLPTQTFFKDYMGVPLLMEPNFSDYSCQFKFGILPPLPK  241

Query  281  HDPAMMQPCYKLCNSKKKHHN  219
             D  + +PC  +C +  +   
Sbjct  242  DDTTLKEPCLDICPTSSRRKE  262



>ref|XP_002271003.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Vitis 
vinifera]
 emb|CBI36963.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 107/204 (52%), Gaps = 8/204 (4%)
 Frame = -2

Query  806  YHDTWFDRLAINHL-SHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQ-QSLIIQAL  633
            Y    FD L +N   S  VK V G  S K GYDGL+++   +     S  + +   ++ L
Sbjct  45   YKPGVFDDLFLNLFRSRMVKEV-GWDSEKPGYDGLIDVANQLMMKSKSNSKVKEAAVRIL  103

Query  632  HKAIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNV  465
                P  +L L  M++      ++     A  T +   WL+GPC V      +G    + 
Sbjct  104  ISLFPPFLLDLYRMLVAPIGGGKVAAMMVARVTALSCQWLMGPCTVNSVNLPDGSSCSSG  163

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            V +++C++LEE+ CVG+C N CK+P+QTF K+ MG+P+ M P+F N SC+  FG  PP  
Sbjct  164  VFVERCKYLEESKCVGICINTCKLPTQTFFKDYMGVPLAMEPDFTNYSCQFSFGVLPPRP  223

Query  284  SHDPAMMQPCYKLC-NSKKKHHNN  216
              D  + +PC ++C N+ ++   N
Sbjct  224  EEDSTLKEPCLEICPNATRRKEIN  247



>ref|XP_002440529.1| hypothetical protein SORBIDRAFT_09g002570 [Sorghum bicolor]
 gb|EES18959.1| hypothetical protein SORBIDRAFT_09g002570 [Sorghum bicolor]
Length=277

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 103/201 (51%), Gaps = 5/201 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALH  630
            Y  ++ D L +      +    G  S K GY GL+E+  R +     + + +   ++ L 
Sbjct  62   YRPSFADDLLLAFFRSKMVEEVGWDSEKPGYAGLMEVANRLMVKGKSAMETEQAAVRVLQ  121

Query  629  KAIPNPILMLMNMVL---PQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L+L   +L      ++     A  T +   WL+GPC V      +G+   + V
Sbjct  122  SLFPPVLLVLYKALLSPIANGQLAAMMLARATALSCQWLMGPCSVNSVTLPDGKSWSSGV  181

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             ++KC++LEE+ C+G+C N CK+P+QTF K+ MG+ + M PNFE+ SC+  FG  PP   
Sbjct  182  FVEKCKYLEESKCLGICINTCKLPTQTFFKDHMGVDLYMEPNFEDYSCQFNFGVPPPPLD  241

Query  281  HDPAMMQPCYKLCNSKKKHHN  219
             D A+ +PC  +C + ++   
Sbjct  242  TDKALKEPCLDICTNARRRRE  262



>ref|XP_010921474.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Elaeis 
guineensis]
Length=265

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 104/201 (52%), Gaps = 6/201 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALH  630
            Y    FD L + +    +    G  S K GY GL+++  R +     + + +   ++ L 
Sbjct  51   YKPGIFDDLLLVYFRKKMVEEVGWDSEKPGYAGLIDVANRLMMKGKSNLETEQSTVRMLQ  110

Query  629  KAIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +LML   ++      RI     A  T +   WL+GPC V   +  +G    + V
Sbjct  111  SLFPPFLLMLFKKLIAPIGGGRIASMMVARATALSCQWLMGPCSVNSVDLPDGSSCTSGV  170

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             + +C++LEE+ C+G+C N CK+P+QTF K  MG+ ++M PNF + SC+  FG  PPS +
Sbjct  171  FVDRCKYLEESKCIGICINTCKLPTQTFFKECMGVSLHMDPNFTDYSCQFNFGNLPPSPA  230

Query  281  HDPAMMQPCYKLC-NSKKKHH  222
             D A+ +PC  +C N+ ++  
Sbjct  231  TDKALQEPCLAICPNASRRRE  251



>gb|KHG05677.1| Chorismate synthase [Gossypium arboreum]
Length=281

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 109/211 (52%), Gaps = 15/211 (7%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAV-------FHNFDSTQQQS-  651
            Y     D   +N     +    G  S K GYDGL+E+ +A+       +H  D+   QS 
Sbjct  58   YKPGNLDHFFLNSFRDKLVKEVGWDSEKPGYDGLIELAKALMMNSRSNYHTKDAAVFQSE  117

Query  650  --LIIQALHKAIPNPILMLMNMVLPQSRIGREYCA---AFTTIFFA-WLVGPCQVKEAEF  489
              L+   + K++  P+L+ +  +L     G +  A   A  T+F   WL+G C+V   + 
Sbjct  118  LFLLPVRILKSLFPPLLLELYKILIAPIDGGKVAAMMVARVTVFTCQWLMGTCKVNSVDL  177

Query  488  -NGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEM  312
             +G    + V +++C++LEE+ CVG+C N CK+P+Q+F K+ MG+P+ M PNF + SC+ 
Sbjct  178  PDGTSCNSGVFVERCKYLEESKCVGICINTCKLPTQSFFKDYMGVPLLMEPNFSDYSCQF  237

Query  311  IFGQDPPSTSHDPAMMQPCYKLCNSKKKHHN  219
             FG  PP    D  + +PC  +C    K H 
Sbjct  238  KFGVSPPLPEDDDTLKEPCLDVCPIANKRHE  268



>ref|XP_007145139.1| hypothetical protein PHAVU_007G213300g [Phaseolus vulgaris]
 gb|ESW17133.1| hypothetical protein PHAVU_007G213300g [Phaseolus vulgaris]
Length=262

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 103/200 (52%), Gaps = 7/200 (4%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALH  630
            Y    FD + +N   + +    G  S + GYDGL+E+  R +     ++      ++ L 
Sbjct  51   YKPGVFDDMFLNLFRNKLVQEVGWDSKEPGYDGLIEVAHRLMMKGTSNSTTVEAAVRVLR  110

Query  629  KAIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  M++      RI     A  T +   WL+GP +V   +  +G    + V
Sbjct  111  SLFPPYLLELYKMLIAPIGGGRIAAMMVARVTVLTCQWLMGPSKVNSVDLPDGTSCSSGV  170

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            ++++CR+LEE+ CVG+CTN CK P+QTF K+ MG+P+ M PNF + SC+  FG  PP   
Sbjct  171  YVERCRYLEESKCVGICTNTCKFPTQTFFKDHMGVPLLMEPNFRDYSCQFKFGVLPP--Q  228

Query  281  HDPAMMQPCYKLCNSKKKHH  222
             D  + +PC + C +  +  
Sbjct  229  DDAILKEPCLEACPNASRRR  248



>ref|XP_009360308.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Pyrus 
x bretschneideri]
Length=223

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 75/130 (58%), Gaps = 15/130 (12%)
 Frame = -2

Query  599  MNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEETNCV  420
            +  + P ++   E+ AA T  FF WLVGP +V+E E NG ++ + VHI+KCR+LE   CV
Sbjct  62   LRKLFPPTKWAAEFNAALTVPFFHWLVGPSKVEELEINGVKQSSGVHIKKCRYLENNGCV  121

Query  419  GMCTNLCKMPSQTFIKNSMGMPVNMVPN---------------FENMSCEMIFGQDPPST  285
            GMC N+CK P+  F  N  G+ + M+PN               FE+ SCEM++G+ PP  
Sbjct  122  GMCVNMCKFPTLDFFTNEFGLSLTMIPNMSDFLWIAVSELAADFEDRSCEMVYGEVPPPF  181

Query  284  SHDPAMMQPC  255
              DP   +PC
Sbjct  182  EEDPVSKKPC  191



>ref|XP_001702558.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06337.1| predicted protein [Chlamydomonas reinhardtii]
Length=280

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 100/183 (55%), Gaps = 9/183 (5%)
 Frame = -2

Query  740  GVRSSKSGYDGLVEITRAV---FHNFDSTQQQSL-IIQALHKA-IPNPILMLMNMVLPQS  576
            G  S  SGYD ++++TR +   F     TQ+ +  I+ AL  + +P    ++ +  LP+ 
Sbjct  85   GSDSKLSGYDAIIDLTRKLNTKFRTAAETQEATRGILNALFPSWLPGAFKVMFSRPLPE-  143

Query  575  RIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRR--EKNVVHIQKCRFLEETNCVGMCTNL  402
                   A  T +   WL+GPC+V + E +G +    + V +++CR+LE+  C  +C N 
Sbjct  144  -FSCRLNALATAMTCQWLMGPCKVNDVEIDGGKVGTGHGVLVERCRYLEQAGCASVCINS  202

Query  401  CKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKKKHH  222
            CK+P+Q+F +  MG+P+ M PN+++ SC+  FG+ P     DPA   PC+  C SK+   
Sbjct  203  CKVPTQSFFEKDMGLPLTMTPNYDDFSCQFSFGKTPDPVDRDPAFATPCFTQCPSKRSRT  262

Query  221  NNC  213
              C
Sbjct  263  PVC  265



>ref|WP_011057777.1| hypothetical protein [Thermosynechococcus elongatus]
 ref|NP_682732.1| hypothetical protein tll1942 [Thermosynechococcus elongatus BP-1]
 dbj|BAC09494.1| tll1942 [Thermosynechococcus elongatus BP-1]
Length=218

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 91/176 (52%), Gaps = 17/176 (10%)
 Frame = -2

Query  797  TWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIP  618
            +W +R  +  L   + +  GV   +  Y G +EITR +       QQQ+++     + IP
Sbjct  23   SWLERWCLARLIRAIASAIGVAPQRWDYVGFIEITRQLQRGRSPAQQQAIVATVFDRLIP  82

Query  617  NPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVG-----------PCQVKEAEFNGRREK  471
              +  L+  +   SR   E+ A F T    WLVG           P Q+ + + +G    
Sbjct  83   PMMSTLIRKLFRPSRWVCEWNAWFATRLTGWLVGASDRYWVEVIPPNQLPQWQHSG----  138

Query  470  NVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFG  303
              V IQKCR+L E+ C+ +C NLCK P++ F +  +G+P+ M PNF++ SCEM+FG
Sbjct  139  --VRIQKCRYLAESQCMALCMNLCKKPTEQFFRQRLGIPLTMTPNFKDYSCEMVFG  192



>gb|KHN16202.1| hypothetical protein glysoja_046728 [Glycine soja]
Length=265

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 105/200 (53%), Gaps = 7/200 (4%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALH  630
            Y    FD L +    + +    G  S K+GYDGL+E+  R +     ++      ++ L 
Sbjct  54   YKPGVFDDLFLKLFRNKLVQEVGWDSKKAGYDGLIEVANRLMMKGTTNSDTVEAAVRILR  113

Query  629  KAIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  M++      +I     A  T +   WL+GPC+V   +  +G    + V
Sbjct  114  SLFPPYLLELYKMLIAPIGGGKIAAMMVARVTVLTCQWLMGPCKVNSVDLPDGTSCSSGV  173

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            ++++C++LEE+ CVG+CT+ CK P+QTF K+ MG+P+ M PNF + SC+  FG  PP   
Sbjct  174  YVERCKYLEESKCVGICTHTCKFPTQTFFKDHMGVPLLMEPNFADYSCQFKFGVLPP--R  231

Query  281  HDPAMMQPCYKLCNSKKKHH  222
             D  + +PC + C + K+  
Sbjct  232  DDTIVKEPCLEACPNAKQRR  251



>ref|XP_008227877.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Prunus 
mume]
Length=264

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 103/195 (53%), Gaps = 5/195 (3%)
 Frame = -2

Query  788  DRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALHKAIPNP  612
            D + +N     +    G  S K GYDGL+E+  R +  +  ++  +   ++ L    P  
Sbjct  57   DEVFLNLFRKKMVEEVGWDSRKPGYDGLIEVANRLMLKSPTNSHTKEAAVRILRSLFPPM  116

Query  611  ILMLMNMVLPQSRIGREYC---AAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKCR  444
            +L L  +++   + G+      A  T I   WL+GPC V   +  +G    + V ++KC+
Sbjct  117  LLQLYKLLIAPIQGGKVAAIMVARVTAITCEWLMGPCTVNSVDLPDGTSWNSGVFVEKCK  176

Query  443  FLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMM  264
            +LE++ CVG+C N CK+P+Q F+K+ MG+P+ M PNF + SC+  FG  PP    D  + 
Sbjct  177  YLEQSKCVGICVNTCKLPTQAFMKDYMGVPLVMEPNFSDYSCQFKFGILPPVPEDDATLK  236

Query  263  QPCYKLCNSKKKHHN  219
            +PC  +C +  +  +
Sbjct  237  EPCLDICPNATRRRD  251



>ref|XP_010267970.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=267

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 102/201 (51%), Gaps = 6/201 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQS-LIIQALH  630
            Y    FD L +    + +    G  S K GYDGL+E+   +  N  S  + +   ++ L 
Sbjct  54   YKPGIFDNLFLALFRNKMVQEVGWDSEKPGYDGLIEVANRLMMNGRSNAETAEAAVRILR  113

Query  629  KAIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  M++      ++     A  T +   WL+G C V   +  +G      V
Sbjct  114  SLFPPFLLELFKMLIAPIDGGKVASMMVARVTALSCQWLMGSCTVNSVDLPDGSSCTTGV  173

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             +++C++LEE+ C+G+C N CK+P+Q F K+ MG+P+ M PNF + SC+  FG  PP  +
Sbjct  174  FVERCKYLEESKCIGICINTCKLPTQAFFKDYMGVPLLMEPNFSDYSCQFKFGVSPPLPT  233

Query  281  HDPAMMQPCYKLC-NSKKKHH  222
             D  + +PC  +C N+ ++  
Sbjct  234  EDKTLKEPCLDICPNATRRRQ  254



>emb|CBJ29265.1| conserved unknown protein [Ectocarpus siliculosus]
Length=199

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 80/157 (51%), Gaps = 11/157 (7%)
 Frame = -2

Query  662  QQQSLIIQALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEA----  495
            +Q+ ++   L    P        M+ P S+   E  A      F WLVG  ++ E     
Sbjct  24   RQREVVRGVLRSVFPAWFPAFYRMLFPPSKFSAEVNAFMCPPLFGWLVGKSELTEGVVDV  83

Query  494  ----EFNGRRE---KNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPN  336
                E  G R+   +N V +++CR+LE + C G C NLCK+P++ F +  +GMP+ M PN
Sbjct  84   KAAKEGEGPRQEVWRNTVKVERCRYLEASKCKGTCMNLCKLPTEAFFREDLGMPLRMTPN  143

Query  335  FENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKKKH  225
            FE++SCE  FGQD      DP M +PC+  C S  K 
Sbjct  144  FEDLSCEFAFGQDALPAEEDPLMREPCWTECLSSDKQ  180



>ref|XP_007051131.1| Uncharacterized protein TCM_004827 [Theobroma cacao]
 gb|EOX95288.1| Uncharacterized protein TCM_004827 [Theobroma cacao]
Length=272

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 106/205 (52%), Gaps = 8/205 (4%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y     D   +N   + +    G  S+K GYDGL+E+ +A+  N  S  +       + K
Sbjct  59   YKPGILDHFFMNSFRNKLVKEVGWDSAKPGYDGLIELAKALMMNSRSNSRTKDAAVRILK  118

Query  626  AIPNPILMLMNMVL----PQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
            ++  P L+ +  +L       ++     A  T +   WL+G   V   +  +G    + V
Sbjct  119  SLFPPFLLELYKILIAPIDGGKVAAVMVARVTVLTCQWLMGTSNVNSVDLPDGTSCNSGV  178

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             +++C++LEE+ CVG+C N CK+P+Q+F K+ MG+P+ M PNF + SC+  FG  PP   
Sbjct  179  FVERCKYLEESKCVGICINTCKLPTQSFFKDCMGVPLVMEPNFSDYSCQFKFGVFPPLPE  238

Query  281  HDPAMMQPCYKLC---NSKKKHHNN  216
            +D A+ +PC  +C   N +++   N
Sbjct  239  NDAALKEPCLDICPIANKRREIQRN  263



>ref|XP_005705238.1| hypothetical protein Gasu_37700 [Galdieria sulphuraria]
 gb|EME28718.1| hypothetical protein Gasu_37700 [Galdieria sulphuraria]
Length=248

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 93/182 (51%), Gaps = 5/182 (3%)
 Frame = -2

Query  779  AINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPI-LM  603
            AI+     ++  TG  S   GYDGLVE  + +       +Q++ + + +      P+ + 
Sbjct  44   AIHLFRKAIERETGRVSKHRGYDGLVEDCKYLQKYRSPVEQRAAVCRIISSLFCAPVGIQ  103

Query  602  LMNMVLPQSRIGREY--CAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQKCRFLEET  429
            L   +L    +   Y   A FT +FF WLVGPCQ      +    K  V I KCRFLEE+
Sbjct  104  LFRSLLGIMPVTWAYHLSAIFTQVFFQWLVGPCQAHA--IHNETFKRGVFISKCRFLEES  161

Query  428  NCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYK  249
             C GMC NLCK+P+Q F  N++G P  M PN+E  SC++ FG+ P     D A+   C  
Sbjct  162  RCRGMCVNLCKIPTQQFFNNTLGFPFTMEPNYETGSCQITFGKSPLPLDQDIAVQIRCSG  221

Query  248  LC  243
             C
Sbjct  222  NC  223



>gb|EYU46818.1| hypothetical protein MIMGU_mgv1a011827mg [Erythranthe guttata]
Length=263

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 97/199 (49%), Gaps = 4/199 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y     D + +N     +    G  S K GYDG+++    +     +++     I+ L  
Sbjct  51   YKPGMIDDIFLNVFRSKMAKENGWDSEKPGYDGIIDAAHRLMRGRSNSEATKASIRVLRS  110

Query  626  AIPNPILMLMNMVL---PQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVH  459
              P  +L L  M++      ++     A  T +   WL+G C V   +  NG    + V 
Sbjct  111  LFPQWLLELYKMLISPVAGGKVASVMVARVTALSCQWLMGKCIVNSVDMPNGSTWTSGVF  170

Query  458  IQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSH  279
            ++KC++LEE+ CVG+C N CK+P+Q F    MG+P+ M PNF + SC+  FG  PP    
Sbjct  171  VEKCKYLEESKCVGVCINTCKLPTQAFFNEYMGVPLVMEPNFIDYSCQFKFGVAPPPPED  230

Query  278  DPAMMQPCYKLCNSKKKHH  222
            D A+ +PC ++C +  +  
Sbjct  231  DTALKEPCLQICPTANRRR  249



>ref|XP_007221575.1| hypothetical protein PRUPE_ppa026536mg [Prunus persica]
 gb|EMJ22774.1| hypothetical protein PRUPE_ppa026536mg [Prunus persica]
Length=245

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 102/195 (52%), Gaps = 5/195 (3%)
 Frame = -2

Query  788  DRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALHKAIPNP  612
            D + +N     +    G  S K GYDGL+E+  R +  +  ++  +   ++ L    P  
Sbjct  38   DEVFLNLFRKKMVEEVGWDSRKPGYDGLIEVANRLMLISPTNSHTKEAAVRILRSLFPPM  97

Query  611  ILMLMNMVLPQSRIGREYC---AAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKCR  444
            +L L  +++   + G+      A  T I   WL+GPC V   +  +G    + V ++KC+
Sbjct  98   LLQLYKLLIAPIQGGKVAAIMVARVTAITCEWLMGPCTVNSVDLPDGTSWNSGVFVEKCK  157

Query  443  FLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMM  264
            +LE++ CVG+C N CK+P+Q F+K+ MG+P+ M PNF + SC+  FG  PP    D  + 
Sbjct  158  YLEQSKCVGICLNTCKLPTQAFMKDYMGVPLVMEPNFSDYSCQFKFGVLPPLPEDDATLK  217

Query  263  QPCYKLCNSKKKHHN  219
            +PC  +C +  +   
Sbjct  218  EPCLDICPNATRRRE  232



>gb|KHN08627.1| hypothetical protein glysoja_024536 [Glycine soja]
Length=264

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 104/201 (52%), Gaps = 7/201 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALH  630
            Y    FD L +N   + +    G  S K GYDGL+E+  R +     +T      ++ L 
Sbjct  53   YKPGVFDDLFLNLFRNKLVQEVGWDSEKPGYDGLIEVANRLMMKGTTNTATVEAAVRILR  112

Query  629  KAIPNPILMLMNMVL---PQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  M++      +I     A  T +   WL+GPC++   +  +G    + V
Sbjct  113  SLFPPYLLELYKMLIVPIGGGKIAAMMVARVTVLTCQWLMGPCKLNSVDLPDGISCSSGV  172

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            ++++C++LEE+ CVG+CTN CK P+Q+F K+ MG+P+ M PNF + SC+  FG  PP   
Sbjct  173  YVERCKYLEESKCVGICTNTCKFPTQSFFKDHMGVPLLMEPNFGDYSCQFKFGVLPP--L  230

Query  281  HDPAMMQPCYKLCNSKKKHHN  219
             D  + +PC + C +  +   
Sbjct  231  DDTIVKEPCLEACPNASQRRT  251



>ref|XP_011042274.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X2 [Populus euphratica]
Length=294

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 116/212 (55%), Gaps = 20/212 (9%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEI-TRAVFHNF--DSTQQQSLIIQA  636
            ++D WF  L  N +   VK V G  S K+GYDGL+E+ +R +      D+T     I+++
Sbjct  60   FYDDWFLALFRNKM---VKEV-GWDSEKAGYDGLIEVASRLMLRRTPSDTTDAAVRILRS  115

Query  635  L--------HKAIPNPIL--MLMNMVLPQSRIGREYC--AAFTTIFFAWLVGPCQVKEAE  492
            L        +K++ +PI    L  +++ +  +   +C  +  T I   WL+G C+V   +
Sbjct  116  LFPPFLLHLYKSLVSPIGGGKLAAIMVGELGVTFHFCFSSRVTVITCQWLMGICKVNSVD  175

Query  491  F-NGRREKNVVHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCE  315
              +G   ++ V +++C++LEE+ CVG+C N CK+P+QTF K+ MG+P+ M PNF + SC+
Sbjct  176  LPDGSSWESGVFVERCKYLEESKCVGICVNTCKLPTQTFFKDYMGIPLLMEPNFNDYSCQ  235

Query  314  MIFGQDPPSTSHDPAMMQPCYKLCNSKKKHHN  219
              FG  PP    D  + +PC + C    K   
Sbjct  236  FKFGVLPPLPEDDGTLKEPCLEACPIASKRRG  267



>ref|XP_010267973.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X5 [Nelumbo nucifera]
Length=253

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 103/196 (53%), Gaps = 7/196 (4%)
 Frame = -2

Query  791  FDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQS-LIIQALHKAIPN  615
            F+ + + +L    + V G  S K GYDGL+E+   +  N  S  + +   ++ L    P 
Sbjct  46   FNVIKMLYLPRATQEV-GWDSEKPGYDGLIEVANRLMMNGRSNAETAEAAVRILRSLFPP  104

Query  614  PILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKC  447
             +L L  M++      ++     A  T +   WL+G C V   +  +G      V +++C
Sbjct  105  FLLELFKMLIAPIDGGKVASMMVARVTALSCQWLMGSCTVNSVDLPDGSSCTTGVFVERC  164

Query  446  RFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAM  267
            ++LEE+ C+G+C N CK+P+Q F K+ MG+P+ M PNF + SC+  FG  PP  + D  +
Sbjct  165  KYLEESKCIGICINTCKLPTQAFFKDYMGVPLLMEPNFSDYSCQFKFGVSPPLPTEDKTL  224

Query  266  MQPCYKLC-NSKKKHH  222
             +PC  +C N+ ++  
Sbjct  225  KEPCLDICPNATRRRQ  240



>ref|XP_001419261.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97554.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=187

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 97/189 (51%), Gaps = 9/189 (5%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSS-----KSGYDGLVEITRAVFHNFDSTQQQSLII  642
            Y D   D LAI+  +  + AV G  +S     K G++ LV +  A+       +Q++ + 
Sbjct  3    YADGALDALAISLFNAKLAAVVGEEASASANEKRGFERLVALADALADGRTVVEQRAAVT  62

Query  641  QALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVV  462
            +AL   IP P+  L   ++  +    E  A  T   FAWLVGPC+V   E +G   +  V
Sbjct  63   RALLSIIPAPVRFLFKKMIKPAPWVDEMNAYITREAFAWLVGPCEVMPRESDGVMAQ--V  120

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             ++KCR+LE++ C   C N CK+P+Q F K + G+   + PN E+ SC M FG  P    
Sbjct  121  KLRKCRYLEQSGCSASCANFCKIPTQRFFKEAFGVDARLDPNHEDGSCVMTFGVKP--DI  178

Query  281  HDPAMMQPC  255
            +D A   PC
Sbjct  179  NDAAFAAPC  187



>ref|NP_001242708.1| uncharacterized protein LOC100788939 [Glycine max]
 gb|ACU24052.1| unknown [Glycine max]
Length=264

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 103/201 (51%), Gaps = 7/201 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALH  630
            Y    FD L +N   + +    G  S K GYDGL+E+  R +     +T      ++ L 
Sbjct  53   YKPGVFDDLFLNLFRNKLVQEVGWDSEKPGYDGLIEVANRLMMKGTTNTATVEAAVRILR  112

Query  629  KAIPNPILMLMNMVL---PQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  M++      +I     A  T +   WL+GPC++   +  +G    + V
Sbjct  113  SLFPPYLLELYKMLIVPIGGGKIAAMMVARVTVLTCQWLMGPCKLNSVDLPDGISCSSGV  172

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
            ++++C++LEE+ CVG+CTN CK P+Q+F K+ MG+P+ M PNF + SC+  FG  PP   
Sbjct  173  YVERCKYLEESKCVGICTNTCKFPTQSFFKDHMGVPLLMEPNFGDYSCQFKFGVLPP--L  230

Query  281  HDPAMMQPCYKLCNSKKKHHN  219
             D  +  PC + C +  +   
Sbjct  231  DDTIVKDPCLEACPNASQRRT  251



>ref|XP_010087223.1| hypothetical protein L484_009732 [Morus notabilis]
 gb|EXB28573.1| hypothetical protein L484_009732 [Morus notabilis]
Length=273

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 101/193 (52%), Gaps = 5/193 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITR-AVFHNFDSTQQQSLIIQALH  630
            Y    FD L +N     +    G  S K+GY GL+E+    V  +  ++      ++ L 
Sbjct  59   YKPGVFDDLFLNLFRDKMVQEVGWDSDKAGYGGLIEVANHLVMKSKSNSNTTEAAVRILR  118

Query  629  KAIPNPILMLMNMV---LPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  M+   L   ++     A  T +   WL+G C V   +  +G    + V
Sbjct  119  SLFPPWLLELYKMLVAPLAGGKVAAVMVARVTALTCQWLMGRCTVNSVDLPDGTSCASGV  178

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             ++KC++LEE+ CVG+C N C++P+Q+F K+ MG+P+ M PNF + SC+  FG +PP   
Sbjct  179  FVEKCKYLEESKCVGICINTCRLPTQSFFKDYMGVPLLMEPNFTDYSCQFKFGVNPPLPQ  238

Query  281  HDPAMMQPCYKLC  243
            +D  + +PC ++C
Sbjct  239  YDAILKEPCLEIC  251



>ref|XP_010267972.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X4 [Nelumbo nucifera]
Length=260

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 95/179 (53%), Gaps = 6/179 (3%)
 Frame = -2

Query  740  GVRSSKSGYDGLVEITRAVFHNFDSTQQQS-LIIQALHKAIPNPILMLMNMVLP---QSR  573
            G  S K GYDGL+E+   +  N  S  + +   ++ L    P  +L L  M++      +
Sbjct  69   GWDSEKPGYDGLIEVANRLMMNGRSNAETAEAAVRILRSLFPPFLLELFKMLIAPIDGGK  128

Query  572  IGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKCRFLEETNCVGMCTNLCK  396
            +     A  T +   WL+G C V   +  +G      V +++C++LEE+ C+G+C N CK
Sbjct  129  VASMMVARVTALSCQWLMGSCTVNSVDLPDGSSCTTGVFVERCKYLEESKCIGICINTCK  188

Query  395  MPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLC-NSKKKHH  222
            +P+Q F K+ MG+P+ M PNF + SC+  FG  PP  + D  + +PC  +C N+ ++  
Sbjct  189  LPTQAFFKDYMGVPLLMEPNFSDYSCQFKFGVSPPLPTEDKTLKEPCLDICPNATRRRQ  247



>ref|XP_010267969.1| PREDICTED: beta-carotene isomerase D27, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=323

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 104/200 (52%), Gaps = 7/200 (4%)
 Frame = -2

Query  803  HDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQS-LIIQALHK  627
            H   F+ + + +L    + V G  S K GYDGL+E+   +  N  S  + +   ++ L  
Sbjct  112  HVGPFNVIKMLYLPRATQEV-GWDSEKPGYDGLIEVANRLMMNGRSNAETAEAAVRILRS  170

Query  626  AIPNPILMLMNMVLP---QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVH  459
              P  +L L  M++      ++     A  T +   WL+G C V   +  +G      V 
Sbjct  171  LFPPFLLELFKMLIAPIDGGKVASMMVARVTALSCQWLMGSCTVNSVDLPDGSSCTTGVF  230

Query  458  IQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSH  279
            +++C++LEE+ C+G+C N CK+P+Q F K+ MG+P+ M PNF + SC+  FG  PP  + 
Sbjct  231  VERCKYLEESKCIGICINTCKLPTQAFFKDYMGVPLLMEPNFSDYSCQFKFGVSPPLPTE  290

Query  278  DPAMMQPCYKLC-NSKKKHH  222
            D  + +PC  +C N+ ++  
Sbjct  291  DKTLKEPCLDICPNATRRRQ  310



>gb|KDO86967.1| hypothetical protein CISIN_1g047235mg [Citrus sinensis]
Length=276

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 106/202 (52%), Gaps = 8/202 (4%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQ--QQSLIIQAL  633
            Y     D L ++   + +    G+ S K GYDGL+E+   +     S+   + +  I+ L
Sbjct  62   YKPGVLDDLFLSSFRNKLVQEVGLDSEKPGYDGLIELVNHLMMKGKSSSDARDAAQIRIL  121

Query  632  HKAIPNPILMLMNMV---LPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNV  465
                P  +L L  ++   L   +I     A  T +   WL+G C V   +  +G   ++ 
Sbjct  122  VSLFPPLVLKLYKILISPLAGGKIAAMMVARVTALTCQWLMGHCTVNSVDLPDGTSCQSG  181

Query  464  VHIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPST  285
            V +++C++LEE+ CVG+C N CK+P+QTF K+ MG+P+ M PNF + SC+  FG  PP  
Sbjct  182  VFVERCKYLEESKCVGVCINTCKLPTQTFFKDYMGVPLLMEPNFSDYSCQFKFGILPPLP  241

Query  284  SHDPAMMQPCYKLC--NSKKKH  225
              D  + +PC  +C  +S++K 
Sbjct  242  KDDTTLKEPCLDICPTSSRRKE  263



>emb|CDP17059.1| unnamed protein product [Coffea canephora]
Length=283

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 95/172 (55%), Gaps = 5/172 (3%)
 Frame = -2

Query  743  TGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHKAIPNPILMLMNMV---LPQSR  573
            TG  S K GYDGL+E+   +     +++     ++ L    P  +L L  ++   L Q +
Sbjct  87   TGWESEKPGYDGLIEVANHLTIGRSNSETIQASVRILRSLFPPLLLELYRILVAPLAQGK  146

Query  572  IGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKCRFLEETNCVGMCTNLCK  396
            +     A  T +   WL+G CQV      +G    + V +++C++LEE+ CVG+C N CK
Sbjct  147  VAAAMIARVTALSCTWLMGQCQVNSVPLPDGSSFMSGVFVERCKYLEESKCVGVCINTCK  206

Query  395  MPSQTFIKNSMGMPVNMVPNFENMSCEMIFG-QDPPSTSHDPAMMQPCYKLC  243
            +P+QTF ++ +G+P+ M PNF + SC+  FG   PP    D A+ +PC ++C
Sbjct  207  LPTQTFFRDYVGVPLLMEPNFTDYSCQFKFGVAPPPPPERDIALTEPCLEIC  258



>ref|XP_010231820.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Brachypodium 
distachyon]
Length=268

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 101/201 (50%), Gaps = 5/201 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVF----HNFDSTQQQSLIIQ  639
            Y  ++ D L +      +    G  S K GYDGL+E+   +        ++ Q    +++
Sbjct  54   YRPSFADDLLLAFFRAKMVEEVGWDSQKPGYDGLIEVANRLMIKGKSALETEQSAVRVLR  113

Query  638  ALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
            AL   +   +   +   L   ++     A  T +   WL+G C V      +GR   + V
Sbjct  114  ALFPPLLLVLFKALLAPLANGQLASLMVARATALSCQWLMGTCSVNSVTLPDGRSLSSGV  173

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             ++KC++LEE+ C+G+C N CK+P+QTF K+ MG+ + M PNFE+ SC+  FG  PP   
Sbjct  174  FVEKCKYLEESKCLGICINTCKLPTQTFFKDHMGVDLYMEPNFEDYSCQFNFGVPPPPLD  233

Query  281  HDPAMMQPCYKLCNSKKKHHN  219
             D A+ +PC  +C + ++   
Sbjct  234  IDKALKEPCLDICTNARRRRE  254



>ref|XP_008667720.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=219

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 76/118 (64%), Gaps = 1/118 (1%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQQSLIIQALHK  627
            Y D WFD+LAI +LS  ++  +G+++ K GY+GL+E   A+   F   QQ   +  AL +
Sbjct  64   YRDNWFDKLAIGYLSRNLQEASGMKNGKDGYEGLIEAALAISALFRVDQQWDTVASALQR  123

Query  626  AIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEFNGRREKNVVHIQ  453
            A P+ IL ++ +++P SR  REY AAFTT+FF WLVGPC+   + + GR E+  +H Q
Sbjct  124  AFPSYILTMIKVMMPPSRFSREYFAAFTTVFFPWLVGPCEGIPSGWKGREERG-LHTQ  180



>ref|XP_002986676.1| hypothetical protein SELMODRAFT_47788, partial [Selaginella moellendorffii]
 gb|EFJ12239.1| hypothetical protein SELMODRAFT_47788, partial [Selaginella moellendorffii]
Length=208

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 102/191 (53%), Gaps = 9/191 (5%)
 Frame = -2

Query  800  DTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVFHNFDSTQQ-QSLIIQALHKA  624
            D  F  L  N L+  V    G  + + GYDGL+++++ +   + +    +   ++ L+  
Sbjct  8    DAAFLSLLRNKLAQEV----GRDADRPGYDGLIQLSQLLMAKYKAKSDVEQATVRILNSM  63

Query  623  IPNPILMLMN-MVLP--QSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHI  456
             P  +L L   +VLP  + ++     A  T     WL+G C +   E  +G    + V +
Sbjct  64   FPQSLLRLFRAVVLPINKGKLAAILSARVTQATCQWLMGTCSISSVELSDGTSIPSGVLV  123

Query  455  QKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHD  276
            +KC++LE + C G+C + CK+P+Q FI   +G+P+ M PNF ++SC+  FG + PS   D
Sbjct  124  EKCKYLEHSKCAGICIHTCKLPTQAFISKELGVPLLMEPNFADLSCQFKFGVEAPSPEDD  183

Query  275  PAMMQPCYKLC  243
            P++  PC ++C
Sbjct  184  PSVSTPCLEMC  194



>ref|XP_006840469.1| hypothetical protein AMTR_s00045p00181910 [Amborella trichopoda]
 gb|ERN02144.1| hypothetical protein AMTR_s00045p00181910 [Amborella trichopoda]
Length=268

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 97/182 (53%), Gaps = 8/182 (4%)
 Frame = -2

Query  740  GVRSSKSGYDGLVEITRAVFHNF-DSTQQQSLIIQALHKAIPNPILMLMNMVLP---QSR  573
            G  S K GYDGL+E+ R +  N  ++ Q +  +++ L    P  +L L  +++      +
Sbjct  74   GWDSEKPGYDGLIEVARRIMRNGQNNVQVKQSVVRILRSLFPPFLLELFQLLIAPIAGGK  133

Query  572  IGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKCRFLEETNCVGMCTNLCK  396
            +     A  TT+   WL+G C +   E  +G    + V +++C++LEE+ C G+C N CK
Sbjct  134  LAAMMIARVTTLTCQWLMGRCTINSIELPDGSSCSSGVLVERCKYLEESRCAGICINTCK  193

Query  395  MPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLC---NSKKKH  225
            +P+QTFIK  MG P+ M PN  + SC+  FG   P   +D  +  PC  +C   + +K+ 
Sbjct  194  LPTQTFIKEYMGTPLLMEPNLSDYSCQFKFGVPAPPPENDEVLKAPCLDICPEASGQKRR  253

Query  224  HN  219
             N
Sbjct  254  KN  255



>ref|XP_008381421.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Malus 
domestica]
Length=269

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 104/195 (53%), Gaps = 6/195 (3%)
 Frame = -2

Query  788  DRLAINHLSHCVKAVTGVRSSKSGYDGLVEIT-RAVFHNFDSTQQQSLIIQALHKAIPNP  612
            D L +      + A  G  S K GYDGL+++  R +  +  ++  +   ++ L    P  
Sbjct  62   DELFLKVFRSKMAAEVGWDSEKPGYDGLIDVANRLMLKSPTNSHAKEAAVRILRSLFPPL  121

Query  611  ILMLMNMV---LPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKCR  444
            +L L  ++   L   ++     A  T I   WL+GPC V   +  +G    + V ++KC+
Sbjct  122  LLDLYKLLVAPLQGGKVAAIMVARVTAITCQWLMGPCTVNSVDLPDGTSWNSGVFVEKCK  181

Query  443  FLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMM  264
            +LEE+ CVG+C N CK+P+Q FIK+ MG+P+ M PNF + SC+  FG  PP    D  + 
Sbjct  182  YLEESKCVGICLNTCKLPTQAFIKDYMGVPLVMEPNFVDYSCQFKFGVLPPLPEDDATLK  241

Query  263  QPCYKLC-NSKKKHH  222
            +PC ++C N+ ++  
Sbjct  242  EPCLEICPNATRRRE  256



>ref|XP_004135988.1| PREDICTED: uncharacterized protein LOC101220175 [Cucumis sativus]
 gb|KGN45022.1| hypothetical protein Csa_7G407750 [Cucumis sativus]
Length=267

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 101/201 (50%), Gaps = 5/201 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEI-TRAVFHNFDSTQQQSLIIQALH  630
            Y     D   +N     +    G  S K GYDGL+E+ +R       +++     ++ L 
Sbjct  54   YKPGILDDFFLNVFRSKMVQEVGWDSEKPGYDGLIEVASRLTMTGKTNSETIEASVRILI  113

Query  629  KAIPNPILMLMNMV---LPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  ++   +   ++     A  T +   WL+G C V   E  +G   ++ V
Sbjct  114  ALFPPLLLKLYRILVSPIAGGKVAAIMVARVTALTCQWLMGTCTVNSIELPDGSSCQSGV  173

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             ++KC++LEE+ C+G+C N CK+P+Q+F K+ MG+P+ M PNF + SC+  FG  PP   
Sbjct  174  FVEKCKYLEESKCIGICINTCKLPTQSFFKDQMGIPLLMEPNFTDYSCQFKFGVLPPLPE  233

Query  281  HDPAMMQPCYKLCNSKKKHHN  219
             D  + +PC ++C +  +   
Sbjct  234  EDSILKEPCLEICPNATRRRE  254



>ref|XP_004163139.1| PREDICTED: uncharacterized LOC101220175 [Cucumis sativus]
Length=267

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 103/201 (51%), Gaps = 6/201 (3%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEI-TRAVFHNFDSTQQQSLIIQALH  630
            Y     D   +N     +    G  S K GYDGL+E+ +R       +++     ++ L 
Sbjct  54   YKPGILDDFFLNVFRSKMVQEVGWDSEKPGYDGLIEVASRLTMTGKTNSETIEASVRILI  113

Query  629  KAIPNPILMLMNMV---LPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
               P  +L L  ++   +   ++     A  T +   WL+G C V   E  +G   ++ V
Sbjct  114  ALFPPLLLKLYRILVSPIAGGKVAAIMVARVTALTCQWLMGTCTVNSIELPDGSSCQSGV  173

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             ++KC++LEE+ C+G+C N CK+P+Q+F K+ MG+P+ M PNF + SC+  FG  PP   
Sbjct  174  FVEKCKYLEESKCIGICINTCKLPTQSFFKDQMGIPLLMEPNFTDYSCQFKFGVLPPLPE  233

Query  281  HDPAMMQPCYKLC-NSKKKHH  222
             D  + +PC ++C N+ ++  
Sbjct  234  EDSILKEPCLEICPNATRRRE  254



>ref|XP_010456098.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Camelina 
sativa]
Length=261

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 99/178 (56%), Gaps = 7/178 (4%)
 Frame = -2

Query  740  GVRSSKSGYDGLVEITRAVFHNFDSTQQQS-LIIQALHKAIPNPILMLMNMVLP---QSR  573
            G  S + GY GL+E+ + +F    +  + S   ++ L    P  IL L  +++    Q +
Sbjct  77   GSDSEEPGYVGLIELVKLLFLKGRTRSETSDAAVRILKSLFPPLILELYKLLIAPIAQGK  136

Query  572  IGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVVHIQKCRFLEETNCVGMCTNLCK  396
            +     A  T +   WL+GP +V   +  NG    + V ++KC++LEE+ CVG+C N CK
Sbjct  137  LAALMVARVTVLTCQWLMGPSKVNIIDLPNGESWDSGVFVEKCQYLEESKCVGVCINTCK  196

Query  395  MPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTSHDPAMMQPCYKLCNSKKKHH  222
            +P+QTF K+ MG+P+ M PNF++ SC+  FG  PP    D  + +PC++ C+  ++  
Sbjct  197  LPTQTFFKDYMGVPLVMEPNFKDYSCQFKFGVAPP--EDDGNVNEPCFETCSIARRRK  252



>ref|XP_008661817.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN37079.1| unknown [Zea mays]
 gb|AFW57470.1| hypothetical protein ZEAMMB73_233894 [Zea mays]
Length=277

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 100/201 (50%), Gaps = 5/201 (2%)
 Frame = -2

Query  806  YHDTWFDRLAINHLSHCVKAVTGVRSSKSGYDGLVEITRAVF----HNFDSTQQQSLIIQ  639
            Y  ++ D L +      +    G  S K GY GL+E+   +        ++ Q    ++Q
Sbjct  62   YRPSFADDLLLAFFRSKMVKEVGWDSEKPGYAGLMEVANRLMVKGKSALETEQAAVRVLQ  121

Query  638  ALHKAIPNPILMLMNMVLPQSRIGREYCAAFTTIFFAWLVGPCQVKEAEF-NGRREKNVV  462
            +L   +   +   +   +   ++     A  T I   WL+G C V      +G+   + V
Sbjct  122  SLFPPLLLVLYKALLAPIANGQLAAMMLARATAISCQWLMGSCSVNSVTLPDGKSWSSGV  181

Query  461  HIQKCRFLEETNCVGMCTNLCKMPSQTFIKNSMGMPVNMVPNFENMSCEMIFGQDPPSTS  282
             ++KC++LEE+ C+G+C N CK+P+QTF K+ MG+ + M PNFE+ SC+  FG  PP   
Sbjct  182  FVEKCKYLEESKCLGICINTCKLPTQTFFKDHMGVDLYMEPNFEDYSCQFNFGVPPPPLD  241

Query  281  HDPAMMQPCYKLCNSKKKHHN  219
             D A+ +PC  +C + ++   
Sbjct  242  TDKALKEPCLDICTNARRRRE  262



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2369537585113