BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c42506_g1_i1 len=103 path=[81:0-102]

Length=103
                                                                      Score     E

emb|CDP14600.1|  unnamed protein product                              48.5    2e-05   
emb|CDP14601.1|  unnamed protein product                              46.2    9e-05   
ref|XP_011099650.1|  PREDICTED: germin-like protein subfamily 1 m...  45.1    3e-04   
gb|EYU40849.1|  hypothetical protein MIMGU_mgv1a021360mg              45.1    3e-04   
gb|EYU24191.1|  hypothetical protein MIMGU_mgv1a025114mg              43.9    3e-04   
gb|EMS52045.1|  Germin-like protein 12-2                              44.7    4e-04   
gb|EMT01744.1|  Germin-like protein 8-5                               44.7    4e-04   
ref|XP_009786133.1|  PREDICTED: germin-like protein subfamily 1 m...  43.1    5e-04   
gb|ABR92335.1|  putative germin-like protein                          44.3    5e-04   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010234322.1|  PREDICTED: germin-like protein 8-8               44.3    5e-04   
gb|EYU20537.1|  hypothetical protein MIMGU_mgv1a013077mg              43.9    8e-04   



>emb|CDP14600.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +2

Query  2   AAVFVNGMVCKNPKFVTADDFYIAAGLNTPAG  97
           AAVFVNG +CKNPK VT DDF +A+G NTPA 
Sbjct  41  AAVFVNGKICKNPKLVTTDDF-VASGFNTPAS  71



>emb|CDP14601.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 46.2 bits (108),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 1/31 (3%)
 Frame = +2

Query  2   AAVFVNGMVCKNPKFVTADDFYIAAGLNTPA  94
           AAVFVNG +CKNPK VT DDF +A G NTPA
Sbjct  41  AAVFVNGKICKNPKQVTTDDF-LATGFNTPA  70



>ref|XP_011099650.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=231

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 1/30 (3%)
 Frame = +2

Query  2   AAVFVNGMVCKNPKFVTADDFYIAAGLNTP  91
           AAVFVNG +CK+PK VT+DDF+I +GLN P
Sbjct  42  AAVFVNGKICKDPKTVTSDDFFI-SGLNKP  70



>gb|EYU40849.1| hypothetical protein MIMGU_mgv1a021360mg [Erythranthe guttata]
Length=230

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 1/30 (3%)
 Frame = +2

Query  2   AAVFVNGMVCKNPKFVTADDFYIAAGLNTP  91
           AAVFVNG +CK+PK VT+DDFY  +GLN P
Sbjct  40  AAVFVNGKICKDPKTVTSDDFY-HSGLNKP  68



>gb|EYU24191.1| hypothetical protein MIMGU_mgv1a025114mg [Erythranthe guttata]
Length=156

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 1/29 (3%)
 Frame = +2

Query  5   AVFVNGMVCKNPKFVTADDFYIAAGLNTP  91
           AVFVNG +CK+PK VT+DDFY  +GLN P
Sbjct  2   AVFVNGKICKDPKTVTSDDFY-HSGLNKP  29



>gb|EMS52045.1| Germin-like protein 12-2 [Triticum urartu]
Length=226

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  2   AAVFVNGMVCKNPKFVTADDFYIAAGLNTP  91
           + VFVNG VCK+PK VTA+DF++AA L+ P
Sbjct  38  SRVFVNGFVCKDPKEVTAEDFFLAAKLDMP  67



>gb|EMT01744.1| Germin-like protein 8-5 [Aegilops tauschii]
Length=226

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  2   AAVFVNGMVCKNPKFVTADDFYIAAGLNTP  91
           + VFVNG VCK+PK VTA+DF++AA L+ P
Sbjct  38  SHVFVNGFVCKDPKEVTAEDFFLAAKLDMP  67



>ref|XP_009786133.1| PREDICTED: germin-like protein subfamily 1 member 14 [Nicotiana 
sylvestris]
Length=139

 Score = 43.1 bits (100),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 1/30 (3%)
 Frame = +2

Query  2   AAVFVNGMVCKNPKFVTADDFYIAAGLNTP  91
           AAVFVNG +CK+PK V ADDF+  +GLN P
Sbjct  40  AAVFVNGKICKDPKVVNADDFF-KSGLNIP  68



>gb|ABR92335.1| putative germin-like protein [Salvia miltiorrhiza]
Length=235

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  2   AAVFVNGMVCKNPKFVTADDFYIAAGLN  85
           AAVFVNG +CK+PK VTADD Y A  LN
Sbjct  43  AAVFVNGKICKDPKSVTADDLYYAGALN  70



>ref|XP_010234322.1| PREDICTED: germin-like protein 8-8 [Brachypodium distachyon]
Length=224

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  2   AAVFVNGMVCKNPKFVTADDFYIAAGLNTP  91
           + VFVNG+VCK+PK VTADDF+ AA L+ P
Sbjct  38  SRVFVNGVVCKDPKDVTADDFFKAAELDKP  67



>gb|EYU20537.1| hypothetical protein MIMGU_mgv1a013077mg [Erythranthe guttata]
Length=231

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%)
 Frame = +2

Query  2   AAVFVNGMVCKNPKFVTADDFYIAAGLNTP  91
           AAV VNG +CK+PK VTADDFY  +GLN P
Sbjct  42  AAVLVNGKICKDPKTVTADDFY-HSGLNKP  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527207176184