BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4243_g1_i2 len=1060 path=[1296:0-781 130:782-1059]

Length=1060
                                                                      Score     E

emb|CDP12252.1|  unnamed protein product                                392   1e-133   
ref|XP_009589194.1|  PREDICTED: soluble inorganic pyrophosphatase...    390   4e-133   
ref|XP_009589193.1|  PREDICTED: soluble inorganic pyrophosphatase...    391   5e-133   
ref|XP_011070408.1|  PREDICTED: soluble inorganic pyrophosphatase       390   6e-133   
ref|XP_009774482.1|  PREDICTED: soluble inorganic pyrophosphatase       389   1e-132   
ref|XP_009803138.1|  PREDICTED: soluble inorganic pyrophosphatase...    389   2e-132   
gb|EYU19444.1|  hypothetical protein MIMGU_mgv1a011868mg                391   2e-132   
ref|XP_010930985.1|  PREDICTED: soluble inorganic pyrophosphatase...    388   5e-132   
ref|XP_009408297.1|  PREDICTED: soluble inorganic pyrophosphatase       387   8e-132   
ref|XP_009599170.1|  PREDICTED: soluble inorganic pyrophosphatase...    387   9e-132   
ref|XP_009405328.1|  PREDICTED: soluble inorganic pyrophosphatase...    387   9e-132   
ref|XP_008781407.1|  PREDICTED: soluble inorganic pyrophosphatase...    386   3e-131   
ref|XP_002268289.1|  PREDICTED: soluble inorganic pyrophosphatase       386   4e-131   Vitis vinifera
ref|XP_009617144.1|  PREDICTED: soluble inorganic pyrophosphatase...    385   4e-131   
ref|XP_008459809.1|  PREDICTED: soluble inorganic pyrophosphatase       385   5e-131   
ref|XP_010542812.1|  PREDICTED: soluble inorganic pyrophosphatase       385   5e-131   
ref|XP_006352220.1|  PREDICTED: soluble inorganic pyrophosphatase...    385   5e-131   
sp|Q43187.1|IPYR_SOLTU  RecName: Full=Soluble inorganic pyrophosp...    385   7e-131   Solanum tuberosum [potatoes]
ref|XP_006360727.1|  PREDICTED: soluble inorganic pyrophosphatase...    384   1e-130   
ref|XP_004252616.1|  PREDICTED: soluble inorganic pyrophosphatase       384   1e-130   
ref|XP_009758552.1|  PREDICTED: soluble inorganic pyrophosphatase...    384   2e-130   
ref|XP_006491395.1|  PREDICTED: soluble inorganic pyrophosphatase...    384   2e-130   
ref|XP_006444701.1|  hypothetical protein CICLE_v10022171mg             384   2e-130   
ref|XP_004140526.1|  PREDICTED: soluble inorganic pyrophosphatase...    384   3e-130   
ref|NP_001274958.1|  soluble inorganic pyrophosphatase                  383   4e-130   
ref|XP_006386667.1|  hypothetical protein POPTR_0002s18230g             383   6e-130   
gb|AAD46520.1|AF149116_1  soluble inorganic pyrophosphatase             382   6e-130   Populus tremula x Populus tremuloides
ref|XP_011025347.1|  PREDICTED: soluble inorganic pyrophosphatase       382   9e-130   
ref|XP_004245439.1|  PREDICTED: soluble inorganic pyrophosphatase...    382   9e-130   
ref|XP_002320239.1|  inorganic pyrophosphatase family protein           382   1e-129   Populus trichocarpa [western balsam poplar]
ref|NP_001140260.1|  soluble inorganic pyrophosphatase                  382   2e-129   Zea mays [maize]
ref|XP_011039516.1|  PREDICTED: soluble inorganic pyrophosphatase...    382   3e-129   
ref|XP_010522877.1|  PREDICTED: soluble inorganic pyrophosphatase       380   5e-129   
ref|XP_002439868.1|  hypothetical protein SORBIDRAFT_09g021610          381   5e-129   Sorghum bicolor [broomcorn]
ref|XP_007051388.1|  Pyrophosphorylase 1                                380   6e-129   
ref|XP_006305610.1|  hypothetical protein CARUB_v10010288mg             380   8e-129   
ref|XP_006418370.1|  hypothetical protein EUTSA_v10008767mg             380   8e-129   
ref|XP_009393406.1|  PREDICTED: soluble inorganic pyrophosphatase...    379   9e-129   
ref|XP_006444700.1|  hypothetical protein CICLE_v10024641mg             381   1e-128   
gb|EPS64301.1|  hypothetical protein M569_10470                         379   1e-128   
ref|XP_010241055.1|  PREDICTED: soluble inorganic pyrophosphatase       379   2e-128   
gb|KDP28400.1|  hypothetical protein JCGZ_14171                         379   2e-128   
ref|NP_171613.1|  pyrophosphorylase 1                                   379   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010251694.1|  PREDICTED: soluble inorganic pyrophosphatase...    379   2e-128   
ref|XP_009118787.1|  PREDICTED: soluble inorganic pyrophosphatase       378   3e-128   
ref|XP_011081347.1|  PREDICTED: soluble inorganic pyrophosphatase...    378   3e-128   
ref|XP_008347191.1|  PREDICTED: soluble inorganic pyrophosphatase       378   3e-128   
ref|XP_003637867.1|  Soluble inorganic pyrophosphatase                  379   3e-128   
ref|XP_009402629.1|  PREDICTED: soluble inorganic pyrophosphatase...    378   4e-128   
ref|XP_010054965.1|  PREDICTED: soluble inorganic pyrophosphatase       377   5e-128   
ref|XP_009119663.1|  PREDICTED: soluble inorganic pyrophosphatase       377   5e-128   
emb|CDY15206.1|  BnaC05g00850D                                          377   6e-128   
gb|AFK34361.1|  unknown                                                 377   6e-128   
ref|XP_006396349.1|  hypothetical protein EUTSA_v10028951mg             377   1e-127   
ref|XP_002880270.1|  hypothetical protein ARALYDRAFT_483853             377   1e-127   
ref|XP_004961950.1|  PREDICTED: soluble inorganic pyrophosphatase...    377   1e-127   
emb|CDY55328.1|  BnaC08g49780D                                          376   1e-127   
ref|XP_004244731.1|  PREDICTED: soluble inorganic pyrophosphatase...    376   1e-127   
ref|XP_008244192.1|  PREDICTED: soluble inorganic pyrophosphatase       376   2e-127   
ref|NP_001104889.1|  soluble inorganic pyrophosphatase                  376   2e-127   Zea mays [maize]
emb|CAJ44303.1|  soluble inorganic pyrophosphatase                      376   2e-127   Papaver rhoeas [field poppy]
ref|XP_009411932.1|  PREDICTED: soluble inorganic pyrophosphatase...    376   3e-127   
ref|NP_001149146.1|  soluble inorganic pyrophosphatase                  376   3e-127   Zea mays [maize]
ref|XP_006397877.1|  hypothetical protein EUTSA_v10001628mg             376   3e-127   
ref|XP_009111378.1|  PREDICTED: soluble inorganic pyrophosphatase       375   4e-127   
ref|XP_010523845.1|  PREDICTED: soluble inorganic pyrophosphatase       375   4e-127   
ref|XP_008806026.1|  PREDICTED: soluble inorganic pyrophosphatase...    375   4e-127   
ref|XP_004306605.1|  PREDICTED: soluble inorganic pyrophosphatase...    375   4e-127   
ref|XP_009128516.1|  PREDICTED: soluble inorganic pyrophosphatase...    375   7e-127   
ref|XP_010507961.1|  PREDICTED: soluble inorganic pyrophosphatase       375   8e-127   
ref|XP_010506700.1|  PREDICTED: soluble inorganic pyrophosphatase...    375   1e-126   
ref|NP_182209.1|  pyrophosphorylase 3                                   374   1e-126   Arabidopsis thaliana [mouse-ear cress]
gb|KHN15869.1|  Soluble inorganic pyrophosphatase                       374   1e-126   
ref|XP_006837931.1|  hypothetical protein AMTR_s00102p00015990          374   1e-126   
emb|CDY07141.1|  BnaCnng01560D                                          374   1e-126   
ref|XP_007135336.1|  hypothetical protein PHAVU_010G120800g             374   1e-126   
gb|KHN06380.1|  Soluble inorganic pyrophosphatase                       374   1e-126   
ref|XP_009335259.1|  PREDICTED: soluble inorganic pyrophosphatase...    374   2e-126   
ref|XP_010480706.1|  PREDICTED: soluble inorganic pyrophosphatase...    374   2e-126   
ref|XP_008358654.1|  PREDICTED: soluble inorganic pyrophosphatase...    374   2e-126   
ref|XP_010480711.1|  PREDICTED: soluble inorganic pyrophosphatase...    374   2e-126   
ref|NP_001054331.1|  Os04g0687100                                       374   2e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010474689.1|  PREDICTED: soluble inorganic pyrophosphatase...    376   3e-126   
dbj|BAI52729.1|  inorganic pyrophosphatase                              373   3e-126   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_007218404.1|  hypothetical protein PRUPE_ppa011444mg             373   3e-126   
ref|XP_002515096.1|  inorganic pyrophosphatase, putative                374   4e-126   Ricinus communis
ref|XP_006858361.1|  hypothetical protein AMTR_s00064p00191050          373   4e-126   
ref|XP_006653062.1|  PREDICTED: soluble inorganic pyrophosphatase...    373   4e-126   
dbj|BAC42722.1|  putative inorganic pyrophosphatase                     373   4e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008244194.1|  PREDICTED: soluble inorganic pyrophosphatase...    372   6e-126   
ref|XP_009366582.1|  PREDICTED: soluble inorganic pyrophosphatase...    372   6e-126   
ref|XP_009404613.1|  PREDICTED: soluble inorganic pyrophosphatase...    372   9e-126   
ref|XP_004959983.1|  PREDICTED: soluble inorganic pyrophosphatase...    372   1e-125   
gb|KEH18552.1|  soluble inorganic pyrophosphatase                       374   1e-125   
ref|XP_010107131.1|  Soluble inorganic pyrophosphatase                  372   1e-125   
gb|EMS59074.1|  Soluble inorganic pyrophosphatase                       372   1e-125   
ref|XP_006443220.1|  hypothetical protein CICLE_v10024501mg             372   1e-125   
gb|ACU15420.1|  unknown                                                 371   3e-125   Glycine max [soybeans]
dbj|BAJ96280.1|  predicted protein                                      371   3e-125   
ref|XP_004510613.1|  PREDICTED: soluble inorganic pyrophosphatase...    370   3e-125   
ref|XP_009142458.1|  PREDICTED: soluble inorganic pyrophosphatase...    370   3e-125   
ref|XP_010253277.1|  PREDICTED: soluble inorganic pyrophosphatase...    370   3e-125   
gb|AFK43659.1|  unknown                                                 370   4e-125   
ref|XP_010054143.1|  PREDICTED: soluble inorganic pyrophosphatase       371   4e-125   
ref|XP_010260077.1|  PREDICTED: soluble inorganic pyrophosphatase...    370   5e-125   
ref|XP_006288631.1|  hypothetical protein CARUB_v10001934mg             370   5e-125   
ref|XP_006654463.1|  PREDICTED: soluble inorganic pyrophosphatase...    370   5e-125   
gb|KHN48994.1|  Soluble inorganic pyrophosphatase                       370   6e-125   
ref|XP_010260078.1|  PREDICTED: soluble inorganic pyrophosphatase...    370   6e-125   
ref|XP_010428363.1|  PREDICTED: soluble inorganic pyrophosphatase...    370   7e-125   
ref|XP_010422714.1|  PREDICTED: soluble inorganic pyrophosphatase...    370   7e-125   
ref|XP_003580869.1|  PREDICTED: soluble inorganic pyrophosphatase       370   7e-125   
ref|XP_010917066.1|  PREDICTED: soluble inorganic pyrophosphatase...    369   8e-125   
ref|XP_007139040.1|  hypothetical protein PHAVU_009G259900g             369   1e-124   
ref|XP_010456152.1|  PREDICTED: soluble inorganic pyrophosphatase...    369   1e-124   
ref|XP_009405327.1|  PREDICTED: soluble inorganic pyrophosphatase...    370   1e-124   
ref|XP_010325308.1|  PREDICTED: soluble inorganic pyrophosphatase...    370   1e-124   
ref|XP_004970701.1|  PREDICTED: soluble inorganic pyrophosphatase...    369   2e-124   
ref|XP_002278867.1|  PREDICTED: soluble inorganic pyrophosphatase       369   2e-124   Vitis vinifera
ref|XP_010676936.1|  PREDICTED: soluble inorganic pyrophosphatase...    369   2e-124   
ref|XP_010684178.1|  PREDICTED: soluble inorganic pyrophosphatase...    369   2e-124   
ref|XP_009142592.1|  PREDICTED: soluble inorganic pyrophosphatase       369   3e-124   
ref|XP_004246468.1|  PREDICTED: soluble inorganic pyrophosphatase       368   4e-124   
ref|XP_006341063.1|  PREDICTED: soluble inorganic pyrophosphatase...    368   4e-124   
emb|CBI38728.3|  unnamed protein product                                388   4e-124   
ref|NP_001055658.1|  Os05g0438500                                       368   5e-124   Oryza sativa Japonica Group [Japonica rice]
gb|KHG06471.1|  Soluble inorganic pyrophosphatase                       367   5e-124   
ref|XP_002271762.1|  PREDICTED: soluble inorganic pyrophosphatase       367   6e-124   Vitis vinifera
ref|XP_003626619.1|  Soluble inorganic pyrophosphatase                  367   1e-123   
gb|AFK49252.1|  unknown                                                 367   1e-123   
ref|XP_003568370.1|  PREDICTED: soluble inorganic pyrophosphatase...    367   1e-123   
gb|AFK47254.1|  unknown                                                 366   2e-123   
gb|KEH42358.1|  soluble inorganic pyrophosphatase                       367   2e-123   
ref|NP_001235777.1|  uncharacterized protein LOC100527417               366   2e-123   
emb|CDM85064.1|  unnamed protein product                                366   2e-123   
ref|XP_002874977.1|  hypothetical protein ARALYDRAFT_490426             366   2e-123   
ref|XP_003590529.1|  Soluble inorganic pyrophosphatase                  367   2e-123   
ref|XP_007144465.1|  hypothetical protein PHAVU_007G158400g             366   2e-123   
ref|XP_003520887.1|  PREDICTED: soluble inorganic pyrophosphatase...    365   3e-123   
ref|XP_003571770.1|  PREDICTED: soluble inorganic pyrophosphatase...    365   3e-123   
ref|XP_006604921.1|  PREDICTED: soluble inorganic pyrophosphatase...    365   3e-123   
emb|CDX73537.1|  BnaC08g24660D                                          365   4e-123   
ref|XP_008447598.1|  PREDICTED: soluble inorganic pyrophosphatase       365   4e-123   
ref|XP_010037866.1|  PREDICTED: soluble inorganic pyrophosphatase       365   5e-123   
ref|XP_004306606.1|  PREDICTED: soluble inorganic pyrophosphatase...    365   5e-123   
ref|NP_192057.1|  pyrophosphorylase 5                                   365   6e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010097392.1|  Soluble inorganic pyrophosphatase                  367   7e-123   
ref|XP_006646504.1|  PREDICTED: soluble inorganic pyrophosphatase...    366   7e-123   
gb|AAF26475.1|AC007323_16  T25K16.5                                     365   7e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019913.1|  PREDICTED: soluble inorganic pyrophosphatase       365   8e-123   
emb|CDX78192.1|  BnaA09g33870D                                          364   9e-123   
ref|XP_004142083.1|  PREDICTED: soluble inorganic pyrophosphatase...    364   1e-122   
ref|XP_009139385.1|  PREDICTED: soluble inorganic pyrophosphatase...    364   1e-122   
gb|ACG47598.1|  soluble inorganic pyrophosphatase                       364   1e-122   Zea mays [maize]
ref|XP_008358748.1|  PREDICTED: soluble inorganic pyrophosphatase...    364   1e-122   
gb|EMT22352.1|  Soluble inorganic pyrophosphatase                       364   1e-122   
ref|XP_008794929.1|  PREDICTED: soluble inorganic pyrophosphatase...    364   1e-122   
gb|KHG30820.1|  Soluble inorganic pyrophosphatase                       364   1e-122   
ref|XP_006588379.1|  PREDICTED: uncharacterized protein LOC100306...    364   2e-122   
ref|XP_006661762.1|  PREDICTED: soluble inorganic pyrophosphatase...    363   2e-122   
ref|XP_010047418.1|  PREDICTED: soluble inorganic pyrophosphatase...    363   3e-122   
emb|CAC83001.1|  soluble pyrophosphatase                                363   3e-122   Beta vulgaris [beet]
ref|XP_006403668.1|  hypothetical protein EUTSA_v10010704mg             363   3e-122   
gb|KEH42359.1|  soluble inorganic pyrophosphatase                       363   4e-122   
ref|XP_009762510.1|  PREDICTED: soluble inorganic pyrophosphatase...    363   4e-122   
ref|XP_003590528.1|  Soluble inorganic pyrophosphatase                  363   6e-122   
gb|ACG41455.1|  soluble inorganic pyrophosphatase                       362   6e-122   Zea mays [maize]
ref|XP_009621479.1|  PREDICTED: soluble inorganic pyrophosphatase...    362   7e-122   
ref|XP_004495003.1|  PREDICTED: soluble inorganic pyrophosphatase...    362   7e-122   
ref|XP_010920680.1|  PREDICTED: soluble inorganic pyrophosphatase...    362   8e-122   
ref|XP_003565184.1|  PREDICTED: soluble inorganic pyrophosphatase...    362   8e-122   
ref|XP_004495002.1|  PREDICTED: soluble inorganic pyrophosphatase...    362   8e-122   
ref|XP_008363850.1|  PREDICTED: soluble inorganic pyrophosphatase...    362   8e-122   
gb|ACZ27843.1|  inorganic pyrophosphatase protein                       362   9e-122   
ref|NP_001064561.1|  Os10g0406100                                       362   9e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004983149.1|  PREDICTED: soluble inorganic pyrophosphatase...    362   9e-122   
ref|XP_004495004.1|  PREDICTED: soluble inorganic pyrophosphatase...    362   9e-122   
ref|NP_001237552.1|  uncharacterized protein LOC100306101               362   1e-121   
gb|KHG29451.1|  Soluble inorganic pyrophosphatase                       362   1e-121   
ref|XP_002309043.1|  inorganic pyrophosphatase family protein           362   1e-121   Populus trichocarpa [western balsam poplar]
gb|KDP35591.1|  hypothetical protein JCGZ_09029                         361   1e-121   
ref|XP_010937695.1|  PREDICTED: soluble inorganic pyrophosphatase...    361   2e-121   
ref|XP_008387733.1|  PREDICTED: soluble inorganic pyrophosphatase...    362   2e-121   
gb|ABK21997.1|  unknown                                                 361   2e-121   Picea sitchensis
gb|KHN11364.1|  Soluble inorganic pyrophosphatase                       361   2e-121   
ref|XP_010529852.1|  PREDICTED: soluble inorganic pyrophosphatase       361   2e-121   
gb|AFK46059.1|  unknown                                                 361   2e-121   
emb|CAJ44304.1|  soluble inorganic pyrophosphatase                      362   2e-121   Papaver rhoeas [field poppy]
gb|AAU84434.1|  inorganic pyrophosphatase                               360   2e-121   Oryza sativa Japonica Group [Japonica rice]
gb|EEC66916.1|  hypothetical protein OsI_33514                          362   3e-121   Oryza sativa Indica Group [Indian rice]
ref|XP_004302755.1|  PREDICTED: soluble inorganic pyrophosphatase...    362   3e-121   
ref|XP_004302756.1|  PREDICTED: soluble inorganic pyrophosphatase...    360   3e-121   
ref|NP_001136694.1|  uncharacterized protein LOC100216827               360   3e-121   Zea mays [maize]
ref|XP_009421347.1|  PREDICTED: soluble inorganic pyrophosphatase...    360   3e-121   
gb|AFP74893.1|  soluble inorganic pyrophosphatase                       360   4e-121   
ref|XP_010649123.1|  PREDICTED: soluble inorganic pyrophosphatase...    360   5e-121   
ref|XP_009374655.1|  PREDICTED: soluble inorganic pyrophosphatase...    360   5e-121   
ref|XP_006653973.1|  PREDICTED: soluble inorganic pyrophosphatase...    360   5e-121   
ref|XP_010686641.1|  PREDICTED: soluble inorganic pyrophosphatase...    360   6e-121   
ref|XP_010263618.1|  PREDICTED: soluble inorganic pyrophosphatase...    360   6e-121   
ref|XP_002264695.2|  PREDICTED: soluble inorganic pyrophosphatase...    360   7e-121   Vitis vinifera
ref|XP_010553295.1|  PREDICTED: soluble inorganic pyrophosphatase...    360   7e-121   
gb|AFP74894.1|  soluble inorganic pyrophosphatase                       360   7e-121   
gb|ACG47583.1|  soluble inorganic pyrophosphatase                       360   7e-121   Zea mays [maize]
gb|AFW74914.1|  Soluble inorganic pyrophosphatase                       360   8e-121   
ref|XP_009116059.1|  PREDICTED: soluble inorganic pyrophosphatase...    360   8e-121   
gb|EEE50931.1|  hypothetical protein OsJ_31465                          359   8e-121   Oryza sativa Japonica Group [Japonica rice]
gb|ABK93489.1|  unknown                                                 359   8e-121   Populus trichocarpa [western balsam poplar]
ref|XP_010553296.1|  PREDICTED: soluble inorganic pyrophosphatase...    359   9e-121   
ref|XP_004961949.1|  PREDICTED: soluble inorganic pyrophosphatase...    360   1e-120   
ref|XP_009377104.1|  PREDICTED: soluble inorganic pyrophosphatase...    359   1e-120   
ref|XP_008241484.1|  PREDICTED: soluble inorganic pyrophosphatase       359   1e-120   
ref|XP_007205831.1|  hypothetical protein PRUPE_ppa010998mg             359   1e-120   
ref|XP_004960501.1|  PREDICTED: soluble inorganic pyrophosphatase...    358   2e-120   
ref|XP_007027101.1|  Pyrophosphorylase 4                                358   2e-120   
emb|CDP06650.1|  unnamed protein product                                358   3e-120   
ref|NP_190930.1|  pyrophosphorylase 4                                   358   3e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504130.1|  PREDICTED: soluble inorganic pyrophosphatase...    358   3e-120   
ref|XP_002467268.1|  hypothetical protein SORBIDRAFT_01g022340          358   3e-120   Sorghum bicolor [broomcorn]
ref|XP_006291827.1|  hypothetical protein CARUB_v10018002mg             358   3e-120   
ref|XP_002876216.1|  hypothetical protein ARALYDRAFT_485748             358   3e-120   
ref|XP_008644851.1|  PREDICTED: soluble inorganic pyrophosphatase       357   3e-120   
emb|CAG30522.1|  putative inorganic pyrophosphatase                     358   3e-120   Arachis hypogaea [goober]
ref|XP_010427018.1|  PREDICTED: soluble inorganic pyrophosphatase...    358   4e-120   
ref|XP_006878535.1|  hypothetical protein AMTR_s00011p00227250          357   5e-120   
ref|XP_006340642.1|  PREDICTED: soluble inorganic pyrophosphatase...    357   7e-120   
ref|XP_011093001.1|  PREDICTED: soluble inorganic pyrophosphatase       357   7e-120   
ref|NP_001054459.1|  Os05g0114000                                       357   7e-120   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007162670.1|  hypothetical protein PHAVU_001G170300g             357   9e-120   
gb|ACN40874.1|  unknown                                                 357   1e-119   Picea sitchensis
ref|XP_006645405.1|  PREDICTED: soluble inorganic pyrophosphatase...    357   1e-119   
ref|XP_002521557.1|  inorganic pyrophosphatase, putative                356   2e-119   Ricinus communis
gb|AAM65537.1|  inorganic pyrophosphatase-like protein                  356   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006429019.1|  hypothetical protein CICLE_v10012723mg             356   2e-119   
ref|XP_003554332.1|  PREDICTED: soluble inorganic pyrophosphatase...    357   2e-119   
ref|XP_003612058.1|  Soluble inorganic pyrophosphatase                  356   2e-119   
emb|CDY41563.1|  BnaC04g00590D                                          374   2e-119   
gb|AFK40071.1|  unknown                                                 356   2e-119   
ref|NP_001044907.1|  Os01g0866500                                       355   3e-119   Oryza sativa Japonica Group [Japonica rice]
gb|AGV54692.1|  soluble inorganic pyrophosphatase                       356   3e-119   
ref|XP_002966020.1|  hypothetical protein SELMODRAFT_167898             355   3e-119   
ref|XP_004232423.1|  PREDICTED: soluble inorganic pyrophosphatase       355   4e-119   
gb|EEC72268.1|  hypothetical protein OsI_05422                          355   4e-119   Oryza sativa Indica Group [Indian rice]
dbj|BAH01087.1|  unnamed protein product                                355   5e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006576178.1|  PREDICTED: uncharacterized protein LOC100500...    355   5e-119   
tpg|DAA36752.1|  TPA: hypothetical protein ZEAMMB73_638704              354   5e-119   
ref|XP_007046883.1|  Soluble inorganic pyrophosphatase isoform 1        355   5e-119   
ref|XP_010029772.1|  PREDICTED: soluble inorganic pyrophosphatase...    355   6e-119   
gb|EYU41686.1|  hypothetical protein MIMGU_mgv1a013331mg                355   6e-119   
gb|EYU41687.1|  hypothetical protein MIMGU_mgv1a013331mg                355   7e-119   
ref|XP_007046885.1|  Soluble inorganic pyrophosphatase isoform 3        355   8e-119   
ref|XP_007204732.1|  hypothetical protein PRUPE_ppa011346mg             354   8e-119   
ref|XP_008661953.1|  PREDICTED: soluble inorganic pyrophosphatase...    354   8e-119   
ref|XP_004287880.1|  PREDICTED: soluble inorganic pyrophosphatase...    354   8e-119   
gb|EMT22354.1|  Soluble inorganic pyrophosphatase                       355   9e-119   
ref|XP_001771781.1|  predicted protein                                  354   1e-118   
ref|XP_004953605.1|  PREDICTED: soluble inorganic pyrophosphatase...    353   1e-118   
ref|XP_010029771.1|  PREDICTED: soluble inorganic pyrophosphatase...    354   1e-118   
ref|XP_008807737.1|  PREDICTED: soluble inorganic pyrophosphatase...    354   1e-118   
gb|EPS67283.1|  hypothetical protein M569_07492                         353   1e-118   
ref|XP_002440472.1|  hypothetical protein SORBIDRAFT_09g001530          353   2e-118   Sorghum bicolor [broomcorn]
emb|CDY30853.1|  BnaC04g27080D                                          364   2e-118   
ref|XP_002531333.1|  inorganic pyrophosphatase, putative                354   2e-118   Ricinus communis
ref|XP_008807739.1|  PREDICTED: soluble inorganic pyrophosphatase...    353   2e-118   
ref|XP_006491397.1|  PREDICTED: soluble inorganic pyrophosphatase...    359   2e-118   
ref|XP_002310249.2|  hypothetical protein POPTR_0007s13110g             353   2e-118   Populus trichocarpa [western balsam poplar]
gb|KDO86651.1|  hypothetical protein CISIN_1g040461mg                   357   2e-118   
ref|XP_006647760.1|  PREDICTED: soluble inorganic pyrophosphatase...    353   3e-118   
gb|ABK96636.1|  unknown                                                 353   3e-118   Populus trichocarpa x Populus deltoides
gb|AFK26595.1|  inorganic pyrophosphotase                               353   3e-118   
ref|NP_001235992.1|  uncharacterized protein LOC100500040               353   4e-118   
ref|XP_006848582.1|  hypothetical protein AMTR_s00168p00035700          352   5e-118   
ref|XP_004512066.1|  PREDICTED: soluble inorganic pyrophosphatase...    352   6e-118   
ref|XP_004143524.1|  PREDICTED: soluble inorganic pyrophosphatase...    353   7e-118   
gb|KGN48845.1|  hypothetical protein Csa_6G502810                       352   7e-118   
ref|XP_008241705.1|  PREDICTED: soluble inorganic pyrophosphatase       352   8e-118   
emb|CDP01996.1|  unnamed protein product                                352   8e-118   
gb|AFK45917.1|  unknown                                                 352   8e-118   
ref|XP_008440735.1|  PREDICTED: soluble inorganic pyrophosphatase...    352   1e-117   
ref|XP_009628780.1|  PREDICTED: soluble inorganic pyrophosphatase...    351   1e-117   
ref|XP_007156971.1|  hypothetical protein PHAVU_002G032700g             351   1e-117   
ref|XP_008440736.1|  PREDICTED: soluble inorganic pyrophosphatase...    351   2e-117   
ref|XP_009401358.1|  PREDICTED: soluble inorganic pyrophosphatase...    351   2e-117   
ref|XP_011077438.1|  PREDICTED: soluble inorganic pyrophosphatase...    351   2e-117   
ref|XP_009401359.1|  PREDICTED: soluble inorganic pyrophosphatase...    351   2e-117   
gb|AEQ94118.1|  putative soluble inorganic pyrophosphatase              350   2e-117   
ref|NP_001236147.1|  uncharacterized protein LOC100306258               350   2e-117   
ref|XP_011094819.1|  PREDICTED: soluble inorganic pyrophosphatase...    350   2e-117   
ref|XP_010679756.1|  PREDICTED: soluble inorganic pyrophosphatase       350   3e-117   
gb|EYU31198.1|  hypothetical protein MIMGU_mgv1a013887mg                350   3e-117   
ref|XP_010235863.1|  PREDICTED: soluble inorganic pyrophosphatase       350   3e-117   
ref|XP_011025826.1|  PREDICTED: soluble inorganic pyrophosphatase       350   4e-117   
ref|XP_009340722.1|  PREDICTED: soluble inorganic pyrophosphatase       350   6e-117   
gb|EYU28270.1|  hypothetical protein MIMGU_mgv1a013880mg                349   7e-117   
ref|NP_001170012.1|  hypothetical protein                               349   7e-117   
ref|XP_008644123.1|  PREDICTED: hypothetical protein isoform X2         349   7e-117   
ref|XP_011077439.1|  PREDICTED: soluble inorganic pyrophosphatase...    349   8e-117   
ref|XP_008338257.1|  PREDICTED: soluble inorganic pyrophosphatase...    349   8e-117   
ref|NP_001238102.1|  uncharacterized protein LOC100527574               349   8e-117   
ref|XP_010906338.1|  PREDICTED: soluble inorganic pyrophosphatase...    349   9e-117   
gb|AFK49350.1|  unknown                                                 349   1e-116   
gb|KDP21750.1|  hypothetical protein JCGZ_03380                         349   1e-116   
ref|XP_010526768.1|  PREDICTED: soluble inorganic pyrophosphatase...    349   1e-116   
gb|AFP74895.1|  soluble inorganic pyrophosphatase                       349   1e-116   
ref|XP_008644122.1|  PREDICTED: hypothetical protein isoform X1         348   2e-116   
ref|NP_001047863.1|  Os02g0704900                                       348   2e-116   
ref|XP_008784919.1|  PREDICTED: soluble inorganic pyrophosphatase       348   3e-116   
gb|KFK34611.1|  soluble inorganic pyrophosphatase                       347   4e-116   
gb|AAF27918.1|AF220202_1  soluble inorganic pyrophosphatase             348   4e-116   
gb|KEH42360.1|  soluble inorganic pyrophosphatase                       350   4e-116   
gb|KHN36090.1|  Soluble inorganic pyrophosphatase                       347   4e-116   
ref|XP_011083205.1|  PREDICTED: soluble inorganic pyrophosphatase...    347   4e-116   
ref|XP_004970700.1|  PREDICTED: soluble inorganic pyrophosphatase...    347   5e-116   
ref|XP_010526767.1|  PREDICTED: soluble inorganic pyrophosphatase...    348   1e-115   
emb|CAA12415.1|  magnesium dependent soluble inorganic pyrophosph...    346   2e-115   
ref|XP_003569005.1|  PREDICTED: soluble inorganic pyrophosphatase...    345   3e-115   
pdb|4LUG|A  Chain A, Crystal Structure Of Inorganic Pyrophosphata...    343   4e-115   
ref|XP_003612057.1|  Soluble inorganic pyrophosphatase                  345   5e-115   
ref|XP_006425645.1|  hypothetical protein CICLE_v10026346mg             344   7e-115   
gb|KEH42361.1|  soluble inorganic pyrophosphatase                       345   9e-115   
ref|NP_001150555.1|  LOC100284187                                       343   1e-114   
ref|XP_006466825.1|  PREDICTED: soluble inorganic pyrophosphatase...    343   1e-114   
ref|XP_006425644.1|  hypothetical protein CICLE_v10026346mg             345   2e-114   
sp|O23979.1|IPYR_HORVD  RecName: Full=Soluble inorganic pyrophosp...    343   3e-114   
ref|XP_006466824.1|  PREDICTED: soluble inorganic pyrophosphatase...    344   3e-114   
ref|XP_001785935.1|  predicted protein                                  342   5e-114   
ref|XP_010905721.1|  PREDICTED: soluble inorganic pyrophosphatase...    342   8e-114   
ref|XP_004509281.1|  PREDICTED: soluble inorganic pyrophosphatase...    342   1e-113   
ref|XP_006466823.1|  PREDICTED: soluble inorganic pyrophosphatase...    343   2e-113   
gb|AAC78101.1|  inorganic pyrophosphatase                               341   2e-113   
ref|NP_001148294.1|  soluble inorganic pyrophosphatase                  339   5e-113   
gb|AFK41558.1|  unknown                                                 339   1e-112   
gb|KDO36213.1|  hypothetical protein CISIN_1g028755mg                   338   1e-112   
gb|KEH43570.1|  soluble inorganic pyrophosphatase                       339   1e-112   
gb|KDO70967.1|  hypothetical protein CISIN_1g027710mg                   338   3e-112   
ref|XP_001760996.1|  predicted protein                                  338   3e-112   
ref|XP_001781962.1|  predicted protein                                  337   5e-112   
gb|EYU28269.1|  hypothetical protein MIMGU_mgv1a013880mg                333   8e-111   
gb|EMT19976.1|  Soluble inorganic pyrophosphatase                       333   9e-111   
gb|KHN16395.1|  Soluble inorganic pyrophosphatase                       333   1e-110   
emb|CAJ86138.1|  H0701F11.4                                             332   2e-110   
gb|EMS51151.1|  Soluble inorganic pyrophosphatase                       330   1e-109   
dbj|BAD87839.1|  putative soluble inorganic pyrophosphatase             330   3e-109   
ref|XP_002966068.1|  hypothetical protein SELMODRAFT_143637             328   5e-109   
emb|CDY46306.1|  BnaA07g01950D                                          330   5e-109   
ref|XP_009102258.1|  PREDICTED: soluble inorganic pyrophosphatase 2     329   6e-109   
ref|XP_010930986.1|  PREDICTED: soluble inorganic pyrophosphatase...    328   7e-109   
gb|EMT27259.1|  Soluble inorganic pyrophosphatase                       328   9e-109   
emb|CDY25149.1|  BnaC07g03580D                                          329   1e-108   
gb|KEH42357.1|  soluble inorganic pyrophosphatase                       329   1e-108   
ref|XP_002886161.1|  inorganic pyrophosphatase                          328   2e-108   
gb|AAM66110.1|  putative inorganic pyrophosphatase                      327   3e-108   
ref|XP_006409177.1|  hypothetical protein EUTSA_v10022844mg             327   5e-108   
ref|NP_179415.1|  soluble inorganic pyrophosphatase 2                   327   5e-108   
ref|XP_010489524.1|  PREDICTED: soluble inorganic pyrophosphatase...    325   3e-107   
ref|XP_004970698.1|  PREDICTED: soluble inorganic pyrophosphatase...    326   4e-107   
ref|XP_010414081.1|  PREDICTED: soluble inorganic pyrophosphatase...    324   5e-107   
ref|XP_009112480.1|  PREDICTED: soluble inorganic pyrophosphatase...    324   7e-107   
ref|XP_009112479.1|  PREDICTED: soluble inorganic pyrophosphatase...    324   8e-107   
ref|XP_010325309.1|  PREDICTED: soluble inorganic pyrophosphatase...    322   1e-106   
ref|XP_010467634.1|  PREDICTED: soluble inorganic pyrophosphatase 2     322   3e-106   
ref|XP_010113422.1|  Soluble inorganic pyrophosphatase                  322   5e-106   
ref|XP_006298520.1|  hypothetical protein CARUB_v10014598mg             322   6e-106   
gb|EYU19443.1|  hypothetical protein MIMGU_mgv1a011868mg                321   2e-105   
gb|KHG21575.1|  Soluble inorganic pyrophosphatase                       316   9e-104   
ref|XP_010263622.1|  PREDICTED: soluble inorganic pyrophosphatase...    314   1e-103   
emb|CAA40764.1|  inorganic pyrophosphatase                              317   2e-103   
gb|AEZ00851.1|  putative soluble inorganic pyrophosphatase              313   3e-103   
gb|KFK40208.1|  inorganic pyrophosphatase                               314   4e-103   
ref|XP_010263621.1|  PREDICTED: soluble inorganic pyrophosphatase...    310   1e-101   
ref|XP_007218459.1|  hypothetical protein PRUPE_ppa011841mg             308   3e-101   
ref|XP_006418371.1|  hypothetical protein EUTSA_v10008767mg             308   6e-101   
gb|KDO36214.1|  hypothetical protein CISIN_1g028755mg                   308   8e-101   
ref|XP_008376269.1|  PREDICTED: soluble inorganic pyrophosphatase...    312   2e-100   
gb|AAG31654.1|  PRLI-interacting factor F                               304   1e-99    
ref|XP_002971422.1|  hypothetical protein SELMODRAFT_172131             305   3e-99    
dbj|BAJ97321.1|  predicted protein                                      303   3e-99    
gb|KEH18553.1|  soluble inorganic pyrophosphatase                       303   4e-99    
ref|XP_007144464.1|  hypothetical protein PHAVU_007G158400g             303   5e-99    
emb|CDM87231.1|  unnamed protein product                                303   1e-98    
ref|XP_010489522.1|  PREDICTED: soluble inorganic pyrophosphatase...    304   2e-98    
gb|KCW78528.1|  hypothetical protein EUGRSUZ_D02652                     299   1e-97    
ref|XP_006429017.1|  hypothetical protein CICLE_v10012723mg             298   9e-97    
gb|AFW74916.1|  hypothetical protein ZEAMMB73_605071                    298   1e-96    
gb|AAK98675.1|AC021893_9  Putative soluble inorganic pyrophosphatase    297   1e-96    
gb|KDO70969.1|  hypothetical protein CISIN_1g027710mg                   297   1e-96    
emb|CDM81476.1|  unnamed protein product                                297   2e-96    
emb|CDM87229.1|  unnamed protein product                                296   3e-96    
gb|KCW56733.1|  hypothetical protein EUGRSUZ_I02418                     296   4e-96    
ref|XP_009371641.1|  PREDICTED: soluble inorganic pyrophosphatase...    295   8e-96    
ref|XP_006425643.1|  hypothetical protein CICLE_v10026346mg             294   9e-96    
gb|EMS55977.1|  Soluble inorganic pyrophosphatase                       294   1e-95    
ref|XP_007046886.1|  Soluble inorganic pyrophosphatase isoform 4        295   1e-95    
ref|XP_006429018.1|  hypothetical protein CICLE_v10012723mg             293   2e-95    
gb|EMT03426.1|  Soluble inorganic pyrophosphatase                       292   6e-95    
ref|XP_008781408.1|  PREDICTED: soluble inorganic pyrophosphatase...    292   7e-95    
ref|XP_010906340.1|  PREDICTED: soluble inorganic pyrophosphatase...    291   9e-95    
gb|EMS55688.1|  Soluble inorganic pyrophosphatase                       292   2e-93    
gb|AAB82136.1|  inorganic pyrophosphatase                               290   2e-93    
gb|EMT15882.1|  Soluble inorganic pyrophosphatase                       289   3e-92    
gb|KDO70971.1|  hypothetical protein CISIN_1g027710mg                   284   3e-91    
gb|KHN02415.1|  Soluble inorganic pyrophosphatase                       286   2e-90    
gb|EMS47674.1|  Soluble inorganic pyrophosphatase                       282   3e-90    
gb|EMT13904.1|  Soluble inorganic pyrophosphatase                       283   3e-90    
ref|XP_010917067.1|  PREDICTED: soluble inorganic pyrophosphatase...    279   6e-90    
gb|KCW78527.1|  hypothetical protein EUGRSUZ_D02652                     279   1e-89    
ref|XP_008338135.1|  PREDICTED: soluble inorganic pyrophosphatase...    277   5e-89    
gb|KDO70970.1|  hypothetical protein CISIN_1g027710mg                   278   1e-88    
gb|KDO36216.1|  hypothetical protein CISIN_1g028755mg                   275   1e-88    
gb|EMS59385.1|  Soluble inorganic pyrophosphatase                       273   1e-86    
ref|XP_002954716.1|  hypothetical protein VOLCADRAFT_76427              271   2e-86    
ref|XP_001694912.1|  soluble inorganic pyrophosphatase                  268   3e-85    
ref|XP_005643649.1|  soluble inorganic pyrophosphatase 2                267   5e-85    
gb|KDD73005.1|  Inorganic pyrophosphatase                               265   4e-84    
gb|KCW56731.1|  hypothetical protein EUGRSUZ_I02418                     264   8e-84    
ref|XP_005843969.1|  hypothetical protein CHLNCDRAFT_32962              260   2e-82    
gb|KHN41561.1|  Soluble inorganic pyrophosphatase                       252   1e-79    
ref|XP_003612059.1|  Soluble inorganic pyrophosphatase                  247   8e-78    
gb|KFM26242.1|  Soluble inorganic pyrophosphatase 2                     265   9e-78    
gb|EMS55687.1|  Soluble inorganic pyrophosphatase                       247   6e-77    
ref|XP_010254786.1|  PREDICTED: LOW QUALITY PROTEIN: soluble inor...    236   5e-73    
gb|ACF74329.1|  putative inorganic pyrophosphatase                      233   1e-72    
gb|KDD72559.1|  Inorganic pyrophosphatase                               232   7e-72    
ref|WP_005006215.1|  Inorganic pyrophosphatase                          229   2e-70    
ref|XP_010462897.1|  PREDICTED: soluble inorganic pyrophosphatase...    228   5e-70    
ref|WP_022000529.1|  inorganic pyrophosphatase                          226   3e-69    
ref|XP_002683119.1|  soluble inorganic pyrophosphatase                  221   6e-67    
ref|WP_022195097.1|  inorganic pyrophosphatase                          218   6e-66    
gb|EPS64318.1|  hypothetical protein M569_10462                         215   8e-66    
ref|WP_022005672.1|  inorganic pyrophosphatase                          216   2e-65    
ref|XP_008781409.1|  PREDICTED: soluble inorganic pyrophosphatase...    212   1e-64    
ref|WP_011586457.1|  inorganic pyrophosphatase                          212   9e-64    
ref|WP_022186185.1|  inorganic pyrophosphatase                          212   1e-63    
ref|WP_009060129.1|  inorganic pyrophosphatase                          212   2e-63    
ref|WP_039721326.1|  inorganic pyrophosphatase                          211   3e-63    
ref|WP_033316657.1|  inorganic pyrophosphatase                          211   4e-63    
ref|XP_008785907.1|  PREDICTED: soluble inorganic pyrophosphatase...    212   5e-63    
ref|WP_020530016.1|  hypothetical protein                               210   5e-63    
ref|WP_037358049.1|  inorganic pyrophosphatase                          210   7e-63    
gb|KFD39550.1|  inorganic pyrophosphatase                               209   8e-63    
ref|WP_018344477.1|  inorganic pyrophosphatase                          209   2e-62    
gb|EZG46819.1|  soluble inorganic pyrophosphatase                       209   2e-62    
ref|WP_012462788.1|  inorganic pyrophosphatase                          209   4e-62    
ref|WP_022078761.1|  inorganic pyrophosphatase 1                        209   4e-62    
ref|XP_010482434.1|  PREDICTED: soluble inorganic pyrophosphatase...    209   5e-62    
ref|XP_008781015.1|  PREDICTED: soluble inorganic pyrophosphatase...    208   6e-62    
gb|ACF83449.1|  unknown                                                 205   6e-62    
ref|WP_007653328.1|  inorganic pyrophosphatase                          207   1e-61    
ref|WP_026463433.1|  inorganic pyrophosphatase                          206   2e-61    
ref|WP_013626950.1|  inorganic pyrophosphatase                          206   3e-61    
ref|WP_028297522.1|  inorganic pyrophosphatase                          205   4e-61    
ref|WP_011565002.1|  inorganic pyrophosphatase                          205   5e-61    
ref|XP_001446352.1|  hypothetical protein                               205   8e-61    
ref|WP_013565867.1|  inorganic pyrophosphatase                          204   1e-60    
ref|WP_019597965.1|  inorganic pyrophosphatase                          204   1e-60    
ref|WP_002647797.1|  inorganic pyrophosphatase                          204   2e-60    
ref|WP_025608462.1|  inorganic pyrophosphatase                          203   4e-60    
ref|WP_012910950.1|  inorganic pyrophosphatase                          202   5e-60    
ref|WP_022834389.1|  inorganic pyrophosphatase                          202   5e-60    
ref|WP_015247736.1|  inorganic pyrophosphatase                          202   5e-60    
ref|XP_001450622.1|  hypothetical protein                               203   5e-60    
gb|EYU35610.1|  hypothetical protein MIMGU_mgv1a0150772mg               200   5e-60    
ref|WP_012793036.1|  inorganic pyrophosphatase                          202   6e-60    
ref|WP_038111825.1|  inorganic pyrophosphatase                          202   9e-60    
ref|WP_033370626.1|  inorganic pyrophosphatase                          201   1e-59    
ref|WP_009055639.1|  inorganic pyrophosphatase                          201   1e-59    
ref|WP_013111910.1|  inorganic pyrophosphatase                          201   1e-59    
ref|WP_014774129.1|  inorganic pyrophosphatase                          201   2e-59    
gb|AHJ95886.1|  inorganic pyrophosphatase                               201   2e-59    
ref|WP_009185366.1|  inorganic pyrophosphatase                          200   4e-59    
ref|WP_011361490.1|  inorganic pyrophosphatase                          200   4e-59    
ref|WP_013062396.1|  inorganic pyrophosphatase                          200   4e-59    
gb|EAR90871.4|  inorganic pyrophosphatase                               202   4e-59    
ref|WP_014244288.1|  inorganic pyrophosphatase                          200   5e-59    
ref|WP_012508309.1|  inorganic pyrophosphatase                          200   5e-59    
ref|WP_014200620.1|  inorganic pyrophosphatase                          200   7e-59    
ref|WP_008199542.1|  inorganic pyrophosphatase                          199   7e-59    
ref|WP_008627083.1|  Inorganic pyrophosphatase                          199   8e-59    
gb|AIZ62975.1|  inorganic pyrophosphatase                               199   1e-58    
ref|WP_011524767.1|  inorganic pyrophosphatase                          199   1e-58    
ref|WP_006365823.1|  inorganic pyrophosphatase                          199   2e-58    
ref|WP_014220144.1|  inorganic pyrophosphatase                          199   2e-58    
ref|WP_026953437.1|  inorganic pyrophosphatase                          198   2e-58    
ref|WP_011404734.1|  inorganic pyrophosphatase                          198   3e-58    
ref|WP_015266079.1|  inorganic pyrophosphatase                          198   3e-58    
ref|WP_018473065.1|  inorganic pyrophosphatase                          197   6e-58    
ref|WP_026954700.1|  inorganic pyrophosphatase                          197   6e-58    
ref|WP_009033592.1|  inorganic pyrophosphatase                          197   6e-58    
ref|WP_014018982.1|  inorganic pyrophosphatase                          197   7e-58    
ref|XP_006599764.1|  PREDICTED: soluble inorganic pyrophosphatase...    196   8e-58    
ref|XP_001011116.3|  inorganic pyrophosphatase family protein           197   9e-58    
ref|WP_010582936.1|  inorganic pyrophosphatase                          196   1e-57    
ref|WP_038049008.1|  inorganic pyrophosphatase                          196   2e-57    
ref|WP_011890266.1|  inorganic pyrophosphatase                          196   2e-57    
ref|WP_035070844.1|  inorganic pyrophosphatase                          196   2e-57    
ref|WP_039128808.1|  inorganic pyrophosphatase                          195   3e-57    
ref|WP_012474609.1|  inorganic pyrophosphatase                          196   3e-57    
ref|WP_014681948.1|  inorganic pyrophosphatase                          195   5e-57    
ref|WP_013454921.1|  inorganic pyrophosphatase                          195   5e-57    
ref|WP_026968546.1|  inorganic pyrophosphatase                          194   6e-57    



>emb|CDP12252.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   392 bits (1007),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 200/216 (93%), Gaps = 5/216 (2%)
 Frame = +1

Query  190  SQSNEVAA--FPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGS  363
            S  NE  A   PQ+R PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVVIEITKGS
Sbjct  3    SDGNENGAETSPQRRAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVIEITKGS  62

Query  364  KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQ---EPVLPGC  534
            KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQ   EPVLPGC
Sbjct  63   KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQARREPVLPGC  122

Query  535  FLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNE  714
            FLRARA+GLMPMIDQGEKDDKIIAVCADDPEYRHYTDI+QLPPHRLAEIRRFFEDYKKNE
Sbjct  123  FLRARAVGLMPMIDQGEKDDKIIAVCADDPEYRHYTDINQLPPHRLAEIRRFFEDYKKNE  182

Query  715  NKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            NKEVAVNEFLP+ TA +AI+YSMDLYAEYI+QTLRK
Sbjct  183  NKEVAVNEFLPAATAVDAIQYSMDLYAEYILQTLRK  218



>ref|XP_009589194.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Nicotiana 
tomentosiformis]
Length=212

 Score =   390 bits (1003),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N   A  QKR PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FN VIEITKGSK
Sbjct  1    MSNENCDEASSQKRAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPSVFNAVIEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRVLYSSVVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYT+I+QLPPHRLAEIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTNINQLPPHRLAEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AV+EFLP  TA +AI+YSMDLYAEYI+ TLRK
Sbjct  181  AVDEFLPPSTAVDAIQYSMDLYAEYILHTLRK  212



>ref|XP_009589193.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Nicotiana 
tomentosiformis]
Length=221

 Score =   391 bits (1004),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N   A  QKR PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FN VIEITKGSK
Sbjct  10   MSNENCDEASSQKRAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPSVFNAVIEITKGSK  69

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA
Sbjct  70   VKYELDKKTGLIKVDRVLYSSVVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  129

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYT+I+QLPPHRLAEIRRFFEDYKKNENKEV
Sbjct  130  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTNINQLPPHRLAEIRRFFEDYKKNENKEV  189

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AV+EFLP  TA +AI+YSMDLYAEYI+ TLRK
Sbjct  190  AVDEFLPPSTAVDAIQYSMDLYAEYILHTLRK  221



>ref|XP_011070408.1| PREDICTED: soluble inorganic pyrophosphatase [Sesamum indicum]
Length=211

 Score =   390 bits (1002),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 200/212 (94%), Gaps = 1/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+ N V++ P KR PRLNERILSS+SRRSVAAHPWHDLEIG  AP+  NVVIEI KGSK
Sbjct  1    MSEENGVSSAP-KRAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPRIINVVIEIPKGSK  59

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLV+MQEPVLPGCFLRA
Sbjct  60   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVIMQEPVLPGCFLRA  119

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRH+TDISQLPPHRLAEIRRFFEDYKKNENKEV
Sbjct  120  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHFTDISQLPPHRLAEIRRFFEDYKKNENKEV  179

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AV+EFLPSDTA +AI++SMDLYAEYI+ +LRK
Sbjct  180  AVDEFLPSDTAVDAIQHSMDLYAEYILHSLRK  211



>ref|XP_009774482.1| PREDICTED: soluble inorganic pyrophosphatase [Nicotiana sylvestris]
 ref|XP_009774489.1| PREDICTED: soluble inorganic pyrophosphatase [Nicotiana sylvestris]
Length=212

 Score =   389 bits (1000),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N   A  Q+R PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FN VIEITKGSK
Sbjct  1    MSNENCDEASSQRRAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPSVFNAVIEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRVLYSSVVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYT+I+QLPPHRLAEIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTNINQLPPHRLAEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AV+EFLP  TA +AI+YSMDLYAEYI+ TLRK
Sbjct  181  AVDEFLPPSTAVDAIQYSMDLYAEYILHTLRK  212



>ref|XP_009803138.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana 
sylvestris]
 ref|XP_009803145.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana 
sylvestris]
 ref|XP_009803151.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana 
sylvestris]
Length=209

 Score =   389 bits (998),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 198/209 (95%), Gaps = 1/209 (0%)
 Frame = +1

Query  196  SNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKY  375
            SNE A   Q++TPRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVVIEITKGSKVKY
Sbjct  2    SNE-AGDQQRQTPRLNERILSSLSRRSVAAHPWHDLEIGPEAPNIFNVVIEITKGSKVKY  60

Query  376  ELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAI  555
            ELDKKTGLIKVDR+LYSSVVYP NYGFIPRTLCED+DPMDVLVLMQEPVLPGCFLRARAI
Sbjct  61   ELDKKTGLIKVDRVLYSSVVYPQNYGFIPRTLCEDSDPMDVLVLMQEPVLPGCFLRARAI  120

Query  556  GLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVN  735
            GLMPMIDQGEKDDKIIAVCADDPEYRHYT+I+QLPPHRLAEIRRFFEDYKKNENKEVAVN
Sbjct  121  GLMPMIDQGEKDDKIIAVCADDPEYRHYTNINQLPPHRLAEIRRFFEDYKKNENKEVAVN  180

Query  736  EFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            +FL  +TA EAI+YSMDLYAEYI+QTLRK
Sbjct  181  DFLAPNTAVEAIQYSMDLYAEYILQTLRK  209



>gb|EYU19444.1| hypothetical protein MIMGU_mgv1a011868mg [Erythranthe guttata]
Length=268

 Score =   391 bits (1004),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/247 (79%), Positives = 209/247 (85%), Gaps = 10/247 (4%)
 Frame = +1

Query  82   YIVNDTELISQLHFYLDLLSPPVTPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSS  261
            +I + T L S +H+ L  L P         S+   MS+ N   + PQ R PRLNERILSS
Sbjct  32   FIYSLTLLPSNIHYLLTFLYP---------SSSGKMSEENNEVS-PQMRAPRLNERILSS  81

Query  262  MSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYP  441
            +SRRSVAAHPWHDLEIG  AP+  NVVIEI KGSKVKYELDKKTGLIKVDRILYSSVVYP
Sbjct  82   LSRRSVAAHPWHDLEIGPGAPQIINVVIEIPKGSKVKYELDKKTGLIKVDRILYSSVVYP  141

Query  442  HNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADD  621
            HNYGFIPRTLCEDNDPMDVLVLMQEPV+PGCFLRARAIGLMPMIDQGEKDDKIIAVCADD
Sbjct  142  HNYGFIPRTLCEDNDPMDVLVLMQEPVVPGCFLRARAIGLMPMIDQGEKDDKIIAVCADD  201

Query  622  PEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEY  801
            PEYRHYTDISQL PHRL EIRRFFEDYKKNENKEVAV+EFLPS TA +AI+YSMDLYAEY
Sbjct  202  PEYRHYTDISQLAPHRLTEIRRFFEDYKKNENKEVAVDEFLPSGTAVDAIQYSMDLYAEY  261

Query  802  IMQTLRK  822
            I+ TLRK
Sbjct  262  ILHTLRK  268



>ref|XP_010930985.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Elaeis 
guineensis]
Length=212

 Score =   388 bits (996),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N  AA  ++  PRLNERILSS+SRRSVAAHPWHDLEIG  AP  FNVV+EITKGSK
Sbjct  1    MSDENGSAAAEKRPVPRLNERILSSLSRRSVAAHPWHDLEIGPGAPSIFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHY DIS+L PHRLAEI+RFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDISELSPHRLAEIKRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVNEFLP++TA EAI++SMDLYA+YIMQ+LR+
Sbjct  181  AVNEFLPANTAVEAIQHSMDLYAQYIMQSLRR  212



>ref|XP_009408297.1| PREDICTED: soluble inorganic pyrophosphatase [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408298.1| PREDICTED: soluble inorganic pyrophosphatase [Musa acuminata 
subsp. malaccensis]
Length=212

 Score =   387 bits (995),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N  A+   +  PRLNERILSSMSRRSVAAHPWHDLEIG  AP  FNVV+EITKGSK
Sbjct  1    MSTVNGAASTETRTVPRLNERILSSMSRRSVAAHPWHDLEIGPGAPAVFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVL+LMQEPVLPG FLRA
Sbjct  61   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLILMQEPVLPGSFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHY D+S+LPPHRLAEIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDLSELPPHRLAEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVNEFLP+ TA EAI+YSMDLYA+YI+Q+LR+
Sbjct  181  AVNEFLPATTAREAIQYSMDLYAQYILQSLRQ  212



>ref|XP_009599170.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana 
tomentosiformis]
 ref|XP_009599171.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana 
tomentosiformis]
Length=209

 Score =   387 bits (994),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
             +R PRLNERILSS+SRRSVAAHPWHDLEIG EAPK FNVVIEITKGSKVKYELDKKTGL
Sbjct  9    HRRAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPKVFNVVIEITKGSKVKYELDKKTGL  68

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSS+VYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  69   IKVDRVLYSSMVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  128

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHYTDI+QLPPHRLAEIRRFFEDYKK ENKEVAVNEFLP  TA
Sbjct  129  GEKDDKIIAVCADDPEYRHYTDINQLPPHRLAEIRRFFEDYKKLENKEVAVNEFLPPSTA  188

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             +AI+YSMDLYAEYI+QTLRK
Sbjct  189  VDAIQYSMDLYAEYILQTLRK  209



>ref|XP_009405328.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=212

 Score =   387 bits (994),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+ N  A+  ++  PRLNERILSS+S+RSVAAHPWHDLEIG EAP  FNVV+EITKGSK
Sbjct  1    MSKENGTASTERRPVPRLNERILSSLSKRSVAAHPWHDLEIGPEAPAVFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVIPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHY D+S+LPPHRLAEIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDLSELPPHRLAEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVNEFL +  A EAI+YSMDLYAEYI+Q+LR+
Sbjct  181  AVNEFLSTTAAREAIQYSMDLYAEYILQSLRR  212



>ref|XP_008781407.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Phoenix 
dactylifera]
Length=212

 Score =   386 bits (991),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+ N   A  ++  PRLNERILSS+SRRSVAAHPWHDLEIG  AP  FNVV+EITKGSK
Sbjct  1    MSEENGSPATEKRPVPRLNERILSSLSRRSVAAHPWHDLEIGPGAPSVFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVL+LMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLILMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHY ++S+L PHRLAEI+RFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNELSELSPHRLAEIKRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVNEFLP++TA EAI+YSMDLYA+YIMQ+LR+
Sbjct  181  AVNEFLPANTAVEAIQYSMDLYAQYIMQSLRR  212



>ref|XP_002268289.1| PREDICTED: soluble inorganic pyrophosphatase [Vitis vinifera]
 emb|CAN81349.1| hypothetical protein VITISV_012719 [Vitis vinifera]
Length=222

 Score =   386 bits (991),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 185/221 (84%), Positives = 197/221 (89%), Gaps = 4/221 (2%)
 Frame = +1

Query  172  SNQ*NMSQSNEV----AAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNV  339
            S+Q N  ++ E         Q   PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FN 
Sbjct  2    SDQVNKHEAQETHVQETQLQQHSVPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNC  61

Query  340  VIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEP  519
            V+EITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVL+LMQEP
Sbjct  62   VVEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLILMQEP  121

Query  520  VLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFED  699
            VLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDI +L PHRLAEIRRFFE+
Sbjct  122  VLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDIKELAPHRLAEIRRFFEE  181

Query  700  YKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            YKKNENKEVAVN+FLPS TA EAI+YSMDLYAEYIMQTLR+
Sbjct  182  YKKNENKEVAVNDFLPSTTAVEAIQYSMDLYAEYIMQTLRR  222



>ref|XP_009617144.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana 
tomentosiformis]
 ref|XP_009617145.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana 
tomentosiformis]
 ref|XP_009617146.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana 
tomentosiformis]
Length=209

 Score =   385 bits (989),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q++ PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVVIEITKGSKVKYELDKKTGL
Sbjct  9    QRQAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPNIFNVVIEITKGSKVKYELDKKTGL  68

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYP NYGFIPRTLCED+DPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  69   IKVDRVLYSSVVYPQNYGFIPRTLCEDSDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  128

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHYT+I+QLPPHRLAEIRRFFEDYKKNENKEVAVN+FL  +TA
Sbjct  129  GEKDDKIIAVCADDPEYRHYTNINQLPPHRLAEIRRFFEDYKKNENKEVAVNDFLAPNTA  188

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYI+QTLRK
Sbjct  189  VEAIQYSMDLYAEYILQTLRK  209



>ref|XP_008459809.1| PREDICTED: soluble inorganic pyrophosphatase [Cucumis melo]
 ref|XP_008459810.1| PREDICTED: soluble inorganic pyrophosphatase [Cucumis melo]
Length=211

 Score =   385 bits (990),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  196  SNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKY  375
            ++E A   + R PRLNERILSS+SRRSVAAHPWHDLEIG +APK FN V+EITKGSKVKY
Sbjct  3    TDENANGDKNRAPRLNERILSSLSRRSVAAHPWHDLEIGPDAPKIFNCVVEITKGSKVKY  62

Query  376  ELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAI  555
            ELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA+AI
Sbjct  63   ELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAKAI  122

Query  556  GLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVN  735
            GLMPMIDQGEKDDKIIAVCADDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEVAVN
Sbjct  123  GLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVN  182

Query  736  EFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            EFLPS  A EAI+YSMDLYAEYI+ TLR+
Sbjct  183  EFLPSGVALEAIQYSMDLYAEYILHTLRR  211



>ref|XP_010542812.1| PREDICTED: soluble inorganic pyrophosphatase [Tarenaya hassleriana]
Length=214

 Score =   385 bits (990),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 180/201 (90%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSKVKYELDKKTGL
Sbjct  14   QRSAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSKVKYELDKKTGL  73

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  74   IKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFLRARAIGLMPMIDQ  133

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEY+HYTDI QLPPHRL EIRRFFEDYKKNENKEVAVN+FLPS+TA
Sbjct  134  GEKDDKIIAVCADDPEYKHYTDIKQLPPHRLTEIRRFFEDYKKNENKEVAVNDFLPSETA  193

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYI+ TLR+
Sbjct  194  VEAIQYSMDLYAEYILHTLRR  214



>ref|XP_006352220.1| PREDICTED: soluble inorganic pyrophosphatase-like [Solanum tuberosum]
Length=204

 Score =   385 bits (988),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            ++  PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVVIEITKGSKVKYELDKKTGL
Sbjct  4    ERSVPRLNERILSSLSRRSVAAHPWHDLEIGPEAPNVFNVVIEITKGSKVKYELDKKTGL  63

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  64   IKVDRVLYSSVVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  123

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHYT+I+QLPPHRLAEIRRFFE+YKKNENKEVAV+EFLP +TA
Sbjct  124  GEKDDKIIAVCADDPEYRHYTNINQLPPHRLAEIRRFFEEYKKNENKEVAVDEFLPPNTA  183

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYI+QTLRK
Sbjct  184  AEAIQYSMDLYAEYILQTLRK  204



>sp|Q43187.1|IPYR_SOLTU RecName: Full=Soluble inorganic pyrophosphatase; AltName: Full=Pyrophosphate 
phospho-hydrolase; Short=PPase [Solanum tuberosum]
 emb|CAA85362.1| soluble inorganic pyrophosphatase [Solanum tuberosum]
Length=211

 Score =   385 bits (988),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N+  + PQ+R PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVVIEI+KGSK
Sbjct  1    MSNENDDLS-PQRRAPRLNERILSSISRRSVAAHPWHDLEIGPEAPSVFNVVIEISKGSK  59

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA
Sbjct  60   VKYELDKKTGLIKVDRILYSSVVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  119

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDI QLPPHRLAEIRRFFEDYKKNENK+V
Sbjct  120  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDIKQLPPHRLAEIRRFFEDYKKNENKDV  179

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AV++FLP ++A  AI+YSMDLYAEYI+ +LRK
Sbjct  180  AVDDFLPPNSAVNAIQYSMDLYAEYILHSLRK  211



>ref|XP_006360727.1| PREDICTED: soluble inorganic pyrophosphatase-like [Solanum tuberosum]
Length=211

 Score =   384 bits (987),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N+  + PQ+R PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVVIEI+KGSK
Sbjct  1    MSNENDDLS-PQRRAPRLNERILSSISRRSVAAHPWHDLEIGPEAPSVFNVVIEISKGSK  59

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA
Sbjct  60   VKYELDKKTGLIKVDRILYSSVVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  119

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDI QLPPHRLAEIRRFFEDYKKNENK+V
Sbjct  120  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDIKQLPPHRLAEIRRFFEDYKKNENKDV  179

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AV++FLP  +A  AI+YSMDLYAEYI+ +LRK
Sbjct  180  AVDDFLPPSSAVNAIQYSMDLYAEYILHSLRK  211



>ref|XP_004252616.1| PREDICTED: soluble inorganic pyrophosphatase [Solanum lycopersicum]
Length=213

 Score =   384 bits (987),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  217  PQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTG  396
            PQ+R PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVVIEI+KGSKVKYELDKKTG
Sbjct  12   PQRRAPRLNERILSSISRRSVAAHPWHDLEIGPEAPSVFNVVIEISKGSKVKYELDKKTG  71

Query  397  LIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMID  576
            LIKVDRILYSSVVYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMID
Sbjct  72   LIKVDRILYSSVVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMID  131

Query  577  QGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDT  756
            QGEKDDKIIAVCADDPEYRHYTDI QLPPHRLAEIRRFFEDYKKNENK+VAV++FLP  T
Sbjct  132  QGEKDDKIIAVCADDPEYRHYTDIKQLPPHRLAEIRRFFEDYKKNENKDVAVDDFLPPST  191

Query  757  AFEAIKYSMDLYAEYIMQTLRK  822
            A +AI+YSMDLYAEYI+ +LRK
Sbjct  192  AVDAIQYSMDLYAEYILHSLRK  213



>ref|XP_009758552.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana 
sylvestris]
Length=209

 Score =   384 bits (986),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
             +R PRLNERILSS+SRRSVAAHPWHDLEIG EAPK FNVVIEI+KGSKVKYELDKKTGL
Sbjct  9    HRRAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPKVFNVVIEISKGSKVKYELDKKTGL  68

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSS+VYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  69   IKVDRVLYSSMVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  128

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHYTDI+QL PHRLAEIRRFFEDYKK ENKEVAVNEFLP +TA
Sbjct  129  GEKDDKIIAVCADDPEYRHYTDINQLAPHRLAEIRRFFEDYKKLENKEVAVNEFLPPNTA  188

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             +AI+YSMDLYAEYI+QTLRK
Sbjct  189  VDAIQYSMDLYAEYILQTLRK  209



>ref|XP_006491395.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X1 
[Citrus sinensis]
 ref|XP_006491396.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 
[Citrus sinensis]
Length=218

 Score =   384 bits (986),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = +1

Query  190  SQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKV  369
               +E    PQ   PRLNERILSSMSRRSVAAHPWHDLEIG  AP  FNVV+EI+KGSKV
Sbjct  8    GDGSETVEAPQGSVPRLNERILSSMSRRSVAAHPWHDLEIGPGAPTIFNVVVEISKGSKV  67

Query  370  KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAR  549
            KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVL+LMQEPVLPGCFLRA+
Sbjct  68   KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLILMQEPVLPGCFLRAK  127

Query  550  AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVA  729
            AIGLMPMIDQGEKDDKIIAVCADDPEY+HY DI +LPPHRL+EIRRFFEDYKKNENKEVA
Sbjct  128  AIGLMPMIDQGEKDDKIIAVCADDPEYKHYNDIKELPPHRLSEIRRFFEDYKKNENKEVA  187

Query  730  VNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VNEFLPS  A EAI+YSMDLYAEYI+ TLR+
Sbjct  188  VNEFLPSSAAVEAIQYSMDLYAEYILHTLRR  218



>ref|XP_006444701.1| hypothetical protein CICLE_v10022171mg [Citrus clementina]
 gb|ESR57941.1| hypothetical protein CICLE_v10022171mg [Citrus clementina]
Length=218

 Score =   384 bits (986),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = +1

Query  190  SQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKV  369
               +E    PQ   PRLNERILSSMSRRSVAAHPWHDLEIG  AP  FNVV+EI+KGSKV
Sbjct  8    GDGSEAVEAPQGSVPRLNERILSSMSRRSVAAHPWHDLEIGPGAPTIFNVVVEISKGSKV  67

Query  370  KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAR  549
            KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVL+LMQEPVLPGCFLRA+
Sbjct  68   KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLILMQEPVLPGCFLRAK  127

Query  550  AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVA  729
            AIGLMPMIDQGEKDDKIIAVCADDPEY+HY DI +LPPHRL+EIRRFFEDYKKNENKEVA
Sbjct  128  AIGLMPMIDQGEKDDKIIAVCADDPEYKHYNDIKELPPHRLSEIRRFFEDYKKNENKEVA  187

Query  730  VNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VNEFLPS  A EAI+YSMDLYAEYI+ TLR+
Sbjct  188  VNEFLPSSAAVEAIQYSMDLYAEYILHTLRR  218



>ref|XP_004140526.1| PREDICTED: soluble inorganic pyrophosphatase-like [Cucumis sativus]
 ref|XP_004171198.1| PREDICTED: soluble inorganic pyrophosphatase-like [Cucumis sativus]
 gb|KGN46478.1| hypothetical protein Csa_6G095940 [Cucumis sativus]
Length=211

 Score =   384 bits (985),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +1

Query  196  SNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKY  375
            ++E     + R PRLNERILSS+SRRSVAAHPWHDLEIG +APK FN V+EITKGSKVKY
Sbjct  3    TDENGNGDKNRAPRLNERILSSLSRRSVAAHPWHDLEIGPDAPKIFNCVVEITKGSKVKY  62

Query  376  ELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAI  555
            ELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA+AI
Sbjct  63   ELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAKAI  122

Query  556  GLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVN  735
            GLMPMIDQGEKDDKIIAVCADDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEVAVN
Sbjct  123  GLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVN  182

Query  736  EFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            EFLPS  A EAI+YSMDLYAEYI+ TLR+
Sbjct  183  EFLPSGVALEAIQYSMDLYAEYILHTLRR  211



>ref|NP_001274958.1| soluble inorganic pyrophosphatase [Solanum tuberosum]
 gb|ABK76339.1| soluble inorganic pyrophosphatase [Solanum tuberosum]
Length=211

 Score =   383 bits (984),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N+  + PQ+R PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVVIEI+KGSK
Sbjct  1    MSNENDDLS-PQRRAPRLNERILSSISRRSVAAHPWHDLEIGPEAPSVFNVVIEISKGSK  59

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA
Sbjct  60   VKYELDKKTGLIKVDRILYSSVVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  119

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDI QLPPHRL EIRRFFEDYKKNENK+V
Sbjct  120  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDIKQLPPHRLVEIRRFFEDYKKNENKDV  179

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AV++FLP  +A  AI+YSMDLYAEYI+ +LRK
Sbjct  180  AVDDFLPPSSAVNAIQYSMDLYAEYILHSLRK  211



>ref|XP_006386667.1| hypothetical protein POPTR_0002s18230g [Populus trichocarpa]
 gb|ERP64464.1| hypothetical protein POPTR_0002s18230g [Populus trichocarpa]
Length=215

 Score =   383 bits (983),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 196/211 (93%), Gaps = 2/211 (1%)
 Frame = +1

Query  190  SQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKV  369
            +Q NEV    + + PRLNERILSS+SRR+VAAHPWHDLEIG  AP  FNVV+EITKGSKV
Sbjct  7    TQENEVET--KHQAPRLNERILSSLSRRTVAAHPWHDLEIGPGAPHIFNVVVEITKGSKV  64

Query  370  KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAR  549
            KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRAR
Sbjct  65   KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRAR  124

Query  550  AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVA  729
            AIGLMPMIDQGEKDDKIIAVCADDPEY+HYTDI +L PHRL+EIRRFFEDYKKNENKEVA
Sbjct  125  AIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKELAPHRLSEIRRFFEDYKKNENKEVA  184

Query  730  VNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VN+FLPS+TA EAI+YSMDLYAEY++ TLR+
Sbjct  185  VNDFLPSNTAVEAIQYSMDLYAEYVLHTLRR  215



>gb|AAD46520.1|AF149116_1 soluble inorganic pyrophosphatase [Populus tremula x Populus 
tremuloides]
 gb|AAS79105.1| soluble inorganic pyrophosphatase [Populus tomentosa]
Length=215

 Score =   382 bits (982),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 196/211 (93%), Gaps = 2/211 (1%)
 Frame = +1

Query  190  SQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKV  369
            +Q NEV    + + PRLNERILSS+SRR+VAAHPWHDLEIG  AP  FNVV+EITKGSKV
Sbjct  7    TQENEVET--KHQAPRLNERILSSLSRRTVAAHPWHDLEIGPGAPHIFNVVVEITKGSKV  64

Query  370  KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAR  549
            KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRAR
Sbjct  65   KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRAR  124

Query  550  AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVA  729
            AIGLMPMIDQGEKDDKIIAVCADDPEY+HYTDI +L PHRL+EIRRFFEDYKKNENKEVA
Sbjct  125  AIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKELAPHRLSEIRRFFEDYKKNENKEVA  184

Query  730  VNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VN+FLPS+TA EAI+YSMDLYAEYI+ TLR+
Sbjct  185  VNDFLPSNTAVEAIQYSMDLYAEYILHTLRR  215



>ref|XP_011025347.1| PREDICTED: soluble inorganic pyrophosphatase [Populus euphratica]
Length=215

 Score =   382 bits (982),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 196/211 (93%), Gaps = 2/211 (1%)
 Frame = +1

Query  190  SQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKV  369
            +Q NEV    + + PRLNERILSS+SRR+VAAHPWHDLEIG  AP  FNVV+EITKGSKV
Sbjct  7    TQDNEVET--RHQAPRLNERILSSLSRRTVAAHPWHDLEIGPGAPHIFNVVVEITKGSKV  64

Query  370  KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAR  549
            KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRAR
Sbjct  65   KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRAR  124

Query  550  AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVA  729
            AIGLMPMIDQGEKDDKIIAVCADDPEY+HYTDI +L PHRL+EIRRFFEDYKKNENKEVA
Sbjct  125  AIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKELAPHRLSEIRRFFEDYKKNENKEVA  184

Query  730  VNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VN+FLPS+TA EAI+YSMDLYAEYI+ TLR+
Sbjct  185  VNDFLPSNTAVEAIQYSMDLYAEYILHTLRR  215



>ref|XP_004245439.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 
[Solanum lycopersicum]
 ref|XP_006343758.1| PREDICTED: soluble inorganic pyrophosphatase-like [Solanum tuberosum]
Length=205

 Score =   382 bits (980),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVVIEI+KGSKVKYELDKKTGL
Sbjct  5    QRHAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPNVFNVVIEISKGSKVKYELDKKTGL  64

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSS+VYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  65   IKVDRVLYSSMVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  124

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHYTDI+QL PHRLAEIRRFFEDYKK ENKEVAVNEFLP  TA
Sbjct  125  GEKDDKIIAVCADDPEYRHYTDINQLAPHRLAEIRRFFEDYKKLENKEVAVNEFLPPSTA  184

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             +AI+YSMDLYAEYI+QTLRK
Sbjct  185  VQAIQYSMDLYAEYILQTLRK  205



>ref|XP_002320239.1| inorganic pyrophosphatase family protein [Populus trichocarpa]
 ref|XP_011039525.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Populus 
euphratica]
 ref|XP_011039533.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Populus 
euphratica]
 gb|ABK94595.1| unknown [Populus trichocarpa]
 gb|EEE98554.1| inorganic pyrophosphatase family protein [Populus trichocarpa]
Length=216

 Score =   382 bits (981),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 1/211 (0%)
 Frame = +1

Query  190  SQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKV  369
            +Q NEV    +++ PRLNERILSS+SRR+VAAHPWHDLEIG  AP  FNVV+EITKGSKV
Sbjct  7    TQENEVVE-AKRQAPRLNERILSSLSRRTVAAHPWHDLEIGPGAPHIFNVVVEITKGSKV  65

Query  370  KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAR  549
            KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRAR
Sbjct  66   KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRAR  125

Query  550  AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVA  729
            AIGLMPMIDQGEKDDKIIAVCADDPEY+HYTDI +L PHRL+EIRRFFEDYKKNENKEVA
Sbjct  126  AIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIRELAPHRLSEIRRFFEDYKKNENKEVA  185

Query  730  VNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VN+FLPS++A EAI+YSMDLYAEYI+ TLR+
Sbjct  186  VNDFLPSNSAVEAIQYSMDLYAEYILHTLRR  216



>ref|NP_001140260.1| soluble inorganic pyrophosphatase [Zea mays]
 gb|ACF79910.1| unknown [Zea mays]
 gb|AFW81813.1| soluble inorganic pyrophosphatase [Zea mays]
Length=224

 Score =   382 bits (980),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +1

Query  217  PQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTG  396
            P++R PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVV+EITKGSKVKYELDKKTG
Sbjct  23   PKRRAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPAVFNVVVEITKGSKVKYELDKKTG  82

Query  397  LIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMID  576
            LIKVDRILYSSVVYPHNYGF+PRTLCEDNDPMDVLVLMQEPVLPG FLRARAIGLMPMID
Sbjct  83   LIKVDRILYSSVVYPHNYGFVPRTLCEDNDPMDVLVLMQEPVLPGAFLRARAIGLMPMID  142

Query  577  QGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDT  756
            QGEKDDKIIAVCADDPEYRHY DIS+L PHRL EIRRFFEDYKKNENKEVAVN+FLP+  
Sbjct  143  QGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIRRFFEDYKKNENKEVAVNDFLPAAA  202

Query  757  AFEAIKYSMDLYAEYIMQTLRK  822
            A EAI+YSMDLY +YIMQTLR+
Sbjct  203  AREAIQYSMDLYGQYIMQTLRR  224



>ref|XP_011039516.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Populus 
euphratica]
Length=235

 Score =   382 bits (980),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 1/211 (0%)
 Frame = +1

Query  190  SQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKV  369
            +Q NEV    +++ PRLNERILSS+SRR+VAAHPWHDLEIG  AP  FNVV+EITKGSKV
Sbjct  26   TQENEVVE-AKRQAPRLNERILSSLSRRTVAAHPWHDLEIGPGAPHIFNVVVEITKGSKV  84

Query  370  KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAR  549
            KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRAR
Sbjct  85   KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRAR  144

Query  550  AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVA  729
            AIGLMPMIDQGEKDDKIIAVCADDPEY+HYTDI +L PHRL+EIRRFFEDYKKNENKEVA
Sbjct  145  AIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIRELAPHRLSEIRRFFEDYKKNENKEVA  204

Query  730  VNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VN+FLPS++A EAI+YSMDLYAEYI+ TLR+
Sbjct  205  VNDFLPSNSAVEAIQYSMDLYAEYILHTLRR  235



>ref|XP_010522877.1| PREDICTED: soluble inorganic pyrophosphatase [Tarenaya hassleriana]
Length=214

 Score =   380 bits (977),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRS AAHPWHDLEIG  AP+ FNVV+EITKGSKVKYELDKKTGL
Sbjct  14   QRSAPRLNERILSSLSRRSGAAHPWHDLEIGPGAPQIFNVVVEITKGSKVKYELDKKTGL  73

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  74   IKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFLRARAIGLMPMIDQ  133

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEY+HYTDI QLPPHRL EIRRFFEDYKKNENKEVAV+EFLPS+TA
Sbjct  134  GEKDDKIIAVCADDPEYKHYTDIKQLPPHRLTEIRRFFEDYKKNENKEVAVDEFLPSETA  193

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI++SMDLYAEYI+ TLR+
Sbjct  194  VEAIQHSMDLYAEYILHTLRR  214



>ref|XP_002439868.1| hypothetical protein SORBIDRAFT_09g021610 [Sorghum bicolor]
 gb|EES18298.1| hypothetical protein SORBIDRAFT_09g021610 [Sorghum bicolor]
Length=229

 Score =   381 bits (978),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+R PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVV+EITKGSKVKYELDKKTGL
Sbjct  29   QRRAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPAVFNVVVEITKGSKVKYELDKKTGL  88

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPG FLRARAIGLMPMIDQ
Sbjct  89   IKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGAFLRARAIGLMPMIDQ  148

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHY DIS+L PHRL EIRRFFEDYKKNENKEVAVN+FLP+  A
Sbjct  149  GEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIRRFFEDYKKNENKEVAVNDFLPAAAA  208

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLY +YIMQTLR+
Sbjct  209  REAIQYSMDLYGQYIMQTLRR  229



>ref|XP_007051388.1| Pyrophosphorylase 1 [Theobroma cacao]
 gb|EOX95545.1| Pyrophosphorylase 1 [Theobroma cacao]
Length=216

 Score =   380 bits (976),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 197/216 (91%), Gaps = 4/216 (2%)
 Frame = +1

Query  187  MSQSNEVAA----FPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEIT  354
            MS+++E AA      ++  PRLNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EIT
Sbjct  1    MSEADENAAKEVEASRQPVPRLNERILSSLSRRSVAAHPWHDLEIGPGAPHVFNCVVEIT  60

Query  355  KGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGC  534
            KGSKVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+D LV+MQEPVLPGC
Sbjct  61   KGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDCLVIMQEPVLPGC  120

Query  535  FLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNE  714
            FLRARAIGLMPMIDQGEKDDKIIAVCADDPEY+HYTDI  LPPHRL+EIRRFFEDYKKNE
Sbjct  121  FLRARAIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKDLPPHRLSEIRRFFEDYKKNE  180

Query  715  NKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            NKEVAVN+FLPS TAFEAI+YSMDLYAEYI+ TLR+
Sbjct  181  NKEVAVNDFLPSTTAFEAIQYSMDLYAEYILHTLRR  216



>ref|XP_006305610.1| hypothetical protein CARUB_v10010288mg [Capsella rubella]
 gb|EOA38508.1| hypothetical protein CARUB_v10010288mg [Capsella rubella]
Length=212

 Score =   380 bits (975),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSKVKYELDKKTGL
Sbjct  12   QRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSKVKYELDKKTGL  71

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  72   IKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRARAIGLMPMIDQ  131

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEVAVN+FLPS+TA
Sbjct  132  GEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVNDFLPSETA  191

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYI+ TLR+
Sbjct  192  VEAIQYSMDLYAEYILHTLRR  212



>ref|XP_006418370.1| hypothetical protein EUTSA_v10008767mg [Eutrema salsugineum]
 gb|ESQ36723.1| hypothetical protein EUTSA_v10008767mg [Eutrema salsugineum]
Length=212

 Score =   380 bits (975),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+  +     Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSK
Sbjct  1    MSEETKEDQKLQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLPS++A EAI+YSMDLYAEYI+ TLR+
Sbjct  181  AVNDFLPSESAVEAIQYSMDLYAEYILHTLRR  212



>ref|XP_009393406.1| PREDICTED: soluble inorganic pyrophosphatase-like [Musa acuminata 
subsp. malaccensis]
Length=212

 Score =   379 bits (974),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  NE A+      P+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVV+EITKGSK
Sbjct  1    MSGENEAASADNHPAPQLNERILSSLSRRSVAAHPWHDLEIGPGAPAVFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRH+ D+++L PHRLAEIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHFNDLNELSPHRLAEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVNEFLP+ TA EAI++SMDLYA+YI+Q+LR+
Sbjct  181  AVNEFLPASTAREAIQHSMDLYAQYILQSLRR  212



>ref|XP_006444700.1| hypothetical protein CICLE_v10024641mg [Citrus clementina]
 ref|XP_006491398.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 
[Citrus sinensis]
 gb|ESR57940.1| hypothetical protein CICLE_v10024641mg [Citrus clementina]
Length=250

 Score =   381 bits (978),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = +1

Query  151  TPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKT  330
            +PF+   S+  ++ + +E AA   +  P+LNERILSS+SRRSVAAHPWHDLEIG  AP  
Sbjct  28   SPFTF-ISDSSSIFKMSEEAANVSRSAPKLNERILSSLSRRSVAAHPWHDLEIGPGAPNV  86

Query  331  FNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLM  510
            FN V+EITKGSKVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVLVLM
Sbjct  87   FNCVVEITKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLVLM  146

Query  511  QEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRF  690
            QEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEY+HYTDI +LPPHRL EIRRF
Sbjct  147  QEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKELPPHRLTEIRRF  206

Query  691  FEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            FEDYKKNENK+VAVNEFLP+ TA EAI+YSMDLYAEYIM +LR+
Sbjct  207  FEDYKKNENKKVAVNEFLPTSTAVEAIQYSMDLYAEYIMLSLRR  250



>gb|EPS64301.1| hypothetical protein M569_10470, partial [Genlisea aurea]
Length=201

 Score =   379 bits (973),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            QK+ P+LNERILSS+SRRSVAAHPWHDLEIG+ AP+  NVVIEI+KGSKVKYELDKKTGL
Sbjct  1    QKQAPKLNERILSSLSRRSVAAHPWHDLEIGSGAPQIVNVVIEISKGSKVKYELDKKTGL  60

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PGCFLRARAIGLMPMIDQ
Sbjct  61   IKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVVPGCFLRARAIGLMPMIDQ  120

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRH TDI+QLPPHRLAEI+RFFEDYKKNENKEV V+EFLPS TA
Sbjct  121  GEKDDKIIAVCADDPEYRHITDITQLPPHRLAEIKRFFEDYKKNENKEVEVDEFLPSATA  180

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             +AI+YSMDLYAEYI+ TLRK
Sbjct  181  TDAIQYSMDLYAEYILHTLRK  201



>ref|XP_010241055.1| PREDICTED: soluble inorganic pyrophosphatase [Nelumbo nucifera]
 ref|XP_010241056.1| PREDICTED: soluble inorganic pyrophosphatase [Nelumbo nucifera]
Length=212

 Score =   379 bits (973),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  P+LNERILSS+SRRSVAAHPWHDLEIG  AP+  N V+EITKGSKVKYELDKKTGL
Sbjct  12   QRPVPQLNERILSSLSRRSVAAHPWHDLEIGPGAPQVVNCVVEITKGSKVKYELDKKTGL  71

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVL+LMQEPVLPGCFLR RAIGLMPMIDQ
Sbjct  72   IKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLILMQEPVLPGCFLRVRAIGLMPMIDQ  131

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHYTDI QLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSD A
Sbjct  132  GEKDDKIIAVCADDPEYRHYTDIKQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDAA  191

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI++SMDLYA+YI+QTLR+
Sbjct  192  QEAIQHSMDLYAQYILQTLRR  212



>gb|KDP28400.1| hypothetical protein JCGZ_14171 [Jatropha curcas]
Length=211

 Score =   379 bits (972),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            PRLNERILSSMS+R+VAAHPWHDLEIG  AP  FNVV+EITKGSKVKYELDKKTGLIKVD
Sbjct  15   PRLNERILSSMSKRTVAAHPWHDLEIGPGAPHIFNVVVEITKGSKVKYELDKKTGLIKVD  74

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD
Sbjct  75   RILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  134

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEVAVNEFLPS+ + EAI
Sbjct  135  DKIIAVCADDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVNEFLPSNHSVEAI  194

Query  772  KYSMDLYAEYIMQTLRK  822
            +YSMDLYAEYI+QTLR+
Sbjct  195  QYSMDLYAEYILQTLRR  211



>ref|NP_171613.1| pyrophosphorylase 1 [Arabidopsis thaliana]
 ref|XP_002889389.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|AAK96621.1| At1g01050/T25K16_5 [Arabidopsis thaliana]
 gb|AAL15299.1| At1g01050/T25K16_5 [Arabidopsis thaliana]
 gb|AAL38377.1| putative inorganic pyrophosphatase [Arabidopsis thaliana]
 gb|AAM10117.1| putative inorganic pyrophosphatase [Arabidopsis thaliana]
 gb|AAM61573.1| soluble inorganic pyrophosphatase, putative [Arabidopsis thaliana]
 gb|AAN64535.1| At1g01050/T25K16_5 [Arabidopsis thaliana]
 dbj|BAE98927.1| putative soluble inorganic pyrophosphatase [Arabidopsis thaliana]
 dbj|BAH30256.1| hypothetical protein [Arabidopsis thaliana]
 gb|EFH65648.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27222.1| inorganic pyrophosphatase [Arabidopsis thaliana]
Length=212

 Score =   379 bits (972),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+  +     Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSK
Sbjct  1    MSEETKDNQRLQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLPS++A EAI+YSMDLYAEYI+ TLR+
Sbjct  181  AVNDFLPSESAVEAIQYSMDLYAEYILHTLRR  212



>ref|XP_010251694.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nelumbo nucifera]
Length=213

 Score =   379 bits (972),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
             PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FN V+EI KGSKVKYELDKKTGLIKV
Sbjct  16   APRLNERILSSLSRRSVAAHPWHDLEIGPGAPQVFNCVVEIAKGSKVKYELDKKTGLIKV  75

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PG FLRARAIGLMPMIDQGEK
Sbjct  76   DRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVIPGSFLRARAIGLMPMIDQGEK  135

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            D KIIAVCADDPEYRHYTDI QLPPHRLAEIRRFFEDYKKNENKEVAVN+FLPS+TA+EA
Sbjct  136  DHKIIAVCADDPEYRHYTDIEQLPPHRLAEIRRFFEDYKKNENKEVAVNDFLPSETAYEA  195

Query  769  IKYSMDLYAEYIMQTLRK  822
            I+YSMDLYAEYI+Q+LR+
Sbjct  196  IQYSMDLYAEYILQSLRR  213



>ref|XP_009118787.1| PREDICTED: soluble inorganic pyrophosphatase [Brassica rapa]
 emb|CDY32448.1| BnaA09g51480D [Brassica napus]
Length=206

 Score =   378 bits (971),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSKVKYELDKKTGL
Sbjct  6    QRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSKVKYELDKKTGL  65

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  66   IKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRARAIGLMPMIDQ  125

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEVAVN+FLPS+ A
Sbjct  126  GEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVNDFLPSENA  185

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYI+ TLR+
Sbjct  186  IEAIQYSMDLYAEYILHTLRR  206



>ref|XP_011081347.1| PREDICTED: soluble inorganic pyrophosphatase-like [Sesamum indicum]
Length=211

 Score =   378 bits (971),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N        R P+LNERILSS+SRRSVAAHPWHDLEIG  AP+  NVVIEI+KGSK
Sbjct  1    MSDGNGTEG-AAGRAPKLNERILSSLSRRSVAAHPWHDLEIGPGAPQIINVVIEISKGSK  59

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPR+LCEDNDPMDVLV+MQEPV+PGCFLRA
Sbjct  60   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRSLCEDNDPMDVLVIMQEPVVPGCFLRA  119

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRH+TDISQLPPHRL EIRRFFEDYKKNENKEV
Sbjct  120  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHFTDISQLPPHRLTEIRRFFEDYKKNENKEV  179

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AV+EFLPSDTA  AI++SMDLYAEYI+ TLRK
Sbjct  180  AVDEFLPSDTALTAIQHSMDLYAEYILHTLRK  211



>ref|XP_008347191.1| PREDICTED: soluble inorganic pyrophosphatase [Malus domestica]
Length=211

 Score =   378 bits (971),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+  E     QK  P+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVVIEITKGSK
Sbjct  1    MSEGKEEETKTQK-APKLNERILSSLSRRSVAAHPWHDLEIGPSAPNVFNVVIEITKGSK  59

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRA
Sbjct  60   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRA  119

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIG+MPMIDQGEKDDKIIAVCADDPEYRH+T+++ LPPHRL+EIRRFFEDYKKNENKEV
Sbjct  120  RAIGVMPMIDQGEKDDKIIAVCADDPEYRHFTELNDLPPHRLSEIRRFFEDYKKNENKEV  179

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN FLP  TA EAI+YSMDLYAEYI+ TLR+
Sbjct  180  AVNAFLPVSTALEAIQYSMDLYAEYILHTLRR  211



>ref|XP_003637867.1| Soluble inorganic pyrophosphatase [Medicago truncatula]
Length=237

 Score =   379 bits (973),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 184/236 (78%), Positives = 199/236 (84%), Gaps = 0/236 (0%)
 Frame = +1

Query  115  LHFYLDLLSPPVTPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPW  294
            L F++ L  PP TPF         MS+         + TPRLNERILSS+SRRSVAAHPW
Sbjct  2    LRFWISLHYPPFTPFLNILLVLFKMSEEKSEEVQETRPTPRLNERILSSLSRRSVAAHPW  61

Query  295  HDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLC  474
            HDLEIG  AP  FN V+EITKGSKVKYELDKKTG+IKVDRILYSSVVYPHNYGFIPRTLC
Sbjct  62   HDLEIGPGAPNIFNCVVEITKGSKVKYELDKKTGMIKVDRILYSSVVYPHNYGFIPRTLC  121

Query  475  EDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQ  654
            EDNDP+DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEY+HYTD  +
Sbjct  122  EDNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDFKE  181

Query  655  LPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            L PHRL EI+RFFEDYKKNENKEVAVNEFLP  TA EAI++SMDLYAEYI+ TLR+
Sbjct  182  LQPHRLMEIKRFFEDYKKNENKEVAVNEFLPPSTAVEAIQHSMDLYAEYILHTLRR  237



>ref|XP_009402629.1| PREDICTED: soluble inorganic pyrophosphatase-like [Musa acuminata 
subsp. malaccensis]
Length=212

 Score =   378 bits (970),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+ +E A+      P+LNERILSSMSRRSVAAHPWHDLEIG  AP  FNVV+EITKGSK
Sbjct  1    MSEGDETASTENHAAPQLNERILSSMSRRSVAAHPWHDLEIGPGAPGVFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCED+DP+DVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDSDPLDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRH+ D+++L PHRL EIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHFNDLNELSPHRLNEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVNEFLP++TA EAI++SMDLYA+YI+ TLR+
Sbjct  181  AVNEFLPANTAREAIQHSMDLYAQYILHTLRR  212



>ref|XP_010054965.1| PREDICTED: soluble inorganic pyrophosphatase [Eucalyptus grandis]
 gb|KCW71450.1| hypothetical protein EUGRSUZ_E00014 [Eucalyptus grandis]
Length=208

 Score =   377 bits (969),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
             PRLNERILSS+SRRSVAAHPWHDLEIG EAP+  N V+EITKGSKVKYELDKKTGLIKV
Sbjct  11   VPRLNERILSSLSRRSVAAHPWHDLEIGPEAPQIVNCVVEITKGSKVKYELDKKTGLIKV  70

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPV+PGCFLRARAIGLMPMIDQGEK
Sbjct  71   DRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPVVPGCFLRARAIGLMPMIDQGEK  130

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            DDKIIAVCADDPEY+HYTDI QLPPHRL+EIRRFFEDYKKNENKEVAVN+FLPS TA EA
Sbjct  131  DDKIIAVCADDPEYKHYTDIKQLPPHRLSEIRRFFEDYKKNENKEVAVNDFLPSSTATEA  190

Query  769  IKYSMDLYAEYIMQTLRK  822
            I+YSMDLYAEYI+ TLR+
Sbjct  191  IQYSMDLYAEYILHTLRR  208



>ref|XP_009119663.1| PREDICTED: soluble inorganic pyrophosphatase [Brassica rapa]
 emb|CDX90003.1| BnaA10g00790D [Brassica napus]
Length=212

 Score =   377 bits (969),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+  +     Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSK
Sbjct  1    MSEETKENQKLQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLPS+ A +AI+YSMDLYAEYI+ TLR+
Sbjct  181  AVNDFLPSEKAVDAIQYSMDLYAEYILHTLRR  212



>emb|CDY15206.1| BnaC05g00850D [Brassica napus]
Length=209

 Score =   377 bits (969),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSKVKYELDKKTGL
Sbjct  9    QRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSKVKYELDKKTGL  68

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  69   IKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRARAIGLMPMIDQ  128

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEVAVN+FLPS+ A
Sbjct  129  GEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVNDFLPSEKA  188

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYI+ TLR+
Sbjct  189  IEAIQYSMDLYAEYILHTLRR  209



>gb|AFK34361.1| unknown [Lotus japonicus]
Length=211

 Score =   377 bits (969),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            M ++ E  A   + TPRLNERILSS+SRRSVAAHPWHDLEIG EAPK FN V+EI+KGSK
Sbjct  1    MGENGE-KAHETRPTPRLNERILSSLSRRSVAAHPWHDLEIGPEAPKIFNCVVEISKGSK  59

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEP+LPGCFLRA
Sbjct  60   VKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPLDVLVIMQEPILPGCFLRA  119

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVC DDPEY+HYTD+SQLPPHRL EIRRFFEDYKKNENKEV
Sbjct  120  RAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDLSQLPPHRLHEIRRFFEDYKKNENKEV  179

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLP+  A EA++YSMDLY EYIM TLR+
Sbjct  180  AVNDFLPASNAVEAVQYSMDLYGEYIMHTLRR  211



>ref|XP_006396349.1| hypothetical protein EUTSA_v10028951mg [Eutrema salsugineum]
 gb|ESQ37802.1| hypothetical protein EUTSA_v10028951mg [Eutrema salsugineum]
Length=220

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = +1

Query  184  NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGS  363
            N S+    +   Q+ TPRLNERILSS+SRRSVAAHPWHDLEIG  AP  FNVVIEI+KGS
Sbjct  8    NQSEKENQSEKLQRPTPRLNERILSSLSRRSVAAHPWHDLEIGPGAPVIFNVVIEISKGS  67

Query  364  KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLR  543
            KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPVLPGCFLR
Sbjct  68   KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFLR  127

Query  544  ARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKE  723
            ARAIGLMPMIDQGEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKE
Sbjct  128  ARAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKE  187

Query  724  VAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VAVN+FLP+  A EAI+YSMDLYAEYI+ +LR+
Sbjct  188  VAVNDFLPNGPAVEAIQYSMDLYAEYILHSLRR  220



>ref|XP_002880270.1| hypothetical protein ARALYDRAFT_483853 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56529.1| hypothetical protein ARALYDRAFT_483853 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
             P+LNERILS++SRRSVAAHPWHDLEIG EAP  FNVV+EITKGSKVKYELDKKTGLIKV
Sbjct  19   VPKLNERILSTLSRRSVAAHPWHDLEIGPEAPLVFNVVVEITKGSKVKYELDKKTGLIKV  78

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK
Sbjct  79   DRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  138

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            DDKIIAVCADDPEY+H+TDI QL PHRL+EIRRFFEDYKKNENKEVAVN+FLPS++A EA
Sbjct  139  DDKIIAVCADDPEYKHFTDIKQLAPHRLSEIRRFFEDYKKNENKEVAVNDFLPSESAHEA  198

Query  769  IKYSMDLYAEYIMQTLRK  822
            I+YSMDLYAEYI+ TLR+
Sbjct  199  IQYSMDLYAEYILHTLRR  216



>ref|XP_004961950.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 
[Setaria italica]
Length=223

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +1

Query  217  PQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTG  396
            P++R PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVV+EITKGSKVKYELDKKTG
Sbjct  22   PKRRAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPAVFNVVVEITKGSKVKYELDKKTG  81

Query  397  LIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMID  576
            LIKVDR+LYSSVVYPHNYGFIPR+LCEDNDPMDVLVLMQEPVLPG FLRARAIGLMPMID
Sbjct  82   LIKVDRVLYSSVVYPHNYGFIPRSLCEDNDPMDVLVLMQEPVLPGAFLRARAIGLMPMID  141

Query  577  QGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDT  756
            QGEKDDKIIAVCADDPEYRHY DIS+L PHRL EIRRFFEDYKKNENK+VAV++FLP+  
Sbjct  142  QGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIRRFFEDYKKNENKDVAVDDFLPAAA  201

Query  757  AFEAIKYSMDLYAEYIMQTLRK  822
            A EAI+YSMDLY +YIMQTLR+
Sbjct  202  AREAIQYSMDLYGQYIMQTLRR  223



>emb|CDY55328.1| BnaC08g49780D [Brassica napus]
Length=206

 Score =   376 bits (966),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSKVKYELDKKTGL
Sbjct  6    QRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSKVKYELDKKTGL  65

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  66   IKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRARAIGLMPMIDQ  125

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEVAVN+FLPS+ A
Sbjct  126  GEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVNDFLPSENA  185

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             +AI+YSMDLYAEYI+ TLR+
Sbjct  186  IDAIQYSMDLYAEYILHTLRR  206



>ref|XP_004244731.1| PREDICTED: soluble inorganic pyrophosphatase-like [Solanum lycopersicum]
 ref|XP_010324681.1| PREDICTED: soluble inorganic pyrophosphatase-like [Solanum lycopersicum]
Length=204

 Score =   376 bits (966),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            ++  P LNERILSS+SRRSVAAHPWHDLEIG EAP  FN VIEITKGSKVKYELDKKTGL
Sbjct  4    ERSAPHLNERILSSLSRRSVAAHPWHDLEIGPEAPNVFNAVIEITKGSKVKYELDKKTGL  63

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  64   IKVDRVLYSSVVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  123

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHYT+I+QLPPHRLAEIRRFFE+YKKNENKEVAV+EFL  +TA
Sbjct  124  GEKDDKIIAVCADDPEYRHYTNINQLPPHRLAEIRRFFEEYKKNENKEVAVDEFLQPNTA  183

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYI+ TLRK
Sbjct  184  AEAIQYSMDLYAEYILHTLRK  204



>ref|XP_008244192.1| PREDICTED: soluble inorganic pyrophosphatase [Prunus mume]
Length=210

 Score =   376 bits (966),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 194/212 (92%), Gaps = 2/212 (1%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+ NE    PQ R P+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVV+EITKGSK
Sbjct  1    MSEGNEEPK-PQ-RAPKLNERILSSLSRRSVAAHPWHDLEIGPTAPHLFNVVVEITKGSK  58

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPVLPGCFLRA
Sbjct  59   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFLRA  118

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIG+MPMIDQGEKDDKIIAVCADDPEY HYT+++ LPPHRL+EIRRFFEDYKKNENKEV
Sbjct  119  RAIGVMPMIDQGEKDDKIIAVCADDPEYTHYTELNDLPPHRLSEIRRFFEDYKKNENKEV  178

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN FLP+  A EAI+YSMDLYAEYIM TLR+
Sbjct  179  AVNAFLPASAALEAIQYSMDLYAEYIMHTLRR  210



>ref|NP_001104889.1| soluble inorganic pyrophosphatase [Zea mays]
 ref|XP_008668607.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Zea 
mays]
 sp|O48556.1|IPYR_MAIZE RecName: Full=Soluble inorganic pyrophosphatase; AltName: Full=Pyrophosphate 
phospho-hydrolase; Short=PPase [Zea mays]
 gb|AAB88618.1| inorganic pyrophosphatase [Zea mays]
 gb|ACF86802.1| unknown [Zea mays]
 gb|ACG41555.1| soluble inorganic pyrophosphatase [Zea mays]
 gb|ACN26746.1| unknown [Zea mays]
 gb|ACR37898.1| unknown [Zea mays]
 tpg|DAA36749.1| TPA: soluble inorganic pyrophosphatase isoform 1 [Zea mays]
 tpg|DAA36750.1| TPA: soluble inorganic pyrophosphatase isoform 2 [Zea mays]
 tpg|DAA36751.1| TPA: soluble inorganic pyrophosphatase isoform 3 [Zea mays]
Length=214

 Score =   376 bits (966),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 197/214 (92%), Gaps = 2/214 (1%)
 Frame = +1

Query  187  MSQSNEVAAFPQ--KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKG  360
            MS+ ++ AA  +  KR P+LNERILSS+SRRSVAAHPWHDLEIG +AP  FNVV+EITKG
Sbjct  1    MSEEDKTAASAEQPKRAPKLNERILSSLSRRSVAAHPWHDLEIGPDAPAVFNVVVEITKG  60

Query  361  SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFL  540
            SKVKYELDKKTGLIKVDR+LYSSVVYPHNYGF+PRTLCEDNDPMDVLVLMQEPV+PG FL
Sbjct  61   SKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFVPRTLCEDNDPMDVLVLMQEPVVPGSFL  120

Query  541  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENK  720
            RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHY DIS+L PHRL EI+RFFEDYKKNENK
Sbjct  121  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNENK  180

Query  721  EVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            EVAV+ FLP+ TA EAI+YSMDLYA+YI+Q+LR+
Sbjct  181  EVAVDAFLPATTAREAIQYSMDLYAQYILQSLRQ  214



>emb|CAJ44303.1| soluble inorganic pyrophosphatase [Papaver rhoeas]
Length=215

 Score =   376 bits (966),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            ++ TP+LNERILSS+SRRSVAAHPWHDLEIG  AP   N V+EITKGSKVKYELDKKTG+
Sbjct  15   KRTTPKLNERILSSLSRRSVAAHPWHDLEIGPGAPSVVNAVVEITKGSKVKYELDKKTGM  74

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVL+LMQEPVLPGCFLR RAIGLMPMIDQ
Sbjct  75   IKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLILMQEPVLPGCFLRIRAIGLMPMIDQ  134

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHYTDI QL PHRLAEIRRFFEDYKKNENKEVAVN+FLPS TA
Sbjct  135  GEKDDKIIAVCADDPEYRHYTDIKQLAPHRLAEIRRFFEDYKKNENKEVAVNDFLPSATA  194

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYIM +LR+
Sbjct  195  HEAIQYSMDLYAEYIMMSLRR  215



>ref|XP_009411932.1| PREDICTED: soluble inorganic pyrophosphatase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411934.1| PREDICTED: soluble inorganic pyrophosphatase-like [Musa acuminata 
subsp. malaccensis]
Length=212

 Score =   376 bits (965),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+  E A+      PRLNERILSS+SR+SVAAH WHDLEIG  AP  FNVV+EITKGSK
Sbjct  1    MSEEKETASRENHPVPRLNERILSSLSRKSVAAHSWHDLEIGPGAPAVFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFL+A
Sbjct  61   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLQA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCA+DPE+ HY D+++L PHRLAEIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCANDPEFHHYNDLNELSPHRLAEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVNEFLP+DTA EAI+YSMDLYA+YI+Q+LR+
Sbjct  181  AVNEFLPADTAREAIQYSMDLYAQYILQSLRQ  212



>ref|NP_001149146.1| soluble inorganic pyrophosphatase [Zea mays]
 ref|XP_008661952.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Zea 
mays]
 gb|ACG34367.1| soluble inorganic pyrophosphatase [Zea mays]
 gb|ACR36084.1| unknown [Zea mays]
 gb|ACR37737.1| unknown [Zea mays]
 gb|AFW60000.1| Soluble inorganic pyrophosphatase isoform 1 [Zea mays]
 gb|AFW60001.1| Soluble inorganic pyrophosphatase isoform 2 [Zea mays]
 gb|AFW60002.1| Soluble inorganic pyrophosphatase isoform 3 [Zea mays]
 gb|AFW60003.1| Soluble inorganic pyrophosphatase isoform 4 [Zea mays]
Length=214

 Score =   376 bits (965),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 196/214 (92%), Gaps = 2/214 (1%)
 Frame = +1

Query  187  MSQSNEVAAFPQ--KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKG  360
            MS+ ++ AA  +  KR P+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVV+EITKG
Sbjct  1    MSEEDKAAASAEQPKRAPKLNERILSSLSRRSVAAHPWHDLEIGPGAPAVFNVVVEITKG  60

Query  361  SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFL  540
            SKVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PG FL
Sbjct  61   SKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVVPGSFL  120

Query  541  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENK  720
            RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHY DIS+L PHRL EI+RFFEDYKKNENK
Sbjct  121  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNENK  180

Query  721  EVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            EVAV+ FLP+ TA EAI+YSMDLYA+YI+Q+LR+
Sbjct  181  EVAVDAFLPATTAQEAIQYSMDLYAQYILQSLRQ  214



>ref|XP_006397877.1| hypothetical protein EUTSA_v10001628mg [Eutrema salsugineum]
 gb|ESQ39330.1| hypothetical protein EUTSA_v10001628mg [Eutrema salsugineum]
Length=216

 Score =   376 bits (965),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
             P+LNERILS++SRRSVAAHPWHDLEIG EAP  FNVV+EITKGSKVKYELDKKTGLIKV
Sbjct  19   VPKLNERILSTLSRRSVAAHPWHDLEIGPEAPLVFNVVVEITKGSKVKYELDKKTGLIKV  78

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK
Sbjct  79   DRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  138

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            DDKIIAVCADDPEY+H+TDI QL PHRL+EIRRFFEDYKKNENK+VAVN+FLPS++A EA
Sbjct  139  DDKIIAVCADDPEYKHFTDIKQLAPHRLSEIRRFFEDYKKNENKKVAVNDFLPSESAHEA  198

Query  769  IKYSMDLYAEYIMQTLRK  822
            I+YSMDLYAEYI+ TLR+
Sbjct  199  IQYSMDLYAEYILHTLRR  216



>ref|XP_009111378.1| PREDICTED: soluble inorganic pyrophosphatase [Brassica rapa]
Length=214

 Score =   375 bits (964),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP  FNVVIEI+KGSKVKYELDKKTGL
Sbjct  14   QRTAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPSIFNVVIEISKGSKVKYELDKKTGL  73

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  74   IKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFLRARAIGLMPMIDQ  133

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEVAVN+FLP+  A
Sbjct  134  GEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVNDFLPNGPA  193

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYI+ TLR+
Sbjct  194  VEAIQYSMDLYAEYILHTLRR  214



>ref|XP_010523845.1| PREDICTED: soluble inorganic pyrophosphatase [Tarenaya hassleriana]
 ref|XP_010523846.1| PREDICTED: soluble inorganic pyrophosphatase [Tarenaya hassleriana]
Length=212

 Score =   375 bits (964),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+     A   +  P+LNERILSS+SRRSVAAHPWHDLE+G EAP   NVV+EITKGSK
Sbjct  1    MSEETGQDAQSPRPVPKLNERILSSLSRRSVAAHPWHDLELGPEAPLIVNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEY+H+TDI QL PHRL+EIRRFFEDYKKNENK+V
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYKHFTDIKQLAPHRLSEIRRFFEDYKKNENKKV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLPS+TA EAI+YSMDLYAEYI+ TLR+
Sbjct  181  AVNDFLPSETAVEAIQYSMDLYAEYILHTLRR  212



>ref|XP_008806026.1| PREDICTED: soluble inorganic pyrophosphatase-like [Phoenix dactylifera]
Length=212

 Score =   375 bits (964),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+ N+ A+  ++  PRLNERILSSMSRRS+AAHPWHDLEIG  AP  FN V+EITKGSK
Sbjct  1    MSEENQSASSNKRPVPRLNERILSSMSRRSIAAHPWHDLEIGPGAPTVFNAVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLC+D DP+DVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCDDGDPLDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHY DI++L PHRLAEIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDINELSPHRLAEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AV+EFLP+  A EA+++SMDLYAEYI+Q LR+
Sbjct  181  AVDEFLPAVAAHEAVQHSMDLYAEYILQGLRR  212



>ref|XP_004306605.1| PREDICTED: soluble inorganic pyrophosphatase-like [Fragaria vesca 
subsp. vesca]
Length=210

 Score =   375 bits (963),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +1

Query  217  PQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTG  396
            P+K TP+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVV+EITKGSKVKYELDKKTG
Sbjct  9    PRKPTPKLNERILSSLSRRSVAAHPWHDLEIGPTAPHIFNVVVEITKGSKVKYELDKKTG  68

Query  397  LIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMID  576
            LIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIG+MPMID
Sbjct  69   LIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGVMPMID  128

Query  577  QGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDT  756
            QGEKDDKIIAVCADDPEY HYT+++ LPPHRL+EIRRFFEDYKKNENKEVAVN FLP+  
Sbjct  129  QGEKDDKIIAVCADDPEYTHYTELNDLPPHRLSEIRRFFEDYKKNENKEVAVNAFLPATA  188

Query  757  AFEAIKYSMDLYAEYIMQTLRK  822
            A EAI+YSMDLYAEYI+ TLR+
Sbjct  189  ALEAIQYSMDLYAEYILHTLRR  210



>ref|XP_009128516.1| PREDICTED: soluble inorganic pyrophosphatase-like [Brassica rapa]
 emb|CDY01933.1| BnaC02g27940D [Brassica napus]
 emb|CDX97250.1| BnaA02g20410D [Brassica napus]
Length=214

 Score =   375 bits (962),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            QK TPRLNERILSS+S+RSVAAHPWHDLEIG  AP  FNVV+EI+KGSKVKYELDKKTGL
Sbjct  14   QKPTPRLNERILSSLSKRSVAAHPWHDLEIGPGAPVIFNVVVEISKGSKVKYELDKKTGL  73

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  74   IKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFLRARAIGLMPMIDQ  133

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEY+HYTDI +LPPHRL EIRRFFEDYKKNENKEVAVN+FLP+  A
Sbjct  134  GEKDDKIIAVCVDDPEYKHYTDIKELPPHRLTEIRRFFEDYKKNENKEVAVNDFLPNGPA  193

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYI+ TLR+
Sbjct  194  VEAIQYSMDLYAEYILHTLRR  214



>ref|XP_010507961.1| PREDICTED: soluble inorganic pyrophosphatase [Camelina sativa]
 ref|XP_010518372.1| PREDICTED: soluble inorganic pyrophosphatase [Camelina sativa]
Length=216

 Score =   375 bits (962),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
             P+LNERILS++SRRSVAAHPWHDLEIG +AP  FNVV+EITKGSKVKYELDKKTGLIKV
Sbjct  19   VPKLNERILSTLSRRSVAAHPWHDLEIGPDAPLVFNVVVEITKGSKVKYELDKKTGLIKV  78

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK
Sbjct  79   DRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  138

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            DDKIIAVCADDPEY+H+TDI QL PHRL+EIRRFFEDYKKNENK+VAVN+FLPS+TA EA
Sbjct  139  DDKIIAVCADDPEYKHFTDIKQLAPHRLSEIRRFFEDYKKNENKKVAVNDFLPSETAHEA  198

Query  769  IKYSMDLYAEYIMQTLRK  822
            I+YSMDLYAEYI+ TLR+
Sbjct  199  IQYSMDLYAEYILHTLRR  216



>ref|XP_010506700.1| PREDICTED: soluble inorganic pyrophosphatase-like [Camelina sativa]
Length=243

 Score =   375 bits (964),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/224 (81%), Positives = 202/224 (90%), Gaps = 3/224 (1%)
 Frame = +1

Query  154  PFS-LKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKT  330
            PF  LK S +    ++ E +  P+   P+LNERILS++SRRSVAAHPWHDLEIG +AP  
Sbjct  22   PFEDLKMSEE-TYEETQESSQSPRP-VPKLNERILSTLSRRSVAAHPWHDLEIGPDAPLV  79

Query  331  FNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLM  510
            FNVV+EITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLM
Sbjct  80   FNVVVEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLM  139

Query  511  QEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRF  690
            QEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEY+H+TDI QL PHRL+EIRRF
Sbjct  140  QEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYKHFTDIKQLAPHRLSEIRRF  199

Query  691  FEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            FEDYKKNENK+VAVN+FLPS+TA EAI+YSMDLYAEYI+ TLR+
Sbjct  200  FEDYKKNENKKVAVNDFLPSETAHEAIQYSMDLYAEYILHTLRR  243



>ref|NP_182209.1| pyrophosphorylase 3 [Arabidopsis thaliana]
 gb|AAC34242.1| putative inorganic pyrophosphatase [Arabidopsis thaliana]
 gb|AAM15021.1| putative inorganic pyrophosphatase [Arabidopsis thaliana]
 gb|ABF19031.1| At2g46860 [Arabidopsis thaliana]
 gb|AEC10764.1| pyrophosphorylase 3 [Arabidopsis thaliana]
Length=216

 Score =   374 bits (961),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
             P+LNERILS++SRRSVAAHPWHDLEIG EAP  FNVV+EITKGSKVKYELDKKTGLIKV
Sbjct  19   VPKLNERILSTLSRRSVAAHPWHDLEIGPEAPLVFNVVVEITKGSKVKYELDKKTGLIKV  78

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK
Sbjct  79   DRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  138

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            DDKIIAVCADDPEY+H+TDI QL PHRL EIRRFFEDYKKNENK+VAVN+FLPS++A EA
Sbjct  139  DDKIIAVCADDPEYKHFTDIKQLAPHRLQEIRRFFEDYKKNENKKVAVNDFLPSESAHEA  198

Query  769  IKYSMDLYAEYIMQTLRK  822
            I+YSMDLYAEYI+ TLR+
Sbjct  199  IQYSMDLYAEYILHTLRR  216



>gb|KHN15869.1| Soluble inorganic pyrophosphatase [Glycine soja]
Length=212

 Score =   374 bits (961),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N       +  PRLNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EITKGSK
Sbjct  1    MSDENGEEPRENRPVPRLNERILSSLSRRSVAAHPWHDLEIGPGAPMIFNCVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPE++HYTD+++LPPHRL EIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEFKHYTDLTELPPHRLMEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLP+ TA E+I+YSMDLYAEYI+ TLR+
Sbjct  181  AVNDFLPASTAVESIQYSMDLYAEYILHTLRR  212



>ref|XP_006837931.1| hypothetical protein AMTR_s00102p00015990 [Amborella trichopoda]
 gb|ERN00500.1| hypothetical protein AMTR_s00102p00015990 [Amborella trichopoda]
Length=216

 Score =   374 bits (961),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +1

Query  190  SQSNEVAAFPQKR-TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            S++   A   +KR TPRLNERILSS+SRRSVAAHPWHDL+IG  AP   N V+EI KGSK
Sbjct  5    SKNGLSAMESEKRPTPRLNERILSSLSRRSVAAHPWHDLDIGPGAPSVVNCVVEIGKGSK  64

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA
Sbjct  65   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  124

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDI +LPPHRL EIRRFFEDYKKNENKEV
Sbjct  125  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDIKELPPHRLQEIRRFFEDYKKNENKEV  184

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLPS  A+EAI+YSMDLYA YI+Q+LR+
Sbjct  185  AVNDFLPSTAAYEAIQYSMDLYATYILQSLRR  216



>emb|CDY07141.1| BnaCnng01560D [Brassica napus]
Length=214

 Score =   374 bits (961),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SR+SVAAHPWHDLEIG  AP  FNVVIEI+KGSKVKYELDKKTGL
Sbjct  14   QRTAPRLNERILSSLSRKSVAAHPWHDLEIGPGAPSIFNVVIEISKGSKVKYELDKKTGL  73

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  74   IKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFLRARAIGLMPMIDQ  133

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEVAVN+FLP+  A
Sbjct  134  GEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVNDFLPNGPA  193

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYI+ TLR+
Sbjct  194  VEAIQYSMDLYAEYILHTLRR  214



>ref|XP_007135336.1| hypothetical protein PHAVU_010G120800g [Phaseolus vulgaris]
 gb|ESW07330.1| hypothetical protein PHAVU_010G120800g [Phaseolus vulgaris]
Length=213

 Score =   374 bits (961),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
            TPRLNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EI+KGSKVKYELDKKTGLIKV
Sbjct  16   TPRLNERILSSLSRRSVAAHPWHDLEIGPGAPMIFNCVVEISKGSKVKYELDKKTGLIKV  75

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEP+LPGCFLRARAIGLMPMIDQGEK
Sbjct  76   DRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPILPGCFLRARAIGLMPMIDQGEK  135

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            DDKIIAVCADDPEY+HYTD  +LPPHRL+EIRRFFEDYKKNENKEVAVNEFLP+ TA EA
Sbjct  136  DDKIIAVCADDPEYKHYTDFKELPPHRLSEIRRFFEDYKKNENKEVAVNEFLPASTAVEA  195

Query  769  IKYSMDLYAEYIMQTLRK  822
            I++SMDLYAEYI+ TLR+
Sbjct  196  IQFSMDLYAEYILHTLRR  213



>gb|KHN06380.1| Soluble inorganic pyrophosphatase [Glycine soja]
Length=212

 Score =   374 bits (961),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N       +  PRLNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EITKGSK
Sbjct  1    MSDENNEEPCENRPVPRLNERILSSLSRRSVAAHPWHDLEIGPGAPMIFNCVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEY+HYTD  +LPPHRL EIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDFKELPPHRLMEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLP+ TA E+I+YSMDLYAEYI+ TLR+
Sbjct  181  AVNDFLPASTAVESIQYSMDLYAEYILHTLRR  212



>ref|XP_009335259.1| PREDICTED: soluble inorganic pyrophosphatase-like [Pyrus x bretschneideri]
 ref|XP_009335260.1| PREDICTED: soluble inorganic pyrophosphatase-like [Pyrus x bretschneideri]
Length=209

 Score =   374 bits (960),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +1

Query  223  KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLI  402
            ++ P+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVVIEITKGSKVKYELDKKTG+I
Sbjct  10   QKAPKLNERILSSLSRRSVAAHPWHDLEIGPSAPDIFNVVIEITKGSKVKYELDKKTGMI  69

Query  403  KVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQG  582
            KVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIG+MPMIDQG
Sbjct  70   KVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGVMPMIDQG  129

Query  583  EKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAF  762
            EKDDKIIAVCADDPEY HYT +  LPPHRL+EIRRFFEDYKKNENKEVAVN FLP+ TA 
Sbjct  130  EKDDKIIAVCADDPEYTHYTALDDLPPHRLSEIRRFFEDYKKNENKEVAVNAFLPASTAL  189

Query  763  EAIKYSMDLYAEYIMQTLRK  822
            EAI+YSMDLYAEYIM TLR+
Sbjct  190  EAIQYSMDLYAEYIMHTLRR  209



>ref|XP_010480706.1| PREDICTED: soluble inorganic pyrophosphatase isoform X3 [Camelina 
sativa]
 ref|XP_010457179.1| PREDICTED: soluble inorganic pyrophosphatase [Camelina sativa]
 ref|XP_010457180.1| PREDICTED: soluble inorganic pyrophosphatase [Camelina sativa]
Length=212

 Score =   374 bits (960),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSKVKYELDKKTGL
Sbjct  12   QRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSKVKYELDKKTGL  71

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  72   IKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRARAIGLMPMIDQ  131

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEVAVN+FLPS  A
Sbjct  132  GEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVNDFLPSGDA  191

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
              AI+YSMDLYAEYI+ TLR+
Sbjct  192  IGAIQYSMDLYAEYILHTLRR  212



>ref|XP_008358654.1| PREDICTED: soluble inorganic pyrophosphatase-like [Malus domestica]
Length=209

 Score =   374 bits (959),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +1

Query  223  KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLI  402
            ++ P+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVVIEITKGSKVKYELDKKTG+I
Sbjct  10   QKAPKLNERILSSLSRRSVAAHPWHDLEIGPSAPDIFNVVIEITKGSKVKYELDKKTGMI  69

Query  403  KVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQG  582
            KVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIG+MPMIDQG
Sbjct  70   KVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGVMPMIDQG  129

Query  583  EKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAF  762
            EKDDKIIAVCADDPEY HYT +  LPPHRL+EIRRFFEDYKKNENKEVAVN FLP+ TA 
Sbjct  130  EKDDKIIAVCADDPEYTHYTALDDLPPHRLSEIRRFFEDYKKNENKEVAVNAFLPASTAL  189

Query  763  EAIKYSMDLYAEYIMQTLRK  822
            EAI+YSMDLYAEYIM TLR+
Sbjct  190  EAIQYSMDLYAEYIMHTLRR  209



>ref|XP_010480711.1| PREDICTED: soluble inorganic pyrophosphatase isoform X4 [Camelina 
sativa]
Length=219

 Score =   374 bits (960),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSKVKYELDKKTGL
Sbjct  19   QRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSKVKYELDKKTGL  78

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  79   IKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRARAIGLMPMIDQ  138

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEVAVN+FLPS  A
Sbjct  139  GEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVNDFLPSGDA  198

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
              AI+YSMDLYAEYI+ TLR+
Sbjct  199  IGAIQYSMDLYAEYILHTLRR  219



>ref|NP_001054331.1| Os04g0687100 [Oryza sativa Japonica Group]
 emb|CAD41934.2| OSJNBa0070M12.12 [Oryza sativa Japonica Group]
 dbj|BAF16245.1| Os04g0687100 [Oryza sativa Japonica Group]
 dbj|BAG87812.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93715.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78295.1| hypothetical protein OsI_18011 [Oryza sativa Indica Group]
 gb|EEE61951.1| hypothetical protein OsJ_16709 [Oryza sativa Japonica Group]
Length=213

 Score =   374 bits (959),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 196/213 (92%), Gaps = 1/213 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQ-KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGS  363
            MS+ +  AA  Q +R P+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVV+EITKGS
Sbjct  1    MSEEDTNAAAGQPRRAPKLNERILSSLSRRSVAAHPWHDLEIGPGAPAVFNVVVEITKGS  60

Query  364  KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLR  543
            KVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PG FLR
Sbjct  61   KVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVIPGSFLR  120

Query  544  ARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKE  723
            ARAIGLMPMIDQGEKDDKIIAVCADDPEYRHY DIS+L PHRL EI+RFFEDYKKNENKE
Sbjct  121  ARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNENKE  180

Query  724  VAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VAV+ FLP++TA +AI+YSMDLYA+YI+Q+LR+
Sbjct  181  VAVDAFLPANTARDAIQYSMDLYAQYILQSLRQ  213



>ref|XP_010474689.1| PREDICTED: soluble inorganic pyrophosphatase-like [Camelina sativa]
Length=280

 Score =   376 bits (965),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+        Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSK
Sbjct  69   MSEEGNEDQKQQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSK  128

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRA
Sbjct  129  VKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRA  188

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFEDYKKNENKEV
Sbjct  189  RAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEV  248

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLPS  A  AI+YSMDLYAEYI+ TLR+
Sbjct  249  AVNDFLPSGDAIGAIQYSMDLYAEYILHTLRR  280



>dbj|BAI52729.1| inorganic pyrophosphatase [Brassica rapa subsp. chinensis]
Length=212

 Score =   373 bits (958),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+  +     Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSK
Sbjct  1    MSEETKENQKLQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVC DDPEY+HYTDI +LPPHRL EIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLFEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLP + A +AI+YSMDLYAEYI+ TLR+
Sbjct  181  AVNDFLPFEKAVDAIQYSMDLYAEYILHTLRR  212



>ref|XP_007218404.1| hypothetical protein PRUPE_ppa011444mg [Prunus persica]
 gb|EMJ19603.1| hypothetical protein PRUPE_ppa011444mg [Prunus persica]
Length=210

 Score =   373 bits (957),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = +1

Query  223  KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLI  402
            +R P+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVV+EITKGSKVKYELDKKTGLI
Sbjct  11   QRAPKLNERILSSLSRRSVAAHPWHDLEIGPTAPHLFNVVVEITKGSKVKYELDKKTGLI  70

Query  403  KVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQG  582
            KVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIG+MPMIDQG
Sbjct  71   KVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFLRARAIGVMPMIDQG  130

Query  583  EKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAF  762
            EKDDKIIAVCADDPEY HYT+++ LPPHRL+EIRRFFEDYKKNENKEVAVN FLP+  A 
Sbjct  131  EKDDKIIAVCADDPEYTHYTELNDLPPHRLSEIRRFFEDYKKNENKEVAVNAFLPAAAAL  190

Query  763  EAIKYSMDLYAEYIMQTLRK  822
            EAI+YSMDLYAEYIM TLR+
Sbjct  191  EAIQYSMDLYAEYIMHTLRR  210



>ref|XP_002515096.1| inorganic pyrophosphatase, putative [Ricinus communis]
 gb|EEF47080.1| inorganic pyrophosphatase, putative [Ricinus communis]
Length=232

 Score =   374 bits (959),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 198/225 (88%), Gaps = 10/225 (4%)
 Frame = +1

Query  148  VTPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPK  327
            V  FS++ +N+    + N       +  PRLNERILSS+S+R+VAAHPWHDLEIG  AP 
Sbjct  18   VFAFSIEMANE---GEGN-------RSVPRLNERILSSLSKRTVAAHPWHDLEIGPGAPN  67

Query  328  TFNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVL  507
             FNVV+EITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVL
Sbjct  68   IFNVVVEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVL  127

Query  508  MQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRR  687
            MQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEY+HYTDI +L PHRL EIRR
Sbjct  128  MQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKELAPHRLMEIRR  187

Query  688  FFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            FFEDYKKNENKEVAVNEFLPS+ A +AI+YSMDLYAEYI+ TLR+
Sbjct  188  FFEDYKKNENKEVAVNEFLPSNHAVDAIQYSMDLYAEYILHTLRR  232



>ref|XP_006858361.1| hypothetical protein AMTR_s00064p00191050 [Amborella trichopoda]
 gb|ERN19828.1| hypothetical protein AMTR_s00064p00191050 [Amborella trichopoda]
Length=216

 Score =   373 bits (958),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +1

Query  190  SQSNEVAAFPQKR-TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            S++   A   +KR TPRLNERILSS+SRRSVAAHPWHDL+IG  AP   N V+EI KGSK
Sbjct  5    SKNGLSAMESEKRPTPRLNERILSSLSRRSVAAHPWHDLDIGPGAPSVVNCVVEIGKGSK  64

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA
Sbjct  65   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  124

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDI +LPPHRL EIRRFFEDYKKNENKEV
Sbjct  125  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDIKELPPHRLQEIRRFFEDYKKNENKEV  184

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLPS  A+EAI+YSM+LYA YI+Q+LR+
Sbjct  185  AVNDFLPSTAAYEAIQYSMNLYATYILQSLRR  216



>ref|XP_006653062.1| PREDICTED: soluble inorganic pyrophosphatase-like [Oryza brachyantha]
Length=213

 Score =   373 bits (957),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 195/213 (92%), Gaps = 1/213 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQ-KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGS  363
            MS+    AA  Q +R P+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVV+EITKGS
Sbjct  1    MSEEETNAAAEQPRRAPKLNERILSSLSRRSVAAHPWHDLEIGPGAPAVFNVVVEITKGS  60

Query  364  KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLR  543
            KVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PG FLR
Sbjct  61   KVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVIPGSFLR  120

Query  544  ARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKE  723
            ARAIGLMPMIDQGEKDDKIIAVCADDPEYRHY DIS+L PHRL EI+RFFEDYKKNENKE
Sbjct  121  ARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNENKE  180

Query  724  VAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VAV+ FLP++TA +AI+YSMDLYA+YI+Q+LR+
Sbjct  181  VAVDAFLPANTARDAIQYSMDLYAQYILQSLRQ  213



>dbj|BAC42722.1| putative inorganic pyrophosphatase [Arabidopsis thaliana]
Length=216

 Score =   373 bits (957),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
             P+LNERILS++SRRSVAAHPWHDLEIG EAP  FNVV+EITKGSKVKYELDKKTGLIKV
Sbjct  19   VPKLNERILSTLSRRSVAAHPWHDLEIGPEAPLVFNVVVEITKGSKVKYELDKKTGLIKV  78

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK
Sbjct  79   DRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  138

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            DDKIIAVCADDPEY+H+TDI QL PHRL EIRRFFE+YKKNENK+VAVN+FLPS++A EA
Sbjct  139  DDKIIAVCADDPEYKHFTDIKQLAPHRLQEIRRFFENYKKNENKKVAVNDFLPSESAHEA  198

Query  769  IKYSMDLYAEYIMQTLRK  822
            I+YSMDLYAEYI+ TLR+
Sbjct  199  IQYSMDLYAEYILHTLRR  216



>ref|XP_008244194.1| PREDICTED: soluble inorganic pyrophosphatase-like [Prunus mume]
Length=213

 Score =   372 bits (956),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  193  QSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVK  372
            + +EV   P+++ P+LNERILSS+SR+SVAAHPWHDLEIG +AP  FN V+EITKGSKVK
Sbjct  4    EESEVQPVPRQKAPKLNERILSSLSRKSVAAHPWHDLEIGPKAPYIFNCVVEITKGSKVK  63

Query  373  YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARA  552
            YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPV PGCFLRA+A
Sbjct  64   YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVHPGCFLRAKA  123

Query  553  IGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAV  732
            IGLMPMIDQGEKDDKIIAVCADDP Y HYTDI +LPPHRL EIRRFFEDYKKNENKEVAV
Sbjct  124  IGLMPMIDQGEKDDKIIAVCADDPAYNHYTDIKELPPHRLCEIRRFFEDYKKNENKEVAV  183

Query  733  NEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            ++FLPS  A EAI+YSMDLYAEYIM TLR+
Sbjct  184  DQFLPSHNAAEAIQYSMDLYAEYIMLTLRR  213



>ref|XP_009366582.1| PREDICTED: soluble inorganic pyrophosphatase-like [Pyrus x bretschneideri]
Length=211

 Score =   372 bits (956),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = +1

Query  223  KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLI  402
            ++ P+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVVIEITKGSKVKYELDKKTGLI
Sbjct  12   RKAPKLNERILSSLSRRSVAAHPWHDLEIGPSAPNVFNVVIEITKGSKVKYELDKKTGLI  71

Query  403  KVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQG  582
            KVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIG+MPMIDQG
Sbjct  72   KVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGVMPMIDQG  131

Query  583  EKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAF  762
            EKDDKIIAVCADDPEYRH+T+++ LPPHRL+EIR FFEDYKKNENKEVAVN FLP  TA 
Sbjct  132  EKDDKIIAVCADDPEYRHFTELNDLPPHRLSEIRCFFEDYKKNENKEVAVNAFLPVSTAL  191

Query  763  EAIKYSMDLYAEYIMQTLRK  822
            EAI+YSMDLYAEYI+ TLR+
Sbjct  192  EAIQYSMDLYAEYILHTLRR  211



>ref|XP_009404613.1| PREDICTED: soluble inorganic pyrophosphatase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404614.1| PREDICTED: soluble inorganic pyrophosphatase-like [Musa acuminata 
subsp. malaccensis]
Length=215

 Score =   372 bits (955),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            +  S + + F   R+P LNERILSSMSRRSVAAHPWHDLEIG  APK FN V+EIT+GSK
Sbjct  5    LQASTKASDFQLSRSP-LNERILSSMSRRSVAAHPWHDLEIGPAAPKIFNCVVEITRGSK  63

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLV+MQEPV+PGCFLRA
Sbjct  64   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVIMQEPVIPGCFLRA  123

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            +AIGLMPMIDQGEKDDKIIAVCADDPEY+HY DI +LPPHRLAEIRRFFEDYKKNENKEV
Sbjct  124  KAIGLMPMIDQGEKDDKIIAVCADDPEYKHYNDIKELPPHRLAEIRRFFEDYKKNENKEV  183

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLP+ +A+EAI++SMDLYA YI+++LR+
Sbjct  184  AVNDFLPASSAYEAIQHSMDLYANYIVESLRR  215



>ref|XP_004959983.1| PREDICTED: soluble inorganic pyrophosphatase-like [Setaria italica]
Length=216

 Score =   372 bits (955),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = +1

Query  223  KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLI  402
            KR P+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVV+EITKGSKVKYELDKKTGLI
Sbjct  17   KRAPKLNERILSSLSRRSVAAHPWHDLEIGPGAPAVFNVVVEITKGSKVKYELDKKTGLI  76

Query  403  KVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQG  582
            KVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PG FLRARAIGLMPMIDQG
Sbjct  77   KVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVIPGSFLRARAIGLMPMIDQG  136

Query  583  EKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAF  762
            EKDDKIIAVCADDPEYRHY DIS+L PHRL EI+RFFEDYKKNENKEVAV+EFLP+ TA 
Sbjct  137  EKDDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNENKEVAVDEFLPATTAR  196

Query  763  EAIKYSMDLYAEYIMQTLRK  822
            +AI+YSMDLYA+YI+Q+LR+
Sbjct  197  DAIQYSMDLYAQYILQSLRQ  216



>gb|KEH18552.1| soluble inorganic pyrophosphatase [Medicago truncatula]
Length=257

 Score =   374 bits (959),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+         + TPRLNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EITKGSK
Sbjct  46   MSEEKSEEVQETRPTPRLNERILSSLSRRSVAAHPWHDLEIGPGAPNIFNCVVEITKGSK  105

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTG+IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRA
Sbjct  106  VKYELDKKTGMIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRA  165

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEY+HYTD  +L PHRL EI+RFFEDYKKNENKEV
Sbjct  166  RAIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDFKELQPHRLMEIKRFFEDYKKNENKEV  225

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVNEFLP  TA EAI++SMDLYAEYI+ TLR+
Sbjct  226  AVNEFLPPSTAVEAIQHSMDLYAEYILHTLRR  257



>ref|XP_010107131.1| Soluble inorganic pyrophosphatase [Morus notabilis]
 gb|EXC13652.1| Soluble inorganic pyrophosphatase [Morus notabilis]
Length=230

 Score =   372 bits (956),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +1

Query  238  LNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRI  417
            LNERILSS+SRRSVAAHPWHDLEIG  AP+ FN V+EITKGSKVKYELDKKTGLIKVDRI
Sbjct  36   LNERILSSLSRRSVAAHPWHDLEIGPSAPQIFNCVVEITKGSKVKYELDKKTGLIKVDRI  95

Query  418  LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDK  597
            LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA+AIGLMPMIDQGEKDDK
Sbjct  96   LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAKAIGLMPMIDQGEKDDK  155

Query  598  IIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKY  777
            IIAVCADDPEY+HY DI +L PHRL+EIRRFFEDYKKNENKEVAVN+FLPS TA EAI+Y
Sbjct  156  IIAVCADDPEYKHYNDIKELAPHRLSEIRRFFEDYKKNENKEVAVNDFLPSSTATEAIQY  215

Query  778  SMDLYAEYIMQTLRK  822
            SMDLYAEY+M TLR+
Sbjct  216  SMDLYAEYVMHTLRR  230



>gb|EMS59074.1| Soluble inorganic pyrophosphatase [Triticum urartu]
Length=216

 Score =   372 bits (954),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 195/216 (90%), Gaps = 4/216 (2%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRT----PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEIT  354
            MS+ +  +A  Q+ T    P+LNERILSS+SRR+VAAHPWHDLEIG  AP  FNVV+EIT
Sbjct  1    MSEEDSTSAAAQQPTSRPAPKLNERILSSLSRRAVAAHPWHDLEIGPGAPAVFNVVVEIT  60

Query  355  KGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGC  534
            KGSKVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PG 
Sbjct  61   KGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVIPGS  120

Query  535  FLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNE  714
            FLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHY DIS+L PHRL EI+RFFEDYKKNE
Sbjct  121  FLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNE  180

Query  715  NKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            NKEVAV+ FLP+ TA EAI+YSMDLYA+YI+Q+LR+
Sbjct  181  NKEVAVDAFLPATTAREAIQYSMDLYAQYILQSLRQ  216



>ref|XP_006443220.1| hypothetical protein CICLE_v10024501mg [Citrus clementina]
 ref|XP_006478998.1| PREDICTED: soluble inorganic pyrophosphatase-like [Citrus sinensis]
 gb|ESR56460.1| hypothetical protein CICLE_v10024501mg [Citrus clementina]
Length=221

 Score =   372 bits (955),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +1

Query  202  EVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYEL  381
            + AA   +  P+LNERILS++SRRSVAAHPWHDLEIG  AP+  N+V+EITKGSKVKYEL
Sbjct  15   QTAAEGNRPVPKLNERILSTLSRRSVAAHPWHDLEIGPGAPQVVNIVVEITKGSKVKYEL  74

Query  382  DKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGL  561
            DKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DV++LMQEPV+PG +LRARAIGL
Sbjct  75   DKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVMILMQEPVIPGSYLRARAIGL  134

Query  562  MPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEF  741
            MPMIDQGEKDDKIIAVCADDPEY+HYTDI QLPPHRL EIRRFFEDYKKNENKEVAVNEF
Sbjct  135  MPMIDQGEKDDKIIAVCADDPEYKHYTDIKQLPPHRLMEIRRFFEDYKKNENKEVAVNEF  194

Query  742  LPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            LP  TAF+AI+YSMDLYAEYI+Q+LR+
Sbjct  195  LPPQTAFDAIQYSMDLYAEYILQSLRR  221



>gb|ACU15420.1| unknown [Glycine max]
Length=223

 Score =   371 bits (953),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N       +  PRLNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EITKGSK
Sbjct  1    MSDENNEEPCENRPVPRLNERILSSLSRRSVAAHPWHDLEIGPGAPMIFNCVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEY+HYTD  +LPPHRL EIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDFKELPPHRLMEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTL  816
            AVN+FLP+ TA E+I+YSMDLYAEYI+ TL
Sbjct  181  AVNDFLPASTAVESIQYSMDLYAEYILHTL  210



>dbj|BAJ96280.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88115.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=217

 Score =   371 bits (952),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 191/212 (90%), Gaps = 1/212 (0%)
 Frame = +1

Query  190  SQSNEVAAFPQKR-TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            S S   A  P  R  P+LNERILSS+SRR+VAAHPWHDLEIG  AP  FNVV+EITKGSK
Sbjct  6    STSAAAAQQPTSRPAPKLNERILSSLSRRAVAAHPWHDLEIGPGAPAVFNVVVEITKGSK  65

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PG FLRA
Sbjct  66   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVIPGSFLRA  125

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHY DIS+L PHRL EI+RFFEDYKKNENKEV
Sbjct  126  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNENKEV  185

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AV+ FLP+ TA EAI+YSMDLYA+YI+Q+LR+
Sbjct  186  AVDAFLPATTAREAIQYSMDLYAQYILQSLRQ  217



>ref|XP_004510613.1| PREDICTED: soluble inorganic pyrophosphatase-like [Cicer arietinum]
Length=212

 Score =   370 bits (951),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            M+  N       + TPRLNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EITKGSK
Sbjct  1    MTDENNEETQESRPTPRLNERILSSLSRRSVAAHPWHDLEIGPGAPHIFNCVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTG+IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGMIKVDRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEY+HY+D  +L PHRL EIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYKHYSDFKELQPHRLMEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVNEFLP  TA EAI++SMDLYAEYI+ TLR+
Sbjct  181  AVNEFLPPATAVEAIQHSMDLYAEYILHTLRR  212



>ref|XP_009142458.1| PREDICTED: soluble inorganic pyrophosphatase-like [Brassica rapa]
 ref|XP_009142459.1| PREDICTED: soluble inorganic pyrophosphatase-like [Brassica rapa]
 emb|CDY48009.1| BnaA04g26810D [Brassica napus]
 emb|CDY27516.1| BnaC04g51570D [Brassica napus]
Length=216

 Score =   370 bits (951),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
             P+LNERILS++SRRSVAAHPWHDLEIG EAP  FNVV+EITKGSKVKYELDKKTGLIKV
Sbjct  19   APKLNERILSTLSRRSVAAHPWHDLEIGPEAPLVFNVVVEITKGSKVKYELDKKTGLIKV  78

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIGLMPMIDQGE 
Sbjct  79   DRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEM  138

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            DDKIIAVCADDPEY+H+TDI QL PHRL+EIRRFFEDYKKNE+KEVAVN+FLPS+ A EA
Sbjct  139  DDKIIAVCADDPEYKHFTDIKQLAPHRLSEIRRFFEDYKKNEHKEVAVNDFLPSEKAHEA  198

Query  769  IKYSMDLYAEYIMQTLRK  822
            I+YSMDLYAEYI+ TLR+
Sbjct  199  IQYSMDLYAEYILHTLRR  216



>ref|XP_010253277.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nelumbo nucifera]
Length=216

 Score =   370 bits (951),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = +1

Query  199  NEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYE  378
            N+  A  Q+  P LNERILSSMSRR+VAAHPWHDLEIG  AP  FN V+EI KGSKVKYE
Sbjct  9    NKAIASTQQLHPPLNERILSSMSRRAVAAHPWHDLEIGPGAPTIFNCVVEIGKGSKVKYE  68

Query  379  LDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIG  558
            LDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVL+LMQEPVLPGCFLRA+AIG
Sbjct  69   LDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLILMQEPVLPGCFLRAKAIG  128

Query  559  LMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNE  738
            LMPMIDQGEKDDKIIAVCADDPEYRHYTDI +LPPHRLAEI+RFFEDYKKNENK+VAVNE
Sbjct  129  LMPMIDQGEKDDKIIAVCADDPEYRHYTDIKELPPHRLAEIKRFFEDYKKNENKKVAVNE  188

Query  739  FLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            FLP+ TA+EAI++SM+LYA YI+++LR+
Sbjct  189  FLPASTAYEAIQHSMNLYATYIVESLRR  216



>gb|AFK43659.1| unknown [Medicago truncatula]
Length=212

 Score =   370 bits (951),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+         + TPRLNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EITKGSK
Sbjct  1    MSEEKSEEVQETRPTPRLNERILSSLSRRSVAAHPWHDLEIGPGAPNIFNCVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTG+IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGMIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEY+HYTD  +L PHRL EI RFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDFKELQPHRLMEIERFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVNEFLP  TA EAI++SMDLYAEYI+ TLR+
Sbjct  181  AVNEFLPPSTAVEAIQHSMDLYAEYILHTLRR  212



>ref|XP_010054143.1| PREDICTED: soluble inorganic pyrophosphatase [Eucalyptus grandis]
 gb|KCW78525.1| hypothetical protein EUGRSUZ_D02652 [Eucalyptus grandis]
 gb|KCW78526.1| hypothetical protein EUGRSUZ_D02652 [Eucalyptus grandis]
Length=227

 Score =   371 bits (952),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EI+KGSKVKYELDKKTGL
Sbjct  27   QRPVPRLNERILSSLSRRSVAAHPWHDLEIGPGAPHIFNCVVEISKGSKVKYELDKKTGL  86

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVL+LMQEPVLPG FLRARAIGLMPMIDQ
Sbjct  87   IKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLILMQEPVLPGTFLRARAIGLMPMIDQ  146

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEY+HYTDI +L PHRL+EIRRFFEDYKKNENKEVAVN+FLPS TA
Sbjct  147  GEKDDKIIAVCADDPEYKHYTDIKELAPHRLSEIRRFFEDYKKNENKEVAVNDFLPSTTA  206

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYI+ TLR+
Sbjct  207  TEAIQYSMDLYAEYILHTLRR  227



>ref|XP_010260077.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X1 
[Nelumbo nucifera]
Length=223

 Score =   370 bits (951),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 198/232 (85%), Gaps = 13/232 (6%)
 Frame = +1

Query  127  LDLLSPPVTPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLE  306
            L ++SPP+      + +Q             QK  P LNERILSS+SRRSVAAHPWHDLE
Sbjct  5    LAVMSPPIETPKKTSGSQ-------------QKAHPPLNERILSSLSRRSVAAHPWHDLE  51

Query  307  IGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDND  486
            IG  AP  FN V+EI KGSKVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCED+D
Sbjct  52   IGPGAPTIFNCVVEIGKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDSD  111

Query  487  PMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPH  666
            PMDVLVLMQEPVLPGCFLRA+AIGLMPMIDQGEKDDKIIAVCADDPEYRHY DI +LPPH
Sbjct  112  PMDVLVLMQEPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPH  171

Query  667  RLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            RLAEIRRFFEDYKKNENKEVAVNEFLPS TA+EAI++SM+LYA+YI++ LR+
Sbjct  172  RLAEIRRFFEDYKKNENKEVAVNEFLPSSTAYEAIQHSMNLYADYIVEGLRR  223



>ref|XP_006288631.1| hypothetical protein CARUB_v10001934mg [Capsella rubella]
 gb|EOA21529.1| hypothetical protein CARUB_v10001934mg [Capsella rubella]
Length=217

 Score =   370 bits (950),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  193  QSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVK  372
            ++N+     Q+ TPRLNERILSS+S+RSVAAHPWHDLEIG  AP  FNVVIEI+KGSKVK
Sbjct  8    KTNQSQKKLQQPTPRLNERILSSLSKRSVAAHPWHDLEIGPGAPVIFNVVIEISKGSKVK  67

Query  373  YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARA  552
            YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLV+MQEPVLPGCFLRARA
Sbjct  68   YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVIMQEPVLPGCFLRARA  127

Query  553  IGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAV  732
            IGLMPMIDQGE+DDKIIAVC DDPEY+HYT+I++LPPHRL EIRRFFEDYKKNENKEVAV
Sbjct  128  IGLMPMIDQGERDDKIIAVCVDDPEYKHYTNINELPPHRLTEIRRFFEDYKKNENKEVAV  187

Query  733  NEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            N+FL    A EAI+YSMDLYAEYI+ TLR+
Sbjct  188  NDFLQPGPAIEAIQYSMDLYAEYILHTLRR  217



>ref|XP_006654463.1| PREDICTED: soluble inorganic pyrophosphatase-like [Oryza brachyantha]
Length=220

 Score =   370 bits (951),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = +1

Query  217  PQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTG  396
            P+   PRLNERILSS+SRRSVAAHPWHDLEIG +AP  FNVV+EITKGSKVKYELDKKTG
Sbjct  19   PKSGAPRLNERILSSLSRRSVAAHPWHDLEIGPDAPAVFNVVVEITKGSKVKYELDKKTG  78

Query  397  LIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMID  576
            LIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPG FLRARAIGLMPMID
Sbjct  79   LIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGSFLRARAIGLMPMID  138

Query  577  QGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDT  756
            QGEKDDKIIAVCADDPEYRH+ DIS+L PHRL EIRRFFEDYKKNENKEVAVN+FLP   
Sbjct  139  QGEKDDKIIAVCADDPEYRHFNDISELSPHRLQEIRRFFEDYKKNENKEVAVNDFLPPTP  198

Query  757  AFEAIKYSMDLYAEYIMQTLRK  822
            A +AI+YSMDLYA+YIM++LR+
Sbjct  199  ARDAIQYSMDLYAQYIMESLRR  220



>gb|KHN48994.1| Soluble inorganic pyrophosphatase [Glycine soja]
Length=216

 Score =   370 bits (950),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = +1

Query  199  NEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYE  378
            N+V+++ Q   PRLNERILSS+SRR VAAHPWHDLEIG EAPK FN V+EI KGSKVKYE
Sbjct  9    NKVSSYQQSPNPRLNERILSSISRRHVAAHPWHDLEIGPEAPKIFNCVVEIGKGSKVKYE  68

Query  379  LDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIG  558
            LDK+TGLI VDRILYSSVVYPHNYGFIPRT+CED DPMDVLV+MQEPVLPGCFLRA+AIG
Sbjct  69   LDKRTGLIMVDRILYSSVVYPHNYGFIPRTICEDGDPMDVLVIMQEPVLPGCFLRAKAIG  128

Query  559  LMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNE  738
            LMPMIDQGEKDDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+
Sbjct  129  LMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVND  188

Query  739  FLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            FLP+  A+EAIK+SM LYAEY+++ LR+
Sbjct  189  FLPASAAYEAIKHSMTLYAEYVVENLRR  216



>ref|XP_010260078.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010260080.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 
[Nelumbo nucifera]
Length=216

 Score =   370 bits (950),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            QK  P LNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EI KGSKVKYELDKKTGL
Sbjct  16   QKAHPPLNERILSSLSRRSVAAHPWHDLEIGPGAPTIFNCVVEIGKGSKVKYELDKKTGL  75

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCED+DPMDVLVLMQEPVLPGCFLRA+AIGLMPMIDQ
Sbjct  76   IKVDRVLYSSVVYPHNYGFIPRTLCEDSDPMDVLVLMQEPVLPGCFLRAKAIGLMPMIDQ  135

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVNEFLPS TA
Sbjct  136  GEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSSTA  195

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
            +EAI++SM+LYA+YI++ LR+
Sbjct  196  YEAIQHSMNLYADYIVEGLRR  216



>ref|XP_010428363.1| PREDICTED: soluble inorganic pyrophosphatase-like [Camelina sativa]
Length=217

 Score =   370 bits (950),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  193  QSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVK  372
            ++N+     Q+ TPRLNERILSS+S+RSVAAHPWHDLEIG  AP  FNVVIEI+KGSKVK
Sbjct  8    KTNQSQKKLQQPTPRLNERILSSLSKRSVAAHPWHDLEIGPGAPVIFNVVIEISKGSKVK  67

Query  373  YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARA  552
            YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLV+MQEPVLPGCFLRARA
Sbjct  68   YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVIMQEPVLPGCFLRARA  127

Query  553  IGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAV  732
            IGLMPMIDQGE+DDKIIAVC DDPEY+HYT+I++LPPHRL EIRRFFEDYKKNENKEVAV
Sbjct  128  IGLMPMIDQGERDDKIIAVCVDDPEYKHYTNINELPPHRLTEIRRFFEDYKKNENKEVAV  187

Query  733  NEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            N+FL    A EAI+YSMDLYAEYI+ TLR+
Sbjct  188  NDFLQPGPAIEAIQYSMDLYAEYILHTLRR  217



>ref|XP_010422714.1| PREDICTED: soluble inorganic pyrophosphatase-like [Camelina sativa]
Length=217

 Score =   370 bits (949),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  193  QSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVK  372
            ++N+     Q+ TPRLNERILSS+S+RSVAAHPWHDLEIG  AP  FNVVIEI+KGSKVK
Sbjct  8    KTNQSQKKLQQPTPRLNERILSSLSKRSVAAHPWHDLEIGPGAPVIFNVVIEISKGSKVK  67

Query  373  YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARA  552
            YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLV+MQEPVLPGCFLRARA
Sbjct  68   YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVIMQEPVLPGCFLRARA  127

Query  553  IGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAV  732
            IGLMPMIDQGE+DDKIIAVC DDPEY+HYT+I++LPPHRL EIRRFFEDYKKNENKEVAV
Sbjct  128  IGLMPMIDQGERDDKIIAVCVDDPEYKHYTNINELPPHRLTEIRRFFEDYKKNENKEVAV  187

Query  733  NEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            N+FL    A EAI+YSMDLYAEYI+ TLR+
Sbjct  188  NDFLQPGPAIEAIQYSMDLYAEYILHTLRR  217



>ref|XP_003580869.1| PREDICTED: soluble inorganic pyrophosphatase [Brachypodium distachyon]
Length=214

 Score =   370 bits (949),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = +1

Query  196  SNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKY  375
            S   A  P++ TP+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVV+EITKGSKVKY
Sbjct  6    STSAAQEPRRPTPKLNERILSSLSRRSVAAHPWHDLEIGPGAPAVFNVVVEITKGSKVKY  65

Query  376  ELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAI  555
            ELDKKTGLIKVDRILYSSVVYPHNYGF+PRTLCEDNDPMDVLVLMQEPV+PG FLRARAI
Sbjct  66   ELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPMDVLVLMQEPVVPGSFLRARAI  125

Query  556  GLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVN  735
            GLMPMIDQGEKDDKIIAVCADDPEYRHY DIS+L PHRL EI+RFFEDYKKNENKEVAV+
Sbjct  126  GLMPMIDQGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNENKEVAVD  185

Query  736  EFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
             FLP+  A EAI++SMDLYA+YI+Q+LR+
Sbjct  186  AFLPATDAREAIQHSMDLYAQYILQSLRQ  214



>ref|XP_010917066.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X1 
[Elaeis guineensis]
Length=212

 Score =   369 bits (948),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+ N+  +  ++   RLNERILSSMSRRSVAAHPWHDLEIG  AP  FNVV+EITKGSK
Sbjct  1    MSEENQSDSSQKRPATRLNERILSSMSRRSVAAHPWHDLEIGPGAPTIFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLC+D DPMDVLVLMQEP+LP CFLRA
Sbjct  61   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCDDGDPMDVLVLMQEPILPACFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHY D+++L PHRLAEIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDLNELSPHRLAEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLR  819
            AVNEFLP+  A EA++ SMDLYAEYI+Q+LR
Sbjct  181  AVNEFLPAVAAQEAVQRSMDLYAEYILQSLR  211



>ref|XP_007139040.1| hypothetical protein PHAVU_009G259900g [Phaseolus vulgaris]
 gb|ESW11034.1| hypothetical protein PHAVU_009G259900g [Phaseolus vulgaris]
Length=211

 Score =   369 bits (948),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 194/212 (92%), Gaps = 1/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            M+++ E A    +  PRLNERILSS+SRRSVAAHPWHDLEIG EAP+ FN V+EITKGSK
Sbjct  1    MAENGEEAQ-ENRPVPRLNERILSSLSRRSVAAHPWHDLEIGPEAPQIFNCVVEITKGSK  59

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA
Sbjct  60   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  119

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIG+MPMIDQGEKDDKIIAVCADDPEY+H+TD  +L PHR++EIRRFFEDYKKNE+KEV
Sbjct  120  RAIGIMPMIDQGEKDDKIIAVCADDPEYKHFTDYKELAPHRISEIRRFFEDYKKNEHKEV  179

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLP+  A +AI+YSMDLYAEYI+ TLR+
Sbjct  180  AVNDFLPASVAVDAIQYSMDLYAEYILHTLRR  211



>ref|XP_010456152.1| PREDICTED: soluble inorganic pyrophosphatase-like [Camelina sativa]
Length=217

 Score =   369 bits (948),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  193  QSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVK  372
            ++N+     Q+ TPRLNERILSS+S+RSVAAHPWHDLEIG  AP  FNVVIEI+KGSKVK
Sbjct  8    KTNQSQKKLQQPTPRLNERILSSLSKRSVAAHPWHDLEIGPGAPVIFNVVIEISKGSKVK  67

Query  373  YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARA  552
            YELDKKTGLIKVDRILYSSVVYPHNYGF+PRTLCEDNDPMDVLV+MQEPVLPGCFLRARA
Sbjct  68   YELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPMDVLVIMQEPVLPGCFLRARA  127

Query  553  IGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAV  732
            IGLMPMIDQGE+DDKIIAVC DDPEY+HYT+I++LPPHRL EIRRFFEDYKKNENKEVAV
Sbjct  128  IGLMPMIDQGERDDKIIAVCVDDPEYKHYTNINELPPHRLTEIRRFFEDYKKNENKEVAV  187

Query  733  NEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            N+FL    A EAI+YSMDLYAEYI+ TLR+
Sbjct  188  NDFLQPGPAIEAIQYSMDLYAEYILHTLRR  217



>ref|XP_009405327.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=237

 Score =   370 bits (950),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/237 (76%), Positives = 196/237 (83%), Gaps = 25/237 (11%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+ N  A+  ++  PRLNERILSS+S+RSVAAHPWHDLEIG EAP  FNVV+EITKGSK
Sbjct  1    MSKENGTASTERRPVPRLNERILSSLSKRSVAAHPWHDLEIGPEAPAVFNVVVEITKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PGCFLRA
Sbjct  61   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVIPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDY--------  702
            RAIGLMPMIDQGEKDDKIIAVCADDPEYRHY D+S+LPPHRLAEIRRFFED         
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDLSELPPHRLAEIRRFFEDCILLRDMVA  180

Query  703  -----------------KKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
                             KKNENKEVAVNEFL +  A EAI+YSMDLYAEYI+Q+LR+
Sbjct  181  YYAFFVRNGNTLTGCSDKKNENKEVAVNEFLSTTAAREAIQYSMDLYAEYILQSLRR  237



>ref|XP_010325308.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X1 
[Solanum lycopersicum]
Length=227

 Score =   370 bits (949),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 190/223 (85%), Gaps = 22/223 (10%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVVIEI+KGSKVKYELDKKTGL
Sbjct  5    QRHAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPNVFNVVIEISKGSKVKYELDKKTGL  64

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMID-  576
            IKVDR+LYSS+VYP NYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMID 
Sbjct  65   IKVDRVLYSSMVYPQNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  124

Query  577  ---------------------QGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFF  693
                                 QGEKDDKIIAVCADDPEYRHYTDI+QL PHRLAEIRRFF
Sbjct  125  VRLIAACRLNFISYLIKGFLIQGEKDDKIIAVCADDPEYRHYTDINQLAPHRLAEIRRFF  184

Query  694  EDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            EDYKK ENKEVAVNEFLP  TA +AI+YSMDLYAEYI+QTLRK
Sbjct  185  EDYKKLENKEVAVNEFLPPSTAVQAIQYSMDLYAEYILQTLRK  227



>ref|XP_004970701.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X4 
[Setaria italica]
Length=214

 Score =   369 bits (946),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = +1

Query  217  PQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTG  396
            P +  PRLNERILSS+SRRSVAAHPWHDLEIG +AP  FNVV+EI+KGSKVKYELDKKTG
Sbjct  13   PGRAAPRLNERILSSLSRRSVAAHPWHDLEIGPDAPAVFNVVVEISKGSKVKYELDKKTG  72

Query  397  LIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMID  576
            LIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPM+D
Sbjct  73   LIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMMD  132

Query  577  QGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDT  756
            QGEKDDKIIAVC DDPEYRHY D+S+L PHR+ EIRRFFEDYKKNENKEVAV+E  P+ T
Sbjct  133  QGEKDDKIIAVCTDDPEYRHYNDLSELSPHRVQEIRRFFEDYKKNENKEVAVDEVQPAST  192

Query  757  AFEAIKYSMDLYAEYIMQTLRK  822
            A +AIKYSMDLYA+YI+Q+LR+
Sbjct  193  ARDAIKYSMDLYAQYILQSLRQ  214



>ref|XP_002278867.1| PREDICTED: soluble inorganic pyrophosphatase [Vitis vinifera]
 emb|CBI32684.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   369 bits (946),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q   P LNERILSSM+RR+VAAHPWHDLEIG  AP  FN V+EI KGSKVKYELDKKTGL
Sbjct  16   QHSHPPLNERILSSMTRRAVAAHPWHDLEIGPGAPTIFNCVVEIGKGSKVKYELDKKTGL  75

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLV+MQEPVLPGCFLRA+AIGLMPMIDQ
Sbjct  76   IKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVIMQEPVLPGCFLRAKAIGLMPMIDQ  135

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHYTDI++LPPHRLAEIRRFFEDYKKNENKEVAVN+FLPS +A
Sbjct  136  GEKDDKIIAVCADDPEYRHYTDINELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPSSSA  195

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
            +EAI++SM+LYA+YI+++LR+
Sbjct  196  YEAIQHSMNLYADYIVESLRR  216



>ref|XP_010676936.1| PREDICTED: soluble inorganic pyrophosphatase-like [Beta vulgaris 
subsp. vulgaris]
Length=222

 Score =   369 bits (947),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = +1

Query  223  KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLI  402
            +R P+LN+RI+SSMSRRSVAAHPWHDLEIG  AP+  N V+EI KGSKVKYELDKKTGLI
Sbjct  23   RRAPKLNQRIISSMSRRSVAAHPWHDLEIGPNAPEICNCVVEIPKGSKVKYELDKKTGLI  82

Query  403  KVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQG  582
             VDRILYSSVVYPHNYGFIPRTLCED DPMDVLVLMQEPV+PGCFLRARAIGLMPMIDQG
Sbjct  83   MVDRILYSSVVYPHNYGFIPRTLCEDGDPMDVLVLMQEPVVPGCFLRARAIGLMPMIDQG  142

Query  583  EKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAF  762
            EKDDKIIAVCADDPE RHYTDI+QLPPHRLAEIRRFFEDYKKNENKEVAVNEFLP+  A 
Sbjct  143  EKDDKIIAVCADDPEVRHYTDINQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPAQIAH  202

Query  763  EAIKYSMDLYAEYIMQTLRK  822
            +AI++SMDLYAEYI+QTLR+
Sbjct  203  DAIQHSMDLYAEYILQTLRR  222



>ref|XP_010684178.1| PREDICTED: soluble inorganic pyrophosphatase-like [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   369 bits (946),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 191/213 (90%), Gaps = 0/213 (0%)
 Frame = +1

Query  184  NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGS  363
            N ++  +V      R PRLNERILSSM+RRSVAAHPWHDLEIG  AP  FN VIEI +GS
Sbjct  9    NETEKKDVGYSKYPRHPRLNERILSSMTRRSVAAHPWHDLEIGPGAPVIFNCVIEIARGS  68

Query  364  KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLR  543
            KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCED+DPMDVLV+MQEPVLPGCFLR
Sbjct  69   KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDSDPMDVLVIMQEPVLPGCFLR  128

Query  544  ARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKE  723
            A+AIGLMPMIDQGEKDDKIIAVCADDPEYRH+ DI +LPPHRLAEIRRFFEDYKKNENKE
Sbjct  129  AKAIGLMPMIDQGEKDDKIIAVCADDPEYRHFNDIKELPPHRLAEIRRFFEDYKKNENKE  188

Query  724  VAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VAV+EFLP+  A EAI+YSMDLYA Y+++TLR+
Sbjct  189  VAVDEFLPASMAHEAIQYSMDLYANYVVETLRQ  221



>ref|XP_009142592.1| PREDICTED: soluble inorganic pyrophosphatase [Brassica rapa]
 emb|CDX80052.1| BnaA05g01040D [Brassica napus]
Length=216

 Score =   369 bits (946),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
             P+LNERILS++S+RSVAAHPWHDLEIG EAP  FNVV+EITKGSKVKYELDKKTGLIKV
Sbjct  19   APKLNERILSTLSKRSVAAHPWHDLEIGPEAPLVFNVVVEITKGSKVKYELDKKTGLIKV  78

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIGLMPMIDQGE 
Sbjct  79   DRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEM  138

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            DDKIIAVCADDPEY+H+TDI QL PHRL+EIRRFFEDYKKNE+KEVAVN+FLPS+ A EA
Sbjct  139  DDKIIAVCADDPEYKHFTDIKQLAPHRLSEIRRFFEDYKKNEHKEVAVNDFLPSEKAHEA  198

Query  769  IKYSMDLYAEYIMQTLRK  822
            I+YSMDLYAEYI+ +LR+
Sbjct  199  IQYSMDLYAEYILHSLRR  216



>ref|XP_004246468.1| PREDICTED: soluble inorganic pyrophosphatase [Solanum lycopersicum]
 ref|XP_010325882.1| PREDICTED: soluble inorganic pyrophosphatase [Solanum lycopersicum]
 ref|XP_010325883.1| PREDICTED: soluble inorganic pyrophosphatase [Solanum lycopersicum]
 ref|XP_010325885.1| PREDICTED: soluble inorganic pyrophosphatase [Solanum lycopersicum]
Length=216

 Score =   368 bits (945),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRSVAAHPWHDLEIG  AP+ FNVVIEI+KGSKVKYELDKKTGLIKVD
Sbjct  20   PPLNERILSSMTRRSVAAHPWHDLEIGPNAPQIFNVVIEISKGSKVKYELDKKTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLC+D+DP+DVLV+MQEP+LPGCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RVLYSSVVYPHNYGFIPRTLCDDSDPLDVLVIMQEPILPGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEY+HYTDI++LPPHRLAEIRRFFEDYKKNENKEVAVN+FLPSD AFEA+
Sbjct  140  DKIIAVCADDPEYKHYTDINELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPSDKAFEAV  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++S DLYA+YI+++LR+
Sbjct  200  QHSQDLYADYIVESLRR  216



>ref|XP_006341063.1| PREDICTED: soluble inorganic pyrophosphatase-like [Solanum tuberosum]
Length=216

 Score =   368 bits (944),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRSVAAHPWHDLEIG +AP+ FNVVIEI+KG KVKYELDKKTGLIKVD
Sbjct  20   PPLNERILSSMTRRSVAAHPWHDLEIGPDAPQIFNVVIEISKGGKVKYELDKKTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEP+LPGCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RVLYSSVVYPHNYGFIPRTLCEDSDPLDVLVIMQEPILPGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEY+HYTDI++LPPHRLAEIRRFFEDYKKNENKEVAVN+FLPSD AFEA+
Sbjct  140  DKIIAVCADDPEYKHYTDINELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPSDKAFEAV  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++S DLYA+YI+++LR+
Sbjct  200  QHSQDLYADYIVESLRR  216



>emb|CBI38728.3| unnamed protein product [Vitis vinifera]
Length=835

 Score =   388 bits (997),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 185/221 (84%), Positives = 197/221 (89%), Gaps = 4/221 (2%)
 Frame = +1

Query  172  SNQ*NMSQSNEV----AAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNV  339
            S+Q N  ++ E         Q   PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FN 
Sbjct  615  SDQVNKHEAQETHVQETQLQQHSVPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNC  674

Query  340  VIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEP  519
            V+EITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVL+LMQEP
Sbjct  675  VVEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLILMQEP  734

Query  520  VLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFED  699
            VLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDI +L PHRLAEIRRFFE+
Sbjct  735  VLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDIKELAPHRLAEIRRFFEE  794

Query  700  YKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            YKKNENKEVAVN+FLPS TA EAI+YSMDLYAEYIMQTLR+
Sbjct  795  YKKNENKEVAVNDFLPSTTAVEAIQYSMDLYAEYIMQTLRR  835



>ref|NP_001055658.1| Os05g0438500 [Oryza sativa Japonica Group]
 gb|AAT07613.1| putative soluble inorganic pyrophosphatase [Oryza sativa Japonica 
Group]
 dbj|BAF17572.1| Os05g0438500 [Oryza sativa Japonica Group]
 gb|EAY98191.1| hypothetical protein OsI_20104 [Oryza sativa Indica Group]
 dbj|BAG87233.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63857.1| hypothetical protein OsJ_18681 [Oryza sativa Japonica Group]
Length=224

 Score =   368 bits (945),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 198/224 (88%), Gaps = 4/224 (2%)
 Frame = +1

Query  163  LKTSNQ*NMSQSNEVAAFPQKRTPR----LNERILSSMSRRSVAAHPWHDLEIGAEAPKT  330
            + + N  N   + +    P ++TPR    LNERILSS+SRRSVAAHPWHDLEIG +AP  
Sbjct  1    MSSENGENGHGAADEVVEPYQQTPRPGPKLNERILSSLSRRSVAAHPWHDLEIGPDAPAV  60

Query  331  FNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLM  510
            FNVV+EITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLM
Sbjct  61   FNVVVEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLM  120

Query  511  QEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRF  690
            QEPVLPG FLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRH+ ++S+L PHRL EIRRF
Sbjct  121  QEPVLPGSFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHFNNLSELSPHRLQEIRRF  180

Query  691  FEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            FEDYKKNENKEVAVN+FLP+ TA EAI+YSMDLYA+YI+Q+L++
Sbjct  181  FEDYKKNENKEVAVNDFLPAPTAREAIQYSMDLYAQYILQSLKR  224



>gb|KHG06471.1| Soluble inorganic pyrophosphatase [Gossypium arboreum]
Length=215

 Score =   367 bits (943),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  223  KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLI  402
            ++ PRLNERILSSMSRRSVAAHPWHDLEIG  AP  FN V+EI KGSKVKYELDKKTGLI
Sbjct  16   RKPPRLNERILSSMSRRSVAAHPWHDLEIGPGAPAIFNCVVEIPKGSKVKYELDKKTGLI  75

Query  403  KVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQG  582
            KVDR+LYSSVVYPHNYGFIPRTLCEDNDP+D LV+MQEPVLPGCFLRARA+GLMPMIDQG
Sbjct  76   KVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDCLVIMQEPVLPGCFLRARALGLMPMIDQG  135

Query  583  EKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAF  762
            EKDDKIIAVC DDPEY+HYTDI  LPPHRL EIRRFFEDYKKNENKEVAV++FLP+  A 
Sbjct  136  EKDDKIIAVCVDDPEYKHYTDIKDLPPHRLTEIRRFFEDYKKNENKEVAVDKFLPATAAV  195

Query  763  EAIKYSMDLYAEYIMQTLRK  822
            EA++YSMDLYAEYIMQTLR+
Sbjct  196  EAVQYSMDLYAEYIMQTLRR  215



>ref|XP_002271762.1| PREDICTED: soluble inorganic pyrophosphatase [Vitis vinifera]
 emb|CBI34623.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   367 bits (943),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = +1

Query  223  KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLI  402
            +R   LNERILSSMSRRSVAAHPWHDLEIG  AP+  N V+EITKGSKVKYELDKKTGLI
Sbjct  15   QRPSSLNERILSSMSRRSVAAHPWHDLEIGPGAPQIVNCVVEITKGSKVKYELDKKTGLI  74

Query  403  KVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQG  582
            KVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVL+LMQEPV+PGCFLRARAIGLMPMIDQG
Sbjct  75   KVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLILMQEPVVPGCFLRARAIGLMPMIDQG  134

Query  583  EKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAF  762
            E DDKIIAVCADDPEYRHYTDI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLPS +A 
Sbjct  135  ENDDKIIAVCADDPEYRHYTDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPSSSAH  194

Query  763  EAIKYSMDLYAEYIMQTLRK  822
            +A+++S+DLYAEYI+Q+LR+
Sbjct  195  QAVQHSIDLYAEYILQSLRR  214



>ref|XP_003626619.1| Soluble inorganic pyrophosphatase [Medicago truncatula]
 gb|ABD32723.1| Inorganic pyrophosphatase [Medicago truncatula]
 gb|AES82837.1| soluble inorganic pyrophosphatase [Medicago truncatula]
Length=219

 Score =   367 bits (941),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
             PRLNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EITKGSKVKYELDKKTGLIKV
Sbjct  22   VPRLNERILSSLSRRSVAAHPWHDLEIGPGAPHIFNCVVEITKGSKVKYELDKKTGLIKV  81

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK
Sbjct  82   DRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  141

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            DDKIIAVCADDPEY+H+TD  +L PHR+ EIRRFFEDYKKNENKEVAVN+FLP  TA EA
Sbjct  142  DDKIIAVCADDPEYKHFTDYKELAPHRIMEIRRFFEDYKKNENKEVAVNDFLPPSTAVEA  201

Query  769  IKYSMDLYAEYIMQTLRK  822
            I+YSMDLYAEYI+ TLR+
Sbjct  202  IQYSMDLYAEYILHTLRR  219



>gb|AFK49252.1| unknown [Lotus japonicus]
Length=216

 Score =   367 bits (941),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 191/205 (93%), Gaps = 1/205 (0%)
 Frame = +1

Query  211  AFPQK-RTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDK  387
            A PQ  + P LNERILSSM+RRSVAAHPWHDLEIG EAPK FN V+EI KGSKVKYELDK
Sbjct  12   ANPQNSQHPPLNERILSSMTRRSVAAHPWHDLEIGPEAPKIFNCVVEIAKGSKVKYELDK  71

Query  388  KTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMP  567
            +TGLIKVDR+LYSSVVYPHNYGFIPRT+CED+DP+DVLV+MQEPVLPGCFLRA+AIGLMP
Sbjct  72   RTGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPIDVLVIMQEPVLPGCFLRAKAIGLMP  131

Query  568  MIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLP  747
            MIDQGEKDDKIIAVCADDPEYRHY DI  LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP
Sbjct  132  MIDQGEKDDKIIAVCADDPEYRHYNDIKDLPPHRLAEIRRFFEDYKKNENKEVAVNDFLP  191

Query  748  SDTAFEAIKYSMDLYAEYIMQTLRK  822
            + TAFEAIK+SM LYA+Y++++LR+
Sbjct  192  ASTAFEAIKHSMSLYADYVVESLRR  216



>ref|XP_003568370.1| PREDICTED: soluble inorganic pyrophosphatase-like [Brachypodium 
distachyon]
Length=224

 Score =   367 bits (941),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +1

Query  217  PQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTG  396
            P+++TPRLNERILSS+SRRSVAAHPWHDLEIG +AP  FNVV+EITKGSKVKYELDKKTG
Sbjct  23   PKRQTPRLNERILSSLSRRSVAAHPWHDLEIGPQAPAVFNVVVEITKGSKVKYELDKKTG  82

Query  397  LIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMID  576
            LIKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLVLMQEPVLPG FLRARAIGLMPMID
Sbjct  83   LIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVLMQEPVLPGTFLRARAIGLMPMID  142

Query  577  QGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDT  756
            QGEKDDKIIAVCADDPEY +  ++S L PHRL EIRRFFEDYKKNENKEVAVN+FLP+D 
Sbjct  143  QGEKDDKIIAVCADDPEYHNLNNLSDLSPHRLQEIRRFFEDYKKNENKEVAVNDFLPADD  202

Query  757  AFEAIKYSMDLYAEYIMQTLRK  822
            A  AI++SMDLYA+YIMQ+LR+
Sbjct  203  ARNAIQHSMDLYAQYIMQSLRR  224



>gb|AFK47254.1| unknown [Lotus japonicus]
Length=216

 Score =   366 bits (940),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +1

Query  202  EVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYEL  381
            +VA     + P LNERILSSM+RRSVAAHPWHDLEIG EAPK FN V+EI KGSKVKYEL
Sbjct  10   KVANSQNSQHPPLNERILSSMTRRSVAAHPWHDLEIGPEAPKIFNCVVEIAKGSKVKYEL  69

Query  382  DKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGL  561
            DK+TGLIKVDR+LYSSVVYPHNYGFIPRT+CED+DP+DVLV+MQEPVLPGCFLRA+AIGL
Sbjct  70   DKRTGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPIDVLVIMQEPVLPGCFLRAKAIGL  129

Query  562  MPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEF  741
            MPMIDQGEKDDKIIAVCADDPEYRHY DI  LPPHRLAEIRRFFEDYKKNEN+EVAVN+F
Sbjct  130  MPMIDQGEKDDKIIAVCADDPEYRHYNDIKDLPPHRLAEIRRFFEDYKKNENREVAVNDF  189

Query  742  LPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            LP+ TAFEAIK+SM LYA+Y++++LR+
Sbjct  190  LPASTAFEAIKHSMSLYADYVVESLRR  216



>gb|KEH42358.1| soluble inorganic pyrophosphatase [Medicago truncatula]
Length=248

 Score =   367 bits (943),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/242 (72%), Positives = 203/242 (84%), Gaps = 14/242 (6%)
 Frame = +1

Query  97   TELISQLHFYLDLLSPPVTPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRS  276
            +E++  ++F  ++  P  TP  + T+N                  P LNERILSS++RRS
Sbjct  21   SEIVMNVNFAEEMAPPIETPNKIPTANY--------------TSPPPLNERILSSLTRRS  66

Query  277  VAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGF  456
            VAAHPWHDLEIG EAPK FN V+EI KG+KVKYELDKKTGLIKVDR+LYSSVVYPHNYGF
Sbjct  67   VAAHPWHDLEIGPEAPKIFNCVVEIGKGNKVKYELDKKTGLIKVDRVLYSSVVYPHNYGF  126

Query  457  IPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRH  636
            IPRT+CED DP+DVLV+MQEPVLPGCFLRA+AIGLMPMIDQGEKDDKIIAVCADDPEYRH
Sbjct  127  IPRTICEDGDPIDVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRH  186

Query  637  YTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTL  816
            Y DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLPS +AFEAI++SM LYA+Y++++L
Sbjct  187  YNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPSSSAFEAIEHSMTLYADYVVESL  246

Query  817  RK  822
            R+
Sbjct  247  RR  248



>ref|NP_001235777.1| uncharacterized protein LOC100527417 [Glycine max]
 gb|ACU16507.1| unknown [Glycine max]
Length=216

 Score =   366 bits (940),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = +1

Query  199  NEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYE  378
            N+V+++ Q   PRLNER LSS+SRR VAAHPWHDLEIG EAPK FN V+EI KGSKVKYE
Sbjct  9    NKVSSYQQSPNPRLNERTLSSISRRHVAAHPWHDLEIGPEAPKIFNCVVEIGKGSKVKYE  68

Query  379  LDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIG  558
            LDK+TGLI VDRILYSSVVYPHNYGFIPRT+CED DPMDVLV+MQEPVLPGCFLRA+AIG
Sbjct  69   LDKRTGLIMVDRILYSSVVYPHNYGFIPRTICEDGDPMDVLVIMQEPVLPGCFLRAKAIG  128

Query  559  LMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNE  738
            LMPMID+GEKDDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+
Sbjct  129  LMPMIDRGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVND  188

Query  739  FLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            FLP+  A+EAIK+SM LYAEY+++ LR+
Sbjct  189  FLPASAAYEAIKHSMTLYAEYVVENLRR  216



>emb|CDM85064.1| unnamed protein product [Triticum aestivum]
Length=208

 Score =   366 bits (939),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
             P+LNERILSS+SRR+VAAHPWHDLEIG  AP  FNVV+EITKGSKVKYELDKKTGLIKV
Sbjct  11   APKLNERILSSLSRRAVAAHPWHDLEIGPGAPAVFNVVVEITKGSKVKYELDKKTGLIKV  70

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PG FLRARAIGLMPMIDQGEK
Sbjct  71   DRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVIPGSFLRARAIGLMPMIDQGEK  130

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            DDKIIAVCADDPEYRHY DIS+L PHRL EI+RFFEDYKKNENKEVAV+ FLP+ TA EA
Sbjct  131  DDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNENKEVAVDAFLPATTAREA  190

Query  769  IKYSMDLYAEYIMQTLRK  822
            I+YSMDLYA+YI+Q+LR+
Sbjct  191  IQYSMDLYAQYILQSLRQ  208



>ref|XP_002874977.1| hypothetical protein ARALYDRAFT_490426 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51236.1| hypothetical protein ARALYDRAFT_490426 [Arabidopsis lyrata subsp. 
lyrata]
Length=217

 Score =   366 bits (940),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  193  QSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVK  372
            ++N+     Q  TPRLNERILSS+S+RSVAAHPWHDLEIG  AP  FNVVIEI+KGSKVK
Sbjct  8    KTNQSQKKLQNPTPRLNERILSSLSKRSVAAHPWHDLEIGPGAPVIFNVVIEISKGSKVK  67

Query  373  YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARA  552
            YELDKKTGLIKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRARA
Sbjct  68   YELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRARA  127

Query  553  IGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAV  732
            IGLMPMIDQGEKDDKIIAVC DDPEY+H T+I++LPPHRL+EIRRFFEDYKKNENKEVAV
Sbjct  128  IGLMPMIDQGEKDDKIIAVCVDDPEYKHITNINELPPHRLSEIRRFFEDYKKNENKEVAV  187

Query  733  NEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            N+FL    A EAI+YSMDLYAEYI+ TLR+
Sbjct  188  NDFLQPGPAIEAIQYSMDLYAEYILHTLRR  217



>ref|XP_003590529.1| Soluble inorganic pyrophosphatase [Medicago truncatula]
 gb|AES60780.1| soluble inorganic pyrophosphatase [Medicago truncatula]
Length=252

 Score =   367 bits (943),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/242 (72%), Positives = 203/242 (84%), Gaps = 14/242 (6%)
 Frame = +1

Query  97   TELISQLHFYLDLLSPPVTPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRS  276
            +E++  ++F  ++  P  TP  + T+N                  P LNERILSS++RRS
Sbjct  25   SEIVMNVNFAEEMAPPIETPNKIPTANY--------------TSPPPLNERILSSLTRRS  70

Query  277  VAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGF  456
            VAAHPWHDLEIG EAPK FN V+EI KG+KVKYELDKKTGLIKVDR+LYSSVVYPHNYGF
Sbjct  71   VAAHPWHDLEIGPEAPKIFNCVVEIGKGNKVKYELDKKTGLIKVDRVLYSSVVYPHNYGF  130

Query  457  IPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRH  636
            IPRT+CED DP+DVLV+MQEPVLPGCFLRA+AIGLMPMIDQGEKDDKIIAVCADDPEYRH
Sbjct  131  IPRTICEDGDPIDVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRH  190

Query  637  YTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTL  816
            Y DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLPS +AFEAI++SM LYA+Y++++L
Sbjct  191  YNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPSSSAFEAIEHSMTLYADYVVESL  250

Query  817  RK  822
            R+
Sbjct  251  RR  252



>ref|XP_007144465.1| hypothetical protein PHAVU_007G158400g [Phaseolus vulgaris]
 gb|ESW16459.1| hypothetical protein PHAVU_007G158400g [Phaseolus vulgaris]
Length=216

 Score =   366 bits (939),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = +1

Query  199  NEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYE  378
            N+V+A+     P LNERILSS++RR+VAAHPWHDLEIG EAPK FN V+EI KGSKVKYE
Sbjct  9    NKVSAYQHTPHPPLNERILSSLTRRTVAAHPWHDLEIGPEAPKIFNCVVEIGKGSKVKYE  68

Query  379  LDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIG  558
            LDKKTGLIKVDRILYSSVVYPHNYGFIPRT+CED+DP+DVLV+MQEPVLPGCFLRA+AIG
Sbjct  69   LDKKTGLIKVDRILYSSVVYPHNYGFIPRTICEDSDPIDVLVIMQEPVLPGCFLRAKAIG  128

Query  559  LMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNE  738
            LMPMIDQGEKDDKIIAVCADDPEYRHY DI  LPPHRLAEIRRFFEDYKKNENKEVAVN+
Sbjct  129  LMPMIDQGEKDDKIIAVCADDPEYRHYNDIKDLPPHRLAEIRRFFEDYKKNENKEVAVND  188

Query  739  FLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            FLP+ +A+EA+K+SM LYA+Y++++LR+
Sbjct  189  FLPASSAYEAVKHSMTLYADYVVESLRR  216



>ref|XP_003520887.1| PREDICTED: soluble inorganic pyrophosphatase-like [Glycine max]
Length=211

 Score =   365 bits (938),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS++ E A    +  PRLNERILSS+S+RSVAAHPWHDLEIG EAP+ FN V+EITKGSK
Sbjct  1    MSENGEEAG-ENRPVPRLNERILSSLSKRSVAAHPWHDLEIGPEAPQIFNCVVEITKGSK  59

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRA
Sbjct  60   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPVLPGCFLRA  119

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMID GEKDDKIIAVCADDPEY+H+TD  +L PHR++EIRRFFEDYKKNE+KEV
Sbjct  120  RAIGLMPMIDGGEKDDKIIAVCADDPEYKHFTDYRELAPHRISEIRRFFEDYKKNEHKEV  179

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLP+  A +AI+YSMDLYAEYI+ TLR+
Sbjct  180  AVNDFLPASVALDAIQYSMDLYAEYILHTLRR  211



>ref|XP_003571770.1| PREDICTED: soluble inorganic pyrophosphatase-like [Brachypodium 
distachyon]
Length=205

 Score =   365 bits (937),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            +K  PRLNERILSS+SRRSVAAH WHDLEIG+ AP+ FNVV+EITKGSKVKYELDKK+GL
Sbjct  5    KKDHPRLNERILSSLSRRSVAAHTWHDLEIGSGAPQVFNVVVEITKGSKVKYELDKKSGL  64

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGF+PRTLCED DP+DVLVLMQEP++PGCFLRA+AIGLMPMIDQ
Sbjct  65   IKVDRVLYSSVVYPHNYGFVPRTLCEDGDPIDVLVLMQEPIIPGCFLRAKAIGLMPMIDQ  124

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEYRHY D+ +L PHRLAEIRRFFEDYKKNENK+VAVN+FLPS TA
Sbjct  125  GEKDDKIIAVCVDDPEYRHYNDLKELSPHRLAEIRRFFEDYKKNENKDVAVNDFLPSKTA  184

Query  760  FEAIKYSMDLYAEYIMQTLR  819
             EAIK+SMDLYAEYI+Q+LR
Sbjct  185  QEAIKHSMDLYAEYILQSLR  204



>ref|XP_006604921.1| PREDICTED: soluble inorganic pyrophosphatase-like [Glycine max]
Length=211

 Score =   365 bits (938),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS + E A    +  PRLNERILSS+SRRSVAAHPWHDLEIG EAP+ FN V+EITKGSK
Sbjct  1    MSDNGEEAG-ENRPVPRLNERILSSLSRRSVAAHPWHDLEIGPEAPQIFNCVVEITKGSK  59

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRA
Sbjct  60   VKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPVLPGCFLRA  119

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMID GEKDDKIIAVCADDPEY+H+TD  +L PHR++EIRRFFEDYKKNE+KEV
Sbjct  120  RAIGLMPMIDGGEKDDKIIAVCADDPEYKHFTDYRELAPHRISEIRRFFEDYKKNEHKEV  179

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLP+  A +AI+YSMDLYAEYI+ TLR+
Sbjct  180  AVNDFLPASVAIDAIQYSMDLYAEYILHTLRR  211



>emb|CDX73537.1| BnaC08g24660D [Brassica napus]
Length=217

 Score =   365 bits (938),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q   P LNERILSSM+ RSVAAHPWHDLEIG EAP  FN V+EI KGSKVKYELDK TGL
Sbjct  17   QASLPLLNERILSSMTHRSVAAHPWHDLEIGPEAPIIFNCVVEIGKGSKVKYELDKTTGL  76

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQ
Sbjct  77   IKVDRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVIMQEPVIPGCFLRAKAIGLMPMIDQ  136

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A
Sbjct  137  GEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAA  196

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
            +EA+++SMDLYA+Y+M+TLR+
Sbjct  197  YEAVQHSMDLYADYVMETLRR  217



>ref|XP_008447598.1| PREDICTED: soluble inorganic pyrophosphatase [Cucumis melo]
Length=213

 Score =   365 bits (937),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 193/214 (90%), Gaps = 3/214 (1%)
 Frame = +1

Query  187  MSQSNEVA--AFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKG  360
            M+ SN     A P    P LNERILSSM+RRSVAAHPWHDLEIG +APK FN V+EI KG
Sbjct  1    MAPSNGTTNNAHPSPHPP-LNERILSSMTRRSVAAHPWHDLEIGPDAPKIFNCVVEIGKG  59

Query  361  SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFL  540
            SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLV+MQEPVLPGCFL
Sbjct  60   SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVIMQEPVLPGCFL  119

Query  541  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENK  720
            RA+AIGLMPMIDQGEKDDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENK
Sbjct  120  RAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENK  179

Query  721  EVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            EVAVN+FLP+  AF AIK+SM+LYA+YI+++LR+
Sbjct  180  EVAVNDFLPAADAFMAIKHSMNLYADYIVESLRR  213



>ref|XP_010037866.1| PREDICTED: soluble inorganic pyrophosphatase [Eucalyptus grandis]
 ref|XP_010037867.1| PREDICTED: soluble inorganic pyrophosphatase [Eucalyptus grandis]
 ref|XP_010037868.1| PREDICTED: soluble inorganic pyrophosphatase [Eucalyptus grandis]
 gb|KCW49644.1| hypothetical protein EUGRSUZ_K03162 [Eucalyptus grandis]
Length=218

 Score =   365 bits (937),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSMSRRSVAAHPWHDLEIG  AP  FN VIEI+KGSKVKYELDKKTGLIKVD
Sbjct  22   PPLNERILSSMSRRSVAAHPWHDLEIGPGAPTVFNCVIEISKGSKVKYELDKKTGLIKVD  81

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  82   RILYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  141

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI  LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  AFEA+
Sbjct  142  DKIIAVCADDPEYRHYNDIKDLPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASAAFEAV  201

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM+LYA+YI+++LR+
Sbjct  202  QHSMNLYADYIVESLRR  218



>ref|XP_004306606.1| PREDICTED: soluble inorganic pyrophosphatase-like [Fragaria vesca 
subsp. vesca]
Length=205

 Score =   365 bits (936),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            +K TP+LNERILSS+SR+SVAAHPWHDLEIG  AP+ FNVV+EI++GSKVKYELDKKTGL
Sbjct  5    KKLTPKLNERILSSLSRKSVAAHPWHDLEIGPSAPQIFNVVVEISQGSKVKYELDKKTGL  64

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPV+PG FLRA+AIGLMPMIDQ
Sbjct  65   IKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVIPGSFLRAKAIGLMPMIDQ  124

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDP Y HY DI +LPPHRL EIRRFFEDYKKNE+KEVAV+EFLP  TA
Sbjct  125  GEKDDKIIAVCADDPAYNHYNDIGELPPHRLTEIRRFFEDYKKNEHKEVAVDEFLPCSTA  184

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI+YSMDLYAEYIM TLR+
Sbjct  185  AEAIQYSMDLYAEYIMLTLRR  205



>ref|NP_192057.1| pyrophosphorylase 5 [Arabidopsis thaliana]
 gb|AAC62786.1| F11O4.12 [Arabidopsis thaliana]
 emb|CAB77718.1| putative inorganic phosphatase [Arabidopsis thaliana]
 gb|AAK96707.1| similar to inorganic pyrophosphatase [Arabidopsis thaliana]
 gb|AAM10229.1| similar to inorganic pyrophosphatase [Arabidopsis thaliana]
 gb|AEE82032.1| pyrophosphorylase 5 [Arabidopsis thaliana]
Length=216

 Score =   365 bits (937),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 190/206 (92%), Gaps = 4/206 (2%)
 Frame = +1

Query  217  PQKR----TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELD  384
            PQK+    TPRLNERILSS+S+RSVAAHPWHDLEIG  AP  FNVVIEI+KGSKVKYELD
Sbjct  11   PQKKLQNPTPRLNERILSSLSKRSVAAHPWHDLEIGPGAPVIFNVVIEISKGSKVKYELD  70

Query  385  KKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLM  564
            KKTGLIKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLM
Sbjct  71   KKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRARAIGLM  130

Query  565  PMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFL  744
            PMIDQGEKDDKIIAVC DDPEY+H T+I++LPPHRL+EIRRFFEDYKKNENKEVAVN+FL
Sbjct  131  PMIDQGEKDDKIIAVCVDDPEYKHITNINELPPHRLSEIRRFFEDYKKNENKEVAVNDFL  190

Query  745  PSDTAFEAIKYSMDLYAEYIMQTLRK  822
                A EAI+YSMDLYAEYI+ TLR+
Sbjct  191  QPGPAIEAIQYSMDLYAEYILHTLRR  216



>ref|XP_010097392.1| Soluble inorganic pyrophosphatase [Morus notabilis]
 gb|EXB67898.1| Soluble inorganic pyrophosphatase [Morus notabilis]
Length=272

 Score =   367 bits (942),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSMSRRSVAAHPWHDLEIG  AP+ FN V+EI KGSKVKYELDKKTGLIKVD
Sbjct  76   PPLNERILSSMSRRSVAAHPWHDLEIGPGAPEVFNCVVEIGKGSKVKYELDKKTGLIKVD  135

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCEDNDPMDVL++MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  136  RVLYSSVVYPHNYGFIPRTLCEDNDPMDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  195

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+ TA+EAI
Sbjct  196  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASTAYEAI  255

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM+LYA+YI++ LR+
Sbjct  256  RHSMNLYADYIVENLRR  272



>ref|XP_006646504.1| PREDICTED: soluble inorganic pyrophosphatase-like [Oryza brachyantha]
Length=241

 Score =   366 bits (939),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS+++   A P++  PRLNERILSS SRRSVAAHPWHDL+IGA+AP  FNVV+EI+KGSK
Sbjct  1    MSEADGEGAKPKRPAPRLNERILSSPSRRSVAAHPWHDLDIGADAPAMFNVVVEISKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLI VDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKTGLIMVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVC DDPEYRHY D+S+L PHR+ EIRRFFEDYKKNENKEV
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCVDDPEYRHYNDLSELSPHRVQEIRRFFEDYKKNENKEV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQT  813
            AVNE LP   A +AI+YSMDLYA YI Q+
Sbjct  181  AVNEVLPVTAARDAIQYSMDLYAHYIAQS  209



>gb|AAF26475.1|AC007323_16 T25K16.5 [Arabidopsis thaliana]
Length=230

 Score =   365 bits (937),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 191/219 (87%), Gaps = 18/219 (8%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q+  PRLNERILSS+SRRSVAAHPWHDLEIG  AP+ FNVV+EITKGSKVKYELDKKTGL
Sbjct  12   QRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSKVKYELDKKTGL  71

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCFLRARAIGLMPMIDQ
Sbjct  72   IKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRARAIGLMPMIDQ  131

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDY------------------K  705
            GEKDDKIIAVC DDPEY+HYTDI +LPPHRL+EIRRFFED                   K
Sbjct  132  GEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDCILFLQCSSLFISIDLSTNK  191

Query  706  KNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            KNENKEVAVN+FLPS++A EAI+YSMDLYAEYI+ TLR+
Sbjct  192  KNENKEVAVNDFLPSESAVEAIQYSMDLYAEYILHTLRR  230



>ref|XP_011019913.1| PREDICTED: soluble inorganic pyrophosphatase [Populus euphratica]
Length=216

 Score =   365 bits (936),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRSVAAHPWHDLEIG EAPK FN VIEI KG KVKYELDKKTGLIKVD
Sbjct  20   PPLNERILSSMNRRSVAAHPWHDLEIGPEAPKIFNCVIEIGKGGKVKYELDKKTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCEDNDPMDVL++MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RVLYSSVVYPHNYGFIPRTLCEDNDPMDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A+EAI
Sbjct  140  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASDAYEAI  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM+LYA+YI+++LR+
Sbjct  200  QHSMNLYADYIVESLRR  216



>emb|CDX78192.1| BnaA09g33870D [Brassica napus]
Length=217

 Score =   364 bits (935),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q   P LNERILSSM+ RSVAAHPWHDLEIG EAP  FN V+EI KGSKVKYELDK TGL
Sbjct  17   QVSLPLLNERILSSMTHRSVAAHPWHDLEIGPEAPIIFNCVVEIGKGSKVKYELDKTTGL  76

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQ
Sbjct  77   IKVDRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVIMQEPVIPGCFLRAKAIGLMPMIDQ  136

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A
Sbjct  137  GEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAA  196

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
            +EA+++SMDLYA+Y+M+TLR+
Sbjct  197  YEAVQHSMDLYADYVMETLRR  217



>ref|XP_004142083.1| PREDICTED: soluble inorganic pyrophosphatase-like [Cucumis sativus]
 ref|XP_004165279.1| PREDICTED: soluble inorganic pyrophosphatase-like [Cucumis sativus]
 gb|KGN54227.1| hypothetical protein Csa_4G293860 [Cucumis sativus]
Length=213

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 193/214 (90%), Gaps = 3/214 (1%)
 Frame = +1

Query  187  MSQSNEVA--AFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKG  360
            M+ SN     A P    P LNERILSSM+RRSVAAHPWHDLEIG +APK FN V+EI KG
Sbjct  1    MAPSNGTTNNAHPSPHPP-LNERILSSMTRRSVAAHPWHDLEIGPDAPKIFNCVVEIGKG  59

Query  361  SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFL  540
            SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLV+MQEPVLPGCFL
Sbjct  60   SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVIMQEPVLPGCFL  119

Query  541  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENK  720
            RA+AIGLMPMIDQGEKDDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENK
Sbjct  120  RAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENK  179

Query  721  EVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            EVAVN+FLP+  A+ AIK+SM+LYA+YI+++LR+
Sbjct  180  EVAVNDFLPAAEAYMAIKHSMNLYADYIVESLRR  213



>ref|XP_009139385.1| PREDICTED: soluble inorganic pyrophosphatase-like [Brassica rapa]
 emb|CDX76197.1| BnaA04g04610D [Brassica napus]
Length=217

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q   P LNERILSS++ RSVAAHPWHDLEIG EAP  FN V+EI KGSKVKYELDK TGL
Sbjct  17   QASVPPLNERILSSLTHRSVAAHPWHDLEIGPEAPVIFNCVVEIGKGSKVKYELDKTTGL  76

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQ
Sbjct  77   IKVDRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVIMQEPVIPGCFLRAKAIGLMPMIDQ  136

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A
Sbjct  137  GEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAA  196

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
            +EA+++SMDLYA+Y+M+TLR+
Sbjct  197  YEAVQHSMDLYADYVMETLRR  217



>gb|ACG47598.1| soluble inorganic pyrophosphatase [Zea mays]
Length=214

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 193/214 (90%), Gaps = 2/214 (1%)
 Frame = +1

Query  187  MSQSNEVAAFPQ--KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKG  360
            MS+ ++ AA  +  KR P+LNERILSS+SRRSVAAHPW DLEI  +AP  FNVV+EITKG
Sbjct  1    MSEEDKTAASAEQPKRAPKLNERILSSLSRRSVAAHPWXDLEICPDAPAVFNVVVEITKG  60

Query  361  SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFL  540
            SKVKYELDKKTGLIKVDR+LYSSVVYPHNYGF+PRTLCEDNDPMDVLVLMQEPV+PG FL
Sbjct  61   SKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFVPRTLCEDNDPMDVLVLMQEPVVPGSFL  120

Query  541  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENK  720
            RARAIGLMPMIDQGEK D IIAVCADDPEYRHY DIS+L PHRL EI+RFFEDYKKNENK
Sbjct  121  RARAIGLMPMIDQGEKXDXIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNENK  180

Query  721  EVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            EVAV+ FLP+ TA EAI+YSMDLYA+YI+Q+LR+
Sbjct  181  EVAVDAFLPATTAREAIQYSMDLYAQYILQSLRQ  214



>ref|XP_008358748.1| PREDICTED: soluble inorganic pyrophosphatase-like [Malus domestica]
 ref|XP_009335258.1| PREDICTED: soluble inorganic pyrophosphatase-like [Pyrus x bretschneideri]
Length=217

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 190/212 (90%), Gaps = 2/212 (1%)
 Frame = +1

Query  193  QSNEVAAFPQ--KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            QS E  A  Q  K+ P+LNERILSS+SR+SVAAHPWHDLEIG +AP  FNVV+EI+KGSK
Sbjct  6    QSEEAKAAIQEHKKAPKLNERILSSLSRKSVAAHPWHDLEIGPKAPHIFNVVVEISKGSK  65

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPV PGCFLRA
Sbjct  66   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVHPGCFLRA  125

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            +AIG+MPMIDQGE+DDKIIAVCADDP Y HYTDI +LPPHRL EIRRFFEDYKKNENKEV
Sbjct  126  KAIGVMPMIDQGEEDDKIIAVCADDPAYNHYTDIKELPPHRLTEIRRFFEDYKKNENKEV  185

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AV++FLP+  A   I+YSMDLYAEYIM TLR+
Sbjct  186  AVDQFLPAPNAATVIQYSMDLYAEYIMLTLRR  217



>gb|EMT22352.1| Soluble inorganic pyrophosphatase [Aegilops tauschii]
Length=224

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = +1

Query  190  SQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKV  369
            S +   A  P+ +TP LNERILSS++RRSVAAHPWHDLEIG +AP  FN VIEI KGSKV
Sbjct  14   SANGTAAPAPKTKTPALNERILSSITRRSVAAHPWHDLEIGPDAPTIFNCVIEIPKGSKV  73

Query  370  KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAR  549
            KYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLC+D+DP+DVLV+MQEPV+PGCFLRA+
Sbjct  74   KYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCDDSDPIDVLVIMQEPVVPGCFLRAK  133

Query  550  AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVA  729
            AIGLMPMIDQGE DDKIIAVCADDPEYRH+ DI  LPPHRLAEIRRFFEDYKKNENKEVA
Sbjct  134  AIGLMPMIDQGEADDKIIAVCADDPEYRHFNDIKDLPPHRLAEIRRFFEDYKKNENKEVA  193

Query  730  VNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VN+FLPS+ A+EAI++SMDLYA YI++ LR+
Sbjct  194  VNDFLPSEDAYEAIQHSMDLYATYIVEGLRR  224



>ref|XP_008794929.1| PREDICTED: soluble inorganic pyrophosphatase-like [Phoenix dactylifera]
 ref|XP_008794936.1| PREDICTED: soluble inorganic pyrophosphatase-like [Phoenix dactylifera]
Length=215

 Score =   364 bits (934),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERI+SSMSRRSVAAHPWHDLEIG  AP  FN V+EI KGSKVKYELDKKTGLIKVD
Sbjct  19   PPLNERIISSMSRRSVAAHPWHDLEIGPGAPTIFNCVVEIGKGSKVKYELDKKTGLIKVD  78

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCED+DPMDVLV+MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  79   RVLYSSVVYPHNYGFIPRTLCEDSDPMDVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  138

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEY+HYTDI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A+EAI
Sbjct  139  DKIIAVCADDPEYKHYTDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAAYEAI  198

Query  772  KYSMDLYAEYIMQTLRK  822
            +YSMDLYA YI+++LR+
Sbjct  199  QYSMDLYATYIVESLRR  215



>gb|KHG30820.1| Soluble inorganic pyrophosphatase [Gossypium arboreum]
Length=216

 Score =   364 bits (934),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRSVAAHPWHDLEIG  AP  FN VIEI KGSKVKYELDKKTGLIKVD
Sbjct  20   PPLNERILSSMTRRSVAAHPWHDLEIGPGAPTVFNCVIEIGKGSKVKYELDKKTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+ TA+EAI
Sbjct  140  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASTAYEAI  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM+LYA+YI+++LR+
Sbjct  200  QHSMNLYADYIVESLRR  216



>ref|XP_006588379.1| PREDICTED: uncharacterized protein LOC100306101 isoform X1 [Glycine 
max]
 gb|KHN05927.1| Soluble inorganic pyrophosphatase [Glycine soja]
Length=216

 Score =   364 bits (934),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = +1

Query  199  NEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYE  378
             +V+++     PRLNERILSS+SR+ VAAHPWHDLEIG EAPK FN V+EI KGSKVKYE
Sbjct  9    TKVSSYQHSPNPRLNERILSSISRKHVAAHPWHDLEIGPEAPKIFNCVVEIGKGSKVKYE  68

Query  379  LDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIG  558
            LDK+TGLI VDRILYSSVVYPHNYGFIPRT+CED DPMDVLV+MQEPVLPGCFLRA+AIG
Sbjct  69   LDKRTGLIMVDRILYSSVVYPHNYGFIPRTICEDGDPMDVLVIMQEPVLPGCFLRAKAIG  128

Query  559  LMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNE  738
            LMPMIDQGEKDDKIIAVCADDPEYRHY DI  LPPHRLAEIRRFFEDYKKNENKEVAVN+
Sbjct  129  LMPMIDQGEKDDKIIAVCADDPEYRHYNDIKDLPPHRLAEIRRFFEDYKKNENKEVAVND  188

Query  739  FLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            FLP+  A+EAIK+SM LYAEY+++ LR+
Sbjct  189  FLPASAAYEAIKHSMTLYAEYVVENLRR  216



>ref|XP_006661762.1| PREDICTED: soluble inorganic pyrophosphatase-like [Oryza brachyantha]
Length=204

 Score =   363 bits (932),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  223  KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLI  402
            K+TP LNERILSS+S+RSVAAH WHDLEIG  AP+ FNVV+EITKGSKVKYELDKKTG+I
Sbjct  5    KKTPCLNERILSSLSKRSVAAHSWHDLEIGPGAPEVFNVVVEITKGSKVKYELDKKTGMI  64

Query  403  KVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQG  582
            KVDR+LYSSVVYPHNYGFIPRTLCED DPMDVLVLMQEPV+PGCFLRA+AIGLMPMIDQG
Sbjct  65   KVDRVLYSSVVYPHNYGFIPRTLCEDGDPMDVLVLMQEPVIPGCFLRAKAIGLMPMIDQG  124

Query  583  EKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAF  762
            EKDDKIIAVC DDPE+RH+ D+ +L PHRLAEIRRFFEDYKKNENKEVAVN+FLP  TA 
Sbjct  125  EKDDKIIAVCVDDPEFRHFNDLKELSPHRLAEIRRFFEDYKKNENKEVAVNDFLPPATAL  184

Query  763  EAIKYSMDLYAEYIMQTLRK  822
            EAIKYSMDLYAEYI+ +LR+
Sbjct  185  EAIKYSMDLYAEYILHSLRR  204



>ref|XP_010047418.1| PREDICTED: soluble inorganic pyrophosphatase-like [Eucalyptus 
grandis]
 gb|KCW88909.1| hypothetical protein EUGRSUZ_A01238 [Eucalyptus grandis]
Length=223

 Score =   363 bits (933),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRSVAAHPWHDLEIG  AP  FN VIEI+KGSKVKYELDKKTGLIKVD
Sbjct  27   PPLNERILSSMTRRSVAAHPWHDLEIGPGAPTVFNCVIEISKGSKVKYELDKKTGLIKVD  86

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  87   RVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  146

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI  LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  AFEAI
Sbjct  147  DKIIAVCADDPEYRHYNDIKDLPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASDAFEAI  206

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM+LYA+YI+++LR+
Sbjct  207  QHSMNLYADYIVESLRR  223



>emb|CAC83001.1| soluble pyrophosphatase [Beta vulgaris]
Length=222

 Score =   363 bits (933),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  223  KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLI  402
            +R P+LN+RI+SSMSRRSVAAHPWHDLEIG  AP+  N V+EI KGSKVKYELDKKTGLI
Sbjct  23   RRAPKLNQRIISSMSRRSVAAHPWHDLEIGPNAPEICNCVVEIPKGSKVKYELDKKTGLI  82

Query  403  KVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQG  582
             VDRILYSSVVYPHNYGFIPRTLCED DPMDVLVLMQEPV+PG FLRARAIGLMPMIDQG
Sbjct  83   MVDRILYSSVVYPHNYGFIPRTLCEDGDPMDVLVLMQEPVVPGRFLRARAIGLMPMIDQG  142

Query  583  EKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAF  762
            EKDDKIIAVCADDPE RHYTDI+QLPPHRLAEIRRFFEDYKKNENKEVAVNEFLP+  A 
Sbjct  143  EKDDKIIAVCADDPEVRHYTDINQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPAQIAH  202

Query  763  EAIKYSMDLYAEYIMQTLRK  822
            +AI++SMDLYAEYI+QTLR+
Sbjct  203  DAIQHSMDLYAEYILQTLRR  222



>ref|XP_006403668.1| hypothetical protein EUTSA_v10010704mg [Eutrema salsugineum]
 gb|ESQ45121.1| hypothetical protein EUTSA_v10010704mg [Eutrema salsugineum]
Length=219

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM++RSVAAHPWHDLEIG EAP  FN V+EI KGSKVKYELDK TGLIKVD
Sbjct  23   PPLNERILSSMTQRSVAAHPWHDLEIGPEAPIIFNCVVEIGKGSKVKYELDKTTGLIKVD  82

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  83   RILYSSVVYPHNYGFIPRTLCEDNDPIDVLVIMQEPVIPGCFLRAKAIGLMPMIDQGEKD  142

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A+EA+
Sbjct  143  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAAYEAV  202

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA+Y+M+TLR+
Sbjct  203  QHSMDLYADYVMETLRR  219



>gb|KEH42359.1| soluble inorganic pyrophosphatase [Medicago truncatula]
Length=229

 Score =   363 bits (933),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 198/230 (86%), Gaps = 15/230 (7%)
 Frame = +1

Query  136  LSPPV-TPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIG  312
            ++PP+ TP  + T+N                  P LNERILSS++RRSVAAHPWHDLEIG
Sbjct  14   MAPPIETPNKIPTANY--------------TSPPPLNERILSSLTRRSVAAHPWHDLEIG  59

Query  313  AEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPM  492
             EAPK FN V+EI KG+KVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRT+CED DP+
Sbjct  60   PEAPKIFNCVVEIGKGNKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTICEDGDPI  119

Query  493  DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRL  672
            DVLV+MQEPVLPGCFLRA+AIGLMPMIDQGEKDDKIIAVCADDPEYRHY DI +LPPHRL
Sbjct  120  DVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRL  179

Query  673  AEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AEIRRFFEDYKKNENKEVAVN+FLPS +AFEAI++SM LYA+Y++++LR+
Sbjct  180  AEIRRFFEDYKKNENKEVAVNDFLPSSSAFEAIEHSMTLYADYVVESLRR  229



>ref|XP_009762510.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X1 
[Nicotiana sylvestris]
Length=222

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRSVAAHPWHDLEIG  AP+ FNVV+EI+KGSKVKYELDKKTGLIKVD
Sbjct  26   PPLNERILSSMTRRSVAAHPWHDLEIGPGAPQIFNVVVEISKGSKVKYELDKKTGLIKVD  85

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  86   RVLYSSVVYPHNYGFIPRTLCEDSDPLDVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  145

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEY+ YTDI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  AFEA+
Sbjct  146  DKIIAVCADDPEYKEYTDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATKAFEAV  205

Query  772  KYSMDLYAEYIMQTLRK  822
            ++S DLYA+YI+++LR+
Sbjct  206  QHSQDLYADYIVESLRR  222



>ref|XP_003590528.1| Soluble inorganic pyrophosphatase [Medicago truncatula]
 gb|AES60779.1| soluble inorganic pyrophosphatase [Medicago truncatula]
Length=224

 Score =   363 bits (931),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSS++RRSVAAHPWHDLEIG EAPK FN V+EI KG+KVKYELDKKTGLIKVD
Sbjct  28   PPLNERILSSLTRRSVAAHPWHDLEIGPEAPKIFNCVVEIGKGNKVKYELDKKTGLIKVD  87

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRT+CED DP+DVLV+MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  88   RVLYSSVVYPHNYGFIPRTICEDGDPIDVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  147

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLPS +AFEAI
Sbjct  148  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPSSSAFEAI  207

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM LYA+Y++++LR+
Sbjct  208  EHSMTLYADYVVESLRR  224



>gb|ACG41455.1| soluble inorganic pyrophosphatase [Zea mays]
Length=213

 Score =   362 bits (929),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +1

Query  217  PQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTG  396
            P++R PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNVV+EITKGSKVKYELDKKTG
Sbjct  23   PKRRAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPAVFNVVVEITKGSKVKYELDKKTG  82

Query  397  LIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMID  576
            LIKVDRILYSSVVYPHNYGF+PRTLCEDNDPMDVLVLMQEPVLPG FLRARAIGLMPMID
Sbjct  83   LIKVDRILYSSVVYPHNYGFVPRTLCEDNDPMDVLVLMQEPVLPGAFLRARAIGLMPMID  142

Query  577  QGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDT  756
            QGEKDDKIIAVCADDPEYRHY DIS+L PHRL EIRRFFEDYKKNENKEVAVN+FLP+  
Sbjct  143  QGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIRRFFEDYKKNENKEVAVNDFLPAAA  202

Query  757  AFEAIKYSMDL  789
            A EAI+YSMDL
Sbjct  203  AREAIQYSMDL  213



>ref|XP_009621479.1| PREDICTED: soluble inorganic pyrophosphatase-like [Nicotiana 
tomentosiformis]
 ref|XP_009762511.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 
[Nicotiana sylvestris]
Length=216

 Score =   362 bits (929),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRSVAAHPWHDLEIG  AP+ FNVV+EI+KGSKVKYELDKKTGLIKVD
Sbjct  20   PPLNERILSSMTRRSVAAHPWHDLEIGPGAPQIFNVVVEISKGSKVKYELDKKTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RVLYSSVVYPHNYGFIPRTLCEDSDPLDVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEY+ YTDI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  AFEA+
Sbjct  140  DKIIAVCADDPEYKEYTDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATKAFEAV  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++S DLYA+YI+++LR+
Sbjct  200  QHSQDLYADYIVESLRR  216



>ref|XP_004495003.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 
[Cicer arietinum]
Length=220

 Score =   362 bits (930),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 199/230 (87%), Gaps = 15/230 (7%)
 Frame = +1

Query  136  LSPPV-TPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIG  312
            ++PP+ TP  + TSN                  P LNERILSS++RRSVAAHPWHDLEIG
Sbjct  5    MAPPIETPNKVHTSNY--------------TSPPPLNERILSSLTRRSVAAHPWHDLEIG  50

Query  313  AEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPM  492
             EAPK FN V+EI KG+KVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRT+CED DP+
Sbjct  51   PEAPKIFNCVVEIGKGNKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTICEDGDPI  110

Query  493  DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRL  672
            DVLV+MQEPVLPGCFLRA+AIGLMPMIDQGEKDDKIIAVCADDPEYRHY DI++LPPHRL
Sbjct  111  DVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDINELPPHRL  170

Query  673  AEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AEIRRFFEDYKKNENKEVAV++FLPS TA+EAI++SM LYA+Y++++LR+
Sbjct  171  AEIRRFFEDYKKNENKEVAVDDFLPSSTAYEAIEHSMSLYADYVVESLRR  220



>ref|XP_010920680.1| PREDICTED: soluble inorganic pyrophosphatase-like [Elaeis guineensis]
Length=215

 Score =   362 bits (929),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERI+SSMSRRSVAAHPWHDLEIG  AP  FN V+EI KGSKVKYELDKKTGLIKVD
Sbjct  19   PPLNERIISSMSRRSVAAHPWHDLEIGPGAPTIFNCVVEIGKGSKVKYELDKKTGLIKVD  78

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCED+DPMDVL++MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  79   RVLYSSVVYPHNYGFIPRTLCEDSDPMDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  138

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEY+HYTDI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A+EAI
Sbjct  139  DKIIAVCADDPEYKHYTDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAAYEAI  198

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA YI+++LR+
Sbjct  199  QHSMDLYATYIVESLRR  215



>ref|XP_003565184.1| PREDICTED: soluble inorganic pyrophosphatase-like [Brachypodium 
distachyon]
Length=216

 Score =   362 bits (929),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 193/216 (89%), Gaps = 4/216 (2%)
 Frame = +1

Query  187  MSQSNEVAAFP----QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEIT  354
            M+   EVAA      + +TP LNERILSS+SRRSVAAHPWHDLEIG EAP  FN VIEI 
Sbjct  1    MAPPAEVAAATNGQQKPKTPALNERILSSISRRSVAAHPWHDLEIGPEAPTIFNCVIEIP  60

Query  355  KGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGC  534
            KGSKVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLC+D+DP+DVLV+MQEPV+PGC
Sbjct  61   KGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCDDSDPIDVLVIMQEPVVPGC  120

Query  535  FLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNE  714
            FLRA+AIGLMPMIDQGE DDKIIAVCADDPEYRH+ DI  LPPHRLAEIRRFFEDYKKNE
Sbjct  121  FLRAKAIGLMPMIDQGEADDKIIAVCADDPEYRHFNDIKDLPPHRLAEIRRFFEDYKKNE  180

Query  715  NKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            NKEVAVN+FLPS+ A+EAI++SMDLYA YI++ LR+
Sbjct  181  NKEVAVNDFLPSNDAYEAIQHSMDLYATYIVEGLRR  216



>ref|XP_004495002.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X1 
[Cicer arietinum]
Length=229

 Score =   362 bits (930),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 199/230 (87%), Gaps = 15/230 (7%)
 Frame = +1

Query  136  LSPPV-TPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIG  312
            ++PP+ TP  + TSN                  P LNERILSS++RRSVAAHPWHDLEIG
Sbjct  14   MAPPIETPNKVHTSNY--------------TSPPPLNERILSSLTRRSVAAHPWHDLEIG  59

Query  313  AEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPM  492
             EAPK FN V+EI KG+KVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRT+CED DP+
Sbjct  60   PEAPKIFNCVVEIGKGNKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTICEDGDPI  119

Query  493  DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRL  672
            DVLV+MQEPVLPGCFLRA+AIGLMPMIDQGEKDDKIIAVCADDPEYRHY DI++LPPHRL
Sbjct  120  DVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDINELPPHRL  179

Query  673  AEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AEIRRFFEDYKKNENKEVAV++FLPS TA+EAI++SM LYA+Y++++LR+
Sbjct  180  AEIRRFFEDYKKNENKEVAVDDFLPSSTAYEAIEHSMSLYADYVVESLRR  229



>ref|XP_008363850.1| PREDICTED: soluble inorganic pyrophosphatase-like [Malus domestica]
Length=228

 Score =   362 bits (930),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRS+AAHPWHDLEIG  APK FN VIEI KGSKVKYELDKKTGLIKVD
Sbjct  32   PPLNERILSSMTRRSIAAHPWHDLEIGPGAPKIFNCVIEIPKGSKVKYELDKKTGLIKVD  91

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  92   RILYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVVPGCFLRAKAIGLMPMIDQGEKD  151

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAV++FLP+ TAF+AI
Sbjct  152  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVDDFLPASTAFDAI  211

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM+LYA+YI+++LR+
Sbjct  212  QHSMNLYADYIVESLRR  228



>gb|ACZ27843.1| inorganic pyrophosphatase protein [Medicago truncatula]
 gb|AFK39571.1| unknown [Medicago truncatula]
 gb|KEH42356.1| soluble inorganic pyrophosphatase [Medicago truncatula]
Length=216

 Score =   362 bits (929),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 198/230 (86%), Gaps = 15/230 (7%)
 Frame = +1

Query  136  LSPPV-TPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIG  312
            ++PP+ TP  + T+N                  P LNERILSS++RRSVAAHPWHDLEIG
Sbjct  1    MAPPIETPNKIPTANY--------------TSPPPLNERILSSLTRRSVAAHPWHDLEIG  46

Query  313  AEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPM  492
             EAPK FN V+EI KG+KVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRT+CED DP+
Sbjct  47   PEAPKIFNCVVEIGKGNKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTICEDGDPI  106

Query  493  DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRL  672
            DVLV+MQEPVLPGCFLRA+AIGLMPMIDQGEKDDKIIAVCADDPEYRHY DI +LPPHRL
Sbjct  107  DVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRL  166

Query  673  AEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AEIRRFFEDYKKNENKEVAVN+FLPS +AFEAI++SM LYA+Y++++LR+
Sbjct  167  AEIRRFFEDYKKNENKEVAVNDFLPSSSAFEAIEHSMTLYADYVVESLRR  216



>ref|NP_001064561.1| Os10g0406100 [Oryza sativa Japonica Group]
 gb|ABB47572.1| Soluble inorganic pyrophosphatase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26475.1| Os10g0406100 [Oryza sativa Japonica Group]
 dbj|BAG93093.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71856.1| soluble inorganic pyrophosphatase [Oryza sativa]
Length=204

 Score =   362 bits (928),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            +K+TP LNERILSS+S+RSVAAH WHDLEIG  AP+ FNVV+EITKGSKVKYELDKKTG+
Sbjct  4    EKKTPCLNERILSSLSKRSVAAHSWHDLEIGPGAPQVFNVVVEITKGSKVKYELDKKTGM  63

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCED DPMDVLVLMQEPV+PGC+LRA+AIGLMPMIDQ
Sbjct  64   IKVDRVLYSSVVYPHNYGFIPRTLCEDGDPMDVLVLMQEPVIPGCYLRAKAIGLMPMIDQ  123

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPE+RH+ D+ +L PHRLAEIRRFFEDYKKNENKEVAVN+FLP  TA
Sbjct  124  GEKDDKIIAVCVDDPEFRHFNDLKELSPHRLAEIRRFFEDYKKNENKEVAVNDFLPPATA  183

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAIKYSMDLYAEYI+ +LR+
Sbjct  184  QEAIKYSMDLYAEYILHSLRR  204



>ref|XP_004983149.1| PREDICTED: soluble inorganic pyrophosphatase-like [Setaria italica]
Length=205

 Score =   362 bits (928),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            +K  PRLNERI+SS+S+RSVAAH WHDLEIG  AP  FN V+EITKGSKVKYELDKKTGL
Sbjct  5    KKSQPRLNERIMSSLSKRSVAAHSWHDLEIGPGAPAVFNCVVEITKGSKVKYELDKKTGL  64

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCED DPMDVLVLMQEPV+PGCFLRARAIGLMPMIDQ
Sbjct  65   IKVDRVLYSSVVYPHNYGFIPRTLCEDGDPMDVLVLMQEPVIPGCFLRARAIGLMPMIDQ  124

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEYRH TD+ +L PHRL EIRRFFEDYKKNENKEVAVNEFLP  TA
Sbjct  125  GEKDDKIIAVCVDDPEYRHLTDLKELSPHRLNEIRRFFEDYKKNENKEVAVNEFLPPTTA  184

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI++SMDLYAEYI+ +LR+
Sbjct  185  LEAIQHSMDLYAEYILHSLRR  205



>ref|XP_004495004.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X3 
[Cicer arietinum]
Length=216

 Score =   362 bits (929),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 199/230 (87%), Gaps = 15/230 (7%)
 Frame = +1

Query  136  LSPPV-TPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIG  312
            ++PP+ TP  + TSN                  P LNERILSS++RRSVAAHPWHDLEIG
Sbjct  1    MAPPIETPNKVHTSNY--------------TSPPPLNERILSSLTRRSVAAHPWHDLEIG  46

Query  313  AEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPM  492
             EAPK FN V+EI KG+KVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRT+CED DP+
Sbjct  47   PEAPKIFNCVVEIGKGNKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTICEDGDPI  106

Query  493  DVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRL  672
            DVLV+MQEPVLPGCFLRA+AIGLMPMIDQGEKDDKIIAVCADDPEYRHY DI++LPPHRL
Sbjct  107  DVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDINELPPHRL  166

Query  673  AEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AEIRRFFEDYKKNENKEVAV++FLPS TA+EAI++SM LYA+Y++++LR+
Sbjct  167  AEIRRFFEDYKKNENKEVAVDDFLPSSTAYEAIEHSMSLYADYVVESLRR  216



>ref|NP_001237552.1| uncharacterized protein LOC100306101 [Glycine max]
 gb|ACU14123.1| unknown [Glycine max]
Length=224

 Score =   362 bits (929),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = +1

Query  199  NEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYE  378
             +V+++     PRLNERILSS+SR+ VAAHPWHDLEIG EAPK FN V+EI KGSKVKYE
Sbjct  9    TKVSSYQHSPNPRLNERILSSISRKRVAAHPWHDLEIGPEAPKIFNCVVEIGKGSKVKYE  68

Query  379  LDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIG  558
            LDK+TGLI VDRILYSSVVYPHNYGFIPRT+CED DPMDVLV+MQEPVLPGCFLRA+AIG
Sbjct  69   LDKRTGLIMVDRILYSSVVYPHNYGFIPRTICEDGDPMDVLVIMQEPVLPGCFLRAKAIG  128

Query  559  LMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNE  738
            LMPMIDQGEKDDKIIAVCADDPEYRHY DI  LPPHRLAEIRRFFEDYKKNENKEVAVN+
Sbjct  129  LMPMIDQGEKDDKIIAVCADDPEYRHYNDIKDLPPHRLAEIRRFFEDYKKNENKEVAVND  188

Query  739  FLPSDTAFEAIKYSMDLYAEYIMQTL  816
            FLP+  A+EAIKYSM LYAEY+++ L
Sbjct  189  FLPASAAYEAIKYSMTLYAEYVVENL  214



>gb|KHG29451.1| Soluble inorganic pyrophosphatase [Gossypium arboreum]
Length=216

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSMSRRSVAAHPWHDLEIG  AP  FN VIEI KGSKVKYELDKKTGLI VD
Sbjct  20   PPLNERILSSMSRRSVAAHPWHDLEIGPGAPMVFNCVIEIPKGSKVKYELDKKTGLIMVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCEDNDPMDVL++MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RVLYSSVVYPHNYGFIPRTLCEDNDPMDVLIIMQEPVIPGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+ TA+EAI
Sbjct  140  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASTAYEAI  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++S++LYA+YI+++LR+
Sbjct  200  QHSLNLYADYIVESLRR  216



>ref|XP_002309043.1| inorganic pyrophosphatase family protein [Populus trichocarpa]
 gb|EEE92566.1| inorganic pyrophosphatase family protein [Populus trichocarpa]
Length=216

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRSVAAHPWHDLEIG EAPK FN V+EI KG KVKYELDKKTGLIKVD
Sbjct  20   PPLNERILSSMNRRSVAAHPWHDLEIGPEAPKIFNCVVEIGKGGKVKYELDKKTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCEDNDPMDVL++MQEPVL GCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RVLYSSVVYPHNYGFIPRTLCEDNDPMDVLIIMQEPVLSGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A+EAI
Sbjct  140  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASDAYEAI  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM+LYA+YI+++LR+
Sbjct  200  QHSMNLYADYIVESLRR  216



>gb|KDP35591.1| hypothetical protein JCGZ_09029 [Jatropha curcas]
Length=216

 Score =   361 bits (927),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 195/220 (89%), Gaps = 8/220 (4%)
 Frame = +1

Query  163  LKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVV  342
            ++TSN+ ++SQ +          P LNERILSSMSRRSVAAHPWHDLEIG  APK FN V
Sbjct  5    IETSNKGHVSQPSS--------HPPLNERILSSMSRRSVAAHPWHDLEIGPGAPKIFNCV  56

Query  343  IEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV  522
            +EI KGSKVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLV+MQEPV
Sbjct  57   VEIGKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVIMQEPV  116

Query  523  LPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDY  702
             PGCFLRA+AIGLMPMIDQGEKDDKIIAVCADDPEYRHY DI  LPPHRLAEIRRFFEDY
Sbjct  117  HPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYDDIKDLPPHRLAEIRRFFEDY  176

Query  703  KKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            KKNENKEVAVN+FLP+  A++AI++SM+LY +YI+++LR+
Sbjct  177  KKNENKEVAVNDFLPASDAYKAIQHSMNLYCDYIVESLRR  216



>ref|XP_010937695.1| PREDICTED: soluble inorganic pyrophosphatase-like [Elaeis guineensis]
Length=215

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +1

Query  238  LNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRI  417
            LNERI+SSMSRRSVAAHPWHDLEIG +AP  FN V+EI KGSKVKYELDKKTG+IKVDR+
Sbjct  21   LNERIISSMSRRSVAAHPWHDLEIGPDAPSIFNCVVEIGKGSKVKYELDKKTGMIKVDRV  80

Query  418  LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDK  597
            LYSSVVYPHNYGFIPRTLCEDNDPMDVL++MQEPVLPGCFLRA+AIGLMPMIDQGEKDDK
Sbjct  81   LYSSVVYPHNYGFIPRTLCEDNDPMDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKDDK  140

Query  598  IIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKY  777
            IIAVCADDPEY+HY+DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A+EA+++
Sbjct  141  IIAVCADDPEYKHYSDIQELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAAYEAVQH  200

Query  778  SMDLYAEYIMQTLRK  822
            SMDLYA YI+++LR+
Sbjct  201  SMDLYATYIVESLRR  215



>ref|XP_008387733.1| PREDICTED: soluble inorganic pyrophosphatase-like [Malus domestica]
 ref|XP_008350422.1| PREDICTED: soluble inorganic pyrophosphatase-like [Malus domestica]
Length=228

 Score =   362 bits (928),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRS+AAHPWHDLEIG  APK FN VIEI KGSKVKYELDKKTGLIKVD
Sbjct  32   PPLNERILSSMTRRSIAAHPWHDLEIGPGAPKIFNCVIEIPKGSKVKYELDKKTGLIKVD  91

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  92   RILYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVVPGCFLRAKAIGLMPMIDQGEKD  151

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAV++FLP+ TAF+AI
Sbjct  152  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVDDFLPAATAFDAI  211

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM+LYA+YI+++LR+
Sbjct  212  QHSMNLYADYIVESLRR  228



>gb|ABK21997.1| unknown [Picea sitchensis]
 gb|ABK26831.1| unknown [Picea sitchensis]
 gb|ABR16976.1| unknown [Picea sitchensis]
 gb|ACN40346.1| unknown [Picea sitchensis]
Length=216

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EI KGSKVKYELDKKTGLIKVD
Sbjct  20   PPLNERILSSLSRRSVAAHPWHDLEIGPGAPSVFNCVVEIGKGSKVKYELDKKTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEP+ PGCFLRARAIG+MPMIDQGEKD
Sbjct  80   RILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPIYPGCFLRARAIGVMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHYTDI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+ TA E I
Sbjct  140  DKIIAVCADDPEYRHYTDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASTACEVI  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA YI+++LR+
Sbjct  200  QHSMDLYATYIVESLRR  216



>gb|KHN11364.1| Soluble inorganic pyrophosphatase [Glycine soja]
Length=211

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  229  TPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKV  408
             PRLNERILSS+SRRS+AAHPWHDLEIG EAP+ FN V+EITKGSKVKYELDKKTGLIKV
Sbjct  14   VPRLNERILSSLSRRSLAAHPWHDLEIGPEAPQIFNCVVEITKGSKVKYELDKKTGLIKV  73

Query  409  DRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEK  588
            DR+LYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIGLMPMID GEK
Sbjct  74   DRVLYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPVLPGCFLRARAIGLMPMIDGGEK  133

Query  589  DDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEA  768
            DDKIIAVCADDPEY+H+TD  +L PHR++EIRRFFEDYKKNE+KEVAVN+FLP+  A +A
Sbjct  134  DDKIIAVCADDPEYKHFTDYRELAPHRISEIRRFFEDYKKNEHKEVAVNDFLPASVAIDA  193

Query  769  IKYSMDLYAEYIMQTLRK  822
            I+YSMDLYAEYI+ TLR+
Sbjct  194  IQYSMDLYAEYILHTLRR  211



>ref|XP_010529852.1| PREDICTED: soluble inorganic pyrophosphatase [Tarenaya hassleriana]
Length=216

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSMS+RSVAAHPWHDLEIG EAPK FN VIEI KGSKVKYELDK TGLIKVD
Sbjct  20   PLLNERILSSMSQRSVAAHPWHDLEIGPEAPKIFNCVIEIGKGSKVKYELDKTTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCED+DPMDVL++MQEPV+PGC+LRA+AIGLMPMIDQGEKD
Sbjct  80   RILYSSVVYPHNYGFIPRTLCEDSDPMDVLIIMQEPVIPGCYLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A++AI
Sbjct  140  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAAYDAI  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLY +Y+++TLR+
Sbjct  200  QHSMDLYGDYVLETLRR  216



>gb|AFK46059.1| unknown [Lotus japonicus]
Length=211

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 189/212 (89%), Gaps = 1/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS++ E      +  PRLNERILSS+SRRSVAAHPWHDLEIG  AP  FN V+EITKGSK
Sbjct  1    MSENGEEGQ-DTRPVPRLNERILSSLSRRSVAAHPWHDLEIGPGAPHIFNCVVEITKGSK  59

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLC+DNDP+DVLVLMQEPVLPGCFLRA
Sbjct  60   VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCDDNDPLDVLVLMQEPVLPGCFLRA  119

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGE+DDKIIAVCADDPEY+H++D  +L PHRL EIRRFFEDYKKNENKEV
Sbjct  120  RAIGLMPMIDQGERDDKIIAVCADDPEYKHFSDFQELAPHRLTEIRRFFEDYKKNENKEV  179

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLP   A EAI++SMDLYAEYI+ TLR+
Sbjct  180  AVNDFLPPSVAVEAIQHSMDLYAEYILHTLRR  211



>emb|CAJ44304.1| soluble inorganic pyrophosphatase [Papaver rhoeas]
Length=236

 Score =   362 bits (928),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 195/225 (87%), Gaps = 6/225 (3%)
 Frame = +1

Query  148  VTPFSLKTSNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPK  327
            V P   KT N      + + A++     P LNERILSSMSRR+VAAHPWHDLEIG  AP 
Sbjct  18   VAPAKNKTLN------AIKAASYSSHARPSLNERILSSMSRRAVAAHPWHDLEIGPGAPT  71

Query  328  TFNVVIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVL  507
             FN V+EI +GSKVKYELDKK+GLIKVDRILYSSVVYPHNYGFIPRTLCED DP+DVL++
Sbjct  72   IFNCVVEIPRGSKVKYELDKKSGLIKVDRILYSSVVYPHNYGFIPRTLCEDADPLDVLII  131

Query  508  MQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRR  687
            MQEPVLPGCFLRA+AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDI +LPPHRLAEIRR
Sbjct  132  MQEPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDIKELPPHRLAEIRR  191

Query  688  FFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            FFEDYKKNENKEVAVN+FLP++ A +AI++SMDLYA+YI++ LR+
Sbjct  192  FFEDYKKNENKEVAVNDFLPAEDASKAIQHSMDLYADYIVEALRR  236



>gb|AAU84434.1| inorganic pyrophosphatase [Oryza sativa Japonica Group]
Length=210

 Score =   360 bits (925),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 190/210 (90%), Gaps = 1/210 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQ-KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGS  363
            MS+ +  AA  Q +R P+LNERILSS+SRRSVAAHPWHDLEIG  AP  FNVV+EITKGS
Sbjct  1    MSEEDTNAAAGQPRRAPKLNERILSSLSRRSVAAHPWHDLEIGPGAPAVFNVVVEITKGS  60

Query  364  KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLR  543
            KVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PG FLR
Sbjct  61   KVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVIPGSFLR  120

Query  544  ARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKE  723
            ARAIGLMPMIDQGEKDDKIIAVCADDPEYRHY DIS+L PHRL EI+RFFEDYKKNENKE
Sbjct  121  ARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNENKE  180

Query  724  VAVNEFLPSDTAFEAIKYSMDLYAEYIMQT  813
            VAV+ FLP++TA +AI+YSMDL A+ I+ +
Sbjct  181  VAVDAFLPANTARDAIQYSMDLAAQNILHS  210



>gb|EEC66916.1| hypothetical protein OsI_33514 [Oryza sativa Indica Group]
Length=247

 Score =   362 bits (929),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            +K+TP LNERILSS+S+RSVAAH WHDLEIG  AP+ FNVV+EITKGSKVKYELDKKTG+
Sbjct  47   EKKTPCLNERILSSLSKRSVAAHSWHDLEIGPGAPQVFNVVVEITKGSKVKYELDKKTGM  106

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCED DPMDVLVLMQEPV+PGC+LRA+AIGLMPMIDQ
Sbjct  107  IKVDRVLYSSVVYPHNYGFIPRTLCEDGDPMDVLVLMQEPVIPGCYLRAKAIGLMPMIDQ  166

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPE+RH+ D+ +L PHRLAEIRRFFEDYKKNENKEVAVN+FLP  TA
Sbjct  167  GEKDDKIIAVCVDDPEFRHFNDLKELSPHRLAEIRRFFEDYKKNENKEVAVNDFLPPATA  226

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAIKYSMDLYAEYI+ +LR+
Sbjct  227  QEAIKYSMDLYAEYILHSLRR  247



>ref|XP_004302755.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=243

 Score =   362 bits (928),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRS+AAHPWHDLEIG  APK FN V+EI KGSKVKYELDKKTGLIKVD
Sbjct  47   PPLNERILSSMTRRSIAAHPWHDLEIGPGAPKIFNCVVEIGKGSKVKYELDKKTGLIKVD  106

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCEDNDP+D L++MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  107  RILYSSVVYPHNYGFIPRTLCEDNDPLDCLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  166

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY+DI  LPPHRLAEIRRFFEDYKKNENKEVAV++FLP+  AFE+I
Sbjct  167  DKIIAVCADDPEYRHYSDIKDLPPHRLAEIRRFFEDYKKNENKEVAVDDFLPASAAFESI  226

Query  772  KYSMDLYAEYIMQTLRK  822
            + SMDLYA+YI+++LR+
Sbjct  227  QQSMDLYADYIVESLRR  243



>ref|XP_004302756.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=215

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  193  QSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVK  372
            ++ +  A      P LNERILSSM+RRS+AAHPWHDLEIG  APK FN V+EI KGSKVK
Sbjct  6    EATQTGANHYSSHPPLNERILSSMTRRSIAAHPWHDLEIGPGAPKIFNCVVEIGKGSKVK  65

Query  373  YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARA  552
            YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDP+D L++MQEPVLPGCFLRA+A
Sbjct  66   YELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDCLIIMQEPVLPGCFLRAKA  125

Query  553  IGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAV  732
            IGLMPMIDQGEKDDKIIAVCADDPEYRHY+DI  LPPHRLAEIRRFFEDYKKNENKEVAV
Sbjct  126  IGLMPMIDQGEKDDKIIAVCADDPEYRHYSDIKDLPPHRLAEIRRFFEDYKKNENKEVAV  185

Query  733  NEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            ++FLP+  AFE+I+ SMDLYA+YI+++LR+
Sbjct  186  DDFLPASAAFESIQQSMDLYADYIVESLRR  215



>ref|NP_001136694.1| uncharacterized protein LOC100216827 [Zea mays]
 gb|ACF82419.1| unknown [Zea mays]
 gb|ACG40673.1| soluble inorganic pyrophosphatase [Zea mays]
 gb|ACL54061.1| unknown [Zea mays]
 gb|AFW74915.1| Soluble inorganic pyrophosphatase [Zea mays]
Length=214

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  223  KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLI  402
            ++ P LNERILSSMSRRSVAAHPWHDLEIG  AP  FN VIEI +GSKVKYELDKKTGLI
Sbjct  15   QKVPALNERILSSMSRRSVAAHPWHDLEIGPGAPTIFNCVIEIPRGSKVKYELDKKTGLI  74

Query  403  KVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQG  582
            KVDR+LYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQG
Sbjct  75   KVDRVLYSSVVYPHNYGFIPRTLCEDSDPLDVLVIMQEPVIPGCFLRAKAIGLMPMIDQG  134

Query  583  EKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAF  762
            E DDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A+
Sbjct  135  EADDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASAAY  194

Query  763  EAIKYSMDLYAEYIMQTLRK  822
            EAI++SMDLYA YI++ LR+
Sbjct  195  EAIQHSMDLYATYIVEGLRR  214



>ref|XP_009421347.1| PREDICTED: soluble inorganic pyrophosphatase-like [Musa acuminata 
subsp. malaccensis]
Length=215

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q   P LNERILSSMSRRSVAAHPWHDLEIG  AP  FN V+EI KGSKVKYELDKKTGL
Sbjct  15   QISHPPLNERILSSMSRRSVAAHPWHDLEIGPGAPTIFNCVVEIGKGSKVKYELDKKTGL  74

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPVLPGCFLRA+AIGLMPMIDQ
Sbjct  75   IKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFLRAKAIGLMPMIDQ  134

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEY+HY DI +LPPHRLAEIRRFFEDYKKNENK+VAVN+FLP+ +A
Sbjct  135  GEKDDKIIAVCADDPEYKHYNDIKELPPHRLAEIRRFFEDYKKNENKDVAVNDFLPASSA  194

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
            ++AI++SMDLYA YI+++LR+
Sbjct  195  YKAIQHSMDLYATYIVESLRR  215



>gb|AFP74893.1| soluble inorganic pyrophosphatase [Hevea brasiliensis]
Length=216

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q   P LNERILSSM+RRSVAAHPWHDLEIG  APK FN VIEI KGSKVKYELDKKTGL
Sbjct  16   QSSHPPLNERILSSMTRRSVAAHPWHDLEIGPGAPKIFNCVIEIGKGSKVKYELDKKTGL  75

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPVLPGCFLRA+AIG+MPMIDQ
Sbjct  76   IKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPGCFLRAKAIGVMPMIDQ  135

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNEN+EVAVN+FLP+  A
Sbjct  136  GEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENEEVAVNDFLPASDA  195

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
            ++A+++SM+LYA+YI+++LR+
Sbjct  196  YKAVQHSMNLYADYIVESLRR  216



>ref|XP_010649123.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Vitis 
vinifera]
Length=223

 Score =   360 bits (925),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = +1

Query  196  SNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKY  375
            S++ + FP      LNERILSSMSRRS+AAHPWHDLEIG  AP  FN V+EI KGSKVKY
Sbjct  17   SSKTSGFPHHVV--LNERILSSMSRRSIAAHPWHDLEIGPGAPSVFNCVVEIGKGSKVKY  74

Query  376  ELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAI  555
            ELDK +GLIKVDR+LYSSVVYPHNYGFIPRT+CED+DPMDVL+LMQEPVLPG FLRARAI
Sbjct  75   ELDKASGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLILMQEPVLPGSFLRARAI  134

Query  556  GLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVN  735
            GLMPMIDQGEKDDKIIAVCADDPE+RHY DI ++PPHRLAEIRRFFEDYKKNENKEV VN
Sbjct  135  GLMPMIDQGEKDDKIIAVCADDPEFRHYKDIKEIPPHRLAEIRRFFEDYKKNENKEVNVN  194

Query  736  EFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            +FLP+D+A EAIKYSMDLYA YI+++LR+
Sbjct  195  DFLPADSAIEAIKYSMDLYASYIVESLRQ  223



>ref|XP_009374655.1| PREDICTED: soluble inorganic pyrophosphatase-like [Pyrus x bretschneideri]
 ref|XP_009350087.1| PREDICTED: soluble inorganic pyrophosphatase-like [Pyrus x bretschneideri]
Length=228

 Score =   360 bits (925),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRS+AAHPWHDLEIG  APK FN VIEI KGSKVKYELDKKTGLIKVD
Sbjct  32   PPLNERILSSMTRRSIAAHPWHDLEIGPGAPKIFNCVIEIPKGSKVKYELDKKTGLIKVD  91

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  92   RILYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVVPGCFLRAKAIGLMPMIDQGEKD  151

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI  LPPHRLAEIRRFFEDYKKNENKEVAV++FLP+ TAF+AI
Sbjct  152  DKIIAVCADDPEYRHYNDIKDLPPHRLAEIRRFFEDYKKNENKEVAVDDFLPAATAFDAI  211

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM+LYA+YI+++LR+
Sbjct  212  QHSMNLYADYIVESLRR  228



>ref|XP_006653973.1| PREDICTED: soluble inorganic pyrophosphatase-like [Oryza brachyantha]
Length=215

 Score =   360 bits (924),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  226  RTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIK  405
            + P LNERILSSMSRRSVAAHPWHDLEIG  AP  FN VIEI +GSKVKYELDKKTGLIK
Sbjct  17   KAPALNERILSSMSRRSVAAHPWHDLEIGPGAPTVFNCVIEIPRGSKVKYELDKKTGLIK  76

Query  406  VDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGE  585
            VDR+LYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQGE
Sbjct  77   VDRVLYSSVVYPHNYGFIPRTLCEDSDPLDVLVIMQEPVIPGCFLRAKAIGLMPMIDQGE  136

Query  586  KDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFE  765
             DDKIIAVCADDPEY+HY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+ +A+E
Sbjct  137  ADDKIIAVCADDPEYKHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASSAYE  196

Query  766  AIKYSMDLYAEYIMQTLRK  822
            AI++SMDLYA YI++ LR+
Sbjct  197  AIQHSMDLYATYIVEGLRR  215



>ref|XP_010686641.1| PREDICTED: soluble inorganic pyrophosphatase-like [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score =   360 bits (924),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = +1

Query  190  SQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKV  369
            +++ E+     +R  +LNERILSS+SRRSVAAHPWHDL++G EAP   N VIEITKGSKV
Sbjct  7    NENEEMVTQSPRRPAKLNERILSSLSRRSVAAHPWHDLDVGPEAPNIVNCVIEITKGSKV  66

Query  370  KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAR  549
            KYELDKKTG+IKVDRILYSSVVYPHNYGFIPRTLC+DNDP+DVLVLMQEPVLP CFLR +
Sbjct  67   KYELDKKTGMIKVDRILYSSVVYPHNYGFIPRTLCDDNDPLDVLVLMQEPVLPACFLRIK  126

Query  550  AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVA  729
            AIGLMPMIDQGE DDKIIAVCADDPEY+ Y+DI +LPPHRLAEIRRFFEDYKKNENKEVA
Sbjct  127  AIGLMPMIDQGEADDKIIAVCADDPEYKFYSDIKELPPHRLAEIRRFFEDYKKNENKEVA  186

Query  730  VNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VN+FLP + A+EAI++SMDLYAEYIM TL++
Sbjct  187  VNDFLPKEAAYEAIQHSMDLYAEYIMHTLKR  217



>ref|XP_010263618.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Nelumbo 
nucifera]
 ref|XP_010263619.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Nelumbo 
nucifera]
 ref|XP_010263620.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Nelumbo 
nucifera]
Length=214

 Score =   360 bits (923),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +1

Query  238  LNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRI  417
            LNERILSSMSRRS AAHPWHDLEIG  AP  FN V+EI+KGSKVKYELDK +GLIK+DR+
Sbjct  20   LNERILSSMSRRSFAAHPWHDLEIGPGAPAVFNCVVEISKGSKVKYELDKTSGLIKIDRV  79

Query  418  LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDK  597
            LYSSVVYPHNYGFIPRT+CED+DPMDVLVLMQEPVLPGC+LRARAIGLMPMIDQGEKDDK
Sbjct  80   LYSSVVYPHNYGFIPRTICEDSDPMDVLVLMQEPVLPGCYLRARAIGLMPMIDQGEKDDK  139

Query  598  IIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKY  777
            IIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVNEFLP++ A +AIKY
Sbjct  140  IIAVCADDPEYRHYKDIKELPPHRLAEIRRFFEDYKKNENKEVAVNEFLPAEEAIKAIKY  199

Query  778  SMDLYAEYIMQTLRK  822
            SMDLYA YI+++LR+
Sbjct  200  SMDLYASYIVESLRQ  214



>ref|XP_002264695.2| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Vitis 
vinifera]
 emb|CBI17491.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   360 bits (923),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 188/209 (90%), Gaps = 2/209 (1%)
 Frame = +1

Query  196  SNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKY  375
            S++ + FP      LNERILSSMSRRS+AAHPWHDLEIG  AP  FN V+EI KGSKVKY
Sbjct  9    SSKTSGFPHHVV--LNERILSSMSRRSIAAHPWHDLEIGPGAPSVFNCVVEIGKGSKVKY  66

Query  376  ELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAI  555
            ELDK +GLIKVDR+LYSSVVYPHNYGFIPRT+CED+DPMDVL+LMQEPVLPG FLRARAI
Sbjct  67   ELDKASGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLILMQEPVLPGSFLRARAI  126

Query  556  GLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVN  735
            GLMPMIDQGEKDDKIIAVCADDPE+RHY DI ++PPHRLAEIRRFFEDYKKNENKEV VN
Sbjct  127  GLMPMIDQGEKDDKIIAVCADDPEFRHYKDIKEIPPHRLAEIRRFFEDYKKNENKEVNVN  186

Query  736  EFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            +FLP+D+A EAIKYSMDLYA YI+++LR+
Sbjct  187  DFLPADSAIEAIKYSMDLYASYIVESLRQ  215



>ref|XP_010553295.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X1 
[Tarenaya hassleriana]
Length=220

 Score =   360 bits (923),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM++RSVAAHPWHDLEIG  APK FN VIEI KGSKVKYELDK TGLIKVD
Sbjct  24   PPLNERILSSMTQRSVAAHPWHDLEIGPGAPKIFNCVIEIGKGSKVKYELDKTTGLIKVD  83

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCED+DPMDVL++MQEPV+PGC+LRA+AIGLMPMIDQGEKD
Sbjct  84   RILYSSVVYPHNYGFIPRTLCEDSDPMDVLIIMQEPVIPGCYLRAKAIGLMPMIDQGEKD  143

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A++AI
Sbjct  144  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAAYDAI  203

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA+YI++TLR+
Sbjct  204  QHSMDLYADYILETLRR  220



>gb|AFP74894.1| soluble inorganic pyrophosphatase [Hevea brasiliensis]
Length=216

 Score =   360 bits (923),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q   P LNERILSSM+RRSVAAHPWHDLEIG  APK FN VIEI KG KVKYELDKKTGL
Sbjct  16   QSSHPPLNERILSSMTRRSVAAHPWHDLEIGPGAPKIFNCVIEIGKGGKVKYELDKKTGL  75

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPVLPGCFLRA+AIGLMPMIDQ
Sbjct  76   IKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPGCFLRAKAIGLMPMIDQ  135

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHY DI +LPPHRLAEIRRF EDYKKNENKEVAVN+FLP+  A
Sbjct  136  GEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFLEDYKKNENKEVAVNDFLPASDA  195

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
            ++A+++SM+LYA+YI+++LR+
Sbjct  196  YKAVQHSMNLYADYIVESLRR  216



>gb|ACG47583.1| soluble inorganic pyrophosphatase [Zea mays]
Length=214

 Score =   360 bits (923),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 191/214 (89%), Gaps = 2/214 (1%)
 Frame = +1

Query  187  MSQSNEVAAFPQ--KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKG  360
            MS+ ++ AA  +  KR P+LNERILSS+SRRSVAAHPWHDLEIG +AP  FNVV+EITKG
Sbjct  1    MSEEDKTAASAEQPKRAPKLNERILSSLSRRSVAAHPWHDLEIGPDAPAVFNVVVEITKG  60

Query  361  SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFL  540
            SKVKYELDKKTGLIKVDR+LYSSVVYPHNYGF+PRTLCEDNDPMDVLVLMQEPV+PG FL
Sbjct  61   SKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFVPRTLCEDNDPMDVLVLMQEPVVPGSFL  120

Query  541  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENK  720
            RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHY DIS+L PHRL EI RFFEDYKKNENK
Sbjct  121  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYXDISELSPHRLXEIXRFFEDYKKNENK  180

Query  721  EVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            EVAV+ FLP+  A EAI+YS DL  + I+++LR+
Sbjct  181  EVAVDAFLPATXAREAIQYSXDLXXQNILRSLRQ  214



>gb|AFW74914.1| Soluble inorganic pyrophosphatase [Zea mays]
Length=239

 Score =   360 bits (925),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  223  KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLI  402
            ++ P LNERILSSMSRRSVAAHPWHDLEIG  AP  FN VIEI +GSKVKYELDKKTGLI
Sbjct  40   QKVPALNERILSSMSRRSVAAHPWHDLEIGPGAPTIFNCVIEIPRGSKVKYELDKKTGLI  99

Query  403  KVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQG  582
            KVDR+LYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQG
Sbjct  100  KVDRVLYSSVVYPHNYGFIPRTLCEDSDPLDVLVIMQEPVIPGCFLRAKAIGLMPMIDQG  159

Query  583  EKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAF  762
            E DDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A+
Sbjct  160  EADDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASAAY  219

Query  763  EAIKYSMDLYAEYIMQTLRK  822
            EAI++SMDLYA YI++ LR+
Sbjct  220  EAIQHSMDLYATYIVEGLRR  239



>ref|XP_009116059.1| PREDICTED: soluble inorganic pyrophosphatase-like [Brassica rapa]
Length=217

 Score =   360 bits (923),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            Q   P LNERILSSM+ RSVAAHPWHDLEIG EAP  FN V+EI KG KVK ELDK TGL
Sbjct  17   QVSLPLLNERILSSMTHRSVAAHPWHDLEIGPEAPIIFNCVVEIGKGGKVKEELDKTTGL  76

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDRILYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQ
Sbjct  77   IKVDRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVIMQEPVIPGCFLRAKAIGLMPMIDQ  136

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A
Sbjct  137  GEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAA  196

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
            +EA+++SMDLYA+Y+M+TLR+
Sbjct  197  YEAVQHSMDLYADYVMETLRR  217



>gb|EEE50931.1| hypothetical protein OsJ_31465 [Oryza sativa Japonica Group]
Length=204

 Score =   359 bits (921),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            +K+TP LNERILSS+S+RSVAAH WHDLEIG  AP+ FNVV+ ITKGSKVKYELDKKTG+
Sbjct  4    EKKTPCLNERILSSLSKRSVAAHSWHDLEIGPGAPQVFNVVVGITKGSKVKYELDKKTGM  63

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCED DPMDVLVLMQEPV+PGC+LRA+AIGLMPMIDQ
Sbjct  64   IKVDRVLYSSVVYPHNYGFIPRTLCEDGDPMDVLVLMQEPVIPGCYLRAKAIGLMPMIDQ  123

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPE+RH+ D+ +L PHRLAEIRRFFEDYKKNENKEVAVN+FLP  TA
Sbjct  124  GEKDDKIIAVCVDDPEFRHFNDLKELSPHRLAEIRRFFEDYKKNENKEVAVNDFLPPATA  183

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAIKYSMDLYAEYI+ +LR+
Sbjct  184  QEAIKYSMDLYAEYILHSLRR  204



>gb|ABK93489.1| unknown [Populus trichocarpa]
Length=216

 Score =   359 bits (922),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRSVAAHPWHDLEIG EAPK FN V+EI KG KVKYELDKK GLIKVD
Sbjct  20   PPLNERILSSMNRRSVAAHPWHDLEIGPEAPKIFNCVVEIGKGGKVKYELDKKNGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCEDNDPMDVL++MQEPVL GCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RVLYSSVVYPHNYGFIPRTLCEDNDPMDVLIIMQEPVLSGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A+EAI
Sbjct  140  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASDAYEAI  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM+LYA+YI+++LR+
Sbjct  200  QHSMNLYADYIVESLRR  216



>ref|XP_010553296.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 
[Tarenaya hassleriana]
Length=216

 Score =   359 bits (922),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM++RSVAAHPWHDLEIG  APK FN VIEI KGSKVKYELDK TGLIKVD
Sbjct  20   PPLNERILSSMTQRSVAAHPWHDLEIGPGAPKIFNCVIEIGKGSKVKYELDKTTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCED+DPMDVL++MQEPV+PGC+LRA+AIGLMPMIDQGEKD
Sbjct  80   RILYSSVVYPHNYGFIPRTLCEDSDPMDVLIIMQEPVIPGCYLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A++AI
Sbjct  140  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAAYDAI  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA+YI++TLR+
Sbjct  200  QHSMDLYADYILETLRR  216



>ref|XP_004961949.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X1 
[Setaria italica]
Length=253

 Score =   360 bits (925),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 190/232 (82%), Gaps = 30/232 (13%)
 Frame = +1

Query  217  PQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNV-------------------  339
            P++R PRLNERILSS+SRRSVAAHPWHDLEIG EAP  FNV                   
Sbjct  22   PKRRAPRLNERILSSLSRRSVAAHPWHDLEIGPEAPAVFNVVSTWIPFLPQSKVAITTER  81

Query  340  -----------VIEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDND  486
                       V+EITKGSKVKYELDKKTGLIKVDR+LYSSVVYPHNYGFIPR+LCEDND
Sbjct  82   ECLIRCAFLEQVVEITKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRSLCEDND  141

Query  487  PMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPH  666
            PMDVLVLMQEPVLPG FLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHY DIS+L PH
Sbjct  142  PMDVLVLMQEPVLPGAFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDISELSPH  201

Query  667  RLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            RL EIRRFFEDYKKNENK+VAV++FLP+  A EAI+YSMDLY +YIMQTLR+
Sbjct  202  RLQEIRRFFEDYKKNENKDVAVDDFLPAAAAREAIQYSMDLYGQYIMQTLRR  253



>ref|XP_009377104.1| PREDICTED: soluble inorganic pyrophosphatase-like [Pyrus x bretschneideri]
Length=228

 Score =   359 bits (922),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRS+AAHPWHDLEIG  APK FN VIEI KGSKVKYELDKKTGLIKVD
Sbjct  32   PPLNERILSSMTRRSIAAHPWHDLEIGPGAPKIFNCVIEIPKGSKVKYELDKKTGLIKVD  91

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  92   RILYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVVPGCFLRAKAIGLMPMIDQGEKD  151

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAV++FLP+ TA +A+
Sbjct  152  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVDDFLPASTALDAV  211

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM+LYA+YI+++LR+
Sbjct  212  QHSMNLYADYIVESLRR  228



>ref|XP_008241484.1| PREDICTED: soluble inorganic pyrophosphatase [Prunus mume]
Length=226

 Score =   359 bits (922),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRS+AAHPWHDLEIG  APK FN VIEI KGSKVKYELDKKTGLIKVD
Sbjct  30   PPLNERILSSMTRRSIAAHPWHDLEIGPGAPKIFNCVIEIPKGSKVKYELDKKTGLIKVD  89

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  90   RILYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVVPGCFLRAKAIGLMPMIDQGEKD  149

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI  LPPHRLAEIRRFFEDYKKNENKEVAV++FLP+  A++AI
Sbjct  150  DKIIAVCADDPEYRHYQDIKDLPPHRLAEIRRFFEDYKKNENKEVAVDDFLPASAAYDAI  209

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA+YI+++LR+
Sbjct  210  QHSMDLYADYIVESLRR  226



>ref|XP_007205831.1| hypothetical protein PRUPE_ppa010998mg [Prunus persica]
 gb|EMJ07030.1| hypothetical protein PRUPE_ppa010998mg [Prunus persica]
Length=228

 Score =   359 bits (922),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRS+AAHPWHDLEIG  APK FN VIEI KGSKVKYELDKKTGLIKVD
Sbjct  32   PPLNERILSSMTRRSIAAHPWHDLEIGPGAPKIFNCVIEIPKGSKVKYELDKKTGLIKVD  91

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  92   RILYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVVPGCFLRAKAIGLMPMIDQGEKD  151

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI  LPPHRLAEIRRFFEDYKKNENKEVAV++FLP+  A++AI
Sbjct  152  DKIIAVCADDPEYRHYQDIKDLPPHRLAEIRRFFEDYKKNENKEVAVDDFLPASAAYDAI  211

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA+YI+++LR+
Sbjct  212  QHSMDLYADYIVESLRR  228



>ref|XP_004960501.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X1 
[Setaria italica]
 ref|XP_004960502.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 
[Setaria italica]
Length=214

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 188/207 (91%), Gaps = 2/207 (1%)
 Frame = +1

Query  202  EVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYEL  381
            E  +F  ++ P LNERILSSMSRR+VAAHPWHDLEIG  AP  FN VIEI +GSKVKYEL
Sbjct  10   EAGSF--QKVPALNERILSSMSRRAVAAHPWHDLEIGPGAPTIFNCVIEIPRGSKVKYEL  67

Query  382  DKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGL  561
            DKKTGLIKVDR+LYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPV+PGCFLRA+AIGL
Sbjct  68   DKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDSDPLDVLVIMQEPVIPGCFLRAKAIGL  127

Query  562  MPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEF  741
            MPMIDQGE DDKIIAVCADDPEY+HY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+F
Sbjct  128  MPMIDQGEADDKIIAVCADDPEYKHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDF  187

Query  742  LPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            LP+  A+EAI++SMDLYA YI++ LR+
Sbjct  188  LPASAAYEAIQHSMDLYATYIVEGLRR  214



>ref|XP_007027101.1| Pyrophosphorylase 4 [Theobroma cacao]
 gb|EOY07603.1| Pyrophosphorylase 4 [Theobroma cacao]
Length=216

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSM+RRSVAAHPWHDLEIG  AP  FN VIEI KGSKVKYELDKKTGLIKVD
Sbjct  20   PPLNERILSSMTRRSVAAHPWHDLEIGPGAPMVFNCVIEIGKGSKVKYELDKKTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPV PGCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVQPGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRH+ DI  LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+ TA+EAI
Sbjct  140  DKIIAVCADDPEYRHFNDIKDLPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATTAYEAI  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SM+LYA+YI+++LR+
Sbjct  200  QHSMNLYADYIVESLRR  216



>emb|CDP06650.1| unnamed protein product [Coffea canephora]
Length=222

 Score =   358 bits (920),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSS++RRS AAHPWHDLEIG  AP  FN V+EI++GSKVKYELDKKTGLIKVD
Sbjct  26   PPLNERILSSLTRRSAAAHPWHDLEIGPGAPMIFNCVVEISRGSKVKYELDKKTGLIKVD  85

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCEDNDP+DVLV+MQEPVLPGCFLRA+AIG+MPMIDQGEKD
Sbjct  86   RVLYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFLRAKAIGVMPMIDQGEKD  145

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI++LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A+EA+
Sbjct  146  DKIIAVCADDPEYRHYNDINELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASKAYEAV  205

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA+YI+++LR+
Sbjct  206  QHSMDLYADYIVESLRR  222



>ref|NP_190930.1| pyrophosphorylase 4 [Arabidopsis thaliana]
 emb|CAB67669.1| inorganic pyrophosphatase-like protein [Arabidopsis thaliana]
 dbj|BAE98700.1| inorganic pyrophosphatase -like protein [Arabidopsis thaliana]
 gb|AEE79120.1| pyrophosphorylase 4 [Arabidopsis thaliana]
Length=216

 Score =   358 bits (919),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSMS RSVAAHPWHDLEIG EAP  FN V+EI KGSKVKYELDK TGLIKVD
Sbjct  20   PTLNERILSSMSHRSVAAHPWHDLEIGPEAPIIFNCVVEIGKGSKVKYELDKTTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RILYSSVVYPHNYGFIPRTLCEDSDPIDVLVIMQEPVIPGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DIS+LPPHR+AEIRRFFEDYKKNENKEVAVN+FLP+  A++A+
Sbjct  140  DKIIAVCADDPEYRHYNDISELPPHRMAEIRRFFEDYKKNENKEVAVNDFLPATAAYDAV  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA+Y+++ LR+
Sbjct  200  QHSMDLYADYVVENLRR  216



>ref|XP_010504130.1| PREDICTED: soluble inorganic pyrophosphatase-like [Camelina sativa]
Length=216

 Score =   358 bits (919),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSMS RSVAAHPWHDLEIG EAP  FN V+EI KGSKVKYELDK TGLIKVD
Sbjct  20   PTLNERILSSMSHRSVAAHPWHDLEIGPEAPIIFNCVVEIGKGSKVKYELDKTTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RILYSSVVYPHNYGFIPRTLCEDSDPIDVLVIMQEPVIPGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DIS+LPPHR+AEIRRFFEDYKKNENKEVAVN+FLP+  A++A+
Sbjct  140  DKIIAVCADDPEYRHYNDISELPPHRMAEIRRFFEDYKKNENKEVAVNDFLPATAAYDAV  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA+Y+++ LR+
Sbjct  200  QHSMDLYADYVVENLRR  216



>ref|XP_002467268.1| hypothetical protein SORBIDRAFT_01g022340 [Sorghum bicolor]
 gb|EER94266.1| hypothetical protein SORBIDRAFT_01g022340 [Sorghum bicolor]
Length=204

 Score =   358 bits (918),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            +K  PRLNERI+S++S+RSVAAH WHDLEIG  AP  FN V+EITKGSKVKYELDKKTG+
Sbjct  4    EKSVPRLNERIMSTLSKRSVAAHSWHDLEIGPGAPAVFNCVVEITKGSKVKYELDKKTGM  63

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCED DPMDVLVLMQEPV+PGCFLRARAIGLMPMIDQ
Sbjct  64   IKVDRVLYSSVVYPHNYGFIPRTLCEDGDPMDVLVLMQEPVIPGCFLRARAIGLMPMIDQ  123

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEYRH TD+ +L PHRL EIRRFFEDYKKNENKEVAVN+FLP  T+
Sbjct  124  GEKDDKIIAVCVDDPEYRHLTDLKELSPHRLNEIRRFFEDYKKNENKEVAVNDFLPPTTS  183

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI++SMDLYAEYI+ +LR+
Sbjct  184  LEAIQHSMDLYAEYILHSLRR  204



>ref|XP_006291827.1| hypothetical protein CARUB_v10018002mg [Capsella rubella]
 ref|XP_010515860.1| PREDICTED: soluble inorganic pyrophosphatase-like [Camelina sativa]
 gb|EOA24725.1| hypothetical protein CARUB_v10018002mg [Capsella rubella]
Length=216

 Score =   358 bits (919),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSMS RSVAAHPWHDLEIG EAP  FN V+EI KGSKVKYELDK TGLIKVD
Sbjct  20   PTLNERILSSMSHRSVAAHPWHDLEIGPEAPIIFNCVVEIGKGSKVKYELDKTTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RILYSSVVYPHNYGFIPRTLCEDSDPIDVLVIMQEPVIPGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DIS+LPPHR+AEIRRFFEDYKKNENKEVAVN+FLP+  A++A+
Sbjct  140  DKIIAVCADDPEYRHYNDISELPPHRMAEIRRFFEDYKKNENKEVAVNDFLPATAAYDAV  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA+Y+++ LR+
Sbjct  200  QHSMDLYADYVVENLRR  216



>ref|XP_002876216.1| hypothetical protein ARALYDRAFT_485748 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52475.1| hypothetical protein ARALYDRAFT_485748 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score =   358 bits (919),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSMS RSVAAHPWHDLEIG EAP  FN V+EI KGSKVKYELDK TGLIKVD
Sbjct  20   PTLNERILSSMSHRSVAAHPWHDLEIGPEAPIIFNCVVEIGKGSKVKYELDKTTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RILYSSVVYPHNYGFIPRTLCEDSDPIDVLVIMQEPVIPGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DIS+LPPHR+AEIRRFFEDYKKNENKEVAVN+FLP+  A++A+
Sbjct  140  DKIIAVCADDPEYRHYNDISELPPHRMAEIRRFFEDYKKNENKEVAVNDFLPATAAYDAV  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA+Y+++ LR+
Sbjct  200  QHSMDLYADYVVENLRR  216



>ref|XP_008644851.1| PREDICTED: soluble inorganic pyrophosphatase [Zea mays]
 gb|AFW68794.1| hypothetical protein ZEAMMB73_398976 [Zea mays]
Length=204

 Score =   357 bits (917),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            +K  PRLNERI+SS+S+RSVAAH WHDLEIG  AP  FN V+EITKGSKVKYELDKKTG+
Sbjct  4    EKSRPRLNERIMSSLSKRSVAAHSWHDLEIGPGAPAVFNCVVEITKGSKVKYELDKKTGM  63

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            IKVDR+LYSSVVYPHNYGFIPRTLCED DPMDVLVLMQEPV+PGCFLRARAIGLMPMIDQ
Sbjct  64   IKVDRVLYSSVVYPHNYGFIPRTLCEDGDPMDVLVLMQEPVIPGCFLRARAIGLMPMIDQ  123

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GEKDDKIIAVC DDPEYRH TD+ +L PHRL EIRRFFEDYKKNENKEVAVN+FLP  T+
Sbjct  124  GEKDDKIIAVCVDDPEYRHLTDLKELSPHRLNEIRRFFEDYKKNENKEVAVNDFLPPTTS  183

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
             EAI++SMDLYAEYI+ +LR+
Sbjct  184  LEAIQHSMDLYAEYILHSLRR  204



>emb|CAG30522.1| putative inorganic pyrophosphatase [Arachis hypogaea]
 gb|AAT47553.1| putative inorganic pyrophosphatase [Arachis hypogaea]
Length=216

 Score =   358 bits (918),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  202  EVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYEL  381
            +VA     + P LNERI+SSM+RRSVAAHPWHDLEIG EAPK FN V+EI KGSKVKYEL
Sbjct  10   KVAITQHSKPPPLNERIISSMTRRSVAAHPWHDLEIGPEAPKIFNCVVEIGKGSKVKYEL  69

Query  382  DKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGL  561
            DKKTGLIKVDR+LYSSVVYPHNYGFIPRT+CED+DPMDVLV+MQEPVLPGCFLRA+AIGL
Sbjct  70   DKKTGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLVIMQEPVLPGCFLRAKAIGL  129

Query  562  MPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEF  741
            MPMIDQGEKDDKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEV V++F
Sbjct  130  MPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVEVHDF  189

Query  742  LPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            L + TA  AIK+SM LYA+YI+++LR+
Sbjct  190  LLATTAMRAIKHSMTLYADYIVESLRR  216



>ref|XP_010427018.1| PREDICTED: soluble inorganic pyrophosphatase-like [Camelina sativa]
Length=216

 Score =   358 bits (918),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSMS RSVAAHPWHDLEIG EAP  FN V+EI KGSKVKYELDK TGLIKVD
Sbjct  20   PTLNERILSSMSHRSVAAHPWHDLEIGPEAPIIFNCVVEIGKGSKVKYELDKTTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQGEKD
Sbjct  80   RILYSSVVYPHNYGFIPRTLCEDSDPIDVLVIMQEPVIPGCFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DIS+LPPHR+AEIRRFFEDYKKNENKEVAVN+FLP+  A++A+
Sbjct  140  DKIIAVCADDPEYRHYNDISELPPHRMAEIRRFFEDYKKNENKEVAVNDFLPATAAYDAV  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA+Y+++ LR+
Sbjct  200  QHSMDLYADYVVENLRR  216



>ref|XP_006878535.1| hypothetical protein AMTR_s00011p00227250 [Amborella trichopoda]
 gb|ERM94680.1| hypothetical protein AMTR_s00011p00227250 [Amborella trichopoda]
Length=215

 Score =   357 bits (917),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 187/213 (88%), Gaps = 3/213 (1%)
 Frame = +1

Query  184  NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGS  363
               + +  + FP  +   LNERILSSMSRRSVAAHPWHDLEIG  AP  FN V+EI KGS
Sbjct  6    GQGEGSNRSCFPHVK---LNERILSSMSRRSVAAHPWHDLEIGPGAPAVFNCVVEIGKGS  62

Query  364  KVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLR  543
            KVKYELDK +GLIK+DR+LYSSVVYPHNYGFIPRT+CED+DPMDVLVLMQEPVLPGCFLR
Sbjct  63   KVKYELDKISGLIKIDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLVLMQEPVLPGCFLR  122

Query  544  ARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKE  723
            ARAIGLMPMIDQGEKDDKIIAVCADDPE+RHY DI +LPPHRLAEIRRFFEDYKKNENK 
Sbjct  123  ARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYQDIKELPPHRLAEIRRFFEDYKKNENKS  182

Query  724  VAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VAVN+FLP++ A +AIKYSMDLYA YI++ LR+
Sbjct  183  VAVNDFLPAEAAIKAIKYSMDLYASYIIECLRQ  215



>ref|XP_006340642.1| PREDICTED: soluble inorganic pyrophosphatase-like [Solanum tuberosum]
Length=214

 Score =   357 bits (916),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +1

Query  238  LNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRI  417
            LNERILSSMSRRS+AAHPWHDLEIG  AP  FN V+EI KGSKVKYELDK +GLIKVDRI
Sbjct  20   LNERILSSMSRRSIAAHPWHDLEIGPGAPSIFNCVVEIGKGSKVKYELDKASGLIKVDRI  79

Query  418  LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDK  597
            LYSSVVYPHNYGFIPRTLCED+DPMDVLVLMQEPVLP  FLRARAIGLMPMIDQGEKDDK
Sbjct  80   LYSSVVYPHNYGFIPRTLCEDSDPMDVLVLMQEPVLPSTFLRARAIGLMPMIDQGEKDDK  139

Query  598  IIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKY  777
            IIAVCADDPE+RHYTDI +LPPHRLAEIRRFFEDYKKNENK VAV +FLP++ A EAIKY
Sbjct  140  IIAVCADDPEFRHYTDIKELPPHRLAEIRRFFEDYKKNENKSVAVEDFLPAEAAVEAIKY  199

Query  778  SMDLYAEYIMQTLRK  822
            SMDLYA YI+++LRK
Sbjct  200  SMDLYASYIVESLRK  214



>ref|XP_011093001.1| PREDICTED: soluble inorganic pyrophosphatase [Sesamum indicum]
 ref|XP_011093002.1| PREDICTED: soluble inorganic pyrophosphatase [Sesamum indicum]
Length=208

 Score =   357 bits (915),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  226  RTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIK  405
            R P+LNERILSS+S+RSV AHPWHD+EIG+EAP   N V+EITKGSKVKYELDKKTG+IK
Sbjct  10   RAPKLNERILSSLSKRSVIAHPWHDIEIGSEAPHIVNCVVEITKGSKVKYELDKKTGMIK  69

Query  406  VDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGE  585
            VDR+LYSSVVYPHNYGFIPRTLCEDNDP+D+LVLMQEPVLPG  LRA+ IGLMPMIDQGE
Sbjct  70   VDRVLYSSVVYPHNYGFIPRTLCEDNDPLDILVLMQEPVLPGSVLRAKPIGLMPMIDQGE  129

Query  586  KDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFE  765
            KDDK+IAVCADDPEYRHYTD  QLPPHRLAEIRRFFEDYKKNENKEVAVN FL  +TAF+
Sbjct  130  KDDKLIAVCADDPEYRHYTDFKQLPPHRLAEIRRFFEDYKKNENKEVAVNAFLSPETAFD  189

Query  766  AIKYSMDLYAEYIMQTLRK  822
             I+ S+DLYAEYIMQTL++
Sbjct  190  VIQNSIDLYAEYIMQTLKR  208



>ref|NP_001054459.1| Os05g0114000 [Oryza sativa Japonica Group]
 gb|AAS75249.1| putative inorganic pyrophosphatase [Oryza sativa Japonica Group]
 dbj|BAF16373.1| Os05g0114000 [Oryza sativa Japonica Group]
 dbj|BAG91372.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78401.1| hypothetical protein OsI_18190 [Oryza sativa Indica Group]
 gb|EEE62094.1| hypothetical protein OsJ_16878 [Oryza sativa Japonica Group]
Length=216

 Score =   357 bits (916),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  226  RTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIK  405
            + P LNERILSSMSRRS+AAHPWHDLEIG  AP  FN VIEI +GSKVKYELDKKTGLI 
Sbjct  18   KAPALNERILSSMSRRSIAAHPWHDLEIGPGAPTIFNCVIEIPRGSKVKYELDKKTGLIV  77

Query  406  VDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGE  585
            VDR+LYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPV+PGCFLRA+AIGLMPMIDQGE
Sbjct  78   VDRVLYSSVVYPHNYGFIPRTLCEDSDPLDVLVIMQEPVIPGCFLRAKAIGLMPMIDQGE  137

Query  586  KDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFE  765
             DDKIIAVCADDPEY+HY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A+E
Sbjct  138  ADDKIIAVCADDPEYKHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASAAYE  197

Query  766  AIKYSMDLYAEYIMQTLRK  822
            AIK+SMDLYA YI++ LR+
Sbjct  198  AIKHSMDLYATYIVEGLRR  216



>ref|XP_007162670.1| hypothetical protein PHAVU_001G170300g [Phaseolus vulgaris]
 ref|XP_007162671.1| hypothetical protein PHAVU_001G170300g [Phaseolus vulgaris]
 gb|AGV54328.1| soluble inorganic pyrophosphatase-like protein [Phaseolus vulgaris]
 gb|ESW34664.1| hypothetical protein PHAVU_001G170300g [Phaseolus vulgaris]
 gb|ESW34665.1| hypothetical protein PHAVU_001G170300g [Phaseolus vulgaris]
Length=229

 Score =   357 bits (917),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERI+SSM+RRSVAAHPWHDLEIG  AP  FN V+EI KGSKVKYELDKK+GLIK+D
Sbjct  33   PPLNERIISSMTRRSVAAHPWHDLEIGPGAPTIFNCVVEIGKGSKVKYELDKKSGLIKID  92

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCED+DP+DVL++MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  93   RVLYSSVVYPHNYGFIPRTLCEDSDPLDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  152

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  AFEA+
Sbjct  153  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAAFEAV  212

Query  772  KYSMDLYAEYIMQTLRK  822
            K SM LYA+YI+++LR+
Sbjct  213  KRSMSLYADYIVESLRR  229



>gb|ACN40874.1| unknown [Picea sitchensis]
Length=213

 Score =   357 bits (915),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 188/211 (89%), Gaps = 3/211 (1%)
 Frame = +1

Query  190  SQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKV  369
               N  + FP      LNERILSS++RRSVAAHPWHDLEIG  AP  FN V+EI KGSKV
Sbjct  6    GDGNVSSGFPDIA---LNERILSSLTRRSVAAHPWHDLEIGPGAPSVFNCVVEIGKGSKV  62

Query  370  KYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRAR  549
            KYELDKKTGLIK+DR+LYSSVVYPHNYGFIPRTLCED+DPMDVLVLMQEP++PGCFLRA+
Sbjct  63   KYELDKKTGLIKIDRVLYSSVVYPHNYGFIPRTLCEDSDPMDVLVLMQEPIVPGCFLRAK  122

Query  550  AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVA  729
            AIGLMPMIDQGEKDDKIIAVCADDPE+RHY DI +LPPHRLAEIRRFFEDYKKNENKEVA
Sbjct  123  AIGLMPMIDQGEKDDKIIAVCADDPEFRHYRDIKELPPHRLAEIRRFFEDYKKNENKEVA  182

Query  730  VNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            VN+FLP++ A +AIKYSMDLYA YI+++LR+
Sbjct  183  VNDFLPAEDAEKAIKYSMDLYASYIVESLRQ  213



>ref|XP_006645405.1| PREDICTED: soluble inorganic pyrophosphatase-like [Oryza brachyantha]
Length=218

 Score =   357 bits (915),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  196  SNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKY  375
            S  V++  + + P LNERILSSMS+RSVAAHPWHDLEIG EAP  FN VIEI +GSKVKY
Sbjct  10   STTVSSPSKGKAPPLNERILSSMSKRSVAAHPWHDLEIGPEAPIIFNCVIEIPRGSKVKY  69

Query  376  ELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAI  555
            ELDKKTGL+KVDR+LYSSVVYPHNYGFIPRTLC+D+DP+DVLV+MQEPV+PGCFLRA+AI
Sbjct  70   ELDKKTGLVKVDRVLYSSVVYPHNYGFIPRTLCDDSDPLDVLVIMQEPVIPGCFLRAKAI  129

Query  556  GLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVN  735
            G+MPMIDQGE DDKIIAVCADDPEY+HY DI  LPPHRLAEIRRFFEDYKKNENKEVAVN
Sbjct  130  GVMPMIDQGEADDKIIAVCADDPEYKHYNDIKDLPPHRLAEIRRFFEDYKKNENKEVAVN  189

Query  736  EFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            +FLP+ +A+E I++SMDLYA YI++ LR+
Sbjct  190  DFLPATSAYETIRHSMDLYATYILEGLRR  218



>ref|XP_002521557.1| inorganic pyrophosphatase, putative [Ricinus communis]
 gb|EEF40828.1| inorganic pyrophosphatase, putative [Ricinus communis]
Length=212

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            M  S   A+    R   LNERI+SSMSRRSVAAHPWHDLEIG  AP  FN V+EI KGSK
Sbjct  1    MDNSGGEASGKSSRKVALNERIISSMSRRSVAAHPWHDLEIGPGAPSVFNCVVEIGKGSK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDK +GLIKVDR+LYSSVVYPHNYGFIPRT+CED+DPMDVLVLMQEPVLPG FLRA
Sbjct  61   VKYELDKISGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLVLMQEPVLPGTFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPE+RHYTDI +LPPHRLAEIRRFFEDYKKNENK+V
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEFRHYTDIKELPPHRLAEIRRFFEDYKKNENKKV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
             V +FLP++ A  AIKYSMDLYA YI+++LR+
Sbjct  181  DVEDFLPAEAAINAIKYSMDLYASYIVESLRQ  212



>gb|AAM65537.1| inorganic pyrophosphatase-like protein [Arabidopsis thaliana]
Length=216

 Score =   356 bits (914),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSMS RSVAAHPWHDLEIG EAP  FN V+EI KGSKVKYELDK TGLIKVD
Sbjct  20   PTLNERILSSMSHRSVAAHPWHDLEIGPEAPIIFNCVVEIGKGSKVKYELDKTTGLIKVD  79

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCED+DP+DVLV+MQEPV+P CFLRA+AIGLMPMIDQGEKD
Sbjct  80   RILYSSVVYPHNYGFIPRTLCEDSDPIDVLVIMQEPVIPACFLRAKAIGLMPMIDQGEKD  139

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DIS+LPPHR+AEIRRFFEDYKKNENKEVAVN+FLP+  A++A+
Sbjct  140  DKIIAVCADDPEYRHYNDISELPPHRMAEIRRFFEDYKKNENKEVAVNDFLPATAAYDAV  199

Query  772  KYSMDLYAEYIMQTLRK  822
            ++SMDLYA+Y+++ LR+
Sbjct  200  QHSMDLYADYVVENLRR  216



>ref|XP_006429019.1| hypothetical protein CICLE_v10012723mg [Citrus clementina]
 ref|XP_006480750.1| PREDICTED: soluble inorganic pyrophosphatase-like [Citrus sinensis]
 gb|ESR42259.1| hypothetical protein CICLE_v10012723mg [Citrus clementina]
 gb|AHL43880.1| putative inorganic pyrophosphatase [Citrus maxima]
Length=217

 Score =   356 bits (914),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERILSSMSRRSVAAHPWHDLEIG  APK FN VIEI KGSKVKYELDKK+GLI VD
Sbjct  21   PPLNERILSSMSRRSVAAHPWHDLEIGPGAPKIFNCVIEIGKGSKVKYELDKKSGLIMVD  80

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCEDNDP+DVL++MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  81   RVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  140

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  A+ ++
Sbjct  141  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASDAYNSV  200

Query  772  KYSMDLYAEYIMQTLRK  822
            + SM+LYA+YI+++LR+
Sbjct  201  QQSMNLYADYIVESLRR  217



>ref|XP_003554332.1| PREDICTED: soluble inorganic pyrophosphatase isoform X1 [Glycine 
max]
 ref|XP_006604534.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Glycine 
max]
Length=229

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERI+SSM+RRSVAAHPWHDLEIG  AP  FN VIEI KGSKVKYELDKK+GLIK+D
Sbjct  33   PPLNERIISSMTRRSVAAHPWHDLEIGPGAPIIFNCVIEIGKGSKVKYELDKKSGLIKID  92

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRT+CED+DP+DVL++MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  93   RVLYSSVVYPHNYGFIPRTICEDSDPLDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  152

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  AFEA+
Sbjct  153  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASAAFEAV  212

Query  772  KYSMDLYAEYIMQTLRK  822
            K SM LYA+YI+++LR+
Sbjct  213  KRSMSLYADYIVESLRR  229



>ref|XP_003612058.1| Soluble inorganic pyrophosphatase [Medicago truncatula]
 gb|AES95016.1| soluble inorganic pyrophosphatase [Medicago truncatula]
Length=213

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 192/214 (90%), Gaps = 4/214 (2%)
 Frame = +1

Query  184  NMSQSNE-VAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKG  360
            N   SNE  ++ P    P+LNERILSSMSRR+VAAHPWHD+EIG  AP  FN VIEI KG
Sbjct  3    NHDGSNEWSSSLPH---PKLNERILSSMSRRTVAAHPWHDVEIGPGAPSVFNCVIEIGKG  59

Query  361  SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFL  540
            SKVKYELDK +GLIKVDRILYSSVVYPHNYGFIPRT+CED+DPMDVLVLMQEPVLPG FL
Sbjct  60   SKVKYELDKTSGLIKVDRILYSSVVYPHNYGFIPRTICEDSDPMDVLVLMQEPVLPGTFL  119

Query  541  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENK  720
            RARAIGLMPMIDQGE+DDKIIAVCADDPE+RHYTDI +LPPHRLAEIRRFFEDYKKNENK
Sbjct  120  RARAIGLMPMIDQGERDDKIIAVCADDPEFRHYTDIKELPPHRLAEIRRFFEDYKKNENK  179

Query  721  EVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            +V V++FLP+++A +AIKYSMDLYA YI+++LRK
Sbjct  180  KVDVDDFLPAESAVDAIKYSMDLYASYIVESLRK  213



>emb|CDY41563.1| BnaC04g00590D [Brassica napus]
Length=752

 Score =   374 bits (960),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P+LNERILS++S+RSVAAHPWHDLEIG EAP  FNVV+EITKGSKVKYELDKKTGLIKVD
Sbjct  556  PKLNERILSTLSKRSVAAHPWHDLEIGPEAPLVFNVVVEITKGSKVKYELDKKTGLIKVD  615

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            RILYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRARAIGLMPMIDQGE D
Sbjct  616  RILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEMD  675

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEY+H+TDI QL PHRL+EIRRFFEDYKKNE+KEVAVN+FLPS+ A EAI
Sbjct  676  DKIIAVCADDPEYKHFTDIKQLAPHRLSEIRRFFEDYKKNEHKEVAVNDFLPSEKAHEAI  735

Query  772  KYSMDLYAEYIMQTLRK  822
            +YSMDLYAEYI+ +LR+
Sbjct  736  QYSMDLYAEYILHSLRR  752



>gb|AFK40071.1| unknown [Medicago truncatula]
Length=216

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 192/214 (90%), Gaps = 4/214 (2%)
 Frame = +1

Query  184  NMSQSNE-VAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKG  360
            N   SNE  ++ P    P+LNERILSSMSRR+VAAHPWHD+EIG  AP  FN VIEI KG
Sbjct  3    NHDGSNEWSSSLPH---PKLNERILSSMSRRTVAAHPWHDVEIGPGAPSVFNCVIEIGKG  59

Query  361  SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFL  540
            SKVKYELDK +GLIKVDRILYSSVVYPHNYGFIPRT+CED+DPMDVLVLMQEPVLPG FL
Sbjct  60   SKVKYELDKTSGLIKVDRILYSSVVYPHNYGFIPRTICEDSDPMDVLVLMQEPVLPGTFL  119

Query  541  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENK  720
            RARAIGLMPMIDQGE+DDKIIAVCADDPE+RHYTDI +LPPHRLAEIRRFFEDYKKNENK
Sbjct  120  RARAIGLMPMIDQGERDDKIIAVCADDPEFRHYTDIKELPPHRLAEIRRFFEDYKKNENK  179

Query  721  EVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            +V V++FLP+++A +AIKYSMDLYA YI+++LRK
Sbjct  180  KVDVDDFLPAESAVDAIKYSMDLYASYIVESLRK  213



>ref|NP_001044907.1| Os01g0866500 [Oryza sativa Japonica Group]
 dbj|BAD81917.1| putative soluble inorganic pyrophosphatase [Oryza sativa Japonica 
Group]
 dbj|BAF06821.1| Os01g0866500 [Oryza sativa Japonica Group]
 gb|EAY76609.1| hypothetical protein OsI_04559 [Oryza sativa Indica Group]
 gb|EAZ14274.1| hypothetical protein OsJ_04199 [Oryza sativa Japonica Group]
 dbj|BAG99401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=212

 Score =   355 bits (912),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 181/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  208  AAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDK  387
             A P++  PRLNERILSS+SRRSVAAHPWHDL+ GA+AP  FNVV+EI+KGSKVKYELDK
Sbjct  9    GAKPKRPAPRLNERILSSLSRRSVAAHPWHDLDTGADAPAVFNVVVEISKGSKVKYELDK  68

Query  388  KTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMP  567
            KTG I VDR+LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPV+PGCFLRARAIGLMP
Sbjct  69   KTGFIMVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVIPGCFLRARAIGLMP  128

Query  568  MIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLP  747
            MIDQGEKDDKIIAVC DDPEYRHY D+S+L PHR+ EIRRFFEDYKKNENKEVAVNE LP
Sbjct  129  MIDQGEKDDKIIAVCVDDPEYRHYNDLSELSPHRVQEIRRFFEDYKKNENKEVAVNEVLP  188

Query  748  SDTAFEAIKYSMDLYAEYI  804
               A +AI+YSMDLYA+YI
Sbjct  189  VTAARDAIQYSMDLYAQYI  207



>gb|AGV54692.1| soluble inorganic pyrophosphatase [Phaseolus vulgaris]
Length=229

 Score =   356 bits (913),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERI+SSM+RRSVAAHPWHDLEIG  AP  FN V+EI KGSKVKYELDKK+GLIK+D
Sbjct  33   PPLNERIISSMTRRSVAAHPWHDLEIGPGAPTIFNCVVEIGKGSKVKYELDKKSGLIKID  92

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRTLCED+DP+DVL++MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  93   RVLYSSVVYPHNYGFIPRTLCEDSDPLDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  152

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  AFEA+
Sbjct  153  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPATAAFEAV  212

Query  772  KYSMDLYAEYIMQTLRK  822
              SM LYA+YI+++LR+
Sbjct  213  SRSMSLYADYIVESLRR  229



>ref|XP_002966020.1| hypothetical protein SELMODRAFT_167898 [Selaginella moellendorffii]
 ref|XP_002971470.1| hypothetical protein SELMODRAFT_147848 [Selaginella moellendorffii]
 gb|EFJ27219.1| hypothetical protein SELMODRAFT_147848 [Selaginella moellendorffii]
 gb|EFJ33440.1| hypothetical protein SELMODRAFT_167898 [Selaginella moellendorffii]
Length=212

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSK  366
            MS  N   A        LN+RILSS+SRRSVAAHPWHDLEIG  AP  FN V+EI+KG K
Sbjct  1    MSTPNGPIANSGSAKSPLNKRILSSLSRRSVAAHPWHDLEIGPGAPAVFNCVVEISKGGK  60

Query  367  VKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRA  546
            VKYELDKK+GLIKVDR+LYSSVVYPHNYGFIPRTLCEDNDP+DVLVLMQEPVLPGCFLRA
Sbjct  61   VKYELDKKSGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRA  120

Query  547  RAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEV  726
            RAIGLMPMIDQGEKDDKIIAVCADDPE+ HY DI  LPPHRLAEIRRFFEDYKKNENK V
Sbjct  121  RAIGLMPMIDQGEKDDKIIAVCADDPEFTHYQDIKDLPPHRLAEIRRFFEDYKKNENKTV  180

Query  727  AVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            AVN+FLP++ A +AI++SMDLYA YI+++LR+
Sbjct  181  AVNDFLPAENAVQAIQHSMDLYASYIVESLRQ  212



>ref|XP_004232423.1| PREDICTED: soluble inorganic pyrophosphatase [Solanum lycopersicum]
Length=214

 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +1

Query  238  LNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRI  417
            LNERILSSMSR+S+AAHPWHDLEIG  AP  FN V+EI KGSKVKYELDK +GLIKVDRI
Sbjct  20   LNERILSSMSRKSIAAHPWHDLEIGPGAPSVFNCVVEIGKGSKVKYELDKASGLIKVDRI  79

Query  418  LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDK  597
            LYSSVVYPHNYGFIPRTLCED+DPMDVLVLMQEPVLP  FLRARAIGLMPMIDQGEKDDK
Sbjct  80   LYSSVVYPHNYGFIPRTLCEDSDPMDVLVLMQEPVLPSTFLRARAIGLMPMIDQGEKDDK  139

Query  598  IIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKY  777
            IIAVCADDPE+RHYTDI +LPPHRLAEIRRFFEDYKKNENK VAV +FLP++ A +AIKY
Sbjct  140  IIAVCADDPEFRHYTDIKELPPHRLAEIRRFFEDYKKNENKSVAVEDFLPAEAAVDAIKY  199

Query  778  SMDLYAEYIMQTLRK  822
            SMDLYA YI+++LRK
Sbjct  200  SMDLYASYIVESLRK  214



>gb|EEC72268.1| hypothetical protein OsI_05422 [Oryza sativa Indica Group]
Length=217

 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            + + P LNERILSSMS+RSVAAHPWHDLEIG EAP  FN VIEI +GSKVKYELDKKTGL
Sbjct  17   EGKAPALNERILSSMSKRSVAAHPWHDLEIGPEAPTIFNCVIEIPRGSKVKYELDKKTGL  76

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            +KVDR+LYSSVVYPHNYGFIPRTLC+D+DP+DVLV+MQEPV+PGCFLRA+AIG+MPMIDQ
Sbjct  77   VKVDRVLYSSVVYPHNYGFIPRTLCDDSDPLDVLVIMQEPVIPGCFLRAKAIGVMPMIDQ  136

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GE DDKIIAVCADDPEY+HY DI  LPPHRLAEIRRFFEDYKKNENKEVAVN+F+P+ +A
Sbjct  137  GEADDKIIAVCADDPEYKHYNDIKDLPPHRLAEIRRFFEDYKKNENKEVAVNDFMPATSA  196

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
            +E I++SMDLYA YI++ LR+
Sbjct  197  YETIRHSMDLYATYILEGLRR  217



>dbj|BAH01087.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56102.1| hypothetical protein OsJ_04954 [Oryza sativa Japonica Group]
Length=217

 Score =   355 bits (911),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  220  QKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGL  399
            + + P LNERILSSMS+RSVAAHPWHDLEIG EAP  FN VIEI +GSKVKYELDKKTGL
Sbjct  17   EGKAPALNERILSSMSKRSVAAHPWHDLEIGPEAPTIFNCVIEIPRGSKVKYELDKKTGL  76

Query  400  IKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQ  579
            +KVDR+LYSSVVYPHNYGFIPRTLC+D+DP+DVLV+MQEPV+PGCFLRA+AIG+MPMIDQ
Sbjct  77   VKVDRVLYSSVVYPHNYGFIPRTLCDDSDPLDVLVIMQEPVIPGCFLRAKAIGVMPMIDQ  136

Query  580  GEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTA  759
            GE DDKIIAVCADDPEY+HY DI  LPPHRLAEIRRFFEDYKKNENKEVAVN+F+P+ +A
Sbjct  137  GEADDKIIAVCADDPEYKHYNDIKDLPPHRLAEIRRFFEDYKKNENKEVAVNDFMPATSA  196

Query  760  FEAIKYSMDLYAEYIMQTLRK  822
            +E I++SMDLYA YI++ LR+
Sbjct  197  YETIRHSMDLYATYILEGLRR  217



>ref|XP_006576178.1| PREDICTED: uncharacterized protein LOC100500040 isoform X1 [Glycine 
max]
 ref|XP_006576179.1| PREDICTED: uncharacterized protein LOC100500040 isoform X2 [Glycine 
max]
 gb|KHN09433.1| Soluble inorganic pyrophosphatase [Glycine soja]
Length=231

 Score =   355 bits (912),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  232  PRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVD  411
            P LNERI+SSM+RRSVAAHPWHDLEIG  AP  FN VIEI KGSKVKYELDKK+GLIK+D
Sbjct  35   PPLNERIISSMTRRSVAAHPWHDLEIGPGAPTIFNCVIEIGKGSKVKYELDKKSGLIKID  94

Query  412  RILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKD  591
            R+LYSSVVYPHNYGFIPRT+CED+DP+DVL++MQEPVLPGCFLRA+AIGLMPMIDQGEKD
Sbjct  95   RVLYSSVVYPHNYGFIPRTICEDSDPLDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKD  154

Query  592  DKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAI  771
            DKIIAVCADDPEYRHY DI +LPPHRLAEIRRFFEDYKKNENKEVAVN+FLP+  AFEA+
Sbjct  155  DKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASAAFEAV  214

Query  772  KYSMDLYAEYIMQTLRK  822
              SM LYA+YI+++LR+
Sbjct  215  NRSMSLYADYIVESLRR  231



>tpg|DAA36752.1| TPA: hypothetical protein ZEAMMB73_638704 [Zea mays]
Length=201

 Score =   354 bits (909),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 184/201 (92%), Gaps = 2/201 (1%)
 Frame = +1

Query  187  MSQSNEVAAFPQ--KRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKG  360
            MS+ ++ AA  +  KR P+LNERILSS+SRRSVAAHPWHDLEIG +AP  FNVV+EITKG
Sbjct  1    MSEEDKTAASAEQPKRAPKLNERILSSLSRRSVAAHPWHDLEIGPDAPAVFNVVVEITKG  60

Query  361  SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFL  540
            SKVKYELDKKTGLIKVDR+LYSSVVYPHNYGF+PRTLCEDNDPMDVLVLMQEPV+PG FL
Sbjct  61   SKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFVPRTLCEDNDPMDVLVLMQEPVVPGSFL  120

Query  541  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENK  720
            RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHY DIS+L PHRL EI+RFFEDYKKNENK
Sbjct  121  RARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNENK  180

Query  721  EVAVNEFLPSDTAFEAIKYSM  783
            EVAV+ FLP+ TA EAI+YSM
Sbjct  181  EVAVDAFLPATTAREAIQYSM  201



>ref|XP_007046883.1| Soluble inorganic pyrophosphatase isoform 1 [Theobroma cacao]
 ref|XP_007046884.1| Soluble inorganic pyrophosphatase isoform 1 [Theobroma cacao]
 gb|EOX91040.1| Soluble inorganic pyrophosphatase isoform 1 [Theobroma cacao]
 gb|EOX91041.1| Soluble inorganic pyrophosphatase isoform 1 [Theobroma cacao]
Length=215

 Score =   355 bits (911),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 189/217 (87%), Gaps = 3/217 (1%)
 Frame = +1

Query  172  SNQ*NMSQSNEVAAFPQKRTPRLNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEI  351
            +N    + S + A FP+     LNERILSSM+RRSVAAHPWHDLEIG  AP  FN V+EI
Sbjct  2    TNNGGEATSGKNAGFPRVA---LNERILSSMTRRSVAAHPWHDLEIGPGAPAVFNCVVEI  58

Query  352  TKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPG  531
             KGSKVKYELDK +GLIKVDR+LYSSVVYPHNYGFIPRT+CED+DPMDVL+LMQEPVLPG
Sbjct  59   GKGSKVKYELDKASGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLILMQEPVLPG  118

Query  532  CFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKN  711
             FLRARAIGLMPMIDQGEKDDKIIAVCADDPE+RHYTDI  LPPHRLAEIRRFFE+YKKN
Sbjct  119  SFLRARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYTDIKHLPPHRLAEIRRFFEEYKKN  178

Query  712  ENKEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            ENK V V +FLP+++A +AIKYSMDLYA YI+++LRK
Sbjct  179  ENKHVDVEDFLPAESAIQAIKYSMDLYASYIVESLRK  215



>ref|XP_010029772.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Eucalyptus 
grandis]
 ref|XP_010029773.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Eucalyptus 
grandis]
 ref|XP_010029774.1| PREDICTED: soluble inorganic pyrophosphatase isoform X2 [Eucalyptus 
grandis]
 gb|KCW56732.1| hypothetical protein EUGRSUZ_I02418 [Eucalyptus grandis]
Length=214

 Score =   355 bits (910),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +1

Query  238  LNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITKGSKVKYELDKKTGLIKVDRI  417
            LNERIL+SM+RRSVAAHPWHDLEIG  AP  FN V+EI+KGSKVKYELDK TGLIKVDR+
Sbjct  20   LNERILTSMTRRSVAAHPWHDLEIGPGAPAVFNCVVEISKGSKVKYELDKTTGLIKVDRV  79

Query  418  LYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDK  597
            LYSSVVYPHNYGFIPRT+CED+DPMDVLVLMQEP+LPG FLRARAIGLMPMIDQGEKDDK
Sbjct  80   LYSSVVYPHNYGFIPRTICEDSDPMDVLVLMQEPILPGSFLRARAIGLMPMIDQGEKDDK  139

Query  598  IIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNENKEVAVNEFLPSDTAFEAIKY  777
            IIAVCADDPE+RHYTDI QLPPHRLAEIRRFFEDYKKNENK V V +FLP+++A +AIKY
Sbjct  140  IIAVCADDPEFRHYTDIKQLPPHRLAEIRRFFEDYKKNENKVVNVEDFLPAESAIDAIKY  199

Query  778  SMDLYAEYIMQTLRK  822
            SMDLYA YI+++LR+
Sbjct  200  SMDLYASYIVESLRQ  214



>gb|EYU41686.1| hypothetical protein MIMGU_mgv1a013331mg [Erythranthe guttata]
Length=215

 Score =   355 bits (910),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 190/215 (88%), Gaps = 3/215 (1%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPR---LNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITK  357
            M+  NE    P    P    LNERILSS++R++VAAHPWHDLEIG  AP  FN V+EI+K
Sbjct  1    MAPPNETNRSPDAPKPARLPLNERILSSLTRKAVAAHPWHDLEIGPGAPIIFNCVVEISK  60

Query  358  GSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCF  537
            GSKVKYELDKKTGLIKVDR+LYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCF
Sbjct  61   GSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFVPRTLCEDNDPLDVLVIMQEPVLPGCF  120

Query  538  LRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNEN  717
            LRA+AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDI +LPPHRLAEIRRFFEDYKKNEN
Sbjct  121  LRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDIKELPPHRLAEIRRFFEDYKKNEN  180

Query  718  KEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            K+VAV+EFLP+  A+EA++ SM+LYA+Y ++ LR+
Sbjct  181  KDVAVDEFLPATKAYEAVQSSMNLYADYTVENLRR  215



>gb|EYU41687.1| hypothetical protein MIMGU_mgv1a013331mg [Erythranthe guttata]
Length=223

 Score =   355 bits (910),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 190/215 (88%), Gaps = 3/215 (1%)
 Frame = +1

Query  187  MSQSNEVAAFPQKRTPR---LNERILSSMSRRSVAAHPWHDLEIGAEAPKTFNVVIEITK  357
            M+  NE    P    P    LNERILSS++R++VAAHPWHDLEIG  AP  FN V+EI+K
Sbjct  9    MAPPNETNRSPDAPKPARLPLNERILSSLTRKAVAAHPWHDLEIGPGAPIIFNCVVEISK  68

Query  358  GSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVLMQEPVLPGCF  537
            GSKVKYELDKKTGLIKVDR+LYSSVVYPHNYGF+PRTLCEDNDP+DVLV+MQEPVLPGCF
Sbjct  69   GSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFVPRTLCEDNDPLDVLVIMQEPVLPGCF  128

Query  538  LRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDISQLPPHRLAEIRRFFEDYKKNEN  717
            LRA+AIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDI +LPPHRLAEIRRFFEDYKKNEN
Sbjct  129  LRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDIKELPPHRLAEIRRFFEDYKKNEN  188

Query  718  KEVAVNEFLPSDTAFEAIKYSMDLYAEYIMQTLRK  822
            K+VAV+EFLP+  A+EA++ SM+LYA+Y ++ LR+
Sbjct  189  KDVAVDEFLPATKAYEAVQSSMNLYADYTVENLRR  223



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2448657046752