BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c41927_g1_i1 len=1074 path=[1052:0-1073]

Length=1074
                                                                      Score     E

emb|CAB55501.1|  tyramine hydroxycinnamoyltransferase                   307   7e-100   Nicotiana tabacum [American tobacco]
ref|XP_009795400.1|  PREDICTED: tyramine N-feruloyltransferase 4/11     305   2e-99    
ref|XP_009620692.1|  PREDICTED: tyramine N-feruloyltransferase 10/30    304   7e-99    
ref|XP_004244517.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    298   1e-96    
ref|XP_006365084.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    298   2e-96    
ref|XP_004245284.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    298   2e-96    
ref|XP_006357082.1|  PREDICTED: tyramine N-feruloyltransferase 10...    297   4e-96    
ref|NP_001234877.1|  N-hydroxycinnamoyl-CoA:tyramine N-hydroxycin...    293   2e-94    
ref|XP_006365083.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    291   1e-93    
ref|XP_006365081.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    291   2e-93    
ref|NP_001234022.1|  N-hydroxycinnamoyl-CoA:tyramine N-hydroxycin...    290   2e-93    
gb|AHJ78616.1|  tyramine hydroxycinnamoyl transferase                   291   2e-93    
ref|XP_004245283.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    290   5e-93    
ref|XP_004245286.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    290   5e-93    
ref|XP_006365085.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    289   2e-92    
ref|XP_006365086.1|  PREDICTED: tyramine N-feruloyltransferase 10...    288   3e-92    
ref|XP_009624134.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    287   3e-92    
ref|XP_006365075.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    288   3e-92    
ref|NP_001234154.1|  N-hydroxycinnamoyl-CoA:tyramine N-hydroxycin...    287   4e-92    
dbj|BAC23029.1|  tyramine hydroxycinnamoyl transferase                  287   5e-92    Solanum tuberosum [potatoes]
gb|AAX15704.1|  tyramine n-hydroxycinnamoyl transferase                 286   9e-92    Capsicum annuum
gb|AHJ78615.1|  tyramine hydroxycinnamoyl transferase                   284   8e-91    
ref|XP_009763598.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    284   9e-91    
ref|XP_004245285.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    277   3e-88    
ref|XP_006365082.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    271   7e-86    
gb|AAK15312.1|AF329463_1  hydroxycinnamoyl-CoA: serotonin N-(hydr...    256   9e-80    Capsicum annuum
ref|XP_009796793.1|  PREDICTED: probable acetyltransferase NATA1-...    202   3e-59    
ref|XP_004249522.1|  PREDICTED: probable acetyltransferase NATA1-...    190   2e-54    
ref|XP_009595747.1|  PREDICTED: probable acetyltransferase NATA1-...    189   6e-54    
ref|XP_004253515.1|  PREDICTED: probable acetyltransferase NATA1-...    187   4e-53    
gb|EYU39619.1|  hypothetical protein MIMGU_mgv1a012952mg                181   7e-51    
ref|XP_009782835.1|  PREDICTED: probable acetyltransferase NATA1-...    180   2e-50    
ref|XP_011077267.1|  PREDICTED: probable acetyltransferase NATA1-...    179   3e-50    
ref|XP_002272073.1|  PREDICTED: probable acetyltransferase NATA1-...    173   6e-48    Vitis vinifera
ref|XP_007009878.1|  Acyl-CoA N-acyltransferases (NAT) superfamil...    172   1e-47    
ref|XP_004307374.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    172   2e-47    
ref|XP_009612298.1|  PREDICTED: L-ornithine N5-acetyltransferase ...    172   2e-47    
ref|XP_009382139.1|  PREDICTED: probable acetyltransferase NATA1-...    170   4e-47    
emb|CDY14413.1|  BnaC03g21820D                                          171   4e-47    
ref|XP_002273620.1|  PREDICTED: probable acetyltransferase NATA1-...    170   9e-47    Vitis vinifera
ref|XP_009599514.1|  PREDICTED: probable acetyltransferase NATA1-...    169   1e-46    
ref|XP_010262883.1|  PREDICTED: probable acetyltransferase NATA1-...    169   2e-46    
ref|XP_011077268.1|  PREDICTED: probable acetyltransferase NATA1-...    169   3e-46    
gb|KDP44395.1|  hypothetical protein JCGZ_20075                         168   3e-46    
ref|XP_007145441.1|  hypothetical protein PHAVU_007G239400g             168   3e-46    
ref|XP_009790558.1|  PREDICTED: L-ornithine N5-acetyltransferase ...    168   5e-46    
ref|XP_004245422.2|  PREDICTED: L-ornithine N5-acetyltransferase ...    167   1e-45    
ref|XP_006356652.1|  PREDICTED: L-ornithine N5-acetyltransferase ...    167   2e-45    
ref|XP_002531687.1|  Tyramine N-feruloyltransferase 4/11, putative      166   2e-45    Ricinus communis
ref|XP_010314778.1|  PREDICTED: probable acetyltransferase NATA1-...    166   2e-45    
ref|XP_007145448.1|  hypothetical protein PHAVU_007G240100g             166   3e-45    
ref|XP_010555817.1|  PREDICTED: probable acetyltransferase NATA1-...    165   3e-45    
ref|XP_009616163.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    166   6e-45    
gb|ABK94515.1|  unknown                                                 164   2e-44    Populus trichocarpa [western balsam poplar]
ref|XP_009133328.1|  PREDICTED: probable acetyltransferase NATA1-...    163   3e-44    
ref|XP_002879780.1|  hypothetical protein ARALYDRAFT_482921             163   5e-44    
emb|CDY07680.1|  BnaA03g18310D                                          163   5e-44    
ref|XP_010509079.1|  PREDICTED: probable acetyltransferase NATA1-...    162   5e-44    
ref|XP_007218286.1|  hypothetical protein PRUPE_ppa010697mg             162   7e-44    
ref|XP_007145442.1|  hypothetical protein PHAVU_007G239500g             163   7e-44    
ref|XP_002312008.2|  GCN5-related N-acetyltransferase family protein    162   8e-44    Populus trichocarpa [western balsam poplar]
gb|ABF94015.1|  GCN5-related N-acetyltransferase, putative, expre...    162   1e-43    Oryza sativa Japonica Group [Japonica rice]
gb|ABK22254.1|  unknown                                                 161   1e-43    Picea sitchensis
ref|XP_008366562.1|  PREDICTED: probable acetyltransferase NATA1-...    161   2e-43    
ref|XP_010558196.1|  PREDICTED: probable acetyltransferase NATA1-...    161   2e-43    
ref|XP_008233301.1|  PREDICTED: probable acetyltransferase NATA1-...    161   3e-43    
ref|XP_011041030.1|  PREDICTED: probable acetyltransferase NATA1-...    160   3e-43    
ref|XP_006294913.1|  hypothetical protein CARUB_v10023984mg             160   4e-43    
ref|XP_009368892.1|  PREDICTED: probable acetyltransferase NATA1-...    160   4e-43    
ref|XP_010517238.1|  PREDICTED: probable acetyltransferase NATA1-...    160   4e-43    
gb|KFK36805.1|  hypothetical protein AALP_AA4G173600                    160   4e-43    
ref|NP_181435.1|  probable acetyltransferase NATA1-like                 160   4e-43    Arabidopsis thaliana [mouse-ear cress]
gb|ABK93391.1|  unknown                                                 160   5e-43    Populus trichocarpa [western balsam poplar]
ref|XP_003535882.1|  PREDICTED: probable acetyltransferase NATA1-...    159   8e-43    
ref|XP_004142435.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    159   8e-43    
ref|XP_002315313.2|  GCN5-related N-acetyltransferase family protein    159   1e-42    Populus trichocarpa [western balsam poplar]
ref|XP_008446870.1|  PREDICTED: probable acetyltransferase NATA1-...    158   3e-42    
ref|XP_004985675.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    157   5e-42    
gb|ACJ83848.1|  unknown                                                 157   9e-42    Medicago truncatula
emb|CDO99758.1|  unnamed protein product                                156   2e-41    
ref|XP_006827452.1|  hypothetical protein AMTR_s00009p00114360          155   3e-41    
ref|XP_010670040.1|  PREDICTED: probable acetyltransferase NATA1-...    154   9e-41    
ref|XP_008446871.1|  PREDICTED: probable acetyltransferase NATA1-...    154   1e-40    
ref|XP_004514602.1|  PREDICTED: diamine acetyltransferase 1-like        154   1e-40    
gb|KDO46232.1|  hypothetical protein CISIN_1g026503mg                   154   1e-40    
ref|XP_006285254.1|  hypothetical protein CARUB_v10006619mg             153   1e-40    
ref|XP_010934574.1|  PREDICTED: probable acetyltransferase NATA1-...    154   1e-40    
ref|XP_010505566.1|  PREDICTED: probable acetyltransferase NATA1-...    154   1e-40    
ref|XP_006436451.1|  hypothetical protein CICLE_v10032618mg             154   2e-40    
ref|XP_002311082.1|  hypothetical protein POPTR_0008s03740g             153   2e-40    Populus trichocarpa [western balsam poplar]
ref|XP_008446872.1|  PREDICTED: probable acetyltransferase NATA1-...    153   2e-40    
ref|XP_011084320.1|  PREDICTED: probable acetyltransferase NATA1-...    153   3e-40    
ref|XP_006294945.1|  hypothetical protein CARUB_v10023999mg             152   3e-40    
ref|XP_004142434.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    152   4e-40    
ref|XP_008784795.1|  PREDICTED: probable acetyltransferase NATA1-...    152   5e-40    
ref|XP_011016733.1|  PREDICTED: probable acetyltransferase NATA1-...    151   8e-40    
gb|KGN52261.1|  hypothetical protein Csa_5G622760                       152   1e-39    
ref|XP_006836668.1|  hypothetical protein AMTR_s00088p00059900          151   1e-39    
ref|NP_565898.1|  L-ornithine N5-acetyltransferase NATA1                150   2e-39    Arabidopsis thaliana [mouse-ear cress]
gb|EPS72761.1|  hypothetical protein M569_01998                         149   4e-39    
ref|XP_002879781.1|  hypothetical protein ARALYDRAFT_482922             148   1e-38    
ref|XP_003558797.1|  PREDICTED: probable acetyltransferase NATA1-...    147   2e-38    
gb|AFK46864.1|  unknown                                                 148   2e-38    
ref|XP_002530925.1|  Tyramine N-feruloyltransferase 4/11, putative      147   3e-38    Ricinus communis
ref|XP_006411125.1|  hypothetical protein EUTSA_v10017189mg             147   3e-38    
dbj|BAJ86466.1|  predicted protein                                      146   6e-38    
gb|AAK96852.1|  Unknown protein                                         145   1e-37    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010067321.1|  PREDICTED: probable acetyltransferase NATA1-...    146   1e-37    
ref|XP_008365057.1|  PREDICTED: LOW QUALITY PROTEIN: probable ace...    145   2e-37    
emb|CDO99757.1|  unnamed protein product                                142   3e-36    
ref|XP_008660524.1|  PREDICTED: probable acetyltransferase NATA1-...    141   4e-36    
ref|XP_006294942.1|  hypothetical protein CARUB_v10023995mg             141   4e-36    
ref|XP_006649412.1|  PREDICTED: probable acetyltransferase NATA1-...    140   8e-36    
emb|CBI31436.3|  unnamed protein product                                139   4e-35    
ref|XP_011031717.1|  PREDICTED: probable acetyltransferase NATA1-...    137   4e-35    
ref|XP_002465843.1|  hypothetical protein SORBIDRAFT_01g046860          138   6e-35    Sorghum bicolor [broomcorn]
ref|XP_010509078.1|  PREDICTED: L-ornithine N5-acetyltransferase ...    138   7e-35    
ref|XP_010918697.1|  PREDICTED: L-ornithine N5-acetyltransferase ...    138   1e-34    
ref|XP_004985674.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    137   2e-34    
ref|NP_001136452.1|  uncharacterized protein LOC100216560               135   8e-34    Zea mays [maize]
ref|XP_004164224.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    135   1e-33    
gb|EAZ25609.1|  hypothetical protein OsJ_09436                          133   3e-33    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010517239.1|  PREDICTED: L-ornithine N5-acetyltransferase ...    132   1e-32    
ref|XP_008446873.1|  PREDICTED: probable acetyltransferase NATA1-...    132   2e-32    
ref|XP_001777294.1|  predicted protein                                  130   4e-32    
ref|XP_004142493.1|  PREDICTED: tyramine N-feruloyltransferase 4/...    130   4e-32    
gb|ACG33599.1|  N-acetyltransferase                                     130   5e-32    Zea mays [maize]
ref|XP_010689389.1|  PREDICTED: L-ornithine N5-acetyltransferase ...    129   3e-31    
ref|XP_002981383.1|  hypothetical protein SELMODRAFT_233690             127   3e-31    
ref|XP_002969906.1|  hypothetical protein SELMODRAFT_231364             127   4e-31    
gb|KHN45195.1|  Tyramine N-feruloyltransferase 4/11                     127   4e-31    
ref|XP_011077269.1|  PREDICTED: probable acetyltransferase NATA1-...    126   1e-30    
gb|AGJ98237.1|  PIG03 N-acetyltransferase-like protein                  125   1e-30    
ref|XP_010693074.1|  PREDICTED: probable acetyltransferase NATA1-...    124   6e-30    
ref|XP_008775354.1|  PREDICTED: probable acetyltransferase NATA1-...    125   1e-29    
gb|AFK38887.1|  unknown                                                 122   3e-29    
ref|XP_006294941.1|  hypothetical protein CARUB_v10023995mg             121   6e-29    
ref|XP_002443698.1|  hypothetical protein SORBIDRAFT_07g000540          121   2e-28    Sorghum bicolor [broomcorn]
ref|XP_010693079.1|  PREDICTED: L-ornithine N5-acetyltransferase ...    120   5e-28    
ref|NP_001048985.1|  Os03g0151600                                       109   7e-25    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010693080.1|  PREDICTED: probable acetyltransferase NATA1-...    108   2e-24    
ref|XP_001778322.1|  predicted protein                                  100   1e-21    
ref|XP_002862906.1|  predicted protein                                99.4    1e-21    
ref|WP_031400004.1|  MULTISPECIES: GCN5 family acetyltransferase      98.6    4e-21    
ref|WP_035925447.1|  GCN5 family acetyltransferase                    98.2    5e-21    
ref|WP_025495639.1|  hypothetical protein                             95.5    5e-20    
ref|WP_014191977.1|  GCN5 family N-acetyltransferase                  95.5    5e-20    
ref|WP_008610194.1|  GCN5 family N-acetyltransferase                  95.1    6e-20    
ref|WP_006578915.1|  acetyltransferase N-acetyltransferase, sperm...  94.7    9e-20    
ref|WP_017423422.1|  GCN5 family N-acetyltransferase                  94.7    9e-20    
ref|WP_012735004.1|  GCN5 family N-acetyltransferase                  94.7    1e-19    
ref|WP_006753061.1|  GCN5 family N-acetyltransferase                  93.6    2e-19    
ref|WP_021159712.1|  Diamine acetyltransferase                        93.6    2e-19    
ref|WP_035501707.1|  GCN5 family acetyltransferase                    93.6    2e-19    
ref|WP_006157544.1|  GCN5 family N-acetyltransferase                  93.6    2e-19    
ref|WP_033350974.1|  GCN5 family acetyltransferase                    93.6    2e-19    
ref|WP_013697060.1|  GCN5 family N-acetyltransferase                  93.2    3e-19    
ref|WP_027788021.1|  GCN5 family acetyltransferase                    93.2    3e-19    
ref|WP_011351390.1|  GCN5 family N-acetyltransferase                  92.8    4e-19    
dbj|BAO87040.1|  acetyltransferase, GnaT family                       92.4    5e-19    
ref|WP_027783916.1|  GCN5 family acetyltransferase                    92.0    6e-19    
ref|WP_028212918.1|  GCN5 family acetyltransferase                    92.4    7e-19    
ref|WP_034206758.1|  GCN5 family acetyltransferase                    92.0    8e-19    
ref|WP_036052326.1|  GCN5 family acetyltransferase                    92.0    8e-19    
ref|WP_038712118.1|  GCN5 family acetyltransferase                    92.0    8e-19    
ref|WP_011656330.1|  GCN5 family N-acetyltransferase                  91.7    9e-19    
ref|WP_007741776.1|  MULTISPECIES: GCN5 family N-acetyltransferase    91.3    1e-18    
ref|WP_008342278.1|  MULTISPECIES: GCN5 family N-acetyltransferase    91.3    1e-18    
ref|WP_012363390.1|  GCN5 family N-acetyltransferase                  91.3    2e-18    
ref|WP_019508394.1|  hypothetical protein                             91.3    2e-18    
ref|WP_006757678.1|  GCN5 family N-acetyltransferase                  91.3    2e-18    
ref|WP_016345900.1|  GCN5-related N-acetyltransferase                 91.3    2e-18    
ref|WP_034183081.1|  GCN5 family acetyltransferase                    90.9    2e-18    
ref|WP_036031788.1|  GCN5 family acetyltransferase                    90.9    2e-18    
ref|WP_026162414.1|  acetyltransferase                                90.9    2e-18    
ref|WP_023475861.1|  Diamine acetyltransferase                        90.5    3e-18    
ref|WP_028215970.1|  GCN5 family acetyltransferase                    90.5    3e-18    
ref|WP_011544925.1|  GCN5 family N-acetyltransferase                  90.5    3e-18    
ref|WP_026795041.1|  MULTISPECIES: GNAT family acetyltransferase      90.5    3e-18    
ref|WP_008983230.1|  GCN5 family N-acetyltransferase                  90.5    3e-18    
ref|WP_027810607.1|  GCN5 family acetyltransferase                    90.1    4e-18    
ref|WP_034186484.1|  GCN5 family acetyltransferase                    90.1    4e-18    
gb|EAY62431.1|  Histone acetyltransferase HPA13                       90.5    5e-18    Burkholderia cenocepacia PC184
ref|WP_006401289.1|  GCN5 family N-acetyltransferase                  89.7    5e-18    
ref|WP_028206700.1|  GCN5 family acetyltransferase                    89.7    5e-18    
ref|WP_012213804.1|  GCN5 family N-acetyltransferase                  89.7    5e-18    
gb|KEI67893.1|  GCN5-related N-acetyltransferase                      89.7    6e-18    
ref|WP_010091812.1|  GCN5 family N-acetyltransferase                  89.4    6e-18    
ref|WP_028445713.1|  hypothetical protein                             89.4    8e-18    
ref|WP_035972783.1|  GCN5 family acetyltransferase                    89.4    8e-18    
ref|WP_025098976.1|  GCN5 family acetyltransferase                    89.4    8e-18    
ref|WP_035990152.1|  GCN5 family acetyltransferase                    89.0    1e-17    
gb|KER71290.1|  GCN5 family acetyltransferase                         89.0    1e-17    
ref|WP_011613738.1|  GNAT family acetyltransferase                    89.0    1e-17    
gb|AIO32497.1|  acetyltransferase domain protein                      88.6    1e-17    
ref|WP_039348442.1|  GCN5 family acetyltransferase                    88.6    1e-17    
gb|AIO75301.1|  acetyltransferase domain protein                      88.6    1e-17    
ref|WP_023175246.1|  GCN5-related N-acetyltransferase                 88.6    1e-17    
ref|WP_008960816.1|  N-acetyltransferase GCN5                         88.6    2e-17    
ref|WP_006764811.1|  GCN5 family N-acetyltransferase                  89.0    2e-17    
ref|WP_035547399.1|  GCN5 family acetyltransferase                    88.2    2e-17    
ref|WP_012029159.1|  N-acetyltransferase GCN5                         88.2    2e-17    
ref|WP_035949763.1|  GCN5 family acetyltransferase                    88.2    2e-17    
ref|WP_026788245.1|  MULTISPECIES: GNAT family acetyltransferase      87.8    2e-17    
ref|WP_011489409.1|  GCN5 family N-acetyltransferase                  88.2    2e-17    
ref|WP_013320181.1|  GNAT family acetyltransferase                    87.8    2e-17    
ref|WP_015227047.1|  N-acetyltransferase GCN5                         87.8    3e-17    
ref|WP_011517457.1|  GCN5 family N-acetyltransferase                  87.8    3e-17    
ref|WP_009029395.1|  N-acetyltransferase GCN5                         87.4    3e-17    
ref|WP_028367666.1|  GCN5 family acetyltransferase                    87.4    4e-17    
ref|WP_026229823.1|  GCN5 family acetyltransferase                    87.0    4e-17    
gb|KIG04486.1|  Diamine N-acetyltransferase                           87.4    4e-17    
gb|EGC98457.1|  GCN5-related N-acetyltransferase                      87.0    4e-17    
ref|WP_014897673.1|  GCN5 family N-acetyltransferase                  87.0    4e-17    
ref|WP_021195864.1|  GCN5 family N-acetyltransferase                  87.4    5e-17    
ref|WP_035867419.1|  GCN5 family acetyltransferase                    87.0    5e-17    
ref|WP_024569078.1|  MULTISPECIES: GCN5 family acetyltransferase      87.0    5e-17    
ref|WP_009241398.1|  MULTISPECIES: GCN5 family N-acetyltransferase    87.4    5e-17    
ref|WP_019448176.1|  GCN5 family N-acetyltransferase                  86.7    6e-17    
ref|WP_036213000.1|  GCN5 family acetyltransferase                    86.7    6e-17    
ref|WP_008949432.1|  GCN5 family N-acetyltransferase                  86.7    6e-17    
ref|WP_029212497.1|  GCN5 family acetyltransferase                    86.7    6e-17    
ref|WP_018421300.1|  GCN5 family N-acetyltransferase                  86.7    7e-17    
ref|WP_035150482.1|  GNAT family acetyltransferase                    86.7    7e-17    
ref|WP_027680645.1|  GCN5 family acetyltransferase                    87.0    7e-17    
ref|WP_039225236.1|  GCN5 family acetyltransferase                    86.7    7e-17    
ref|WP_029307178.1|  GCN5 family acetyltransferase                    86.3    8e-17    
ref|WP_012598416.1|  GNAT family acetyltransferase                    86.3    8e-17    
ref|WP_014428055.1|  GCN5 family N-acetyltransferase                  85.9    1e-16    
ref|WP_012593544.1|  MULTISPECIES: GNAT family acetyltransferase      85.9    1e-16    
ref|WP_011402140.1|  GCN5 family N-acetyltransferase                  85.9    1e-16    
ref|WP_015138713.1|  acetyltransferase                                85.9    1e-16    
ref|WP_006098026.1|  GNAT family acetyltransferase                    85.9    1e-16    
ref|WP_012762773.1|  GCN5 family N-acetyltransferase                  86.3    1e-16    
ref|WP_004631744.1|  acetyltransferase                                85.9    1e-16    
ref|WP_011883923.1|  GCN5 family N-acetyltransferase                  85.9    1e-16    
ref|WP_012436324.1|  MULTISPECIES: GCN5 family N-acetyltransferase    85.9    1e-16    
ref|WP_009889958.1|  GCN5 family N-acetyltransferase                  85.9    1e-16    
ref|WP_007180956.1|  GCN5 family N-acetyltransferase                  85.9    2e-16    
gb|AIO41211.1|  acetyltransferase domain protein                      85.5    2e-16    
ref|WP_039600089.1|  GCN5 family acetyltransferase                    85.9    2e-16    
ref|WP_027865519.1|  GCN5 family acetyltransferase                    85.5    2e-16    
ref|WP_006415185.1|  GCN5 family N-acetyltransferase                  85.5    2e-16    
ref|WP_005458921.1|  N-acetyltransferase GCN5                         85.5    2e-16    
ref|WP_009631895.1|  acetyltransferase                                85.1    2e-16    
ref|WP_029823581.1|  GCN5 family acetyltransferase                    85.1    3e-16    
ref|WP_009856394.1|  GCN5 family N-acetyltransferase                  84.7    4e-16    
ref|XP_007722606.1|  hypothetical protein A1O1_03513                  85.5    4e-16    
ref|WP_036251230.1|  GCN5 family acetyltransferase                    84.3    4e-16    
ref|WP_005266656.1|  N-acetyltransferase GCN5                         84.3    4e-16    
ref|WP_035059218.1|  hypothetical protein                             84.3    4e-16    
ref|WP_006528232.1|  acetyltransferase                                84.3    4e-16    
ref|WP_006496519.1|  GCN5 family N-acetyltransferase                  84.3    4e-16    
ref|WP_017651327.1|  GNAT family acetyltransferase                    84.3    4e-16    
ref|WP_029805082.1|  GCN5 family acetyltransferase                    84.3    4e-16    
ref|WP_031847714.1|  GCN5 family acetyltransferase                    84.3    4e-16    
ref|WP_017333153.1|  GCN5 family N-acetyltransferase                  84.3    5e-16    
ref|WP_024974868.1|  GCN5 family acetyltransferase                    84.3    5e-16    
ref|WP_034194227.1|  GCN5 family acetyltransferase                    84.3    5e-16    
ref|WP_006486211.1|  GCN5 family N-acetyltransferase                  84.3    5e-16    
ref|WP_034200842.1|  GCN5 family acetyltransferase                    84.0    6e-16    
ref|WP_002788994.1|  GNAT family acetyltransferase                    84.0    6e-16    
ref|WP_026101301.1|  GNAT family acetyltransferase                    84.3    6e-16    
ref|WP_013626805.1|  GCN5 family N-acetyltransferase                  84.0    6e-16    
ref|WP_002759515.1|  GNAT family acetyltransferase                    84.0    6e-16    
ref|WP_023584919.1|  GCN5 family N-acetyltransferase                  84.0    6e-16    
ref|WP_002768916.1|  GNAT family acetyltransferase                    84.0    6e-16    
ref|WP_012433902.1|  GCN5 family N-acetyltransferase                  84.0    6e-16    
gb|EPM38749.1|  hypothetical protein M272_20270                       84.3    6e-16    
ref|WP_008641982.1|  GCN5-related N-acetyltransferase                 83.6    7e-16    
ref|WP_029937317.1|  GNAT family acetyltransferase                    84.0    7e-16    
ref|WP_018396977.1|  hypothetical protein                             84.0    7e-16    
ref|WP_024968707.1|  GNAT family acetyltransferase                    84.0    7e-16    
ref|WP_002791932.1|  GNAT family acetyltransferase                    83.6    7e-16    
ref|WP_031107727.1|  GCN5 family acetyltransferase                    84.0    8e-16    
ref|WP_028199220.1|  GCN5 family acetyltransferase                    83.6    8e-16    
ref|WP_015601120.1|  acetyltransferase domain protein                 83.6    8e-16    
ref|WP_014722708.1|  GCN5 family N-acetyltransferase                  83.6    8e-16    
ref|WP_035959616.1|  GCN5 family acetyltransferase                    83.6    8e-16    
ref|WP_012400222.1|  GCN5 family N-acetyltransferase                  83.6    8e-16    
ref|WP_024372979.1|  GNAT family acetyltransferase                    83.6    8e-16    
ref|WP_010116380.1|  GCN5 family N-acetyltransferase                  83.6    9e-16    
ref|WP_035490779.1|  diamine acetyltransferase                        83.6    9e-16    
ref|WP_027817321.1|  GCN5 family acetyltransferase                    83.6    9e-16    
ref|WP_008198452.1|  GNAT family acetyltransferase                    83.6    1e-15    
ref|WP_024506709.1|  GCN5 family acetyltransferase                    83.6    1e-15    
ref|WP_030101294.1|  GCN5 family acetyltransferase                    83.6    1e-15    
ref|WP_016516595.1|  putative acetyltransferase                       83.2    1e-15    
ref|WP_002778721.1|  GNAT family acetyltransferase                    83.2    1e-15    
ref|WP_031846363.1|  GCN5 family acetyltransferase                    83.2    1e-15    
ref|WP_025507961.1|  GCN5 family acetyltransferase                    83.2    1e-15    
ref|WP_017306356.1|  hypothetical protein                             83.2    1e-15    
ref|WP_029846448.1|  GCN5 family acetyltransferase                    83.2    1e-15    
ref|WP_006239452.1|  N-acetyltransferase GCN5                         82.8    1e-15    
ref|WP_020835219.1|  GCN5 family N-acetyltransferase                  82.8    1e-15    
ref|WP_002747253.1|  acetyltransferase family protein                 82.8    1e-15    
ref|WP_031565120.1|  diamine acetyltransferase                        83.2    1e-15    
ref|WP_031778700.1|  GCN5 family acetyltransferase                    82.8    1e-15    
ref|WP_025547575.1|  GCN5 family acetyltransferase                    82.8    1e-15    
ref|WP_025787670.1|  GCN5 family acetyltransferase                    82.8    1e-15    
ref|WP_002749863.1|  GNAT family acetyltransferase                    82.8    1e-15    
ref|WP_002738561.1|  putative N-acetyltransferase                     82.8    1e-15    
ref|WP_029861248.1|  GCN5 family acetyltransferase                    82.8    2e-15    
ref|WP_017447634.1|  GCN5 family N-acetyltransferase                  82.8    2e-15    
ref|WP_002797118.1|  GNAT family acetyltransferase                    82.8    2e-15    
ref|WP_029816603.1|  GCN5 family acetyltransferase                    82.8    2e-15    
ref|WP_014559821.1|  GCN5 family N-acetyltransferase                  82.8    2e-15    
ref|WP_005454093.1|  GCN5 family N-acetyltransferase                  82.8    2e-15    
ref|WP_029833991.1|  GCN5 family acetyltransferase                    82.8    2e-15    
ref|WP_031857060.1|  GCN5 family acetyltransferase                    82.8    2e-15    
ref|WP_029796826.1|  GCN5 family acetyltransferase                    82.8    2e-15    
ref|WP_029828325.1|  GCN5 family acetyltransferase                    82.8    2e-15    
ref|WP_015313153.1|  Histone acetyltransferase HPA2-related acety...  82.8    2e-15    
ref|WP_005466050.1|  N-acetyltransferase GCN5                         82.8    2e-15    
ref|WP_009764088.1|  N-acetyltransferase GCN5                         82.8    2e-15    
ref|WP_002781235.1|  Genome sequencing data, contig C289              82.8    2e-15    
ref|WP_031852129.1|  GCN5 family acetyltransferase                    82.4    2e-15    
ref|WP_031363463.1|  GCN5 family acetyltransferase                    82.4    2e-15    
gb|EQL92773.1|  acetyltransferase family protein                      82.4    2e-15    
ref|WP_027367585.1|  diamine acetyltransferase                        82.4    2e-15    
ref|WP_028671881.1|  hypothetical protein                             82.8    2e-15    
ref|WP_038738336.1|  GCN5 family acetyltransferase                    82.4    2e-15    
ref|WP_035120407.1|  GNAT family acetyltransferase                    82.8    2e-15    
ref|WP_024702904.1|  GCN5 family acetyltransferase                    82.4    2e-15    
ref|WP_012626534.1|  GNAT family acetyltransferase                    82.4    2e-15    
ref|WP_038731104.1|  GCN5 family acetyltransferase                    82.4    2e-15    
ref|XP_007758119.1|  acetyltransferase                                82.8    2e-15    
ref|WP_010998388.1|  GNAT family acetyltransferase                    82.4    2e-15    
ref|WP_029559380.1|  GCN5 family acetyltransferase                    82.4    3e-15    
ref|WP_039009034.1|  GCN5 family acetyltransferase                    82.4    3e-15    
ref|WP_006025785.1|  GCN5 family N-acetyltransferase                  82.4    3e-15    
ref|WP_033320144.1|  GCN5 family acetyltransferase                    82.4    3e-15    
ref|WP_005983815.1|  sortase-like acyltransferase                     82.0    3e-15    
ref|WP_025525641.1|  GCN5 family acetyltransferase                    82.0    3e-15    
ref|WP_009787422.1|  GNAT family acetyltransferase                    82.0    3e-15    
ref|WP_027672265.1|  diamine acetyltransferase                        82.0    3e-15    
ref|WP_018462479.1|  hypothetical protein                             81.6    4e-15    
ref|WP_030000601.1|  GCN5 family acetyltransferase                    81.6    4e-15    
ref|WP_030309118.1|  GCN5 family acetyltransferase                    81.6    4e-15    
ref|WP_026734797.1|  GNAT family acetyltransferase                    81.6    4e-15    
ref|WP_012163365.1|  GNAT family acetyltransferase                    81.6    4e-15    
ref|WP_021485221.1|  acetyltransferase family protein                 81.6    4e-15    
emb|CDM22914.1|  Histone acetyltransferase HPA2                       82.0    4e-15    
gb|KCV74203.1|  GCN5 family acetyltransferase                         81.6    4e-15    
ref|WP_025555911.1|  GCN5 family acetyltransferase                    81.6    4e-15    
ref|WP_008219117.1|  GCN5 family N-acetyltransferase                  81.6    5e-15    
ref|WP_038080588.1|  GNAT family acetyltransferase                    81.6    5e-15    
ref|WP_032412534.1|  GCN5 family acetyltransferase                    81.3    5e-15    
ref|WP_038750286.1|  GCN5 family acetyltransferase                    81.6    5e-15    
ref|WP_023342695.1|  acetyltransferase                                81.3    5e-15    
ref|WP_020842038.1|  GCN5 family N-acetyltransferase                  81.3    5e-15    
ref|WP_025504934.1|  GCN5 family acetyltransferase                    81.3    5e-15    
ref|WP_012045976.1|  N-acetyltransferase GCN5                         81.3    5e-15    
ref|WP_021821577.1|  acetyltransferase family protein                 81.3    5e-15    
ref|WP_035798096.1|  GCN5 family acetyltransferase                    81.3    6e-15    
ref|WP_031812539.1|  GCN5 family acetyltransferase                    81.3    6e-15    
ref|WP_012159661.1|  GNAT family acetyltransferase                    81.3    6e-15    
ref|WP_017747773.1|  GNAT family acetyltransferase                    81.3    6e-15    
ref|WP_011141734.1|  GCN5 family N-acetyltransferase                  81.6    6e-15    
ref|WP_024763441.1|  diamine acetyltransferase                        81.3    6e-15    
ref|WP_008541192.1|  GNAT family acetyltransferase                    81.3    7e-15    
ref|WP_006195303.1|  GNAT family acetyltransferase                    81.3    7e-15    
ref|WP_030235636.1|  GCN5 family acetyltransferase                    80.9    8e-15    
ref|WP_015187151.1|  Diamine N-acetyltransferase                      80.9    8e-15    
ref|WP_029700843.1|  MULTISPECIES: GNAT family acetyltransferase      80.5    9e-15    
ref|WP_005440670.1|  N-acetyltransferase GCN5                         80.9    9e-15    
ref|WP_012017878.1|  GCN5 family N-acetyltransferase                  80.9    9e-15    
ref|WP_015203198.1|  Diamine N-acetyltransferase                      80.9    9e-15    
ref|WP_012800752.1|  GCN5 family N-acetyltransferase                  80.5    1e-14    
ref|WP_023066689.1|  acetyltransferase family protein                 80.5    1e-14    
ref|WP_009454319.1|  MULTISPECIES: GNAT family acetyltransferase      80.5    1e-14    
ref|WP_007233073.1|  GCN5 family N-acetyltransferase                  80.5    1e-14    
ref|WP_006615031.1|  N-acetyltransferase GCN5                         80.5    1e-14    
ref|WP_009552074.1|  GCN5 family N-acetyltransferase                  80.5    1e-14    
ref|WP_015665162.1|  putative acetyltransferase family protein        80.1    1e-14    
ref|XP_006679841.1|  hypothetical protein BATDEDRAFT_20071            80.9    1e-14    
ref|WP_004200317.1|  N-acetyltransferase GCN5                         80.1    1e-14    
ref|WP_035809289.1|  GCN5 family acetyltransferase                    80.1    1e-14    
ref|WP_015083405.1|  N-acetyltransferase GCN5                         80.1    1e-14    
ref|WP_038794127.1|  GCN5 family acetyltransferase                    80.1    2e-14    
gb|AIA10612.1|  acetyltransferase (GNAT) family                       80.1    2e-14    
ref|WP_025583896.1|  GCN5 family acetyltransferase                    80.1    2e-14    
ref|WP_021009405.1|  N-acetyltransferase GCN5                         80.1    2e-14    
ref|WP_035238727.1|  hypothetical protein                             80.1    2e-14    
gb|KES22557.1|  diamine acetyltransferase                             80.1    2e-14    
ref|WP_023313365.1|  acetyltransferase                                80.1    2e-14    
emb|CEA08044.1|  Mycothiol acetyltransferase                          80.1    2e-14    
ref|WP_016861674.1|  GNAT family acetyltransferase                    80.1    2e-14    
ref|WP_028840252.1|  diamine acetyltransferase                        80.1    2e-14    
ref|WP_038736061.1|  GCN5 family acetyltransferase                    80.1    2e-14    
ref|WP_012353773.1|  GCN5 family N-acetyltransferase                  80.1    2e-14    
ref|WP_017899860.1|  GNAT family acetyltransferase                    79.7    2e-14    
dbj|GAL92956.1|  GCN5-related N-acetyltransferase                     80.1    2e-14    
ref|WP_002910717.1|  MULTISPECIES: GNAT family acetyltransferase      79.7    2e-14    
ref|WP_017714859.1|  hypothetical protein                             80.1    2e-14    
ref|WP_004145471.1|  GNAT family acetyltransferase                    79.7    2e-14    
ref|WP_004203250.1|  MULTISPECIES: GNAT family acetyltransferase      79.7    2e-14    
ref|WP_004189338.1|  GNAT family acetyltransferase                    79.7    2e-14    
ref|WP_028084628.1|  GNAT family acetyltransferase                    80.1    2e-14    
ref|WP_024430059.1|  MULTISPECIES: GCN5 family acetyltransferase      80.1    2e-14    
gb|AHM78890.1|  Diamine acetyltransferase                             80.1    2e-14    
ref|WP_034462767.1|  GCN5 family acetyltransferase                    79.7    2e-14    
ref|WP_032417296.1|  GCN5 family acetyltransferase                    79.7    2e-14    
ref|WP_032435057.1|  GCN5 family acetyltransferase                    79.7    2e-14    
ref|WP_004544085.1|  GCN5 family N-acetyltransferase                  80.1    2e-14    
ref|WP_012854006.1|  N-acetyltransferase GCN5                         79.7    2e-14    
ref|WP_025862016.1|  GCN5 family acetyltransferase                    79.7    2e-14    
ref|WP_019490739.1|  hypothetical protein                             80.1    2e-14    
ref|WP_029694926.1|  GNAT family acetyltransferase [                  79.7    2e-14    
ref|WP_008804344.1|  MULTISPECIES: GNAT family acetyltransferase      79.7    2e-14    
ref|WP_029799879.1|  GCN5 family acetyltransferase                    79.7    2e-14    
ref|WP_009944557.1|  acetyltransferase, GNAT family protein           79.7    2e-14    
ref|WP_020201746.1|  GCN5 family N-acetyltransferase                  79.7    2e-14    
ref|WP_039716986.1|  GNAT family acetyltransferase                    79.7    2e-14    
ref|WP_025509524.1|  GCN5 family acetyltransferase                    79.7    2e-14    
ref|WP_030016499.1|  hypothetical protein                             79.7    2e-14    
gb|KHL05247.1|  hypothetical protein LK10_01860                       79.7    2e-14    
gb|KHF17049.1|  GCN5 family acetyltransferase                         79.7    2e-14    
ref|WP_014377696.1|  N-acetyltransferase GCN5                         79.7    2e-14    
gb|EWE68385.1|  hypothetical protein L443_00612                       79.0    2e-14    
ref|WP_004199373.1|  MULTISPECIES: GCN5 family N-acetyltransferase    79.7    2e-14    
ref|WP_008186089.1|  GNAT family acetyltransferase                    79.7    2e-14    
ref|WP_029837180.1|  GCN5 family acetyltransferase                    79.7    2e-14    
ref|WP_036350927.1|  GCN5 family acetyltransferase                    79.3    2e-14    
ref|WP_037928360.1|  GCN5 family acetyltransferase                    79.7    2e-14    
ref|WP_015173805.1|  N-acetyltransferase GCN5                         79.3    2e-14    
ref|WP_012967800.1|  MULTISPECIES: GNAT family acetyltransferase      79.3    3e-14    
ref|WP_010815016.1|  acetyltransferase protein                        79.7    3e-14    
ref|WP_026413782.1|  GCN5 family acetyltransferase                    79.3    3e-14    
ref|WP_020651894.1|  hypothetical protein                             79.3    3e-14    
ref|WP_019718323.1|  GCN5 family N-acetyltransferase                  79.7    3e-14    
gb|AIA15751.1|  Acetyltransferase (GNAT) family                       79.3    3e-14    
ref|WP_025523953.1|  GCN5 family acetyltransferase                    79.3    3e-14    
gb|EKG14087.1|  hypothetical protein MPH_08830                        79.7    3e-14    
ref|WP_027537647.1|  GCN5 family acetyltransferase                    79.3    3e-14    
ref|WP_026531787.1|  GCN5 family acetyltransferase                    79.3    3e-14    
ref|WP_027578143.1|  GCN5 family acetyltransferase                    79.3    3e-14    
ref|WP_010476026.1|  GNAT family acetyltransferase                    79.3    3e-14    
ref|WP_024365893.1|  GCN5 family acetyltransferase                    79.3    3e-14    
ref|WP_024701312.1|  GCN5 family acetyltransferase                    79.3    3e-14    
ref|WP_035116037.1|  GNAT family acetyltransferase                    79.3    3e-14    
ref|WP_016866540.1|  GNAT family acetyltransferase                    79.3    3e-14    
ref|WP_015198812.1|  Diamine N-acetyltransferase                      79.3    3e-14    
ref|WP_011615976.1|  GCN5 family N-acetyltransferase                  79.3    3e-14    
ref|WP_028853567.1|  GCN5 family acetyltransferase                    79.3    3e-14    
ref|WP_018007963.1|  GCN5 family N-acetyltransferase                  79.3    3e-14    
ref|WP_015478202.1|  N-acetyltransferase GCN5                         79.3    3e-14    
ref|WP_011002480.1|  GCN5 family N-acetyltransferase                  79.3    3e-14    
ref|WP_038777715.1|  GCN5 family acetyltransferase                    79.3    3e-14    
ref|WP_029040104.1|  GCN5 family acetyltransferase                    79.0    3e-14    
ref|WP_004532082.1|  GCN5 family N-acetyltransferase                  79.3    3e-14    
ref|WP_010482964.1|  GCN5 family N-acetyltransferase                  79.3    3e-14    
ref|WP_017522027.1|  hypothetical protein                             79.0    4e-14    
gb|KGW92145.1|  acetyltransferase domain protein                      79.3    4e-14    
ref|WP_007355166.1|  MULTISPECIES: GNAT family acetyltransferase      79.0    4e-14    
ref|WP_038723139.1|  GCN5 family acetyltransferase                    79.0    4e-14    
ref|WP_017973486.1|  hypothetical protein                             79.0    4e-14    
ref|WP_018625488.1|  GCN5 family N-acetyltransferase                  79.0    4e-14    
ref|WP_026087313.1|  GNAT family acetyltransferase                    79.0    4e-14    
ref|WP_009462620.1|  MULTISPECIES: N-acetyltransferase GCN5           79.3    4e-14    
ref|WP_015114701.1|  N-acetyltransferase GCN5                         79.0    4e-14    
ref|WP_022536495.1|  GCN5 family N-acetyltransferase                  79.0    4e-14    
ref|WP_002801343.1|  GNAT family acetyltransferase                    79.0    4e-14    
ref|WP_026103112.1|  GNAT family acetyltransferase                    79.0    4e-14    
ref|WP_004539805.1|  GCN5 family N-acetyltransferase                  79.0    4e-14    
ref|WP_014260906.1|  GCN5 family N-acetyltransferase                  79.0    4e-14    
ref|WP_004191276.1|  GCN5 family N-acetyltransferase                  79.0    4e-14    
ref|WP_024475596.1|  GCN5 family acetyltransferase                    79.0    5e-14    
ref|WP_005447377.1|  N-acetyltransferase GCN5                         79.0    5e-14    
ref|WP_009620500.1|  N-acetyltransferase GCN5                         79.0    5e-14    
ref|WP_004524608.1|  MULTISPECIES: GCN5 family N-acetyltransferase    79.0    5e-14    
ref|WP_010304791.1|  N-acetyltransferase GCN5                         78.6    5e-14    
ref|WP_018311545.1|  GCN5 family N-acetyltransferase                  79.0    5e-14    
ref|WP_028090708.1|  GNAT family acetyltransferase                    78.6    5e-14    
ref|WP_035273629.1|  GCN5 family acetyltransferase                    78.6    6e-14    
ref|WP_008899475.1|  GCN5 family N-acetyltransferase                  78.6    6e-14    
ref|WP_036170294.1|  GCN5 family acetyltransferase                    78.6    6e-14    
ref|WP_035817287.1|  GCN5 family acetyltransferase                    78.6    6e-14    
ref|WP_039277785.1|  GNAT family acetyltransferase                    78.6    6e-14    
ref|WP_027844249.1|  GNAT family acetyltransferase                    78.6    6e-14    
ref|XP_008873956.1|  hypothetical protein H310_09615                  78.6    6e-14    
ref|WP_003804278.1|  GCN5 family N-acetyltransferase                  78.6    7e-14    
ref|WP_017316252.1|  GNAT family acetyltransferase                    78.2    7e-14    
ref|WP_009949687.1|  N-acetyltransferase GCN5                         78.2    8e-14    
ref|WP_024838748.1|  GNAT family acetyltransferase                    78.2    8e-14    
ref|WP_024520341.1|  GCN5 family acetyltransferase                    78.2    8e-14    
ref|WP_025165498.1|  diamine acetyltransferase                        78.6    8e-14    
ref|WP_032676220.1|  GCN5 family acetyltransferase                    78.2    8e-14    
ref|WP_008233572.1|  Histone acetyltransferase HPA2 and related a...  78.2    8e-14    
gb|EFX02327.1|  gcn5-related n-acetyltransferase                      78.6    8e-14    
ref|WP_028161794.1|  GCN5 family acetyltransferase                    78.2    8e-14    
gb|KGI80070.1|  GCN5 family acetyltransferase                         78.2    8e-14    
ref|WP_022820056.1|  GNAT family acetyltransferase                    77.8    8e-14    
ref|WP_011318043.1|  GNAT family acetyltransferase                    78.2    8e-14    
ref|WP_033293843.1|  GCN5 family acetyltransferase                    78.2    8e-14    
ref|WP_012541306.1|  MULTISPECIES: GNAT family acetyltransferase      77.8    9e-14    
ref|WP_039200265.1|  GNAT family acetyltransferase                    77.8    9e-14    
ref|WP_017617312.1|  N-acetyltransferase GCN5                         77.8    9e-14    
ref|WP_025549603.1|  diamine acetyltransferase                        77.8    1e-13    
ref|WP_032456282.1|  GCN5 family acetyltransferase                    77.8    1e-13    



>emb|CAB55501.1| tyramine hydroxycinnamoyltransferase [Nicotiana tabacum]
Length=233

 Score =   307 bits (786),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 179/234 (76%), Gaps = 5/234 (2%)
 Frame = +3

Query  186  APPAVIDTGVTTEK-LRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDS  362
            A   +I    T  K L I++K+Y R+RLA E+D+SHIYKLFYQIHEYH+ THLYK +E S
Sbjct  1    ARATLITMATTNNKNLTITEKVYVRVRLANEADISHIYKLFYQIHEYHNYTHLYKATESS  60

Query  363  LCKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAF  542
            LC +LFK NPNP FY P++LL+EVS T F     DE  F+P++K FDL+A V D E++ F
Sbjct  61   LCDLLFKANPNPLFYGPSVLLLEVSPTPFENTKKDEK-FKPVLKTFDLRATVEDKEAEEF  119

Query  543  RSNVADHE---AYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAAN  713
            +S     E    +IAGYAFF+ NYSCFYDK GI+FESLYFR SYRKLGMG L+F TVA+ 
Sbjct  120  KSKSCGDEKEDVFIAGYAFFYANYSCFYDKAGIYFESLYFRESYRKLGMGSLLFGTVASI  179

Query  714  AADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            AA+ GF+SVEGIVAVWNKKSYDFYV+MGVEI DEFRYGKL GDALQ YA K+ +
Sbjct  180  AANNGFASVEGIVAVWNKKSYDFYVNMGVEIFDEFRYGKLVGDALQKYADKEKA  233



>ref|XP_009795400.1| PREDICTED: tyramine N-feruloyltransferase 4/11 [Nicotiana sylvestris]
 sp|Q9SMB8.1|THT11_TOBAC RecName: Full=Tyramine N-feruloyltransferase 4/11; AltName: Full=Hydroxycinnamoyl-CoA: 
tyramine N-hydroxycinnamoyltransferase 
[Nicotiana tabacum]
 emb|CAB55502.1| tyramine hydroxycinnamoyltransferase [Nicotiana tabacum]
Length=226

 Score =   305 bits (782),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 175/224 (78%), Gaps = 4/224 (2%)
 Frame = +3

Query  213  VTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENP  392
               + L I++K+Y R+RLA E+D+SHIYKLFYQIHEYH+ THLYK +E SLC +LFK NP
Sbjct  4    TNNKNLTITEKVYVRVRLANEADISHIYKLFYQIHEYHNYTHLYKATESSLCDLLFKANP  63

Query  393  NPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHE--  566
            NP FY P++LL+EVS T F     DE  F+P++K FDL+A V D E++ F+S     E  
Sbjct  64   NPLFYGPSVLLLEVSPTPFENTKKDEK-FKPVLKTFDLRATVEDKEAEEFKSKSCGDEKE  122

Query  567  -AYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVE  743
              +IAGYAFF+ NYSCFYDK GI+FESLYFR SYRKLGMG L+F TVA+ AA+ GF+SVE
Sbjct  123  DVFIAGYAFFYANYSCFYDKAGIYFESLYFRESYRKLGMGSLLFGTVASIAANNGFASVE  182

Query  744  GIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            GIVAVWNKKSYDFYV+MGVEI DEFRYGKL GDALQ YA K+ +
Sbjct  183  GIVAVWNKKSYDFYVNMGVEIFDEFRYGKLVGDALQKYADKEKA  226



>ref|XP_009620692.1| PREDICTED: tyramine N-feruloyltransferase 10/30 [Nicotiana tomentosiformis]
 sp|P80969.2|THT10_TOBAC RecName: Full=Tyramine N-feruloyltransferase 10/30; AltName: 
Full=Hydroxycinnamoyl-CoA: tyramine N-hydroxycinnamoyltransferase 
[Nicotiana tabacum]
 emb|CAB55503.1| tyramine hydroxycinnamoyltransferase [Nicotiana tabacum]
Length=226

 Score =   304 bits (779),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 174/222 (78%), Gaps = 4/222 (2%)
 Frame = +3

Query  213  VTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENP  392
               + L I++K+Y R+RLA E+D+SHIYKLFYQIHEYH+ THLYK +E SLC +LFK NP
Sbjct  4    TNNKNLTITEKVYVRVRLANEADISHIYKLFYQIHEYHNYTHLYKATESSLCDLLFKANP  63

Query  393  NPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHE--  566
            NP FY P++LL+EVS T F     DE  F+P++K FDL+A V D E++ F+S     E  
Sbjct  64   NPLFYGPSVLLLEVSPTPFENTKKDEK-FKPVLKTFDLRATVEDKEAEEFKSKSCGDEKE  122

Query  567  -AYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVE  743
              +IAGYAFF+ NYSCFYDK GI+FESLYFR SYRKLGMG L+F TVA+ AA+ GF+SVE
Sbjct  123  DVFIAGYAFFYANYSCFYDKAGIYFESLYFRESYRKLGMGGLLFGTVASIAANNGFASVE  182

Query  744  GIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
            GIVAVWNKKSYDFYV+MGVEI DEFRYGKL GDALQ YA K+
Sbjct  183  GIVAVWNKKSYDFYVNMGVEIFDEFRYGKLVGDALQKYADKE  224



>ref|XP_004244517.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Solanum 
lycopersicum]
Length=226

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 174/222 (78%), Gaps = 5/222 (2%)
 Frame = +3

Query  207  TGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLF-K  383
            + +    L I++K+Y R+RLA E+D+ HIYKLFYQIHEYH+ THLYK +E SLC +LF K
Sbjct  2    STIDNNPLTITEKVYVRVRLANENDIHHIYKLFYQIHEYHNYTHLYKATESSLCDLLFNK  61

Query  384  ENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVAD-  560
             NP+P FY P+ILL+EVS T F         F+P++KEFDL++ V D E+D F+SN  + 
Sbjct  62   TNPSPLFYGPSILLLEVSPTPFLDIDSKNEKFKPVLKEFDLRSNVVDKEADEFKSNSMND  121

Query  561  ---HEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGF  731
               ++ YIAGY+FF+ NYSCFYDK GI+FESLYFR SYRKLGMGRL+F TVA+ AA+ GF
Sbjct  122  NDKNDVYIAGYSFFYANYSCFYDKAGIYFESLYFRESYRKLGMGRLLFGTVASIAANNGF  181

Query  732  SSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            SSVEGIVAVWNKKSYDFYVDMGVEI +EFRYGK+ GDALQ Y
Sbjct  182  SSVEGIVAVWNKKSYDFYVDMGVEIFEEFRYGKMVGDALQKY  223



>ref|XP_006365084.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Solanum 
tuberosum]
Length=246

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 180/238 (76%), Gaps = 9/238 (4%)
 Frame = +3

Query  183  MAPP-----AVIDTGVTTEK--LRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHL  341
            MAP      A+I T  ++E   + I+ KIY R+RLA +SD+SHIY+LFYQIHEYH+ THL
Sbjct  1    MAPALQQSEAIITTNSSSENNNVTITGKIYTRVRLATKSDLSHIYQLFYQIHEYHNYTHL  60

Query  342  YKVSEDSLCKMLFKENPNPPFYSPTILLVEVSATEFPAP-TPDESGFEPIVKEFDLKAPV  518
            YK +E SL  +LFKENP P FY P++LL+EVS T F  P    + GF+P++  FDLK PV
Sbjct  61   YKATESSLANLLFKENPLPLFYGPSVLLLEVSPTPFNEPKNTTDKGFKPVLTTFDLKFPV  120

Query  519  ADDESDAFRSNVADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMF  695
             + + + FRS   D  +AYIAGYAFF+ NYSCFYDKPG +FESLYFR SYRKLGMG L+F
Sbjct  121  VEGQVEEFRSKYDDKSDAYIAGYAFFYANYSCFYDKPGFYFESLYFRESYRKLGMGSLLF  180

Query  696  STVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
             TVA+ AA+ GF SVEGIVAVWNKKSYDFY++MGVEI DEFRYGKL G+ LQ YA KK
Sbjct  181  GTVASIAANNGFVSVEGIVAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYADKK  238



>ref|XP_004245284.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Solanum 
lycopersicum]
Length=234

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 178/230 (77%), Gaps = 6/230 (3%)
 Frame = +3

Query  186  APPAVIDTGVTTEK--LRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSED  359
            AP   I T V++E   + I+ KIY R+RLA +SD+SHIYKLFYQIHEYH+ THLYK +E 
Sbjct  4    APSETITTDVSSENNNVTITGKIYTRVRLATKSDLSHIYKLFYQIHEYHNFTHLYKATES  63

Query  360  SLCKMLFKENPNPPFYSPTILLVEVSATEF--PAPTPDESGFEPIVKEFDLKAPVADDES  533
            SL  +LFKENP P FY P++LL+EVS T F  P  T DE GF+PI+  FDLK PV + E 
Sbjct  64   SLANLLFKENPLPLFYGPSVLLLEVSPTPFDEPKNTTDE-GFKPILTTFDLKFPVVEGEV  122

Query  534  DAFRSNVADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAA  710
            + FRS   D  +AYIAGYAFF+ NYSCF DKPG +FESLYFR SYRKLGMG+L+F TVA+
Sbjct  123  EEFRSKYDDKSDAYIAGYAFFYANYSCFNDKPGFYFESLYFRESYRKLGMGKLLFGTVAS  182

Query  711  NAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
             AA+ GF SVEGI+AVWNKKSYDFY++MGVE+ DEFRYGKL G+ LQ YA
Sbjct  183  IAANNGFVSVEGIIAVWNKKSYDFYINMGVEVFDEFRYGKLHGENLQKYA  232



>ref|XP_006357082.1| PREDICTED: tyramine N-feruloyltransferase 10/30-like [Solanum 
tuberosum]
Length=228

 Score =   297 bits (761),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 174/219 (79%), Gaps = 5/219 (2%)
 Frame = +3

Query  228  LRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLF-KENPNPPF  404
            L I++K+Y R+RLA E+D+ HIYKLFYQIHEYH+ THLYK +E SLC +LF K NP+P F
Sbjct  8    LTITEKVYVRVRLANENDIHHIYKLFYQIHEYHNYTHLYKATESSLCDLLFNKTNPSPLF  67

Query  405  YSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVAD----HEAY  572
            Y P+ILL+EVS T F         F+P++K+FDL+A V D E+D F+SN  +    ++ +
Sbjct  68   YGPSILLLEVSPTPFSDIDSKGEKFKPVLKKFDLRANVVDKEADEFKSNSINDDDKNDVF  127

Query  573  IAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIV  752
            IAGY+FF+ NYSCFYDK GI+FESLYFR SYRKLGMGRL+F TVA+ AA+ GFSSVEGIV
Sbjct  128  IAGYSFFYANYSCFYDKAGIYFESLYFRESYRKLGMGRLLFGTVASIAANNGFSSVEGIV  187

Query  753  AVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
            AVWNKKSYDFYVDMGVEI +EFRYGK+ GDALQ YA  K
Sbjct  188  AVWNKKSYDFYVDMGVEIFEEFRYGKMVGDALQKYADPK  226



>ref|NP_001234877.1| N-hydroxycinnamoyl-CoA:tyramine N-hydroxycinnamoyl transferase 
THT1-3 [Solanum lycopersicum]
 gb|AAL99189.1| N-hydroxycinnamoyl-CoA:tyramine N-hydroxycinnamoyl transferase 
THT1-3 [Solanum lycopersicum]
Length=231

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 178/232 (77%), Gaps = 9/232 (4%)
 Frame = +3

Query  183  MAPPAVIDTGVTTE---KLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVS  353
            MAP   ++  +T++    + I+ KIY R+RLA +SD+SHIY+LFYQIHEYH+ THLYK +
Sbjct  1    MAP--ALEQAITSDASSDVTITGKIYTRVRLATKSDLSHIYRLFYQIHEYHNYTHLYKAT  58

Query  354  EDSLCKMLFKENPNPPFYSPTILLVEVSATEF--PAPTPDESGFEPIVKEFDLKAPVADD  527
            E SL  +LFKENP P FY P++LL+EVS T F  P  T DE GF+P++  FDLK PV + 
Sbjct  59   ESSLANLLFKENPLPLFYGPSVLLLEVSPTPFDEPKNTTDE-GFKPVLTTFDLKFPVVEG  117

Query  528  ESDAFRSNVADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTV  704
            E + FRS   D  + YIAGYAFF+ NYSCFYDKPG +FESLYFR SYRKLGMG L+F TV
Sbjct  118  EVEEFRSKYDDKSDVYIAGYAFFYANYSCFYDKPGFYFESLYFRESYRKLGMGSLLFGTV  177

Query  705  AANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
            A+ AA+ GF SVEGIVAVWNKKSYDFYV+MGVEI DEFRYGKL G+ LQ YA
Sbjct  178  ASIAANNGFVSVEGIVAVWNKKSYDFYVNMGVEIFDEFRYGKLHGENLQKYA  229



>ref|XP_006365083.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Solanum 
tuberosum]
Length=251

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 173/235 (74%), Gaps = 7/235 (3%)
 Frame = +3

Query  186  APPAVIDTGVTTEK--LRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSED  359
             P   I T  ++E   + I+ KIY R+RLA +SD+SHIY+LFYQIHEYH+ THLYK +E 
Sbjct  9    TPSETITTDASSENNNVTITGKIYTRVRLATKSDLSHIYQLFYQIHEYHNYTHLYKATES  68

Query  360  SLCKMLFKENPNPPFYSPTILLVEVSATEFPAP-TPDESGFEPIVKEFDLKAPVADDESD  536
            SL  +LFKENP P FY P++LL+EVS T F  P      G +P++K FDLK PV + + +
Sbjct  69   SLANLLFKENPLPLFYGPSVLLLEVSPTPFNEPKNTTNEGLKPVLKTFDLKFPVVEGQVE  128

Query  537  AFRSNVAD----HEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTV  704
             FRS   D     + YIAGYAFF+ NYSCFYDKPG +FESLYFR SYRKLGMG L+F TV
Sbjct  129  EFRSKYDDGNDKSDVYIAGYAFFYANYSCFYDKPGFYFESLYFRESYRKLGMGSLLFGTV  188

Query  705  AANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
            A+ AA+ GF SVEGIVAVWNKKSYDFY++MGVEI DEFRYGKL G+ LQ YA  K
Sbjct  189  ASIAANNGFVSVEGIVAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYADNK  243



>ref|XP_006365081.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Solanum 
tuberosum]
Length=259

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 172/238 (72%), Gaps = 13/238 (5%)
 Frame = +3

Query  198  VIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKML  377
             ID    +  + I+ KIY R+RLA +SD+SHIY+LFYQIHEYH+ THLYK +E SL  +L
Sbjct  15   TIDASSESNNVTITGKIYTRVRLATKSDLSHIYQLFYQIHEYHNYTHLYKSTESSLANLL  74

Query  378  FKENPNPPFYSPTILLVEVSATEFPAP-TPDESGFEPIVKEFDLKAPVADDESDAFRSNV  554
            FKENP P FY P++LL+EVS T F  P      GF+P++  FDLK PV + + + FRS  
Sbjct  75   FKENPLPLFYGPSVLLLEVSPTPFNEPKNTTNEGFKPVLTTFDLKFPVVEGQVEEFRSKY  134

Query  555  ADH------------EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFS  698
             D             +AYIAGYAFF+ NYSCFYDKPG +FESLYFR SYRKLGMG+L+F 
Sbjct  135  DDKIEEFRSKYDDKSDAYIAGYAFFYANYSCFYDKPGFYFESLYFRESYRKLGMGKLLFG  194

Query  699  TVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKS  872
            TVA+ AA+ GF SVEGI+AVWNKKSYDFY++MGVEI DEFRYGKL G+ LQ YA  K 
Sbjct  195  TVASIAANNGFVSVEGIIAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYADNKG  252



>ref|NP_001234022.1| N-hydroxycinnamoyl-CoA:tyramine N-hydroxycinnamoyl transferase 
THT7-8 [Solanum lycopersicum]
 gb|AAL99191.1| N-hydroxycinnamoyl-CoA:tyramine N-hydroxycinnamoyl transferase 
THT7-8 [Solanum lycopersicum]
Length=239

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 170/230 (74%), Gaps = 3/230 (1%)
 Frame = +3

Query  183  MAPPAVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDS  362
            ++     D       + I+ KIY RLRLA +SD+SHIY+LFYQIH YH+ THLYK +E S
Sbjct  5    LSETITTDASSENNNVTITGKIYTRLRLATKSDLSHIYQLFYQIHAYHNNTHLYKATESS  64

Query  363  LCKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAF  542
            L  +LFKENP P FY P++LL+EVS T F  PT +  GF+P++  FDLK PV + + + F
Sbjct  65   LANLLFKENPLPLFYGPSVLLLEVSPTPFNEPTNE--GFKPVLTTFDLKFPVVEGQVEEF  122

Query  543  RSNVADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAA  719
            RS   D  + YIAGYAFF+ NYSCF DKPG +FESLYFR SYRKLGMG L+F TVA+ AA
Sbjct  123  RSKYDDKSDVYIAGYAFFYVNYSCFSDKPGFYFESLYFRESYRKLGMGSLLFGTVASIAA  182

Query  720  DKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
            + GF SVEGIVAVWNKKSYDFYV+MGVEI DEFRYGKL G+ LQ YA  K
Sbjct  183  NNGFVSVEGIVAVWNKKSYDFYVNMGVEIFDEFRYGKLHGENLQKYANDK  232



>gb|AHJ78616.1| tyramine hydroxycinnamoyl transferase [Solanum tuberosum]
Length=247

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 169/225 (75%), Gaps = 2/225 (1%)
 Frame = +3

Query  198  VIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKML  377
            + D       + I+ KIY R+RLA +SD+SHIY+LFYQIHEYH+ THLYK +E SL  +L
Sbjct  15   ITDASSENNNVTITGKIYTRVRLATKSDLSHIYQLFYQIHEYHNYTHLYKATESSLANLL  74

Query  378  FKENPNPPFYSPTILLVEVSATEFPAP-TPDESGFEPIVKEFDLKAPVADDESDAFRSNV  554
            FKENP P FY P++LL+EVS T F  P      GF+P++  FDLK PV + E + FRS  
Sbjct  75   FKENPLPLFYGPSVLLLEVSPTPFNEPKNTTNEGFKPVLTTFDLKFPVIEGEVEEFRSKY  134

Query  555  ADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGF  731
             D  +AYIAGYAFF+ NYSCF DKPG +FESLYFR SYRKLGMG+L+F TV++ AAD GF
Sbjct  135  DDKSDAYIAGYAFFYANYSCFNDKPGFYFESLYFRESYRKLGMGKLLFGTVSSIAADNGF  194

Query  732  SSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKK  866
             SV GIVAVWNKKSYDFY++MGVEI DEFRYGKL G+ LQ YA K
Sbjct  195  VSVNGIVAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYADK  239



>ref|XP_004245283.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Solanum 
lycopersicum]
Length=240

 Score =   290 bits (741),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 178/236 (75%), Gaps = 9/236 (4%)
 Frame = +3

Query  183  MAPPAVIDTGVTTE---KLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVS  353
            MAP   +   +T++    + I+ KIY R+RLA +SD+SHIYKLFYQIH YH+ THLYK +
Sbjct  1    MAP--ALQQSITSDASSDVTITGKIYTRVRLATKSDLSHIYKLFYQIHVYHNYTHLYKAT  58

Query  354  EDSLCKMLFKENPNPPFYSPTILLVEVSATEF--PAPTPDESGFEPIVKEFDLKAPVADD  527
            E SL  +LFKENP P FY P++LL+EVS T F  P  T DE GF+P++  FDLK PV + 
Sbjct  59   ESSLANLLFKENPLPLFYGPSVLLLEVSPTPFDEPKNTTDE-GFKPVLTTFDLKFPVVEG  117

Query  528  ESDAFRSNVADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTV  704
            E + FRS   D  +AYIAGYAFF+ NYSCF DKPG +FESLYFR SYRKLGMG+L+F TV
Sbjct  118  EVEEFRSKYDDKSDAYIAGYAFFYANYSCFNDKPGFYFESLYFRESYRKLGMGKLLFGTV  177

Query  705  AANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKS  872
            ++ AAD GF SV+GIVAVWNKKSYDFY++MGVEI DEFRYGKL G+ LQ YA  K 
Sbjct  178  SSIAADNGFVSVDGIVAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYAHNKG  233



>ref|XP_004245286.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Solanum 
lycopersicum]
Length=242

 Score =   290 bits (742),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 175/236 (74%), Gaps = 9/236 (4%)
 Frame = +3

Query  183  MAP------PAVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLY  344
            MAP      P+   T   +  + I+ KIY R+RLA +SD+SHIY+LFYQIHEYH+ THLY
Sbjct  1    MAPSLQQPIPSEAITSDASSDVTITGKIYTRVRLATKSDLSHIYRLFYQIHEYHNYTHLY  60

Query  345  KVSEDSLCKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVAD  524
            K +E SL  +LFKENP P FY P++LL+EVS T F     +E  F P++  FDLK PV +
Sbjct  61   KATESSLANLLFKENPLPLFYGPSVLLLEVSPTPFKEAKNEE--FNPVLTTFDLKFPVVE  118

Query  525  DESDAFRSNVADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFST  701
             + + FRS   D  +AYIAGYAFF+ NYSCFYDKPG +FESLYFR SYRKLGMG+L+F T
Sbjct  119  GQVEEFRSKYDDKSDAYIAGYAFFYANYSCFYDKPGFYFESLYFRESYRKLGMGKLLFGT  178

Query  702  VAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
            VA+ AA+ GF SVEGI+AVWNKKSYDFY++MGVEI DEFRYGKL G+ LQ YA  K
Sbjct  179  VASIAANNGFVSVEGIIAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYAHNK  234



>ref|XP_006365085.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Solanum 
tuberosum]
Length=250

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/233 (60%), Positives = 175/233 (75%), Gaps = 4/233 (2%)
 Frame = +3

Query  186  APPAVIDTGVTTEK--LRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSED  359
            +P  +I T  ++E   + I+ KIY R+RLA +SD+SHIY+LFYQIHEYH+ THLYK +E 
Sbjct  11   SPSEIITTDASSENNNVTITGKIYTRVRLATKSDLSHIYQLFYQIHEYHNYTHLYKATES  70

Query  360  SLCKMLFKENPNPPFYSPTILLVEVSATEFPAP-TPDESGFEPIVKEFDLKAPVADDESD  536
            SL  +LFKENP P FY P++LL+EVS T F  P      GF P++  FDLK PV + + +
Sbjct  71   SLEGLLFKENPLPLFYGPSVLLLEVSPTPFNEPKNTTNEGFNPVLTTFDLKFPVVEGQVE  130

Query  537  AFRSNVADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAAN  713
             FRS   D  +AYIAGYAFF+ NYSCF DKPG +FESLYFR SYRKLGMG+L+F TV++ 
Sbjct  131  EFRSKYDDKSDAYIAGYAFFYANYSCFNDKPGFYFESLYFRESYRKLGMGKLLFGTVSSI  190

Query  714  AADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKS  872
            AA+ GF SV+GI+AVWNKKSYDFY++MGVE+ DEFRYGKL G+ LQ YA  K 
Sbjct  191  AANNGFVSVDGIIAVWNKKSYDFYINMGVEVFDEFRYGKLHGENLQKYADNKG  243



>ref|XP_006365086.1| PREDICTED: tyramine N-feruloyltransferase 10/30-like [Solanum 
tuberosum]
Length=247

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 169/225 (75%), Gaps = 2/225 (1%)
 Frame = +3

Query  198  VIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKML  377
            + D       + I+ KI  R+RLA +SD+SHIY+LFYQIHEYH+ THLYK +E SL  +L
Sbjct  15   ITDASSENNNVTITGKINTRVRLATKSDLSHIYQLFYQIHEYHNYTHLYKATESSLANLL  74

Query  378  FKENPNPPFYSPTILLVEVSATEFPAP-TPDESGFEPIVKEFDLKAPVADDESDAFRSNV  554
            FKENP P FY P++LL+EVS T F  P      GF+P++  FDLK PV + E + FRS  
Sbjct  75   FKENPLPLFYGPSVLLLEVSPTPFNEPKNTTNEGFKPVLTTFDLKFPVIEGEVEEFRSKY  134

Query  555  ADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGF  731
             D  +AYIAGYAFF+ NYSCF DKPG +FESLYFR SYRKLGMG+L+F TV++ AAD GF
Sbjct  135  DDKSDAYIAGYAFFYANYSCFNDKPGFYFESLYFRESYRKLGMGKLLFGTVSSIAADNGF  194

Query  732  SSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKK  866
             SV+GIVAVWNKKSYDFY++MGVEI DEFRYGKL G+ LQ YA K
Sbjct  195  VSVDGIVAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYADK  239



>ref|XP_009624134.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Nicotiana 
tomentosiformis]
Length=239

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 175/232 (75%), Gaps = 5/232 (2%)
 Frame = +3

Query  195  AVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKM  374
            + I        + I++KIY R+RLA ++D++HIY+LFYQIH +H+ THLYK ++ SL  +
Sbjct  3    STISETTPENNVTITEKIYTRVRLATKADLNHIYQLFYQIHAHHNNTHLYKATDSSLEDL  62

Query  375  LFKENPNPPFYSPTILLVEVSATEFP-APTPDESGFEPIVKEFDLKAPVADDESDAFRSN  551
            LFKENP P +Y P++LL+EVS T F  +      GF+P++K FDLK PV + E+D FRS 
Sbjct  63   LFKENPLPLYYGPSVLLLEVSPTPFTESKHTTNQGFKPVLKTFDLKFPVVEGEADEFRSK  122

Query  552  VAD----HEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAA  719
              D    ++ +IAGYAFF+ NYSCFYDKPG +FESLYFR SYRKLGMGRL+F TVA  AA
Sbjct  123  YDDGNDKNDVFIAGYAFFYANYSCFYDKPGFYFESLYFRESYRKLGMGRLLFGTVACIAA  182

Query  720  DKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            + GF SVEGIVAVWNKKSYDFY++MGVEI DEFRYGKL GDALQ YA K+ +
Sbjct  183  NNGFVSVEGIVAVWNKKSYDFYIEMGVEIFDEFRYGKLHGDALQKYADKEKN  234



>ref|XP_006365075.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Solanum 
tuberosum]
Length=243

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 168/225 (75%), Gaps = 4/225 (2%)
 Frame = +3

Query  204  DTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFK  383
            D       + I+ KIY RLRLA +SD+SHIY+LFYQIH YH  THLYK +E SL  +LFK
Sbjct  13   DASSENNNVTITGKIYTRLRLATKSDLSHIYQLFYQIHAYHKNTHLYKATESSLANLLFK  72

Query  384  ENPNPPFYSPTILLVEVSATEF--PAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVA  557
            ENP P FY P++LL+EVS T F  P  T DE GF+P++  FDLK PV + + + F+S   
Sbjct  73   ENPLPLFYGPSVLLLEVSPTPFNEPKNTTDE-GFKPVLTTFDLKFPVVEGQVEEFQSKYD  131

Query  558  DH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFS  734
            D  + YIAGYAFF+ NYSCFYDKPG +FESLYFR  YRKLGMG L+F TVA+ AA+ GF 
Sbjct  132  DKSDVYIAGYAFFYANYSCFYDKPGFYFESLYFREIYRKLGMGSLLFGTVASIAANNGFV  191

Query  735  SVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
            SVEGIVAVWNKKSYDFY++MGVEI DEFRYGKL G+ LQ YA  K
Sbjct  192  SVEGIVAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYADNK  236



>ref|NP_001234154.1| N-hydroxycinnamoyl-CoA:tyramine N-hydroxycinnamoyl transferase 
THT7-1 [Solanum lycopersicum]
 gb|AAL99190.1| N-hydroxycinnamoyl-CoA:tyramine N-hydroxycinnamoyl transferase 
THT7-1 [Solanum lycopersicum]
Length=246

 Score =   287 bits (735),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 175/229 (76%), Gaps = 5/229 (2%)
 Frame = +3

Query  192  PAVIDTGVT--TEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSL  365
            P++ D+  T  +  + I+ KIY R+RLA +SD+SHIYKLFYQIHEYH+ THLYK +E SL
Sbjct  12   PSLSDSLTTDASSDVTITGKIYTRVRLATKSDLSHIYKLFYQIHEYHNFTHLYKATESSL  71

Query  366  CKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFR  545
              +LFKENP P FY P++LL+EVS T F  PT     F+P++  FDLK PV + + + FR
Sbjct  72   EGLLFKENPLPLFYGPSVLLLEVSPTPFNEPT--NQAFKPVLTTFDLKFPVVEGQVEEFR  129

Query  546  SNVADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAAD  722
            S   D  +AYIAGYAFF+ NYSCF DKPG +FESLYFR SYRKLGMG+L+F TV++ AA+
Sbjct  130  SKHDDKSDAYIAGYAFFYANYSCFNDKPGFYFESLYFRESYRKLGMGKLLFGTVSSIAAN  189

Query  723  KGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
             GF SV+GI+AVWNKKSYDFY++MGVEI DEFRYGKL G+ LQ YA  K
Sbjct  190  NGFVSVDGIIAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYAHNK  238



>dbj|BAC23029.1| tyramine hydroxycinnamoyl transferase [Solanum tuberosum]
Length=247

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 171/226 (76%), Gaps = 4/226 (2%)
 Frame = +3

Query  198  VIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKML  377
            + D       + I+ KIY R+RLA +SD+SHIY+LFYQIH YH+ THLYK +E SL  +L
Sbjct  15   ITDASSENNNVTITGKIYTRVRLATKSDLSHIYQLFYQIHVYHNFTHLYKATESSLEGLL  74

Query  378  FKENPNPPFYSPTILLVEVSATEF--PAPTPDESGFEPIVKEFDLKAPVADDESDAFRSN  551
            FKENP P FY P++LL+EVS T F  P  T DE GF P++  FDLK PV + + + FRS 
Sbjct  75   FKENPLPLFYGPSVLLLEVSPTPFNEPKNTTDE-GFNPVLTTFDLKFPVVEGQVEEFRSK  133

Query  552  VADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKG  728
              D  +AYIAGYAFF+ NYSCF DKPG +FESLYFR SYRKLGMG+L+F TV++ AAD G
Sbjct  134  YDDKSDAYIAGYAFFYANYSCFNDKPGFYFESLYFRESYRKLGMGKLLFGTVSSIAADNG  193

Query  729  FSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKK  866
            F SV+GIVAVWNKKSYDFY++MGVEI DEFRYGKL G+ LQ YA K
Sbjct  194  FVSVDGIVAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYADK  239



>gb|AAX15704.1| tyramine n-hydroxycinnamoyl transferase [Capsicum annuum]
Length=245

 Score =   286 bits (733),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 170/224 (76%), Gaps = 5/224 (2%)
 Frame = +3

Query  219  TEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNP  398
               L I+ KI+ R+RLA +SD+ HIY+LFYQIH YH+ THLYK +E SL  +LFKENP P
Sbjct  17   NNNLTITGKIHTRVRLATKSDLHHIYQLFYQIHAYHNFTHLYKATESSLGDLLFKENPLP  76

Query  399  PFYSPTILLVEVSATEFPAPTPD-ESGFEPIVKEFDLKAPVADDESDAFRSNVAD----H  563
             FY P++LL+EVS T F  P  + + GF+P++  F+LK PV + + + F+S   D     
Sbjct  77   LFYGPSVLLLEVSPTPFTQPKNNKDEGFKPVLTTFNLKFPVVEGQVEEFQSKYDDGNDKR  136

Query  564  EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVE  743
            + +IAGYAFF+ NYSCFYDKPG +FESLYFR SYRKLGMGRL+F TVA+ AA+ GF SVE
Sbjct  137  DVFIAGYAFFYANYSCFYDKPGFYFESLYFRESYRKLGMGRLLFGTVASIAANNGFVSVE  196

Query  744  GIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            GIVAVWNKKSYDFY+DMGVEI DEFRYGKL G+ LQ YA K+ +
Sbjct  197  GIVAVWNKKSYDFYIDMGVEIFDEFRYGKLHGENLQKYADKQKN  240



>gb|AHJ78615.1| tyramine hydroxycinnamoyl transferase [Solanum tuberosum]
 gb|AHJ78617.1| tyramine hydroxycinnamoyl transferase [Solanum tuberosum]
Length=247

 Score =   284 bits (727),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = +3

Query  198  VIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKML  377
            + D       + I+ KIY R+RLA +SD+SHIY+LFYQIH YH+ THLYK +E SL  +L
Sbjct  15   ITDASSENNNVTITGKIYTRVRLATKSDLSHIYQLFYQIHVYHNFTHLYKATESSLEGLL  74

Query  378  FKENPNPPFYSPTILLVEVSATEF-PAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNV  554
            FKENP P FY P++LL+EVS T F         GF+P++  FDLK PV + E + FRS  
Sbjct  75   FKENPLPLFYGPSVLLLEVSPTPFNETKNTTNEGFKPVLTMFDLKFPVIEGEVEEFRSKY  134

Query  555  ADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGF  731
             D  +AYIAGYAFF+ NYSCF DKPG +FESLYFR SYRKLGMG+L+F TV++ AAD GF
Sbjct  135  DDKSDAYIAGYAFFYANYSCFNDKPGFYFESLYFRESYRKLGMGKLLFGTVSSIAADNGF  194

Query  732  SSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKK  866
             SV+GIVAVWNKKSYDFY++MGVEI DEFRYGKL G+ LQ YA K
Sbjct  195  VSVDGIVAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYADK  239



>ref|XP_009763598.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Nicotiana 
sylvestris]
Length=243

 Score =   284 bits (726),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 172/221 (78%), Gaps = 5/221 (2%)
 Frame = +3

Query  228  LRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFY  407
            + I++ IY R+RLA+++D+ HIY+LFYQIH YH+ THLYK ++ SL  +LFKENP P +Y
Sbjct  18   VTITEMIYTRVRLARKADLYHIYQLFYQIHAYHNNTHLYKATQCSLENLLFKENPLPLYY  77

Query  408  SPTILLVEVSATEFP-APTPDESGFEPIVKEFDLKAPVADDESDAFRSNVAD----HEAY  572
             P++LL+EVS T F  +      GF+P++K FDLK PVA+ E+  FRS   D     + +
Sbjct  78   GPSVLLLEVSPTPFTESKHTTNEGFKPVLKTFDLKFPVAEGEAAEFRSKYDDGNDKRDVF  137

Query  573  IAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIV  752
            IAGYAFF+ NYSCFYDKPG +FESLYFR SYRKLGMG+L+F TVA+ AA+ GF SVEGIV
Sbjct  138  IAGYAFFYANYSCFYDKPGFYFESLYFRESYRKLGMGKLLFGTVASIAANNGFVSVEGIV  197

Query  753  AVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            AVWNKKSYDFY++MGVEI DEFRYGKL GDALQ YA K+ +
Sbjct  198  AVWNKKSYDFYIEMGVEIFDEFRYGKLHGDALQKYADKEKN  238



>ref|XP_004245285.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Solanum 
lycopersicum]
Length=237

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 169/227 (74%), Gaps = 3/227 (1%)
 Frame = +3

Query  192  PAVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCK  371
            P+   T   +  + I+ KIY R+RLA +S++SHIYKLFYQIHEYH+  HLY+ SE SL  
Sbjct  10   PSESITSDASSDVTITGKIYTRVRLATKSNLSHIYKLFYQIHEYHNYIHLYRASESSLAN  69

Query  372  MLFKENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSN  551
            +LFKENP P FY P++LL+EVS T F  PT +  GF+P++  FDLK PV + E + FRS 
Sbjct  70   LLFKENPLPLFYGPSVLLLEVSQTPFKEPTNE--GFKPVLTTFDLKFPVVEGEVEEFRSK  127

Query  552  VADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKG  728
              D  +AYIAGYAFF+ NYSCF DKPG++ ESLY R SYR LGMG+L+F TVA+ AA+ G
Sbjct  128  YDDKSDAYIAGYAFFYANYSCFNDKPGLYLESLYLRESYRNLGMGKLLFGTVASIAANNG  187

Query  729  FSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
            F SVE IVAVWNKK+YD Y++MG+EI DEFRYGKL G+ ++ YA K 
Sbjct  188  FVSVEEIVAVWNKKAYDLYINMGLEIFDEFRYGKLHGENIKMYADKN  234



>ref|XP_006365082.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Solanum 
tuberosum]
Length=243

 Score =   271 bits (694),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 168/236 (71%), Gaps = 4/236 (2%)
 Frame = +3

Query  180  VMAPPAVIDTGVTTEK--LRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVS  353
            ++ P   I T  ++E   + I+ KIY R+RLA  SD+SHIY+LFYQIH YH+ THLYK +
Sbjct  7    LLTPCETIITDASSENNNVTITRKIYTRVRLATMSDLSHIYQLFYQIHVYHNYTHLYKAT  66

Query  354  EDSLCKMLFKENPNPPFYSPTILLVEVSATEFPAP-TPDESGFEPIVKEFDLKAPVADDE  530
            E SL  +LFKENP P FY P+IL++EVS T F  P      GF+P++  FDLK PV + +
Sbjct  67   ESSLANLLFKENPLPLFYGPSILILEVSPTPFKEPKNTTNGGFKPVLTTFDLKFPVVEGQ  126

Query  531  SDAFRSNVADH-EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVA  707
             + FRS   D  + YIAGY FF+ NYSCF DKPG++ ESLY R SYRKLGMG+L+F TV+
Sbjct  127  VEEFRSKYDDKSDVYIAGYVFFYANYSCFNDKPGLYLESLYLRESYRKLGMGKLLFGTVS  186

Query  708  ANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            + AA+ GF S+E IVAVWNKK+Y  YV+MG+EI DEFRYGKL G+ LQ YA K   
Sbjct  187  SIAANNGFVSLEEIVAVWNKKAYALYVNMGLEIFDEFRYGKLHGENLQKYADKNGG  242



>gb|AAK15312.1|AF329463_1 hydroxycinnamoyl-CoA: serotonin N-(hydroxycinnamoyl)transferase 
[Capsicum annuum]
Length=250

 Score =   256 bits (654),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 164/225 (73%), Gaps = 6/225 (3%)
 Frame = +3

Query  219  TEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNP  398
             + + I+ KIY R+RLA +SD+ H Y+LFYQIH YH+  HL+K +E SL  + FKENP P
Sbjct  21   NDNVTITGKIYTRVRLATKSDLHHAYQLFYQIHAYHNQFHLFKATESSLSDLFFKENPLP  80

Query  399  PFYSPTILLVEVSATEFPAPTPD-ESGFEPIVKEFDLKAPVADDESDAFRSNVAD----H  563
             FY PT+LL+EVS T F  P  + + GF+P+    DLK PV + + + FRS   D     
Sbjct  81   LFYGPTLLLLEVSPTAFTEPKNNKDEGFKPVFTALDLKFPVVEGQVEEFRSKYDDGTDKR  140

Query  564  EAYIAGYAFFFPNYSCF-YDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSV  740
            + +IAGYA+FF +YS F  DKPGI F+SLYFR SYRKLGMG+L+F TVA+ AA+ GF++V
Sbjct  141  DVFIAGYAYFFASYSLFGNDKPGIHFDSLYFRESYRKLGMGKLLFGTVASIAANNGFAAV  200

Query  741  EGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            EGIVAVWNKKSYDFYV MGVE+ D+FR+GKL G+ LQ YA K+ +
Sbjct  201  EGIVAVWNKKSYDFYVSMGVEMHDDFRFGKLDGENLQKYADKEKN  245



>ref|XP_009796793.1| PREDICTED: probable acetyltransferase NATA1-like [Nicotiana sylvestris]
Length=222

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 142/218 (65%), Gaps = 2/218 (1%)
 Frame = +3

Query  222  EKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPP  401
            EK+  S +I  R+RLA ESDV H++KL YQ+ +YH+   ++  +E S+   LFK NP PP
Sbjct  3    EKISFSTQISGRVRLATESDVPHLHKLMYQMAKYHNYAKVFNATEASISTNLFKSNPCPP  62

Query  402  FYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAG  581
            FYS T  ++EVS   FP  T   S F+PI K  +L +P+ D ES+ FR+N  + + +IAG
Sbjct  63   FYSVTAFILEVSPNNFPKKTTKHSIFDPIQKTINLDSPIVDPESELFRTN--EDDIFIAG  120

Query  582  YAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVW  761
            Y  FFP+YS +++KPG F E++Y R  YRK G G+++FS VA+ AA  GFS+V+ +   W
Sbjct  121  YILFFPSYSGYFEKPGFFIENMYVRECYRKYGFGKILFSAVASQAAKMGFSTVDWLTVGW  180

Query  762  NKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            N  + DFY+ MG  IM + +  +L+G+ L A+A  + +
Sbjct  181  NVDAIDFYLGMGAYIMADVKRFRLSGNGLDAFASSEDA  218



>ref|XP_004249522.1| PREDICTED: probable acetyltransferase NATA1-like [Solanum lycopersicum]
Length=232

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 129/207 (62%), Gaps = 2/207 (1%)
 Frame = +3

Query  243  KIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTIL  422
             +++R+RLA   DV HI+KL +Q+  +  LTHL+  +E SL   LF EN  PPF S T+ 
Sbjct  27   NVFSRIRLATIVDVPHIHKLIHQMAVFERLTHLFSATESSLSSTLFPENSPPPFTSFTVF  86

Query  423  LVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPN  602
            L+EVS T FP    +   F PI K  +L  P+ D ++++FRS    ++  +AG+  FFPN
Sbjct  87   LLEVSQTPFPLIDQNYPNFTPIHKTVNLDLPITDPQAESFRS--CGNDVVVAGFVLFFPN  144

Query  603  YSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDF  782
            YS F  KPG + E ++ R  YR+ G G+++ S VAA AA  G+  VE +V  WN  +  F
Sbjct  145  YSTFLAKPGFYIEDIFVRECYRRKGFGKMLLSAVAAQAAKMGYGRVEWVVLDWNVNAIKF  204

Query  783  YVDMGVEIMDEFRYGKLTGDALQAYAK  863
            Y +MG ++M E+R  +LTGDALQA+A 
Sbjct  205  YEEMGAQVMQEWRVCRLTGDALQAFAN  231



>ref|XP_009595747.1| PREDICTED: probable acetyltransferase NATA1-like [Nicotiana tomentosiformis]
Length=235

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 132/208 (63%), Gaps = 3/208 (1%)
 Frame = +3

Query  243  KIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTIL  422
            ++++R+RLA  +DV HI+KL +Q+  +  LTHL+  +E SL   LF EN  PPF + T+ 
Sbjct  27   QVFSRIRLATNADVPHIHKLIHQMAVFERLTHLFSATESSLSTTLFPENSPPPFTTFTVF  86

Query  423  LVEVSATEF-PAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFP  599
            L+EVS   F P    + + F PI K  +L  PV+D E++ F+S    ++A +AG+  FFP
Sbjct  87   LLEVSQNPFLPIDNQNCTNFSPIHKTINLDLPVSDAEAEMFKS--GGNDAVVAGFVLFFP  144

Query  600  NYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYD  779
            NYS F  KPG + E ++ R  YR+ G GRL+ STVAA AA  G+  VE +V  WN  +  
Sbjct  145  NYSSFLAKPGFYIEDIFVRECYRRKGFGRLLLSTVAAQAAKMGYGRVEWVVLDWNVNAIK  204

Query  780  FYVDMGVEIMDEFRYGKLTGDALQAYAK  863
            FY +MG +I+ E+R  +LTG AL+A+A 
Sbjct  205  FYEEMGAQILQEWRVCRLTGGALEAFAN  232



>ref|XP_004253515.1| PREDICTED: probable acetyltransferase NATA1-like [Solanum lycopersicum]
Length=241

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/229 (39%), Positives = 142/229 (62%), Gaps = 16/229 (7%)
 Frame = +3

Query  222  EKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFK-ENPNP  398
            EK+  S +I++R+RLA ESDVSH++KL YQ+ +YH+ T ++  ++ S+   LFK +NP P
Sbjct  3    EKISFSTQIFSRVRLATESDVSHLHKLMYQMAKYHNYTKVFNATKASITTNLFKSDNPCP  62

Query  399  PFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSN---------  551
            PFYS T  ++EVS+  FP  T     F+PI+K  +L +P+ D + + FR++         
Sbjct  63   PFYSVTAFILEVSSDSFPQNTLKNPIFDPILKIVNLDSPILDSDLELFRTSNNISSILSE  122

Query  552  ------VADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAAN  713
                   +D+   +AGY  F+P YS +++KPG F E+++ R  YRK G G+++FS VA+ 
Sbjct  123  VDNKPLSSDNNVLVAGYVLFYPCYSGYFEKPGFFIENMFVRECYRKCGFGKMLFSAVASQ  182

Query  714  AADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
            A   GF+ V+ +   WN+ + DFY+ MG  IM + +  +L GD L A+A
Sbjct  183  AIKLGFTKVDWLTVGWNENAIDFYLGMGAYIMQDVKRFRLCGDGLDAFA  231



>gb|EYU39619.1| hypothetical protein MIMGU_mgv1a012952mg [Erythranthe guttata]
Length=235

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 130/209 (62%), Gaps = 6/209 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            +++R+RLA   DV HI+KL +Q+  +  LTHL++ + DSL   LF  N  PPF S T+ L
Sbjct  27   LFSRIRLATVDDVPHIHKLIHQMAVFERLTHLFQATADSLAATLFPPNAPPPFTSFTVFL  86

Query  426  VEVSATEF-PAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVAD--HEAYIAGYAFFF  596
            +E+S + F P+  P    F P++K   L  P+AD E + FRS+ A    +  + G+  FF
Sbjct  87   LELSNSPFFPSQNPH---FTPVLKPHHLDLPIADPEKEIFRSSAAGATGDVTVGGFVLFF  143

Query  597  PNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSY  776
            PNYS F  KPG + E ++ R  YR+ G+G+++ ST+AA AA  G+  VE +V  WN  + 
Sbjct  144  PNYSSFLAKPGFYIEDIFVRECYRRKGLGQMLLSTLAAQAAKMGYGRVEWVVLDWNANAI  203

Query  777  DFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
             FY  MG EI+ E+R  +LTG++LQAYA 
Sbjct  204  KFYEQMGAEILPEWRICRLTGESLQAYAN  232



>ref|XP_009782835.1| PREDICTED: probable acetyltransferase NATA1-like [Nicotiana sylvestris]
Length=235

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 127/208 (61%), Gaps = 3/208 (1%)
 Frame = +3

Query  243  KIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTIL  422
            ++++R+RLA  +DV HI+K  +Q+  +  LTHL+  +E SL   LF EN  PPF + TI 
Sbjct  27   QVFSRIRLATNADVPHIHKFIHQMAVFERLTHLFSATESSLSATLFPENSPPPFTTFTIF  86

Query  423  LVEVSATEF-PAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFP  599
            L+EVS   F P    + + F PI K  +L  P++D E++ F+S   D    +AG+  FFP
Sbjct  87   LLEVSQNPFLPIDNQNCTNFSPIHKTINLDLPISDPEAEMFKSGGNDE--VVAGFVLFFP  144

Query  600  NYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYD  779
            NYS F  KPG + E ++    YR+ G GRL+ S VAA AA  G+  VE +V  WN  +  
Sbjct  145  NYSSFLAKPGFYIEDIFVMECYRRKGFGRLLLSAVAAQAAKMGYGRVEWVVLDWNVNAIK  204

Query  780  FYVDMGVEIMDEFRYGKLTGDALQAYAK  863
            FY +MG +I+ E+R  +LTG AL+A+A 
Sbjct  205  FYEEMGAQILQEWRVCRLTGGALEAFAN  232



>ref|XP_011077267.1| PREDICTED: probable acetyltransferase NATA1-like [Sesamum indicum]
Length=225

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 128/208 (62%), Gaps = 6/208 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++ R+RLA   DV HI+KL +Q+  +  LTHL++ +  +L   LF  N  PPF S T+ L
Sbjct  17   LFTRIRLATREDVPHIHKLIHQMAVFERLTHLFEATPAALSATLFPPNAPPPFTSFTVFL  76

Query  426  VEVSATEFPAPTPDES-GFEPIVKEFDLKAPVADDESDAFRSNVAD--HEAYIAGYAFFF  596
            +E+S + FP   P +S  F P +K   L  P+ D E +AFRSN +D   +  + G+  FF
Sbjct  77   LELSTSPFP---PSQSPHFIPRLKSLHLDLPIHDPEKEAFRSNASDANDDVIVGGFVLFF  133

Query  597  PNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSY  776
            PNYS F  KPG + E ++ R  YR+ G+G+++ S VAA AA  G+  VE +V  WN  + 
Sbjct  134  PNYSTFLAKPGFYIEDIFVRECYRRKGLGKMLLSAVAAQAAKMGYGRVEWVVLDWNVNAI  193

Query  777  DFYVDMGVEIMDEFRYGKLTGDALQAYA  860
             FY  MG +I+ E+R  +LTG+ALQA+A
Sbjct  194  KFYEQMGAQILPEWRICRLTGEALQAHA  221



>ref|XP_002272073.1| PREDICTED: probable acetyltransferase NATA1-like [Vitis vinifera]
Length=227

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 122/211 (58%), Gaps = 10/211 (5%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            + + I+AR+R+A  SDV  ++KL YQ+  +  L HL+  +E SL   LF     PPF S 
Sbjct  26   VGNPIFARIRIANPSDVRPLHKLMYQLAVFERLPHLFSATESSLSSNLFN---TPPFQSF  82

Query  414  TILLVEVSATEFP-APTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAF  590
            T+ L+EVS T FP AP        PI    +L  P+AD ES  F S     +A +AG+  
Sbjct  83   TVFLLEVSPTPFPDAPV---GAHPPITHVINLDLPIADPESQEFGSG---GDAVVAGFVL  136

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
            FFPNYS F  KPG + E LY R  YR+ G G+++ S VAA A   G+  VE  V  WN  
Sbjct  137  FFPNYSTFLGKPGFYIEDLYVRDCYRRKGFGKMLLSAVAAQAVKMGYGRVEWCVLDWNVN  196

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
            +  FY +MG +++ E+R  +LTGDALQAY  
Sbjct  197  AIKFYEEMGAQVLQEWRICRLTGDALQAYGN  227



>ref|XP_007009878.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Theobroma 
cacao]
 gb|EOY18688.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Theobroma 
cacao]
Length=235

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 125/225 (56%), Gaps = 12/225 (5%)
 Frame = +3

Query  183  MAPPAVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDS  362
            MAPP         E   +   ++ R+RLA  SDV  I+KL +Q+  +  LTHL+  +E S
Sbjct  18   MAPP---------ETTPLGHPLFTRIRLAAPSDVPFIHKLIHQMAVFERLTHLFTATESS  68

Query  363  LCKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAF  542
            L   LF+   +PPF S TI ++EVS+T  P        F  I K F+   P+ D E DAF
Sbjct  69   LHSTLFR---SPPFDSFTIFILEVSSTPIPPLPSIYPSFTSIEKTFNFDIPINDPEEDAF  125

Query  543  RSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAAD  722
              N    +  IAG+  FFPNYS F  KPG + E L+ R  YR+ G G+++ S VA  A  
Sbjct  126  TVNFGKDQIIIAGFVLFFPNYSTFLGKPGFYVEDLFVRQCYRRKGFGKMLLSAVAKQAVK  185

Query  723  KGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
             G+  VE +V  WN  +  FY  MG +++ ++R  +LTGDALQAY
Sbjct  186  MGYGRVEWVVLDWNINAIKFYEQMGAKVLPDWRICRLTGDALQAY  230



>ref|XP_004307374.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Fragaria 
vesca subsp. vesca]
Length=234

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 124/209 (59%), Gaps = 6/209 (3%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            +   ++AR+RLA+ +DV HIYKL +Q+  +  L+     +E SL   LF    +PPF S 
Sbjct  28   MGHPLFARVRLAQPTDVPHIYKLIHQMAVFERLSDHCSATEASLASTLFN---SPPFQSF  84

Query  414  TILLVEVSATEFPAPTP-DESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAF  590
            T+ ++E S T FP         ++P+VK  +L  PV D E   F S V D  A +AG+  
Sbjct  85   TVFVLEASPTPFPNDAHYSNPHYQPVVKTLNLDLPVEDPERLVFWSGVGD--AVVAGFVL  142

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
            FFPNYS F  KPG + E L+ R  YR+ GMG+++ S VA  A   G+  VE +V  WN  
Sbjct  143  FFPNYSTFLGKPGFYVEDLFVRECYRRKGMGKMLLSAVAKQAVKMGYGRVEWVVLDWNVN  202

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            + +FY +MG +IM E+R  +LTGDALQAY
Sbjct  203  AINFYEEMGAKIMQEWRICRLTGDALQAY  231



>ref|XP_009612298.1| PREDICTED: L-ornithine N5-acetyltransferase NATA1-like [Nicotiana 
tomentosiformis]
Length=271

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 146/240 (61%), Gaps = 10/240 (4%)
 Frame = +3

Query  174  TTVMAPPAVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVS  353
            +T +A   +I++  T E    S +I AR+RLA E DV H++KL  Q+ EYH L+ ++  +
Sbjct  31   STHVAATTLINSFQTKENTIFSHQISARIRLATELDVPHLHKLVTQMAEYHGLSEIFTTT  90

Query  354  EDSLCKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDES--GFEPIVKE-FDL-KAPVA  521
            E SL   LFK N +PPF+S T L++E+S   FP  T   +   F PI+K  ++L +  V 
Sbjct  91   ETSLYNNLFKSN-DPPFHSLTALVLEISPNPFPPITKSNNLISFTPIIKNNYNLDQMYVL  149

Query  522  DDESDAFRSNVA-----DHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGR  686
            D E + FRS        +   Y+AG+   FP+Y+ F++KPG++ + ++ R  YR + +G+
Sbjct  150  DPELETFRSKFKGDGENNGNVYVAGHVLVFPSYNGFFEKPGLYLDQMFVRKCYRGMRLGK  209

Query  687  LMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKK  866
            L+FS VA+ AA  G   V+ +VA WN++S +FY  MG   + E+R  KL GD LQ+++KK
Sbjct  210  LLFSAVASQAAKMGMGMVDWLVADWNEESINFYEKMGAHYIPEYRLCKLYGDQLQSFSKK  269



>ref|XP_009382139.1| PREDICTED: probable acetyltransferase NATA1-like [Musa acuminata 
subsp. malaccensis]
Length=214

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 125/208 (60%), Gaps = 2/208 (1%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++AR+RLA   DV +I++L  Q+ E+  LTHL+  +E SL   LF     PPF S T+L+
Sbjct  9    VWARIRLADRRDVPNIHRLIRQMAEFELLTHLFSATEASLSDTLFPSPALPPFLSFTVLI  68

Query  426  VEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNY  605
            +E+S + F   + D   F PIV+  DL++ V D E+  F S   +    +AG+   FPNY
Sbjct  69   LELSHSPFSEDS-DAPLFAPIVRRIDLESAVEDPEAAEFASPRGEG-IVVAGFVLCFPNY  126

Query  606  SCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFY  785
            S F  KPG++ E ++ RA++R+ G+GR++ + VA  AA  G   VE  V  WN  +  FY
Sbjct  127  STFLAKPGLYIEDIFVRATWRRRGLGRMLLAAVAGQAAQMGMGRVEWCVLDWNVNAIKFY  186

Query  786  VDMGVEIMDEFRYGKLTGDALQAYAKKK  869
             DMG E+M  +R  +LTG ALQAY  +K
Sbjct  187  EDMGAEVMPMWRICRLTGPALQAYLHEK  214



>emb|CDY14413.1| BnaC03g21820D [Brassica napus]
Length=233

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 126/218 (58%), Gaps = 4/218 (2%)
 Frame = +3

Query  204  DTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFK  383
            +  +  E   I   +++R+RLA   DV  I+KL +Q+  +  LTHL+  +E +L   LF 
Sbjct  15   EPNMVPETSPIGHPVFSRIRLATPLDVPFIHKLIHQMAVFERLTHLFSATESNLSSSLFT  74

Query  384  ENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADH  563
               +PPF S T+ L+EVS + FPA  P    F P++K  +L  P+ D ES  F  ++ + 
Sbjct  75   ---SPPFKSFTVFLLEVSRSPFPATLPSPQDFTPLLKTHNLDLPIEDPESHNFTPDMLN-  130

Query  564  EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVE  743
            +  +AG+  FFPNYS F  KPG + E ++ R  YR+ G G ++ + VA  A   G+  VE
Sbjct  131  DVVVAGFVLFFPNYSSFLAKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRVE  190

Query  744  GIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
             +V  WN  +  FY  MG +I+ E+R  +LTGDALQA+
Sbjct  191  WVVLDWNANAIKFYEQMGAQILQEWRVCRLTGDALQAF  228



>ref|XP_002273620.1| PREDICTED: probable acetyltransferase NATA1-like [Vitis vinifera]
Length=229

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 120/209 (57%), Gaps = 10/209 (5%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            I + I+AR+R+A  SDV H++KL YQ      LTH++  +E SL   LF    +PPF S 
Sbjct  26   IGNPIFARIRIANSSDVPHLHKLMYQHAASQRLTHIFSATESSLSATLFN---SPPFQSF  82

Query  414  TILLVEVSATEFP-APTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAF  590
            T+LL+EVS T FP  P        PI +  +L  P+ D ES  F S     EA + G+  
Sbjct  83   TVLLLEVSPTPFPDGPV---GCHPPITRIVNLDLPIVDPESKEFGSG---GEAVVVGFVL  136

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
            FFPNY  F  KPG + ESLY R  YRK G G+++ S VAA A   G+  ++  V  WN  
Sbjct  137  FFPNYGVFLGKPGFYIESLYTRECYRKKGFGKMLLSAVAAQAVKMGYGKLDWCVLGWNAN  196

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            ++ FY  MG ++ +E +  +LT DALQAY
Sbjct  197  AFGFYKKMGAQVFEELKMCRLTSDALQAY  225



>ref|XP_009599514.1| PREDICTED: probable acetyltransferase NATA1-like [Nicotiana tomentosiformis]
Length=217

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 128/217 (59%), Gaps = 3/217 (1%)
 Frame = +3

Query  213  VTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENP  392
            +  E    S +I AR+RL KE DV H++KL  Q+  YH+L++++  +E SL   LFK   
Sbjct  1    MKQENTMFSHQISARIRLVKEPDVPHLHKLISQMANYHNLSNVFTTTETSLSNTLFK---  57

Query  393  NPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAY  572
            +PPF+S T L++E+S   FP     E          +L+ P+ D E + FRS       Y
Sbjct  58   SPPFHSFTALILEISPNPFPNTMAQEHHNVIKNNTINLETPIFDPEFETFRSRFNSDHIY  117

Query  573  IAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIV  752
            +AG+   +P+Y+ F++KPG++ + L+ R  YR LG G+++FS VA+ AA+ G   V+ +V
Sbjct  118  VAGHVLVYPSYNGFFEKPGLYLDQLFVRKCYRGLGFGKMLFSAVASQAANNGMGMVDWLV  177

Query  753  AVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
            A WN+KS  FY  MG   + +++  KL G+ LQ YA 
Sbjct  178  ADWNEKSMKFYDKMGAHYIPQYKLCKLYGEKLQQYAN  214



>ref|XP_010262883.1| PREDICTED: probable acetyltransferase NATA1-like [Nelumbo nucifera]
Length=232

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 125/209 (60%), Gaps = 7/209 (3%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            + + I+ R+RLA  +DV HI+KL +Q+  +  LTHL+  +E SL   LF    + PF S 
Sbjct  28   VGNPIFVRIRLACNNDVPHIHKLIHQMAVFERLTHLFSATEASLSATLFN---SLPFQSF  84

Query  414  TILLVEVSATEFPAPTPDESG-FEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAF  590
            T+L++EVS   F       +  + P+V+  +L AP+ D E++ FRS     +  +AG+  
Sbjct  85   TVLILEVSQVPFLQDQHQNNPLYPPVVRIINLDAPINDPEAETFRSGA---DVVVAGFVL  141

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
            FFPNYS F  KPG + E ++ R  YR+ GMGR++ S VA+ A   G+  VE  V  WN  
Sbjct  142  FFPNYSTFLAKPGFYIEDIFVRECYRRKGMGRMLLSAVASQAVKMGYGRVEWCVLDWNMN  201

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            +  FY +MG E++ E+R  +L G+ALQAY
Sbjct  202  AIKFYEEMGAEVLQEWRICRLAGEALQAY  230



>ref|XP_011077268.1| PREDICTED: probable acetyltransferase NATA1-like isoform X1 [Sesamum 
indicum]
Length=235

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 129/218 (59%), Gaps = 7/218 (3%)
 Frame = +3

Query  219  TEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNP  398
            +E      +++ R+RLA   DV HI+KL +Q+  + SLTHL++ +  +L   LF  N  P
Sbjct  17   SEPTPCGHELFTRIRLATVEDVPHIHKLTHQLAVFESLTHLFQATPATLAATLFPPNAPP  76

Query  399  PFYSPTILLVEVSATEFPAPTPDES-GFEPIVKEFDLKAPVADD-ESDAFRSNVAD--HE  566
            PF S T+LL+E+S   FP   P E+  F P  K   L  P+ DD E +AFRSN  D   +
Sbjct  77   PFTSVTVLLLELSTLPFP---PSENPHFTPWHKSLHLDLPIDDDPEKEAFRSNAGDVNED  133

Query  567  AYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEG  746
              + G+  FFPNY+ F  KPG + ++++ R   R+ G+G+L+   VA  AA  G+  V+ 
Sbjct  134  VTVGGFVLFFPNYAAFLAKPGFYIDNIFVREYCRRKGLGKLLLWAVAEQAAKMGYGRVDW  193

Query  747  IVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
            +V  WN  +  FY  MG +I+ E R+ +LTG+AL+AYA
Sbjct  194  VVLDWNVNAITFYEGMGAKILPELRFCRLTGEALEAYA  231



>gb|KDP44395.1| hypothetical protein JCGZ_20075 [Jatropha curcas]
Length=231

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 125/208 (60%), Gaps = 8/208 (4%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            +   +++R+RLA  +DV HI+KL +Q+  +  LTHL+  +E SL   LF    +PPF+S 
Sbjct  28   VGHPLFSRIRLATPADVPHIHKLIHQMAVFERLTHLFSATESSLSATLFT---SPPFHSF  84

Query  414  TILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFF  593
            TI L+EVS+   P  T   S F PI +   L  P+ D E++ F++   D    +AG+  F
Sbjct  85   TIFLLEVSSNPLPKIT---SHFAPIDRIIQLDHPINDPETETFKNGSDD--VVVAGFVLF  139

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG + E L+ R  YR+ G+GR++ S VA  A   G+  VE +V  WN  +
Sbjct  140  FPNYSTFLGKPGFYVEDLFVRECYRRKGLGRMLLSAVAGQAVKMGYGRVEWVVLDWNVNA  199

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAY  857
              FY +MG +++ E+R  +LTG+ L+AY
Sbjct  200  IKFYEEMGAKVLPEWRICRLTGENLEAY  227



>ref|XP_007145441.1| hypothetical protein PHAVU_007G239400g [Phaseolus vulgaris]
 gb|ESW17435.1| hypothetical protein PHAVU_007G239400g [Phaseolus vulgaris]
Length=230

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 122/206 (59%), Gaps = 5/206 (2%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++ R+RLA  SDV HI+KL +Q+  +  LTHL+  +E SL   LF     P F+S TI L
Sbjct  26   LFTRIRLATPSDVPHIHKLIHQMAVFERLTHLFSATESSLAATLFSPTAQP-FHSFTIFL  84

Query  426  VEVSATEFPAPTPDESGF-EPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPN  602
            +E S   F A T D + F +P+ K  +L+ P+ D E + F+S     +  + G+  FFPN
Sbjct  85   LEASPNPFAASTLDSNPFFKPLTKFVNLRVPIEDPERETFKSM---DDVTVVGFVLFFPN  141

Query  603  YSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDF  782
            YS F  KPG + E L+ R  YR+ G GR++ S VA  A   G+  VE +V  WN  +  F
Sbjct  142  YSSFLAKPGFYVEDLFVRECYRRKGFGRMLLSAVAKQAVKMGYGRVEWVVLDWNVNAIRF  201

Query  783  YVDMGVEIMDEFRYGKLTGDALQAYA  860
            Y +MG +I++E+R  +LTG+ALQ Y 
Sbjct  202  YEEMGADILNEWRICRLTGEALQTYG  227



>ref|XP_009790558.1| PREDICTED: L-ornithine N5-acetyltransferase NATA1-like [Nicotiana 
sylvestris]
Length=243

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 143/239 (60%), Gaps = 9/239 (4%)
 Frame = +3

Query  174  TTVMAPPAVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVS  353
            +T +A   +I++    E    S +I AR+RLA E DV  ++KL  Q+ EYH L+ ++  +
Sbjct  4    STHVAANTLINSFQPKENTIFSHQISARIRLATEVDVPLLHKLVTQMAEYHGLSEIFTTT  63

Query  354  EDSLCKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDES-GFEPIVKE-FDL-KAPVAD  524
            E SL   LFK N NPPF+S T L++E+S   FP  T   +  F PI+K  ++L K  V D
Sbjct  64   ETSLHNNLFKSN-NPPFHSLTALVLEISPNPFPLVTKSNNLSFIPIIKNNYNLDKMEVLD  122

Query  525  DESDAFRSNVA-----DHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRL  689
             E + FRS        +   Y+AG+   FP+Y+ F++KPG++ + ++ R  YR + +G+L
Sbjct  123  PELETFRSKFKGDGENNGNVYVAGHVLVFPSYNGFFEKPGLYLDQMFVRKCYRGMRLGKL  182

Query  690  MFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKK  866
            +FS VA+ AA  G   V+ +VA WN++S +FY  MG   + E+R  KL G  LQA++KK
Sbjct  183  LFSAVASKAAKMGMGMVDWLVADWNEESINFYEKMGAHYIPEYRLCKLYGGQLQAFSKK  241



>ref|XP_004245422.2| PREDICTED: L-ornithine N5-acetyltransferase NATA1-like [Solanum 
lycopersicum]
Length=244

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 133/213 (62%), Gaps = 4/213 (2%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            + +I AR+RLA E D+ +++KL  Q+ EYH L+ ++  +E SL   LFK   NPPF+SPT
Sbjct  23   NHQISARIRLATELDIPNLHKLVTQMAEYHGLSQIFTTTEASLYNNLFKSQ-NPPFHSPT  81

Query  417  ILLVEVSATEFPAPTPDESGFEPIVKE-FDLKA-PVADDESDAFRSNVADHE-AYIAGYA  587
             L++E+S   FP  T   + F PI+K  ++       D E +++RS +  H+  Y+AG+ 
Sbjct  82   ALILEISPNPFPHTTTTTTNFVPIIKNNYNFNTLETLDHELESYRSKIIGHDDVYVAGHV  141

Query  588  FFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNK  767
              +P+Y+ F++KPG+F + ++ R  YR +  G+L+FSTVA  A   G   V+ +VA WN+
Sbjct  142  LVYPSYNGFFEKPGLFLDQMFVRKCYRGMKFGKLLFSTVAMQAEKMGMGMVDWLVADWNE  201

Query  768  KSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKK  866
            ++ +FY  MG   + ++R  KL GD LQA+ KK
Sbjct  202  ETINFYEKMGAHYIPDYRLCKLYGDQLQAFGKK  234



>ref|XP_006356652.1| PREDICTED: L-ornithine N5-acetyltransferase NATA1-like [Solanum 
tuberosum]
Length=244

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 130/222 (59%), Gaps = 14/222 (6%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            + +I AR+RLA E DV +++KL  Q+ EYH L+ ++  +E SL   LFK  PNPPF+SPT
Sbjct  23   NHQISARIRLATELDVPNLHKLVTQMAEYHGLSQIFTTTETSLYNNLFKS-PNPPFHSPT  81

Query  417  ILLVEVSATEFPAPT-PDESGFEPIVKE---FDLKAPVADDESDAFRSNVADH-------  563
             L++E+S   FP       + F PI+K    FD    + D E + +RS    H       
Sbjct  82   ALILEISPNPFPQTNHTTTTNFVPIIKNNYNFD-NLEILDHELETYRSKFNGHGHDNSNN  140

Query  564  -EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSV  740
               Y+AG+   +P+Y+ F++KPG+F + ++ R  YR +  G+L+FS VA  A   G   V
Sbjct  141  CNVYVAGHVLVYPSYNGFFEKPGLFLDQMFVRKCYRGMKFGKLLFSAVAMQAEKMGMGMV  200

Query  741  EGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKK  866
            + +VA WN+++ +FY  MG   + E+R  KL GD LQA+ KK
Sbjct  201  DWLVANWNEETINFYEKMGAHYIPEYRLCKLYGDQLQAFGKK  242



>ref|XP_002531687.1| Tyramine N-feruloyltransferase 4/11, putative [Ricinus communis]
 gb|EEF30706.1| Tyramine N-feruloyltransferase 4/11, putative [Ricinus communis]
Length=233

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 120/208 (58%), Gaps = 6/208 (3%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            +   +++R+RLA  +DV HIYKL  Q+  +  LTHL+  +E SL   LF     PPF S 
Sbjct  28   VGHPLFSRIRLATPADVPHIYKLIQQMAVFEKLTHLFSATETSLFSTLFNA---PPFQSF  84

Query  414  TILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFF  593
            T+ L+EVS    P        F PI +   L  P+ D ES+ F+ N    +  +AG+  F
Sbjct  85   TVFLLEVSTN--PLSKIISPNFTPIERVVQLDHPIIDPESEMFK-NSGSGDVVVAGFVLF  141

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG + E L+ R  YR+ GMG+++ S VAA A   G+  VE +V  WN  +
Sbjct  142  FPNYSSFLAKPGFYVEDLFVRECYRRKGMGKMLLSAVAAQAVKMGYGRVEWVVLDWNVNA  201

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAY  857
              FY +MG +I+ E+R  +LTGD L+AY
Sbjct  202  IKFYEEMGAKILPEWRICRLTGDNLEAY  229



>ref|XP_010314778.1| PREDICTED: probable acetyltransferase NATA1-like [Solanum lycopersicum]
Length=223

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 130/223 (58%), Gaps = 8/223 (4%)
 Frame = +3

Query  195  AVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKM  374
            A+I    ++     + K+++R+R+A E DV HIYKL  Q+  YH +THL K +E S+   
Sbjct  2    ALISPISSSNGKTFNQKLFSRIRVAIECDVPHIYKLMQQLFVYHDITHLLKSNESSIASG  61

Query  375  LFKENPNPPFYSP-TILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSN  551
            LF  N   P  SP T LL+EVS   FP+   D++      KE DL  P+ D+ES+ FR  
Sbjct  62   LF--NSKYPHLSPVTTLLIEVSTDPFPSCANDKNN----SKELDLNMPLVDEESEQFRVV  115

Query  552  VAD-HEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKG  728
              D H+ +IAGY  F+P +S F++ P    E+ + R  YR+ G G+ +FST+A   A  G
Sbjct  116  KHDQHDVFIAGYVMFYPCFSSFFENPVFHMENFFIRECYRRKGFGKWLFSTMALEVARMG  175

Query  729  FSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            FSS++   + WN+ + DFY  MG  I D+FR   L G AL+AY
Sbjct  176  FSSIDLYASDWNESTLDFYKHMGATISDDFRVLSLAGKALEAY  218



>ref|XP_007145448.1| hypothetical protein PHAVU_007G240100g [Phaseolus vulgaris]
 gb|ESW17442.1| hypothetical protein PHAVU_007G240100g [Phaseolus vulgaris]
Length=224

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 128/224 (57%), Gaps = 10/224 (4%)
 Frame = +3

Query  186  APPAVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSL  365
            APP +     T E   +S  ++ R+RLA  SD+ HI+KL +Q+  Y  LTHL+  +E SL
Sbjct  5    APPTL-----TAETTPLSRHLFTRIRLATPSDIPHIHKLIHQMAVYERLTHLFSATESSL  59

Query  366  CKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDESGF-EPIVKEFDLKAPVADDESDAF  542
               LF     P F+S TILL+E S T FP  T D + F +PI K  +L  P  D E D F
Sbjct  60   SATLFSPTVQP-FHSFTILLLEASPTPFPFSTVDSNPFFKPITKLVNLSLPFEDPERDTF  118

Query  543  RSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAAD  722
            +S     +  + G+  FFPNYS F  KPG + E+LY R  YR++G G+++   VA  A  
Sbjct  119  KSM---DDVTVTGFVLFFPNYSTFLGKPGFYVENLYVRECYRRMGFGKMLLCAVAKEAVK  175

Query  723  KGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQA  854
              +  V+ +V  WN  +  FY  MG E ++E+++ ++TG AL+A
Sbjct  176  MKYGRVDWVVLDWNVNALRFYEGMGGETVEEYKFFRMTGKALEA  219



>ref|XP_010555817.1| PREDICTED: probable acetyltransferase NATA1-like [Tarenaya hassleriana]
Length=214

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 120/206 (58%), Gaps = 6/206 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            +++R+RLA  SDV  I+KL +Q+  +  LTHL+  +E  L   LF    +PPF S T+ L
Sbjct  12   LFSRIRLATPSDVPFIHKLIHQMAVFERLTHLFSATESGLASTLFN---SPPFQSFTVFL  68

Query  426  VEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNY  605
            +E+S + FP      S F P +K  +   P  D E   F S+  + +  +AG+  FFPNY
Sbjct  69   LEISRSPFPHLA--SSDFTPFLKTHNFDLPTEDPERLVFTSDPGN-DVVVAGFVLFFPNY  125

Query  606  SCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFY  785
            S F  KPG + E ++ R  YR+ G GR++ + VA  A   G+  VE +V  WN  +  FY
Sbjct  126  STFLAKPGFYIEDIFVRDCYRRKGFGRMLLTAVAKQAVKMGYGRVEWVVLDWNMNAIKFY  185

Query  786  VDMGVEIMDEFRYGKLTGDALQAYAK  863
              MG +IM E+R  +LTGDALQAY+K
Sbjct  186  EQMGAQIMQEWRVCRLTGDALQAYSK  211



>ref|XP_009616163.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Nicotiana 
tomentosiformis]
Length=242

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 128/213 (60%), Gaps = 12/213 (6%)
 Frame = +3

Query  243  KIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTIL  422
            K++AR+R+A ESDV HIYKL  Q+  YH++THL K +E+S+   LFK  P  P  SP   
Sbjct  24   KLFARIRVATESDVPHIYKLMQQLFAYHNITHLLKSTENSIASALFK--PKFPHLSPVTA  81

Query  423  LVEVSATEFPAPTP---DES--GFEPIVKEFDL-KAPVADDESDAFR--SNVADHEAYIA  578
            LV ++  E P P     DE+  G    VKE DL   P+ D+ES+ FR   N  D + +IA
Sbjct  82   LV-INFIEPPLPLSADFDENLQGVLLGVKEIDLDNMPLIDEESEEFRDVKNQQD-DVFIA  139

Query  579  GYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAV  758
            GY  F+P +S F+D P    E L+ R  YR  G G+ MFST+A+ AA  GFSS++ I + 
Sbjct  140  GYVMFYPCFSSFFDNPVFHMEDLFIRECYRGKGFGKWMFSTIASKAARMGFSSIDWIASQ  199

Query  759  WNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            WNK +  FY  MG  I D+FR   L G AL+A+
Sbjct  200  WNKSAIQFYTQMGARISDDFRVLSLAGKALEAF  232



>gb|ABK94515.1| unknown [Populus trichocarpa]
Length=236

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 127/209 (61%), Gaps = 5/209 (2%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            +   ++AR+RLA   D+ HI+KL +Q+  +  LTHL+  +E SL   LFK   +PPF S 
Sbjct  28   VGHPLFARIRLATPLDIPHIHKLIHQMAIFEKLTHLFTATESSLASTLFK---SPPFLSF  84

Query  414  TILLVEVSATEFPAPTPDES-GFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAF  590
            TI L+EVS+  F   +   S  F PI + F+L   + D E++ F++ + + +  +AG+  
Sbjct  85   TIFLLEVSSHPFEKDSNFHSQSFTPIERIFNLDHSLIDPEAETFKNGI-NGDVVVAGFVL  143

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
            FFPN+S F  KPG + E L+ R  YR+ G+G+L+ S VA+ A   G+  VE +V  WN  
Sbjct  144  FFPNFSTFLGKPGFYVEDLFVRECYRRKGLGKLLLSAVASQAVKMGYGRVEWVVLDWNVN  203

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            +  FY +MG  ++ E+R  +LTG AL+AY
Sbjct  204  AIKFYEEMGANVLPEWRICRLTGPALEAY  232



>ref|XP_009133328.1| PREDICTED: probable acetyltransferase NATA1-like [Brassica rapa]
Length=234

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 120/208 (58%), Gaps = 4/208 (2%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            I   I++R+RLA   DV  I+KL +Q+  +  LTHL+  +E +L   LF    +PPF S 
Sbjct  26   IGHPIFSRIRLATPLDVPFIHKLIHQMAVFERLTHLFSATESNLSSTLFT---SPPFKSF  82

Query  414  TILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFF  593
            T+ L+EVS + FP   P    F P++K  +L  P+ D ES  F  ++ + +  +AG+  F
Sbjct  83   TVFLLEVSRSPFPTTLPSPPDFTPLLKTHNLDLPIEDPESYNFTPDMLN-DVVVAGFVLF  141

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG + E ++ R  YR+ G G ++ + VA  A   G+  VE +V  WN  +
Sbjct  142  FPNYSSFLAKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRVEWVVLDWNANA  201

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAY  857
              FY  MG +I+ E+R  +L GDAL A+
Sbjct  202  IKFYEQMGAQILQEWRVCRLAGDALLAF  229



>ref|XP_002879780.1| hypothetical protein ARALYDRAFT_482921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56039.1| hypothetical protein ARALYDRAFT_482921 [Arabidopsis lyrata subsp. 
lyrata]
Length=235

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 123/212 (58%), Gaps = 11/212 (5%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            I   I++R+RLA  SDV  I+KL +Q+  +  LTHL+  +E  L   LF   P   F S 
Sbjct  26   IGHPIFSRIRLATPSDVPFIHKLIHQMAVFERLTHLFSATESGLTSTLFTSRP---FQSF  82

Query  414  TILLVEVSATEFP----APTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAG  581
            T+ L+EVS + FP    +P+PD   F P +K  +L  P+ D ES  F  ++ + +  +AG
Sbjct  83   TVFLLEVSRSPFPTTITSPSPD---FTPFLKTHNLDLPIEDPESYNFSPDMLN-DVVVAG  138

Query  582  YAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVW  761
            +  FFPNYS F  KPG + E ++ R  YR+ G G ++ + VA  A   G+  VE +V  W
Sbjct  139  FVLFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRVEWVVLDW  198

Query  762  NKKSYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            N  +  FY  MG +I+ E+R  +LTGDAL+A+
Sbjct  199  NVNAIKFYEQMGAQILQEWRVCRLTGDALEAF  230



>emb|CDY07680.1| BnaA03g18310D [Brassica napus]
Length=234

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 120/208 (58%), Gaps = 4/208 (2%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            I   +++R+RLA   DV  I+KL +Q+  +  LTHL+  +E +L   LF    +PPF S 
Sbjct  26   IGHPVFSRIRLATPLDVPFIHKLIHQMAVFERLTHLFSATESNLSSTLFT---SPPFKSF  82

Query  414  TILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFF  593
            T+ L+EVS + FP   P    F P++K  +L  P+ D ES  F  ++ + +  +AG+  F
Sbjct  83   TVFLLEVSRSPFPTSLPSPPDFTPLLKTHNLDLPIEDPESYNFTPDMLN-DVVVAGFVLF  141

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG + E ++ R  YR+ G G ++ + VA  A   G+  VE +V  WN  +
Sbjct  142  FPNYSSFLAKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRVEWVVLDWNANA  201

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAY  857
              FY  MG +I+ E+R  +L GDAL A+
Sbjct  202  IKFYEQMGAQILQEWRVCRLAGDALLAF  229



>ref|XP_010509079.1| PREDICTED: probable acetyltransferase NATA1-like [Camelina sativa]
Length=235

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 121/219 (55%), Gaps = 4/219 (2%)
 Frame = +3

Query  207  TGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKE  386
            T +   K  I   +++R+RLA  SDV  I+KL +Q+  +  LTHL+  +E  L   LF  
Sbjct  17   TDMVPLKSPIGHPVFSRIRLATPSDVPFIHKLIHQMAVFERLTHLFAATETGLTSTLFNS  76

Query  387  NPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHE  566
             P   F S T+ L+EVS + F    P    F P +K   L  P+ D ES  F  ++ + +
Sbjct  77   RP---FQSFTVFLLEVSRSPFTEIAPSSPDFTPFLKTHSLDLPIEDPESYNFSPDMLN-D  132

Query  567  AYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEG  746
              +AG+  FFPNYS F  KPG + E ++ R  YR+ G G ++ S VA  A   G+  VE 
Sbjct  133  VVVAGFVLFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLSAVAKQAVKMGYGRVEW  192

Query  747  IVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
            +V  WN  +  FY  MG EI+ E+R  +LTGDAL+A+ K
Sbjct  193  VVLDWNVNAIKFYEQMGAEILQEWRVCRLTGDALEAFDK  231



>ref|XP_007218286.1| hypothetical protein PRUPE_ppa010697mg [Prunus persica]
 gb|EMJ19485.1| hypothetical protein PRUPE_ppa010697mg [Prunus persica]
Length=239

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 123/211 (58%), Gaps = 6/211 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++AR+RLA  +DV HI+KL +Q+  +  L+     +E SL   LF    +PPF S TI +
Sbjct  31   LFARIRLAHPTDVPHIHKLIHQMAVFERLSDQCIATEASLSSTLFT---SPPFQSFTIFV  87

Query  426  VEVSATEFPAPTP-DESGFEPIVKEFDLKAPVADDESDAFRSN--VADHEAYIAGYAFFF  596
            +EVS T F      +   + PI K  +L  P+ D + D FRSN  V   +A +AG+  FF
Sbjct  88   LEVSHTPFVEHLQYNNPAYPPITKVVNLDLPINDPDRDLFRSNGGVLGGDACVAGFVLFF  147

Query  597  PNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSY  776
            PNYS F  KPG + E L+ R  YR+ G+G+++ S VA  A   G+  VE +V  WN  + 
Sbjct  148  PNYSTFLAKPGFYIEDLFVRECYRRKGLGKMLLSAVAKQAVKMGYGRVEWVVLDWNVNAI  207

Query  777  DFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
             FY +MG +I+ E+R  +LTGDAL AY   +
Sbjct  208  RFYEEMGAKILQEWRICRLTGDALNAYVNAQ  238



>ref|XP_007145442.1| hypothetical protein PHAVU_007G239500g [Phaseolus vulgaris]
 gb|ESW17436.1| hypothetical protein PHAVU_007G239500g [Phaseolus vulgaris]
Length=271

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 119/205 (58%), Gaps = 5/205 (2%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            I+ R+RLA  SDV HI+KL +Q+  +  LTHL+  +E SL   LF     P F+S TI L
Sbjct  66   IFTRIRLATPSDVPHIHKLIHQMAVFERLTHLFSATESSLAATLFSPTTQP-FHSFTIFL  124

Query  426  VEVSATEFPAPTPDESGF-EPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPN  602
            +E S   F   T D + F  P+ K  +L+ P+ D E + F+S     +  + G+  FFPN
Sbjct  125  LEASPNPFAVSTLDSNPFFTPLTKLVNLRVPLEDPERETFKSM---DDVTVVGFVLFFPN  181

Query  603  YSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDF  782
            YS    KPG + E L+ R  YR+ G GR++ S VA +A   G   VE +V  WN  +  F
Sbjct  182  YSTVLGKPGFYVEDLFVRECYRRKGFGRMLLSAVARHAVKMGCGRVEWVVHDWNVNAIRF  241

Query  783  YVDMGVEIMDEFRYGKLTGDALQAY  857
            Y +MG +I++E+R  +LTG+ALQ Y
Sbjct  242  YEEMGADILNEWRICRLTGEALQTY  266



>ref|XP_002312008.2| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
 gb|EEE89375.2| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
Length=236

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 126/209 (60%), Gaps = 5/209 (2%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            +   ++AR+RLA   D+ HI+KL +Q+  +  LTHL+  +E SL   LFK   +PPF S 
Sbjct  28   VGHPLFARIRLATPLDIPHIHKLIHQMAIFEKLTHLFTATESSLASTLFK---SPPFLSF  84

Query  414  TILLVEVSATEFPAPTPDES-GFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAF  590
            TI L+EVS+  F   +   S  F PI + F+L   + D E++ F++ + + +  +AG+  
Sbjct  85   TIFLLEVSSHPFEKDSNFHSQSFTPIERIFNLDHSLIDPEAETFKNGI-NGDVVVAGFVL  143

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
            FFPN+S F  KPG + E L+ R  YR+ G+G+L+ S VA+ A   G+  VE +V  WN  
Sbjct  144  FFPNFSTFLGKPGFYVEDLFVRECYRRKGLGKLLLSAVASQAVKMGYGRVEWVVLDWNVN  203

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            +  FY +MG  +  E+R  +LTG AL+AY
Sbjct  204  AIKFYEEMGANVFPEWRICRLTGPALEAY  232



>gb|ABF94015.1| GCN5-related N-acetyltransferase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAG93355.1| unnamed protein product [Oryza sativa Japonica Group]
Length=227

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 121/213 (57%), Gaps = 8/213 (4%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            S +++A LRLA  SDV HI+ L +Q+ E+  LT L+  + + L   LF   P PPF S T
Sbjct  11   SGEVWAELRLADSSDVPHIHALIHQMAEFELLTDLFAATHELLTSTLFPSPPRPPFTSFT  70

Query  417  ILLVEVSATEFPAPTPDESGFEPIVKE-FDLKA-PVADDESDAFRSNVADHEAYIAGYAF  590
             L++++S +  PA     SG   I     DL A P+AD E+ AF S         AG+  
Sbjct  71   ALILDLSPSPLPA-----SGPSTIASHCLDLSASPLADPEAAAFASPRGGGR-VTAGFVI  124

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
             FPNYS F  KPG++ E ++ RA +R+ G+GR+M S VA  AA+ G   VE  V  WNK 
Sbjct  125  CFPNYSTFLSKPGLYVEDIFVRAPWRRRGLGRMMLSAVAGKAAELGMGRVEWCVLDWNKN  184

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
            + DFY  MG E++ ++R  +LTG AL  Y   +
Sbjct  185  AIDFYEGMGAEVLPQWRICRLTGAALDKYKGNQ  217



>gb|ABK22254.1| unknown [Picea sitchensis]
Length=210

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 114/204 (56%), Gaps = 4/204 (2%)
 Frame = +3

Query  249  YARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLV  428
            +A +RLA + DV HI KL  Q+ E+  L      +E++L   LF     PPF  PT+ L+
Sbjct  10   FACVRLATKEDVPHILKLIQQLAEFERLIDRCIATEEALSSTLFSA---PPFQGPTVFLL  66

Query  429  EVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYS  608
            E+S   FP P   +  FE +VK   LK PV D E  +F S + +    + G+  FF NYS
Sbjct  67   EISNNNFPIPKTLDESFEQMVKNVILKTPVNDPERVSFVSALGNDRT-VVGFVLFFKNYS  125

Query  609  CFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYV  788
             F  KPG + E L+ R  YR+ G+G ++   VA  AA  GF  VE  V  WN  +  FY 
Sbjct  126  TFLAKPGFYIEDLFVREPYRRRGLGAILIRAVAGQAAKMGFGRVEWCVLDWNVNAIKFYE  185

Query  789  DMGVEIMDEFRYGKLTGDALQAYA  860
            DMG +++ E+R  +LTG+AL+A+ 
Sbjct  186  DMGAQVLQEWRICRLTGEALEAFG  209



>ref|XP_008366562.1| PREDICTED: probable acetyltransferase NATA1-like [Malus domestica]
Length=233

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 123/207 (59%), Gaps = 6/207 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            +++R+RLA  +DV HI+KL  Q+  +  LT L+  +E SL   LF     PPF S TIL+
Sbjct  31   LFSRIRLAHPTDVPHIHKLIQQMAVFERLTDLFVATESSLSSTLFTS---PPFQSFTILV  87

Query  426  VEVSATEFPAPTP-DESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPN  602
            +EVS T F      + S + P +K  +L  P+ D E D FRSN  D  A +AG+  FFPN
Sbjct  88   LEVSETPFVEHLQCNNSAYPPTIKTHNLDLPIDDAERDLFRSNGGD--AVVAGFVLFFPN  145

Query  603  YSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDF  782
            YS F  KPG + E L+ R  YR+ G+G+++ S VA  A   G+  VE +V  WN  +  F
Sbjct  146  YSTFLGKPGFYIEDLFVRECYRRKGLGKMLLSAVAKQAVKMGYGRVEWVVLDWNVNAIKF  205

Query  783  YVDMGVEIMDEFRYGKLTGDALQAYAK  863
            Y +MG +I+ E+R  +LTGDAL AY  
Sbjct  206  YEEMGAKILQEWRICRLTGDALNAYVN  232



>ref|XP_010558196.1| PREDICTED: probable acetyltransferase NATA1-like [Tarenaya hassleriana]
Length=231

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 125/221 (57%), Gaps = 8/221 (4%)
 Frame = +3

Query  204  DTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFK  383
            +  +  E   +   +++R+RLA  SDV  I+KL  ++  +  LTHL+  +E  L   LF 
Sbjct  15   EPNMVPETAPLGHPLFSRIRLATPSDVPFIHKLILRMAVFERLTHLFSATESGLASTLFN  74

Query  384  ENPNPPFYSPTILLVEVSATEFP-APTPDESGFEPIVKEFDLKAPVADDESDAFRSNVAD  560
               +PPF S T+ L+EVS + FP  P+ D   F P +K  +   P+ D E   F S+  +
Sbjct  75   ---SPPFQSFTVFLLEVSRSSFPHLPSSD---FTPFLKTHNFDLPMDDPERSGFMSDPGN  128

Query  561  HEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSV  740
             +  +AG+  FFPNYS F  KPG + E ++ R  YR  G GR++ + VA  A   G+  V
Sbjct  129  -DVVVAGFVLFFPNYSSFLAKPGFYIEDIFVRDCYRSKGFGRMLLTAVAKQAVKMGYGRV  187

Query  741  EGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
            E +V  WN  +  FY  MG +I+ E+R  +LTGDAL+AY+K
Sbjct  188  EWVVLDWNVNAIKFYEQMGAQILQEWRVCRLTGDALEAYSK  228



>ref|XP_008233301.1| PREDICTED: probable acetyltransferase NATA1-like [Prunus mume]
Length=239

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 123/211 (58%), Gaps = 6/211 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++AR+RLA  +DV HI+KL +Q+  +  L+     +E SL   LF    +PPF S TI +
Sbjct  31   LFARIRLAHPTDVPHIHKLIHQMAVFERLSDQCIATEASLSSTLFT---SPPFQSFTIFV  87

Query  426  VEVSATEFPAPTP-DESGFEPIVKEFDLKAPVADDESDAFRSN--VADHEAYIAGYAFFF  596
            +EVS   F      + + + P+ K  +L  P+ D + D FRSN  V   +A +AG+  FF
Sbjct  88   LEVSHAPFVEHLQYNNAAYPPVTKVVNLDLPINDPDRDLFRSNGGVLGGDACVAGFVLFF  147

Query  597  PNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSY  776
            PNYS F  KPG + E L+ R  YR+ G+G+++ S VA  A   G+  VE +V  WN  + 
Sbjct  148  PNYSTFLAKPGFYIEDLFVRECYRRKGLGKMLLSAVAKQAVKMGYGRVEWVVLDWNVNAI  207

Query  777  DFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
             FY +MG +I+ E+R  +LTGDAL AY   +
Sbjct  208  RFYEEMGAKILQEWRICRLTGDALNAYVNAQ  238



>ref|XP_011041030.1| PREDICTED: probable acetyltransferase NATA1-like [Populus euphratica]
Length=236

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 125/209 (60%), Gaps = 5/209 (2%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            +   +++R+RLA   DV HI KL +Q+  +  LTHL+  +E  L   LFK   +PPF+S 
Sbjct  28   VGHPLFSRIRLATPLDVPHIQKLIHQMAIFEKLTHLFTATESELASTLFK---SPPFHSF  84

Query  414  TILLVEVSATEFPAPTPDES-GFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAF  590
            TI L+EVS+  F   +   S  F P+ +  +L   + D E++ FR+ + + +A +AG+  
Sbjct  85   TIFLLEVSSRPFEKDSNLHSQNFTPVERIINLDHSLIDPEAETFRNGI-NGDAVVAGFVL  143

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
            FFPNYS F  KPG + E L+ R  YR+ G+G+++ S VA+ A   G+  VE +V  WN  
Sbjct  144  FFPNYSTFLGKPGFYVEDLFVRECYRRKGLGKMLLSAVASQAVKMGYGRVEWVVLDWNVN  203

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            +  FY +MG  ++ E+R  ++TG AL AY
Sbjct  204  AIKFYEEMGANVLPEWRICRITGPALDAY  232



>ref|XP_006294913.1| hypothetical protein CARUB_v10023984mg [Capsella rubella]
 gb|EOA27811.1| hypothetical protein CARUB_v10023984mg [Capsella rubella]
Length=232

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 121/210 (58%), Gaps = 9/210 (4%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            I   +++R+RLA  SDV  I++L +Q+  +  LTHL+  +E  L   LF   P   F S 
Sbjct  25   IGHPMFSRIRLATPSDVPFIHRLIHQMAVFERLTHLFAATESGLTSTLFNSRP---FQSF  81

Query  414  TILLVEVSATEF--PAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYA  587
            T+ L+EVS + F   AP+PD   F P  K  +L  P+ D ES  F  ++ + +  IAG+ 
Sbjct  82   TVFLLEVSRSPFTAAAPSPD---FTPFHKTHNLDLPIEDRESYNFSPDMLN-DVVIAGFV  137

Query  588  FFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNK  767
             FFPNYS F  KPG + E ++ R  YR+ G G ++ + VA  A   G+  VE +V  WN 
Sbjct  138  LFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRVEWVVLDWNV  197

Query  768  KSYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
             +  FY  MG EI+ E+R  +LTGDALQA+
Sbjct  198  NAMKFYEQMGAEILQEWRVCRLTGDALQAF  227



>ref|XP_009368892.1| PREDICTED: probable acetyltransferase NATA1-like [Pyrus x bretschneideri]
Length=233

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 123/207 (59%), Gaps = 6/207 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            +++R+RLA  +DV HI+KL +Q+  +  LT L+  +E SL   LF     PPF S TI +
Sbjct  31   LFSRIRLAHPTDVPHIHKLIHQMAVFEHLTDLFVATESSLSSTLFTS---PPFQSFTIFV  87

Query  426  VEVSATEFPAPTP-DESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPN  602
            +EVS T F      + S + P VK  +L  P+ D E D FRSN  D  A +AG+  FFPN
Sbjct  88   LEVSETPFVEHLQCNNSAYPPTVKTHNLDLPIDDPERDLFRSNGGD--AVVAGFVLFFPN  145

Query  603  YSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDF  782
            YS F  KPG + E L+ R  YR+ G+G+++ S VA  A   G+  VE +V  WN  +  F
Sbjct  146  YSTFLGKPGFYIEDLFVRECYRRKGLGKMLLSAVAKQAVKMGYGRVEWVVLDWNVNAIKF  205

Query  783  YVDMGVEIMDEFRYGKLTGDALQAYAK  863
            Y +MG +++ E+R  +LTGDAL AY  
Sbjct  206  YEEMGAKVLQEWRICRLTGDALNAYVN  232



>ref|XP_010517238.1| PREDICTED: probable acetyltransferase NATA1-like [Camelina sativa]
Length=236

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 125/224 (56%), Gaps = 12/224 (5%)
 Frame = +3

Query  207  TGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKE  386
            T +   K  I   +++R+RLA  SDV  I+KL +Q+  +  LTHL+  +E  L   LF  
Sbjct  17   TNMVPLKSPIGLPVFSRIRLATPSDVPFIHKLIHQMAVFERLTHLFAATESGLTSTLFNS  76

Query  387  NPNPPFYSPTILLVEVS-----ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSN  551
             P   F S T+ L+EVS     AT  P+ +PD   F P +K   L  P+ D ES  F  +
Sbjct  77   RP---FQSFTVFLLEVSRSPFTATASPSSSPD---FTPFLKTHSLDLPIEDPESYNFSPD  130

Query  552  VADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGF  731
            + + +  +AG+  FFPNYS F  KPG + E ++ R  YR+ G G ++ S VA  A   G+
Sbjct  131  MLN-DVVVAGFVLFFPNYSTFLSKPGFYIEDIFVREPYRRKGFGSMLLSAVAKQAVKMGY  189

Query  732  SSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
              VE +V  WN  +  FY  MG EI+ E+R  +LTGDAL+A+ K
Sbjct  190  GRVEWVVLDWNVNAIKFYEQMGAEILQEWRVCRLTGDALEAFDK  233



>gb|KFK36805.1| hypothetical protein AALP_AA4G173600 [Arabis alpina]
Length=234

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 123/208 (59%), Gaps = 8/208 (4%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            S  I++R+RL+  SDV  I+KL +Q+  +  LTHL+  +E +L   LF    +PPF S T
Sbjct  27   SHPIFSRIRLSTPSDVPFIHKLIHQMAVFEQLTHLFSATESNLSSTLFT---SPPFKSFT  83

Query  417  ILLVEVSATEFPAPT-PDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFF  593
            + L+E+S + FPA T PD   F P +K      P+ D ES  F  ++ + +  +AG+  F
Sbjct  84   VFLLEISRSPFPATTSPD---FTPFLKTHYFDLPIQDPESYNFTPDMLN-DVVVAGFVLF  139

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG + E ++ R  YR+ G G ++ S VA  A   G+  VE +V  WN  +
Sbjct  140  FPNYSSFLAKPGFYIEDIFVREPYRRKGFGSMLLSAVAKQAVKMGYGRVEWVVLDWNVNA  199

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAY  857
              FY  MG +I+ E+R  +LTGDAL+A+
Sbjct  200  IKFYEQMGAQILQEWRVCRLTGDALEAF  227



>ref|NP_181435.1| probable acetyltransferase NATA1-like [Arabidopsis thaliana]
 sp|Q9ZV06.1|NATAL_ARATH RecName: Full=Probable acetyltransferase NATA1-like [Arabidopsis 
thaliana]
 gb|AAC79612.1| unknown protein [Arabidopsis thaliana]
 gb|AAO44047.1| At2g39020 [Arabidopsis thaliana]
 gb|AEC09627.1| uncharacterized protein AT2G39020 [Arabidopsis thaliana]
Length=236

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 122/213 (57%), Gaps = 12/213 (6%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            I   +++R+RLA  SDV  I+KL +Q+  +  LTHL+  +E  L   LF   P   F S 
Sbjct  26   IGHPMFSRIRLATPSDVPFIHKLIHQMAVFERLTHLFSATESGLASTLFTSRP---FQSF  82

Query  414  TILLVEVSATEFPA-----PTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIA  578
            T+ L+EVS + FPA     P+PD   F P  K  +L  P+ D ES  F  ++ + +  +A
Sbjct  83   TVFLLEVSRSPFPATITSSPSPD---FTPFFKTHNLDLPIDDPESYNFSPDMLN-DVVVA  138

Query  579  GYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAV  758
            G+  FFPNYS F  KPG + E ++ R  YR+ G G ++ + VA  A   G+  VE +V  
Sbjct  139  GFVLFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRVEWVVLD  198

Query  759  WNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            WN  +  FY  MG +I+ E+R  +LTGDAL+A+
Sbjct  199  WNVNAIKFYEQMGAQILQEWRVCRLTGDALEAF  231



>gb|ABK93391.1| unknown [Populus trichocarpa]
Length=236

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 127/209 (61%), Gaps = 5/209 (2%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            +   +++R+RLA   DV +I KL +Q+  +  LTHL+  +E  L   LFK   +PPF+S 
Sbjct  28   VGHPLFSRIRLATPLDVPNIQKLIHQMAIFEKLTHLFTATESDLASTLFK---SPPFHSF  84

Query  414  TILLVEVSATEFPAPTPDES-GFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAF  590
            TI L+EVS+  F   +   S  F PI +  +L   ++D E++ FR+ + + +A +AG+  
Sbjct  85   TIFLLEVSSRPFEKDSNLHSQNFTPIERIINLDHSLSDPEAETFRNGI-NGDAVVAGFVL  143

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
            FFPNYS F  KPG + E L+ R  YR+ G+G+++ S VA+ A   G+  VE +V  WN  
Sbjct  144  FFPNYSTFLGKPGFYVEDLFVRECYRRKGLGKMLLSAVASQAVKMGYGRVEWVVLDWNVN  203

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            +  FY +MG  ++ E+R  ++TG AL+AY
Sbjct  204  AIKFYEEMGANVLPEWRICRITGPALEAY  232



>ref|XP_003535882.1| PREDICTED: probable acetyltransferase NATA1-like [Glycine max]
Length=228

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 123/209 (59%), Gaps = 7/209 (3%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            +  ++ R+RLA  SDV HI+KL +Q+  +  LTHL+  +E SL   LF     PPF S T
Sbjct  23   TTPLFTRIRLATPSDVPHIHKLIHQMAVFERLTHLFSATESSLSSTLFTS---PPFQSFT  79

Query  417  ILLVEVSATEFPAPTPDESGF-EPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFF  593
            +LL+E S T F   T + + F +PI K  +L  P+ D ESD F++        + G+  F
Sbjct  80   VLLLEASPTPFLNSTLNPNPFYKPITKLLNLSNPINDPESDTFKT---LDGVTVVGFVLF  136

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG + E L+ R  YR+ G GR++ S VA  A    +  VE +V  WN  +
Sbjct  137  FPNYSTFLGKPGFYVEDLFVRECYRRKGFGRMLLSAVAKQAVKMEYGRVEWVVLDWNVNA  196

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
              FY +MG E+++E+R  +LTG+ALQAY 
Sbjct  197  IRFYQEMGAEVLNEWRVCRLTGEALQAYG  225



>ref|XP_004142435.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Cucumis 
sativus]
 ref|XP_004164218.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Cucumis 
sativus]
 gb|KGN52260.1| hypothetical protein Csa_5G622750 [Cucumis sativus]
Length=235

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/211 (38%), Positives = 118/211 (56%), Gaps = 7/211 (3%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            I + ++ R+RLA  SDV HI+KL YQ+  +  LTHL+  +E SL   LF   P   F S 
Sbjct  27   IGNPLFTRIRLAAPSDVPHIHKLIYQMAVFERLTHLFSATEASLSAHLFSSTP---FQSF  83

Query  414  TILLVEVSATEFPAPTPDE--SGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYA  587
            T+ ++EVS   FP  +P      + P+ +  +   PV D E + F+S   D    +AG+ 
Sbjct  84   TVFILEVSTKPFPENSPHNYNPNYTPVARIINSDLPVDDPEREIFKSE--DENVVVAGFV  141

Query  588  FFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNK  767
             FFPN+S F  KPG++ E ++ R  YR+ G G+L+ S VA  A    +  VE +V  WN 
Sbjct  142  LFFPNFSTFLGKPGLYVEDIFVRECYRRKGFGKLLLSAVAKQAVKMNYGRVEWVVLDWNA  201

Query  768  KSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
             +  FY +MG +I+ E+R  +LTG  L+ Y 
Sbjct  202  NAIRFYEEMGAQILPEWRICRLTGKTLEVYG  232



>ref|XP_002315313.2| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
 gb|EEF01484.2| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
Length=236

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 126/209 (60%), Gaps = 5/209 (2%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            +   +++R+RLA   DV +I KL +Q+  +  LTHL+  +E  L   LFK   +PPF S 
Sbjct  28   VGHPLFSRIRLATPLDVPNIQKLIHQMAIFEKLTHLFTATESDLASTLFK---SPPFQSF  84

Query  414  TILLVEVSATEFPAPTPDES-GFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAF  590
            TI L+EVS+  F   +   S  F PI +  +L   ++D E++ FR+ + + +A +AG+  
Sbjct  85   TIFLLEVSSRPFEKDSNLHSQNFTPIERIINLDHSLSDPEAETFRNGI-NGDAVVAGFVL  143

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
            FFPNYS F  KPG + E L+ R  YR+ G+G+++ S VA+ A   G+  VE +V  WN  
Sbjct  144  FFPNYSTFLGKPGFYVEDLFVRECYRRKGLGKMLLSAVASQAVKMGYGRVEWVVLDWNVN  203

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            +  FY +MG  ++ E+R  ++TG AL+AY
Sbjct  204  AIKFYEEMGANVLPEWRICRITGPALEAY  232



>ref|XP_008446870.1| PREDICTED: probable acetyltransferase NATA1-like [Cucumis melo]
Length=235

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 123/218 (56%), Gaps = 7/218 (3%)
 Frame = +3

Query  213  VTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENP  392
            V  +   I   +++R+RLA  SDV HI+KL +Q+  +  LTHL+  +E SL   LF   P
Sbjct  20   VPADSTPIGHPLFSRVRLAALSDVPHIHKLIHQMAVFERLTHLFSATESSLSAYLFSSTP  79

Query  393  NPPFYSPTILLVEVSATEFPAPTPDE--SGFEPIVKEFDLKAPVADDESDAFRSNVADHE  566
               F S T+ ++EVS   FP  +P      + P+V+  +   PV D E + F+S   D  
Sbjct  80   ---FQSFTVFILEVSTKPFPENSPHNYNPNYAPVVRIINSDLPVDDPEWEVFKSE--DEN  134

Query  567  AYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEG  746
              +AG+  FFPN+S F  KPG + E ++ R  YR+ G+G+++ S VA  A    +  VE 
Sbjct  135  VVVAGFVLFFPNFSTFLGKPGFYVEDIFVRECYRRKGLGKVLLSAVAKQAVKMDYGRVEW  194

Query  747  IVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
            +V  WN+ +  FY +MG +I+ E+R  +LTG +L+ Y 
Sbjct  195  VVLDWNENAIRFYKEMGAQILPEWRICRLTGKSLEVYG  232



>ref|XP_004985675.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Setaria 
italica]
Length=227

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/232 (39%), Positives = 126/232 (54%), Gaps = 14/232 (6%)
 Frame = +3

Query  183  MAPPAVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDS  362
            MAPPA   T         S  ++A LRLA   DV HIY L +Q+ E+  LT L+  +E+ 
Sbjct  1    MAPPANSTT--------FSGDVWAELRLADARDVPHIYSLIHQMAEFELLTDLFAATEEL  52

Query  363  LCKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKA-PVADDESDA  539
            L   LF     PPF S T L++++S    P+P   +S         DL A P+AD E+ A
Sbjct  53   LTSTLFPSPAPPPFTSFTALVLDLS----PSPVVPDSSSTIGSLRLDLSASPLADPEAAA  108

Query  540  FRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAA  719
            F S         AG+   FPNYS F  KPG++ E ++ RA +R+ G+GR+M S+VA  AA
Sbjct  109  FASPRGGGR-VTAGFVICFPNYSSFLSKPGLYVEDIFVRAPWRRRGLGRMMLSSVAGRAA  167

Query  720  DKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            + G   VE  V  WNK + DFY  MG +++ ++R  +LTG AL  Y   + +
Sbjct  168  ELGMGRVEWCVLDWNKNAIDFYEGMGADVLPQWRICRLTGAALDKYKGNQEA  219



>gb|ACJ83848.1| unknown [Medicago truncatula]
 gb|AFK47209.1| unknown [Medicago truncatula]
 gb|KEH41364.1| acyl-CoA N-acyltransferase (NAT) family protein [Medicago truncatula]
Length=233

 Score =   157 bits (396),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 117/206 (57%), Gaps = 3/206 (1%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++ R+RLA  SDV +I+KL  Q+  +  LTHL   +E S    LF    N PF S TIL+
Sbjct  27   VFTRIRLATPSDVPYIHKLMQQMAVFERLTHLMTATEASYSSTLFSPE-NKPFLSTTILI  85

Query  426  VEVSATEFPAPTPDESGF-EPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPN  602
            +EVS   F     D   F +PI K   L  P+ D E + F++   + E ++AG+  FFPN
Sbjct  86   LEVSQNPFTDTHFDNDPFYKPITKTVTLDLPIDDPEKENFKTQHGN-EVFVAGFVLFFPN  144

Query  603  YSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDF  782
            YS F  K G + E L+ R  YR+ G G+++ + VA  A   G+  VE +V  WN  +  F
Sbjct  145  YSTFLGKHGFYVEDLFVRECYRRKGFGKMLLTAVAKQAVKMGYGRVEWVVLDWNVNAIKF  204

Query  783  YVDMGVEIMDEFRYGKLTGDALQAYA  860
            Y DMG +I+ E+R  +LTG+ L+AY 
Sbjct  205  YEDMGAKILQEWRLCRLTGENLEAYG  230



>emb|CDO99758.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 124/207 (60%), Gaps = 4/207 (2%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT-IL  422
            ++AR+RL    DV  ++KL +Q+  Y  LT  +  +E SL   LF     PP ++   + 
Sbjct  30   LFARIRLGTIFDVPQLHKLIHQMATYERLTDQFAATEASLASTLFPSPSPPPPFTSFTVF  89

Query  423  LVEVSATEFPAPTP-DESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFP  599
            ++EVS   FP PTP D S F PI+K F L  P+ D E + FRS +   +  +AG+  FFP
Sbjct  90   ILEVSPDPFP-PTPQDPSNFSPILKTFHLDLPIEDSEKEIFRSEIGG-DVVVAGFVLFFP  147

Query  600  NYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYD  779
            NYS F  KPG + E L+ R  YRK G GR++F+ VAA AA  G+  VE +V  WN  +  
Sbjct  148  NYSTFLAKPGFYIEDLFVREPYRKKGFGRMLFTAVAAQAAKMGYGRVEWVVLDWNVNAIQ  207

Query  780  FYVDMGVEIMDEFRYGKLTGDALQAYA  860
            FY  MG +++ ++R  +LTGDAL+A+A
Sbjct  208  FYEQMGAKVLPDWRVCRLTGDALEAFA  234



>ref|XP_006827452.1| hypothetical protein AMTR_s00009p00114360 [Amborella trichopoda]
 gb|ERM94868.1| hypothetical protein AMTR_s00009p00114360 [Amborella trichopoda]
Length=234

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 119/206 (58%), Gaps = 6/206 (3%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +RL    DV H+ KL +Q+  +  LTHL++ +E SL   LF    +PPF   T+ ++E
Sbjct  24   AGIRLGVPEDVPHLLKLIHQMAVFERLTHLFQATEHSLSSTLFS---SPPFQGTTVFILE  80

Query  432  VSATEFPA-PTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYS  608
            +  T+FP  P  D+  F+PI K+     PV D E+  F S+  + +  +AG+  FF NYS
Sbjct  81   I-LTDFPRNPCDDKQSFKPIFKQLIFDPPVEDTEAKTFASS-RNGDGVVAGFVLFFQNYS  138

Query  609  CFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYV  788
             F  K G + E L+ R  YR+ G+GR++  +VA  A   G   VE  V  WN  +  FY 
Sbjct  139  TFMAKSGFYIEDLFVRECYRRRGLGRMLMESVAGQAVKMGLGRVEWCVLDWNVNAIKFYE  198

Query  789  DMGVEIMDEFRYGKLTGDALQAYAKK  866
            +MG E+M ++R  +L+G++L+AY +K
Sbjct  199  EMGAEVMQQWRICRLSGESLEAYKEK  224



>ref|XP_010670040.1| PREDICTED: probable acetyltransferase NATA1-like [Beta vulgaris 
subsp. vulgaris]
Length=234

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 117/209 (56%), Gaps = 7/209 (3%)
 Frame = +3

Query  240  DKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTI  419
            + +Y R+RLA +SDV  I+KL +Q+  +  LTHL++ +E SL   LF    +PPF S T+
Sbjct  29   NTLYTRIRLATKSDVPFIHKLIHQMAVFEKLTHLFEATESSLSSTLFN---SPPFQSFTV  85

Query  420  LLVEVSATEFPAPTPDE-SGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFF  596
             L+E S+T      P   S F+PI K F L  P+ D E   F        + IAG+  FF
Sbjct  86   FLLEASSTPLSLHHPPTISLFQPIHKTFHLSQPMDDPEFARF---CTSEGSTIAGFVLFF  142

Query  597  PNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSY  776
            PNYS F  KPG + E ++ R  YR+ G+G L+   VA  A   G+  VE  V  WN  + 
Sbjct  143  PNYSSFLAKPGFYVEDVFVRECYRRKGLGGLLMKAVANQAVKLGYGRVEWCVLDWNMNAI  202

Query  777  DFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
             FY  +G ++M E+R  +LTGD+L  Y +
Sbjct  203  RFYEKIGADVMQEWRICRLTGDSLLTYGQ  231



>ref|XP_008446871.1| PREDICTED: probable acetyltransferase NATA1-like isoform X1 [Cucumis 
melo]
Length=240

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 122/208 (59%), Gaps = 7/208 (3%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            I+  +++R+RLA  SD+ HI+KL ++I  Y  LTHL+  +E SL   LF    +PPF S 
Sbjct  22   IAHPLFSRIRLAGPSDIPHIHKLIHEIAVYERLTHLFSATESSLSAHLFS---SPPFQSF  78

Query  414  TILLVEVSATEFPAPTPDESG--FEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYA  587
            T+ ++EVS   FP  +P  S   + P+V+  D + PV D E + ++S   D    +AG+ 
Sbjct  79   TMFILEVSHEPFPENSPHNSNSHYSPVVRIVDSEVPVDDPERELYKSE--DENVVVAGFV  136

Query  588  FFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNK  767
             FFP +S    KPG F E++  R  YR+ G+G+++ S V   A +  +  VE +V   N 
Sbjct  137  LFFPKFSALLGKPGFFVEAIVVRKCYRRKGLGKMLLSAVVNQAVEMDYCQVELVVLERNV  196

Query  768  KSYDFYVDMGVEIMDEFRYGKLTGDALQ  851
            ++  FY +MG +I+ E+R   LTGD+L+
Sbjct  197  RAIKFYEEMGAQILGEWRVCDLTGDSLR  224



>ref|XP_004514602.1| PREDICTED: diamine acetyltransferase 1-like [Cicer arietinum]
Length=233

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 116/206 (56%), Gaps = 3/206 (1%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++ R+RL   SDV +I+KL YQ+  +  LTH +  +E S    LF    N PF S TI +
Sbjct  27   VFTRIRLGTPSDVPYIHKLMYQMAVFERLTHQFSATESSYSSTLFTPT-NQPFQSITIFI  85

Query  426  VEVSATEFPAPTPDESGF-EPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPN  602
            +EVS   F     D + F +P  K  +L  P+ D E + FR+   + E ++AG+  FFPN
Sbjct  86   LEVSPNPFTDTHFDNNPFYKPSTKVVNLDLPIDDPEKELFRTQHGN-EVFVAGFVLFFPN  144

Query  603  YSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDF  782
            YS F  K G + E L+ R  YR+ G GR++ + VA  A   G+  VE  V  WN  + +F
Sbjct  145  YSTFLGKHGFYVEDLFVRECYRRKGFGRMLLTAVAKQAVKMGYGRVEWTVLDWNLNAINF  204

Query  783  YVDMGVEIMDEFRYGKLTGDALQAYA  860
            Y DMG  ++ ++R  +LTGD L++Y 
Sbjct  205  YEDMGANVLQDWRLCRLTGDNLESYG  230



>gb|KDO46232.1| hypothetical protein CISIN_1g026503mg [Citrus sinensis]
Length=237

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 121/210 (58%), Gaps = 9/210 (4%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            +++R+RLA  +DV HI+KL +Q+  +  LTHL+  +E SL   LF    +PPF S T+LL
Sbjct  30   LFSRIRLATPADVPHIHKLIHQMAVFEKLTHLFSATESSLAATLFN---SPPFTSFTVLL  86

Query  426  VEVSATEFPAPTPDESGFEPIVKEFD----LKAPVADDESDAFRSNVADHEAYIAGYAFF  593
            +EVS + F AP    +         D    L  P+ D + + F S+   H+  +AG+  F
Sbjct  87   LEVSPSPF-APLHSPASSPSPYSPVDRIVYLDLPLDDPDRETFASD-ETHDVTVAGFVLF  144

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG + E ++ R  YR+ G GR++ S VA  A   G+  VE IV  WN  +
Sbjct  145  FPNYSTFLAKPGFYIEDIFVRECYRRKGFGRILLSAVAKQAVKMGYGRVEWIVLDWNVNA  204

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
              FY +MG +++ E+R  +LTGDAL AY  
Sbjct  205  IKFYEEMGAKVLSEWRICRLTGDALDAYGN  234



>ref|XP_006285254.1| hypothetical protein CARUB_v10006619mg [Capsella rubella]
 gb|EOA18152.1| hypothetical protein CARUB_v10006619mg [Capsella rubella]
Length=222

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 120/213 (56%), Gaps = 11/213 (5%)
 Frame = +3

Query  222  EKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPP  401
            E   + D I++R+RLA  SDV  I+KL Y++  +   THL+  +E  L   LF    +PP
Sbjct  15   ETSAVGDPIFSRVRLATSSDVPFIHKLIYEMAVFEGQTHLFSATESGLTSTLFN---SPP  71

Query  402  FYSPTILLVEVSATEFPAP-TPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIA  578
            F S T+ L+E+S + FP+  +PD   F P VK  +L  P+ D E D F  ++++ +  +A
Sbjct  72   FQSVTVFLLEISPSPFPSTVSPD---FTPFVKTHNLDLPIEDPERDNFTPDISN-DVVVA  127

Query  579  GYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAV  758
            G+  FFPNY  F    G++ E +Y R  YR  G G ++ S VA  A   G+  +E +   
Sbjct  128  GFVLFFPNYLGFLSTHGLYIEDIYVREPYRGKGFGSMLLSAVAKQAVKMGYGRIEWVA--  185

Query  759  WNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
             N  +  FY  MGV I+ + R  +LTGDALQAY
Sbjct  186  -NVNALKFYEQMGVRILQKLRVCRLTGDALQAY  217



>ref|XP_010934574.1| PREDICTED: probable acetyltransferase NATA1-like [Elaeis guineensis]
Length=233

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 123/211 (58%), Gaps = 7/211 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++AR+RLA   DV HI++L +Q+ E+  LTHL+  +E SL   LF     PPF S T+L+
Sbjct  17   VWARIRLADSRDVPHIHRLIHQMAEFEKLTHLFSTTESSLSSTLFPSPQPPPFLSFTVLI  76

Query  426  VEVSATEFPAP------TPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYA  587
            +E+S   F         T + S F PIV+  +LK+P+ D E+  F S        +  + 
Sbjct  77   LELSPNPFSQSDEEHKDTANPSLFRPIVRRVELKSPLEDPEAVEFASPRGGGAVVVG-FV  135

Query  588  FFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNK  767
              FPNYS F  KPG++ E ++ RA++R+ G GR++ S VAA AA  G   VE  V  WN 
Sbjct  136  LCFPNYSTFLAKPGLYVEDIFVRAAWRRRGFGRMLLSAVAAQAAKMGMGRVEWCVLDWNV  195

Query  768  KSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
             +  FY +MG E++ ++R  +LTG+ALQ Y 
Sbjct  196  NAISFYEEMGAEVLPQWRICRLTGEALQRYG  226



>ref|XP_010505566.1| PREDICTED: probable acetyltransferase NATA1-like [Camelina sativa]
Length=238

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 121/223 (54%), Gaps = 8/223 (4%)
 Frame = +3

Query  207  TGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKE  386
            T +   K  I   +++R+RLA  SDV  I+KL +Q+  +  LTHL+  +E  L   LF  
Sbjct  17   TNMVPLKSPIGHPVFSRIRLATPSDVPFIHKLIHQMAVFERLTHLFAATESGLASTLFNS  76

Query  387  NPNPPFYSPTILLVEVSATEFPAPTPDES----GFEPIVKEFDLKAPVADDESDAFRSNV  554
             P   F S T+ L+EVS + F A           F P +K   L  P+ D ES  F  ++
Sbjct  77   RP---FQSFTVFLLEVSRSPFTATAAASPSSSPDFTPFLKTHSLDLPIEDPESYNFSPDM  133

Query  555  ADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFS  734
             + +  +AG+  FFPNYS F  KPG + E ++ R  YR+ G G ++ S VA  A   G+ 
Sbjct  134  LN-DVVVAGFVLFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLSAVAKQAVKMGYG  192

Query  735  SVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
             VE +V  WN  +  FY  MG EI+ E+R  +LTGDAL+A+ K
Sbjct  193  RVEWVVLDWNVNAIKFYEQMGAEILQEWRVCRLTGDALEAFDK  235



>ref|XP_006436451.1| hypothetical protein CICLE_v10032618mg [Citrus clementina]
 ref|XP_006485644.1| PREDICTED: probable acetyltransferase NATA1-like [Citrus sinensis]
 gb|ESR49691.1| hypothetical protein CICLE_v10032618mg [Citrus clementina]
Length=237

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 121/210 (58%), Gaps = 9/210 (4%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            +++R+RLA  +DV HI+KL +Q+  +  LTHL+  +E SL   LF    +PPF S T+LL
Sbjct  30   LFSRIRLATPADVPHIHKLIHQMAVFEKLTHLFSATESSLAATLFN---SPPFTSFTVLL  86

Query  426  VEVSATEFPAPTPDESGFEPIVKEFD----LKAPVADDESDAFRSNVADHEAYIAGYAFF  593
            +EVS + F AP    +         D    L  P+ D + + F S+   H+  +AG+  F
Sbjct  87   LEVSPSPF-APLHSPASSPSPYSPVDRIVYLDLPLDDPDRETFASD-ETHDVTVAGFVLF  144

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG + E ++ R  YR+ G GR++ S VA  A   G+  VE IV  WN  +
Sbjct  145  FPNYSTFLAKPGFYIEDIFVRECYRRKGFGRMLLSAVAKQAVKMGYGRVEWIVLDWNVNA  204

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
              FY +MG +++ E+R  +LTGDAL AY  
Sbjct  205  IKFYEEMGAKVLSEWRICRLTGDALGAYGN  234



>ref|XP_002311082.1| hypothetical protein POPTR_0008s03740g [Populus trichocarpa]
 gb|EEE88449.1| hypothetical protein POPTR_0008s03740g [Populus trichocarpa]
Length=236

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 118/209 (56%), Gaps = 8/209 (4%)
 Frame = +3

Query  243  KIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTIL  422
            ++Y R+RLA  +DV HI+KL YQ+  + + THL+  +E SL   LF    +PPF S T+ 
Sbjct  29   QLYTRIRLATPADVPHIHKLIYQMAVFQNETHLFTATESSLASTLFN---SPPFQSFTVF  85

Query  423  LVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVA---DHEAYIAGYAFF  593
            ++EVS+   P        F PI +   +    AD E++ F+S VA   D +  +AG+  F
Sbjct  86   ILEVSSN--PFKNIHSPAFLPIERTVLVDHVAADPEAETFKSGVANEDDDDVTVAGFVLF  143

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
             P+Y+ F  KPG   E L  R  YR+ G G+++ S VA  A   GF  VE  V  WN  +
Sbjct  144  VPSYTTFAGKPGFHVEDLLVRECYRRKGFGKVLLSAVAEQAVKMGFKRVEWSVLEWNVNA  203

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
              FY +MG ++  E+R  +LTGDAL+AY 
Sbjct  204  IKFYEEMGAKVSTEWRVCRLTGDALEAYG  232



>ref|XP_008446872.1| PREDICTED: probable acetyltransferase NATA1-like isoform X2 [Cucumis 
melo]
Length=227

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 120/205 (59%), Gaps = 7/205 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            +++R+RLA  SD+ HI+KL ++I  Y  LTHL+  +E SL   LF    +PPF S T+ +
Sbjct  13   LFSRIRLAGPSDIPHIHKLIHEIAVYERLTHLFSATESSLSAHLFS---SPPFQSFTMFI  69

Query  426  VEVSATEFPAPTPDESG--FEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFP  599
            +EVS   FP  +P  S   + P+V+  D + PV D E + ++S   D    +AG+  FFP
Sbjct  70   LEVSHEPFPENSPHNSNSHYSPVVRIVDSEVPVDDPERELYKSE--DENVVVAGFVLFFP  127

Query  600  NYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYD  779
             +S    KPG F E++  R  YR+ G+G+++ S V   A +  +  VE +V   N ++  
Sbjct  128  KFSALLGKPGFFVEAIVVRKCYRRKGLGKMLLSAVVNQAVEMDYCQVELVVLERNVRAIK  187

Query  780  FYVDMGVEIMDEFRYGKLTGDALQA  854
            FY +MG +I+ E+R   LTGD+L+ 
Sbjct  188  FYEEMGAQILGEWRVCDLTGDSLRV  212



>ref|XP_011084320.1| PREDICTED: probable acetyltransferase NATA1-like [Sesamum indicum]
Length=239

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 122/210 (58%), Gaps = 7/210 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++ R+RLA   DV HI+KL +Q+  +  LT L+  +   L   LF  NP PPF S T+ L
Sbjct  28   LFTRIRLATAEDVPHIHKLIHQMAVFERLTDLFHATPADLSATLFPPNPPPPFTSFTVFL  87

Query  426  VEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRS-----NVADHEAYIAGYAF  590
            +E+S+  F A       F P++    L  P+ D E ++FRS     N+  ++  + G+  
Sbjct  88   LELSSIPFLATA--NPHFPPLLNSVLLDLPIDDPERESFRSRANDVNIIGNDVIVGGFVL  145

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
            FFPNYS F  KPG + E ++ R  YR+ G+G+++ + VAA AA  G+  VE +V  WN  
Sbjct  146  FFPNYSTFLAKPGFYIEDIFVRECYRRKGLGKMLLTAVAAQAAKMGYGRVEWVVLDWNVN  205

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
            +  FY  MG +I+ E+R  +L+G+ LQAYA
Sbjct  206  AITFYEQMGAQILPEWRICRLSGEVLQAYA  235



>ref|XP_006294945.1| hypothetical protein CARUB_v10023999mg [Capsella rubella]
 gb|EOA27843.1| hypothetical protein CARUB_v10023999mg [Capsella rubella]
Length=227

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/219 (38%), Positives = 122/219 (56%), Gaps = 11/219 (5%)
 Frame = +3

Query  210  GVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKEN  389
             +  +   I   +++R+RLA  SDV  I+KL +Q+  +  LT+ +  +E  L   LF   
Sbjct  12   NIVAQTSPIGHPMFSRIRLATASDVPFIHKLIHQMAVFEDLTNFFFATESGLTSTLFN--  69

Query  390  PNPPFYSPTILLVEVSATEFP----APTPDESGFEPIVKEFDLKAPVADDESDAFRSNVA  557
             +PPF S T+ L+EVS + FP    A +PD   F P +K   L  P+ D +S  F  +++
Sbjct  70   -SPPFKSVTVFLLEVSPSPFPTTFAASSPD---FTPFLKTHSLDLPIEDPDSYNFSPDLS  125

Query  558  DHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSS  737
            + +  +AG+  FFPNYS +  K G   E L  R  YR+ G GR++ + VA  A   G+  
Sbjct  126  N-DVVVAGFVMFFPNYSSYLSKHGFCIEDLLVREPYRRRGFGRMLLTAVAKQAVKMGYGK  184

Query  738  VEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQA  854
            VE +V  WN  +  FY  MG EI+ E R+ +LTGDALQA
Sbjct  185  VEWVVLDWNVNAIKFYEQMGAEILQECRFCRLTGDALQA  223



>ref|XP_004142434.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Cucumis 
sativus]
 ref|XP_004164217.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Cucumis 
sativus]
Length=226

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 119/208 (57%), Gaps = 7/208 (3%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            I   +++R+RLA  SD+ HI+KL Y+I  Y   THL+  +E SL   LF     PPF S 
Sbjct  10   IGHPLFSRIRLAGPSDIPHIHKLIYEIAVYERHTHLFSATESSLSAHLFS---YPPFQSF  66

Query  414  TILLVEVSATEFPAPTPDESG--FEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYA  587
            TI ++EVS   FP  +P  S   + P+V+    + PV D E + F+S   D    +AG+ 
Sbjct  67   TIFILEVSHEPFPENSPHNSNANYSPVVRIVYSEVPVDDPEREIFKSE--DENVVVAGFV  124

Query  588  FFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNK  767
             FFPN+S    KPG F ES+  R  YR+ G+G+++ S V   A +  +  VE +V   N+
Sbjct  125  LFFPNFSALLGKPGFFVESVAVRKCYRRKGLGKMLLSAVVNQAVEMDYGQVELVVLEGNE  184

Query  768  KSYDFYVDMGVEIMDEFRYGKLTGDALQ  851
             +  FY +MG +I+ E+R   LTGD+L+
Sbjct  185  TAIKFYEEMGAQILTEWRVCDLTGDSLR  212



>ref|XP_008784795.1| PREDICTED: probable acetyltransferase NATA1-like [Phoenix dactylifera]
 ref|XP_008784803.1| PREDICTED: probable acetyltransferase NATA1-like [Phoenix dactylifera]
Length=235

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 124/211 (59%), Gaps = 7/211 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++AR+RLA   DV HI++L  Q+ E+  LTHL+  +E SL   LF   P PPF+S T+L+
Sbjct  19   VWARIRLADSWDVPHIHRLIRQMAEFEKLTHLFSATESSLSSTLFPSPPPPPFHSFTVLI  78

Query  426  VEVSATEF------PAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYA  587
            +E+S   F      P    + S F PIV+  +LK+PV D E+  F S        +  + 
Sbjct  79   LELSTNPFSQGDEEPKDAANPSLFRPIVRRVELKSPVEDPEAAEFASPRGGGAVVVG-FV  137

Query  588  FFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNK  767
              FPNYS F  KPG++ E ++ RA++R+ G GR++ S VAA AA  G   VE  V  WN 
Sbjct  138  LCFPNYSTFLAKPGLYVEDIFVRAAWRRRGFGRILLSAVAAQAAKMGMGRVEWCVLDWNA  197

Query  768  KSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
             +  FY +MG E++ ++R  +LTG+ALQ Y 
Sbjct  198  NAISFYEEMGAEVLPQWRICRLTGEALQGYG  228



>ref|XP_011016733.1| PREDICTED: probable acetyltransferase NATA1-like [Populus euphratica]
Length=232

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/219 (38%), Positives = 121/219 (55%), Gaps = 9/219 (4%)
 Frame = +3

Query  216  TTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPN  395
            T+  L    ++Y+R+RLA  +DV HI+KL YQ+  + + THL+  +E SL   LF    +
Sbjct  15   TSTTLVGQHQLYSRIRLATPADVPHIHKLIYQMAVFQNETHLFTATESSLASTLFN---S  71

Query  396  PPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVA----DH  563
            PPF S T+ ++EVS+   P        F PI +   +    AD E++ F+S VA    D 
Sbjct  72   PPFQSFTVFILEVSSK--PFKNIHSPAFLPIERTVLVDHVAADPEAETFKSVVANEDGDD  129

Query  564  EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVE  743
               +AG+  F P+Y+ F  KPG   E L  R  YR+   G+++ S VA  A   GF  VE
Sbjct  130  NVTVAGFVLFVPSYTTFAGKPGFHVEDLLVRECYRRKSFGKMLLSAVAEQAVKMGFKRVE  189

Query  744  GIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
              V  WN  +  FY +MG +++ E+R  +LTGDAL+AY 
Sbjct  190  WSVLEWNVNAIKFYEEMGAKVLTEWRVCRLTGDALEAYG  228



>gb|KGN52261.1| hypothetical protein Csa_5G622760 [Cucumis sativus]
Length=262

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 119/208 (57%), Gaps = 7/208 (3%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            I   +++R+RLA  SD+ HI+KL Y+I  Y   THL+  +E SL   LF     PPF S 
Sbjct  46   IGHPLFSRIRLAGPSDIPHIHKLIYEIAVYERHTHLFSATESSLSAHLFS---YPPFQSF  102

Query  414  TILLVEVSATEFPAPTPDESG--FEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYA  587
            TI ++EVS   FP  +P  S   + P+V+    + PV D E + F+S   D    +AG+ 
Sbjct  103  TIFILEVSHEPFPENSPHNSNANYSPVVRIVYSEVPVDDPEREIFKSE--DENVVVAGFV  160

Query  588  FFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNK  767
             FFPN+S    KPG F ES+  R  YR+ G+G+++ S V   A +  +  VE +V   N+
Sbjct  161  LFFPNFSALLGKPGFFVESVAVRKCYRRKGLGKMLLSAVVNQAVEMDYGQVELVVLEGNE  220

Query  768  KSYDFYVDMGVEIMDEFRYGKLTGDALQ  851
             +  FY +MG +I+ E+R   LTGD+L+
Sbjct  221  TAIKFYEEMGAQILTEWRVCDLTGDSLR  248



>ref|XP_006836668.1| hypothetical protein AMTR_s00088p00059900 [Amborella trichopoda]
 gb|ERM99521.1| hypothetical protein AMTR_s00088p00059900 [Amborella trichopoda]
Length=234

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 124/221 (56%), Gaps = 11/221 (5%)
 Frame = +3

Query  207  TGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKE  386
            TG  TEK R+     AR+RLA   DV H+ KL +Q+  +  + HL++ +E SL   LF  
Sbjct  14   TGEPTEKSRV-----ARIRLAVPEDVPHLLKLIHQMAVFEHMPHLFQATEHSLSSTLFS-  67

Query  387  NPNPPFYSPTILLVEVSATEFPA-PTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADH  563
              +PPF   T+ ++E+  ++FP  P      F+PI K+     PV D E+  F S+  + 
Sbjct  68   --SPPFQGTTVFILEI-FSDFPQNPCDKNQFFKPIFKKLVFDPPVEDVEAKTFASS-QNG  123

Query  564  EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVE  743
            +  +AG+  F  NYS F  KPG + E L+ R  YR+ G+GR++  +VA  A   GF  ++
Sbjct  124  DGVVAGFVLFVQNYSTFLAKPGFYMEDLFVRECYRRRGLGRMLMESVAGQAVKMGFGIMQ  183

Query  744  GIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKK  866
              V  WN  +  FY +MG E+M ++   +L+G+AL+AY  K
Sbjct  184  WCVLDWNVNAIKFYEEMGAEVMQQWSLCRLSGEALEAYRGK  224



>ref|NP_565898.1| L-ornithine N5-acetyltransferase NATA1 [Arabidopsis thaliana]
 sp|Q9ZV05.1|NATA1_ARATH RecName: Full=L-ornithine N5-acetyltransferase NATA1; AltName: 
Full=Protein N-ACETYLTRANSFERASE ACTIVITY 1 [Arabidopsis thaliana]
 gb|AAC79613.1| expressed protein [Arabidopsis thaliana]
 gb|AEC09628.1| ornithine N-delta-acetyltransferase [Arabidopsis thaliana]
Length=228

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/232 (35%), Positives = 125/232 (54%), Gaps = 12/232 (5%)
 Frame = +3

Query  183  MAPP-AVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSED  359
            MAPP A  +     E      ++++R+RLA  +DV  I+KL +Q+  +  LTHL+  +E 
Sbjct  1    MAPPTAAPEPNTVPETSPTGHRMFSRIRLATPTDVPFIHKLIHQMAVFERLTHLFVATES  60

Query  360  SLCKMLFKENPNPPFYSPTILLVEVSATEFP----APTPDESGFEPIVKEFDLKAPVADD  527
             L   LF   P   F + T+ L+E+S + FP    A +PD   F P ++   +  P+ D 
Sbjct  61   GLASTLFNSRP---FQAVTVFLLEISPSPFPTTHDASSPD---FTPFLETHKVDLPIEDP  114

Query  528  ESDAFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVA  707
            + + F  +  + +  +AG+  FFPNY  F  K G + E ++ R  YR+ G G+L+ + VA
Sbjct  115  DREKFLPDKLN-DVVVAGFVLFFPNYPSFLAKQGFYIEDIFMREPYRRKGFGKLLLTAVA  173

Query  708  ANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
              A   G   VE IV  WN  + +FY  MG ++  E+R  +LTGDALQA  K
Sbjct  174  KQAVKLGVGRVEWIVIDWNVNAINFYEQMGAQVFKEWRLCRLTGDALQAIDK  225



>gb|EPS72761.1| hypothetical protein M569_01998, partial [Genlisea aurea]
Length=205

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 120/207 (58%), Gaps = 5/207 (2%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            +  +  R+RLA   DV H++KL +Q+  +  LT  +  +E SL   LF  NP PPF S +
Sbjct  4    NQTLLTRIRLATVDDVPHLHKLIHQMAIFERLTSQFHATEASLSATLFPPNPPPPFTSVS  63

Query  417  ILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFF  596
            +L++EVS+  FP PT     F PI +   +  P+ D + ++FRS     +  + G+  FF
Sbjct  64   VLVLEVSSVPFP-PTTCPQIFTPIERSLHVDLPIEDPDRESFRSE----DGTVCGFVLFF  118

Query  597  PNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSY  776
            PNY+ F  K G + E L+ R  YR+ G+G+++   VA  AA+ G   VE +V  WN  + 
Sbjct  119  PNYASFLAKAGFYIEDLFVRDCYRRKGLGKMLLCAVARQAAEMGHGRVEWVVLDWNADAI  178

Query  777  DFYVDMGVEIMDEFRYGKLTGDALQAY  857
             FY  MG +++ E+R  +L+GDALQAY
Sbjct  179  AFYRRMGAKLLPEWRRCRLSGDALQAY  205



>ref|XP_002879781.1| hypothetical protein ARALYDRAFT_482922 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56040.1| hypothetical protein ARALYDRAFT_482922 [Arabidopsis lyrata subsp. 
lyrata]
Length=227

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 119/228 (52%), Gaps = 5/228 (2%)
 Frame = +3

Query  183  MAPP-AVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSED  359
            MAPP A  +     E       +++R+RLA  +DV  I+KL +Q+  +  LTHL+  +E 
Sbjct  1    MAPPTAAPEPNTVPETSPTGHPMFSRIRLATPTDVPFIHKLIHQMAVFERLTHLFVATES  60

Query  360  SLCKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDA  539
             L   LF   P   F + T+ L+E+S + F         F P ++   +  P+ D + D 
Sbjct  61   GLASTLFNSRP---FQAVTVFLLEISPSPFSTNDVSSPEFTPFLETHKVDLPIEDPDKDK  117

Query  540  FRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAA  719
            F  +  + +  +AG+  FFPNY  F  K G + E ++ R  YR+ G G+L+ + VA  A 
Sbjct  118  FLPDKLN-DVVVAGFVLFFPNYPSFLAKQGFYIEDIFVREPYRRKGFGKLLLTAVAKQAV  176

Query  720  DKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
              G   VE IV  WN  + +FY  MG ++  E+R  +LTGDALQA  K
Sbjct  177  KLGVGRVEWIVIDWNVNAINFYEQMGAQVFKEWRLCRLTGDALQAIDK  224



>ref|XP_003558797.1| PREDICTED: probable acetyltransferase NATA1-like [Brachypodium 
distachyon]
Length=221

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 114/208 (55%), Gaps = 7/208 (3%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            S  ++A LRLA   DV HI+ L +Q+ E+  LT L+  + + L   LF      PF S T
Sbjct  8    SGDVWAELRLADARDVPHIHSLIHQMAEFELLTDLFAATHELLTSTLFPSPQPAPFTSFT  67

Query  417  ILLVEVSATEFPAPTPDESGFEPIVKEFDLKA-PVADDESDAFRSNVADHEAYIAGYAFF  593
             L++++S +  PA     S      +  DL A P+AD E+ AF S         +G+   
Sbjct  68   ALILDLSPSPIPA-----SADTIASRRLDLSASPLADPEAAAFASPRGGGR-VTSGFVIC  121

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG++ E ++ RA +R+ G+GR+M S VA  AA+ G   VE  V  WNK +
Sbjct  122  FPNYSTFLAKPGLYVEDIFVRAPWRRRGLGRMMLSAVAGRAAEIGMGRVEWCVLDWNKNA  181

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAY  857
             DFY  MG E+  ++R  +LTG AL  Y
Sbjct  182  IDFYEGMGAEVFQQWRICRLTGAALDKY  209



>gb|AFK46864.1| unknown [Lotus japonicus]
Length=234

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 122/229 (53%), Gaps = 6/229 (3%)
 Frame = +3

Query  186  APPAVIDTGVTT--EKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSED  359
            APP+      TT  E       ++ R+RLA  SDV HI K+ YQ+  +   THL+  +E 
Sbjct  5    APPSPTTPAATTLPETATPCHPMFTRIRLATPSDVPHILKMTYQLAVFEHFTHLFVGTES  64

Query  360  SLCKMLFKENPNPPFYSPTILLVEVSATEFPAPT--PDESGFEPIVKEFDLKAPVADDES  533
            SL   LF  N  P F+S T+ ++E S   F   T   ++  ++P +K  +L   + D E 
Sbjct  65   SLSSALFSPNVQP-FHSSTVFILEASQNPFTDDTHFDNDPFYKPTMKVVNLDLIIDDPEK  123

Query  534  DAFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAAN  713
            + FR N   ++ +I  +  FFPNYS F  K G + E L+ R  YR+ G G+++ S VA  
Sbjct  124  ETFR-NQHGNDIFIVRFVLFFPNYSTFMAKAGFYVEDLFVRECYRRKGFGKMLLSAVAKQ  182

Query  714  AADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
            A   G+  VE IV  WN  +  FY  MG +I+ E+R  +L GD LQA+ 
Sbjct  183  AVKMGYGRVEWIVLDWNVNAIKFYEGMGAKILQEWRLCRLIGDDLQAHG  231



>ref|XP_002530925.1| Tyramine N-feruloyltransferase 4/11, putative [Ricinus communis]
 gb|EEF31440.1| Tyramine N-feruloyltransferase 4/11, putative [Ricinus communis]
Length=222

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 117/208 (56%), Gaps = 6/208 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            +Y R+RLA   DV HI+KL Y++ +Y+ L   ++ +E SL   LFK   +PPF S T  L
Sbjct  13   LYTRVRLATPEDVPHIHKLIYKMADYYHLADTFEATESSLSAHLFK---SPPFQSFTTFL  69

Query  426  VEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNY  605
             EVS    P P  +   F P+ +   +  PV D +++ F+S  +  +A + G+   FPN+
Sbjct  70   AEVSTK--PLPRIESPHFTPVERVVQIDRPVIDPDAETFKST-SGGDAVVVGFTLIFPNF  126

Query  606  SCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFY  785
            S F  KPG   E L+ R  +R  GMG+L+ S VA+     G+  VE  V  WN +S+ FY
Sbjct  127  STFMGKPGFHLEDLFIREGHRGFGMGKLLLSAVASQTVKMGYGRVEWTVIDWNVRSHKFY  186

Query  786  VDMGVEIMDEFRYGKLTGDALQAYAKKK  869
              +G +++ ++R  +L+ + L+AY   K
Sbjct  187  ERLGAKVLPDWRICRLSEENLEAYGDAK  214



>ref|XP_006411125.1| hypothetical protein EUTSA_v10017189mg [Eutrema salsugineum]
 gb|ESQ52578.1| hypothetical protein EUTSA_v10017189mg [Eutrema salsugineum]
Length=232

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/220 (37%), Positives = 121/220 (55%), Gaps = 5/220 (2%)
 Frame = +3

Query  204  DTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFK  383
            +  +  E   I   +++R+RLA  SDV  I+KL +Q+  +  LTHL+  +E  L   LF 
Sbjct  15   EPNMVPESSPIGHPVFSRIRLATPSDVPFIHKLIHQMAVFERLTHLFSATESGLSSTLFT  74

Query  384  ENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADH  563
              P   F S T+ L+E+S + FP  +     F P +K  +L  P+ D ES  F  ++   
Sbjct  75   SRP---FQSFTVFLLEISRSPFPTSS-SSPDFTPFLKTHNLDLPIDDPESYNFTPDMLK-  129

Query  564  EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVE  743
            +  +AG+  FFPNYS F  KPG + E ++ R  YR+ G G ++ + VA  A   G+  VE
Sbjct  130  DVVVAGFVLFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRVE  189

Query  744  GIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
             +V  WN  +  FY  MG +I+ E+R  +L GDALQA+ K
Sbjct  190  WVVLDWNSNAIKFYEQMGAQILQEWRVCRLAGDALQAFDK  229



>dbj|BAJ86466.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00544.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=227

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 117/214 (55%), Gaps = 7/214 (3%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            S +++A LRLA   DV HI+ L +Q+ E+  LT L+  + + L   LF      PF S T
Sbjct  8    SGEVWAELRLADARDVPHIHSLIHQMAEFELLTDLFAATHELLASTLFPTPQPAPFASFT  67

Query  417  ILLVEVSATEFPAPTPDESGFEPIVKEFDLKA-PVADDESDAFRSNVADHEAYIAGYAFF  593
             L+++ S +  P+ + D  G     +  DL A P+AD E+ AF S         AG+   
Sbjct  68   ALILDFSPSPVPS-SADTVG----SRRLDLSASPLADPEAAAFPSPRGGGR-VTAGFVIC  121

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG++ E ++ RA +R+ G+GR+M S VA  AA+ G   VE  V  WN+ +
Sbjct  122  FPNYSTFLAKPGLYVEDIFVRAPWRRRGLGRMMLSAVAGRAAEIGMGRVEWCVLDWNQNA  181

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKSS  875
             DFY  MG E+  ++R  +LTG AL  Y     S
Sbjct  182  IDFYEGMGAEVFKQWRICRLTGAALDKYKGAGGS  215



>gb|AAK96852.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL66882.1| unknown protein [Arabidopsis thaliana]
Length=206

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 117/210 (56%), Gaps = 11/210 (5%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            +++R+RLA  +DV  I+KL +Q+  +  LTHL+  +E  L   LF   P   F + T+ L
Sbjct  1    MFSRIRLATPTDVPFIHKLIHQMAVFERLTHLFVATESGLASTLFNSRP---FQAVTVFL  57

Query  426  VEVSATEFP----APTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFF  593
            +E+S + FP    A +PD   F P ++   +  P+ D + + F  +  + +  +AG+  F
Sbjct  58   LEISPSPFPTTHDASSPD---FTPFLETHKVDLPIEDPDREKFLPDKLN-DVVVAGFVLF  113

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNY  F  K G + E ++ R  YR+ G G+L+ + VA  A   G   VE IV  WN  +
Sbjct  114  FPNYPSFLAKQGFYIEDIFMREPYRRKGFGKLLLTAVAKQAVKLGVGRVEWIVIDWNVNA  173

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
             +FY  MG ++  E+R  +LTGDALQA  K
Sbjct  174  INFYEQMGAQVFKEWRLCRLTGDALQAIDK  203



>ref|XP_010067321.1| PREDICTED: probable acetyltransferase NATA1-like [Eucalyptus 
grandis]
Length=242

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 118/222 (53%), Gaps = 26/222 (12%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++AR+RLA  SDV HI+K+ YQ+  +  L      +E SL   LF    +PPF S T+LL
Sbjct  28   LFARVRLAAPSDVPHIHKMIYQMAVFERLADQCAATEASLSSTLFN---SPPFQSFTVLL  84

Query  426  VEVS-------------ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHE  566
            +EVS              T  PA       F P+V   +L  P+ D E++ F S      
Sbjct  85   LEVSHLPFAPLPPPPQNPTGVPA-------FAPVVHAINLDLPIEDPEAEIFASGAEGGA  137

Query  567  AYIAG---YAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSS  737
               A    +  FFPNYS F  KPG + E L+ R  YR+ G+GR++ + VA  AA  G+  
Sbjct  138  GAGAVVAGFVLFFPNYSTFLAKPGFYIEDLFVRECYRRKGLGRMLLTAVAGQAARMGYGR  197

Query  738  VEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
            VE +V  WN  +  FY DMG +I+ ++R  +LTG+AL AYA 
Sbjct  198  VEWVVLDWNVNAIKFYEDMGAKILQDWRICRLTGEALSAYAN  239



>ref|XP_008365057.1| PREDICTED: LOW QUALITY PROTEIN: probable acetyltransferase NATA1-like, 
partial [Malus domestica]
Length=232

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 115/206 (56%), Gaps = 8/206 (4%)
 Frame = +3

Query  255  RLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEV  434
            R+ LA  +DV HI+KL +Q+  +  LT L+  +E SL  +LF  +P   F S TI ++EV
Sbjct  31   RIPLALPTDVPHIHKLIHQLAVFEHLTDLFXATESSLSSILFTSHP---FQSFTIFVLEV  87

Query  435  SATEFPAPT---PDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNY  605
            S T F        + S +   +K  +L  P+ D E + FRSN  D  A +AG+  FFPNY
Sbjct  88   SQTPFVEHLHLECNNSAYPXXIKTLNLDLPIDDPERNLFRSNXGD--AVVAGFVLFFPNY  145

Query  606  SCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFY  785
            S    K G + E L+ R  YR+ G+G+++ STV   A   G+  VE  V   N  +  F+
Sbjct  146  STLLGKRGFYVEDLFVRECYRRKGLGKMLLSTVVKQAVRMGYGIVEWAVLDXNVNAIKFH  205

Query  786  VDMGVEIMDEFRYGKLTGDALQAYAK  863
             +MG +I+ E+R  +LTGDAL AY  
Sbjct  206  EEMGAKILQEWRICRLTGDALNAYVN  231



>emb|CDO99757.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/232 (35%), Positives = 116/232 (50%), Gaps = 6/232 (3%)
 Frame = +3

Query  189  PP--AVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDS  362
            PP  A I      E       +YAR+RLA   DV HI+KL +Q+  +  L H    +E S
Sbjct  8    PPFLATIPENTVPETAPFRHPLYARIRLATILDVPHIHKLIHQLASFERLAHQCTATEAS  67

Query  363  LCKMLFKENPNPP-FYSPTILLVEVSATEFPAPTPDE--SGFEPIVKEFDLKAPVADDES  533
            L   LF     PP F S  + ++EVS   FP P P E  +   P++K   L  P+ D E 
Sbjct  68   LAATLFPSPNPPPPFTSFNVFILEVSPDHFPPPAPQEDTTNSSPLLKTLHLDLPIEDSEK  127

Query  534  DAFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAAN  713
            + FRS +   +  +AG+  FFP YS +  KPG   E L+ R  YRK G G+++ + VA  
Sbjct  128  EIFRSEIGG-DVVVAGFVLFFPKYSTYLAKPGFHIEDLFVREPYRKHGFGKMLITAVAGQ  186

Query  714  AADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
            A   G+  VE +V  WN  +  FY  +G ++  + R  +LTG+ L      K
Sbjct  187  AVKMGYGMVEWVVLDWNANAIQFYERIGTKVYQDKRICRLTGEDLDVEGSAK  238



>ref|XP_008660524.1| PREDICTED: probable acetyltransferase NATA1-like [Zea mays]
 gb|ACG28542.1| N-acetyltransferase [Zea mays]
 gb|AFW89666.1| hypothetical protein ZEAMMB73_012692 [Zea mays]
 gb|AIB05552.1| GNAT transcription factor, partial [Zea mays]
Length=225

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 118/208 (57%), Gaps = 6/208 (3%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            S  ++A LRLA  SDV HI++L +Q+ E+  LT L+  +E+ L   LF     PPF S T
Sbjct  11   SGDVWAELRLASASDVPHIHRLIHQMAEFELLTDLFAATEELLTSTLFPSPTPPPFTSFT  70

Query  417  ILLVEVSATEFPAPTPDESGFEPIVKEFDLKA-PVADDESDAFRSNVADHEAYIAGYAFF  593
             L++++S    P+P   +       +  DL A P+AD E+ AF S         AG+   
Sbjct  71   ALILDLS----PSPVAPDPSSTIASRRLDLSASPLADPEAAAFASPRGGGR-VTAGFVIC  125

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG++ E ++ RA +R+ G+GR+M S VA  AA+ G   VE  V  WNK +
Sbjct  126  FPNYSTFLSKPGLYVEDIFVRAPWRRRGLGRMMLSAVAGRAAELGMGRVEWCVLDWNKNA  185

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAY  857
             DFY  MG +++ ++R  +L G AL  Y
Sbjct  186  IDFYEGMGADVLPQWRICRLAGKALDKY  213



>ref|XP_006294942.1| hypothetical protein CARUB_v10023995mg [Capsella rubella]
 gb|EOA27840.1| hypothetical protein CARUB_v10023995mg [Capsella rubella]
Length=229

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 110/206 (53%), Gaps = 4/206 (2%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            +++ +RLA  SDV  I+KL +Q+  +  LTHL+  +E  L   LF   P   F + T+ L
Sbjct  25   VFSLIRLATPSDVPFIHKLIHQMAVFERLTHLFVATEAGLASTLFNSRP---FQAVTVFL  81

Query  426  VEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNY  605
            +E+S + F         F P  +  ++  P+ D ES  F  +  + +  +AG+  FFPNY
Sbjct  82   LEISRSPFSTTDATSPDFTPFFETHNVDLPIEDPESQDFSPDKLN-DVIVAGFVLFFPNY  140

Query  606  SCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFY  785
              F  K G + E ++ R  YR+ G G+++ + VA  A   G   VE IV  WN  + +FY
Sbjct  141  PSFLAKQGFYIEDIFVREPYRRKGFGKMLLTAVAKQAVKLGVGRVEWIVIDWNVNAINFY  200

Query  786  VDMGVEIMDEFRYGKLTGDALQAYAK  863
              MG  +  E+R  +LTGDALQA  K
Sbjct  201  EQMGATVFKEWRLCRLTGDALQAIDK  226



>ref|XP_006649412.1| PREDICTED: probable acetyltransferase NATA1-like [Oryza brachyantha]
Length=226

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 116/208 (56%), Gaps = 6/208 (3%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            S +++A LRLA  SDV HI+ L +Q+ E+  LT L+  + + L   LF   P PP  S T
Sbjct  11   SGEVWAELRLADASDVPHIHALIHQMAEFELLTDLFAATHELLTSTLFPSPPRPPLPSFT  70

Query  417  ILLVEVSATEFPAPTPDESGFEPIVKEFDLKA-PVADDESDAFRSNVADHEAYIAGYAFF  593
             L++ +S +  PA      G        DL A P+AD E+ AF S         AG+   
Sbjct  71   ALILVLSPSPLPAAADSTIG----SCRLDLSASPLADPEAAAFASPRGGGR-VTAGFVIC  125

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG++ E ++ RA +R+ G+GR+M S VA  AA+ G   VE  V  WNK +
Sbjct  126  FPNYSTFLSKPGLYVEDIFVRAPWRRRGLGRMMLSAVAGKAAELGMGRVEWCVLDWNKNA  185

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAY  857
             DFY  MG E++ ++R  +LTG AL  Y
Sbjct  186  IDFYEGMGAEVLPQWRICRLTGAALDKY  213



>emb|CBI31436.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 103/208 (50%), Gaps = 42/208 (20%)
 Frame = +3

Query  234  ISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSP  413
            I + I+AR+R+A  SDV H++KL YQ      LTH++  +E SL   LF    +PPF S 
Sbjct  51   IGNPIFARIRIANSSDVPHLHKLMYQHAASQRLTHIFSATESSLSATLFN---SPPFQSF  107

Query  414  TILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFF  593
            T+LL+E  +                                         EA + G+  F
Sbjct  108  TVLLLEFGS---------------------------------------GGEAVVVGFVLF  128

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNY  F  KPG + ESLY R  YRK G G+++ S VAA A   G+  ++  V  WN  +
Sbjct  129  FPNYGVFLGKPGFYIESLYTRECYRKKGFGKMLLSAVAAQAVKMGYGKLDWCVLGWNANA  188

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            + FY  MG ++ +E +  +LT DALQAY
Sbjct  189  FGFYKKMGAQVFEELKMCRLTSDALQAY  216



>ref|XP_011031717.1| PREDICTED: probable acetyltransferase NATA1-like [Populus euphratica]
 ref|XP_011031718.1| PREDICTED: probable acetyltransferase NATA1-like [Populus euphratica]
Length=182

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 107/180 (59%), Gaps = 6/180 (3%)
 Frame = +3

Query  321  YHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDES-GFEPIVKE  497
            +  LTHL+  +E SL   LFK   +PPF S TI L+EVS+  F   +   S  F PI + 
Sbjct  4    FEKLTHLFTATESSLASTLFK---SPPFLSFTIFLLEVSSHPFEKDSNFHSQSFTPIERI  60

Query  498  FDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLG  677
            F+L   + D E++ F++ +  +   +AG+  FFPN+S F  KPG + E L+ R  YR+ G
Sbjct  61   FNLDHSLIDPEAETFKNGI--NGDVVAGFVLFFPNFSTFLGKPGFYVEDLFVRECYRRKG  118

Query  678  MGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            +G+L+ S VA+ A   G+  VE +V  WN  +  FY +MG  ++ E+R  +LTG AL+AY
Sbjct  119  LGKLLLSAVASQAVKMGYGRVEWVVLDWNVNAIKFYEEMGANVLPEWRICRLTGSALEAY  178



>ref|XP_002465843.1| hypothetical protein SORBIDRAFT_01g046860 [Sorghum bicolor]
 gb|EER92841.1| hypothetical protein SORBIDRAFT_01g046860 [Sorghum bicolor]
Length=227

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 117/208 (56%), Gaps = 6/208 (3%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            S  ++A LRLA   DV HI++L +Q+ E+  LT L+  +E+ L   LF     PPF S T
Sbjct  11   SGDVWAELRLADARDVPHIHRLIHQMAEFELLTDLFAATEELLTSTLFPSPTPPPFTSFT  70

Query  417  ILLVEVSATEFPAPTPDESGFEPIVKEFDLKA-PVADDESDAFRSNVADHEAYIAGYAFF  593
             L++++S    P+P   +S      +  DL A P+ D E+ AF S         AG+   
Sbjct  71   ALILDLS----PSPIVPDSSSTIASRRLDLSASPLTDPEAAAFASPRGGGR-VTAGFVIC  125

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG++ E ++ RA +R+ G+GR+M S VA  AA+ G   VE  V  WNK +
Sbjct  126  FPNYSTFLSKPGLYVEDIFVRAPWRRRGLGRMMLSAVAGRAAELGMGRVEWCVLDWNKNA  185

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAY  857
             DFY  MG +++ ++R  +L G AL  Y
Sbjct  186  IDFYEGMGADVLPQWRICRLAGAALDKY  213



>ref|XP_010509078.1| PREDICTED: L-ornithine N5-acetyltransferase NATA1 [Camelina sativa]
Length=231

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 112/217 (52%), Gaps = 4/217 (2%)
 Frame = +3

Query  213  VTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENP  392
            V  E  +    +++R+RLA  SDV  I+KL +Q+  +  LTHL+  +E  L   LF   P
Sbjct  16   VPAETSKTDHPMFSRIRLATPSDVPFIHKLIHQMAVFERLTHLFVATESGLASTLFNSRP  75

Query  393  NPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAY  572
               F + T+ L+E+S + F         F P ++  +   P+ D +S  F  +    +  
Sbjct  76   ---FQAVTVFLLEISRSPFSTTDATSPDFTPFLETHNGDLPIEDPDSQDFSPDKL-KDVV  131

Query  573  IAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIV  752
            +AG+  FFPNY  F  K   + E ++ R  YR+ G G+++ + VA  A   G   VE IV
Sbjct  132  VAGFVLFFPNYPSFLAKQCFYIEDIFVREPYRRKGFGKMLLTAVAKQAVKLGMGRVEWIV  191

Query  753  AVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
              WN  + +FY  MGV +  E+R  +LTGDAL A  K
Sbjct  192  IDWNVNAINFYEQMGVIVFKEWRLCRLTGDALHAIDK  228



>ref|XP_010918697.1| PREDICTED: L-ornithine N5-acetyltransferase NATA1-like [Elaeis 
guineensis]
Length=248

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 116/218 (53%), Gaps = 12/218 (6%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++AR+RLA   DV  I++L  ++ ++    H++  +E SL   LF     PPF S T LL
Sbjct  21   VWARIRLADNQDVPIIHRLVCRLTDFLHFNHVFSATETSLSSSLFPTPSPPPFLSLTALL  80

Query  426  VEVSATEFPAPTP-----------DESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAY  572
            +E+S +  P   P                 P+V+  +L APVAD E++ F S        
Sbjct  81   LELSPSPIPQRDPEDEKEEGREENKPGSISPVVRRIELAAPVADKEAETFASPRG-RGLV  139

Query  573  IAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIV  752
            +AG+   FP YS F  KPG++ E L+ R  +R+ G+GR++ S VAA AA  G   VE  V
Sbjct  140  VAGFTLCFPKYSAFRAKPGLYVEGLFVRKPWRRRGLGRMLLSAVAAQAARLGLPKVEWGV  199

Query  753  AVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKK  866
              WN  + DFY  MG     + R+ KL+G+AL+AY  +
Sbjct  200  PNWNAGAVDFYAGMGAVEQRDGRHFKLSGEALKAYETR  237



>ref|XP_004985674.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Setaria 
italica]
Length=227

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 121/213 (57%), Gaps = 8/213 (4%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            S  ++A LRLA   DV HIY L +Q+ E+  LT L+  +E+ L   LF     PPF S T
Sbjct  11   SGDMWAELRLADARDVPHIYSLIHQMAEFELLTDLFTATEELLTSTLFPSPTPPPFTSFT  70

Query  417  ILLVEVSATEFPAPT-PDESGFEPIVKEFDLKA-PVADDESDAFRSNVADHEAYIAGYAF  590
             L++++S    P+P  PD S     ++  DL A P+AD E+ AF S         AG+  
Sbjct  71   ALVLDLS----PSPVVPDSSSIIGSLR-LDLSAFPLADPEAAAFASPRGGGRV-TAGFVI  124

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
             FPNYS +  KPG++ E ++ RA +R+ G+GR+M S+VA  AA+ G   VE  V  WNK 
Sbjct  125  CFPNYSSYLSKPGLYVEDIFVRAPWRRRGLGRMMLSSVAGRAAELGMGLVEWCVLDWNKN  184

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKK  869
            + D YV MG ++  ++R  +LTG AL  Y   +
Sbjct  185  AIDLYVGMGADMFPDWRICRLTGAALDKYKGNQ  217



>ref|NP_001136452.1| uncharacterized protein LOC100216560 [Zea mays]
 gb|ACF81960.1| unknown [Zea mays]
 tpg|DAA43410.1| TPA: hypothetical protein ZEAMMB73_831604 [Zea mays]
 gb|AIB05556.1| GNAT transcription factor, partial [Zea mays]
Length=227

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 115/208 (55%), Gaps = 6/208 (3%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            S  ++A LRLA   DV HI++L + + E+  LT L+  +E+ L   LF     PPF S T
Sbjct  11   SGDVWAELRLADARDVPHIHRLIHHMAEFELLTDLFAATEELLTSTLFPSPTPPPFTSFT  70

Query  417  ILLVEVSATEFPAPTPDESGFEPIVKEFDLKA-PVADDESDAFRSNVADHEAYIAGYAFF  593
             L++++S    P P   +S      +  DL A P+AD E+  F S         AG+   
Sbjct  71   ALVLDLS----PTPILPDSSSTIASRRLDLSASPLADPEAATFASPRGGGR-VTAGFVIC  125

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG++ E ++ RA +R+ G+GR+M S VA  AA+ G   VE  V  WNK +
Sbjct  126  FPNYSTFLSKPGLYVEDIFVRAPWRRRGLGRMMLSAVAGRAAELGMGRVEWCVLDWNKNA  185

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAY  857
             DFY  MG +++ ++R  +L G AL  Y
Sbjct  186  IDFYEGMGADVLPQWRICRLAGAALDKY  213



>ref|XP_004164224.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Cucumis 
sativus]
Length=230

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 118/223 (53%), Gaps = 8/223 (4%)
 Frame = +3

Query  216  TTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPN  395
            +T     S  ++ R+RLA  SD+ HI+ L +Q+  Y  LTHL+  ++ SL   LF    +
Sbjct  13   STVPFHCSAPLFTRIRLAVPSDIPHIHNLIHQMAVYQRLTHLFSATQSSLSANLFS---S  69

Query  396  PPFYSPTILLVEVSATEFPAPTPDES--GFEPIVKEFDLKAPVADDESDAFRSNVADHEA  569
            PPF S T+ ++EVS+T FP  +   S   + P+V   D + PV D ES+ F++   D   
Sbjct  70   PPFQSFTVFILEVSSTPFPENSLHNSNPNYTPVVGILDSEPPVDDPESEDFKAE--DENV  127

Query  570  YIAGYAFFFPNYSCFYDKPGIFFESLYFRASY-RKLGMGRLMFSTVAANAADKGFSSVEG  746
             +AG+  FFPN+     KPG F E++  R  Y R+  + R++   V   A    +  VE 
Sbjct  128  VVAGFVMFFPNFPSLLGKPGFFVEAIVVRDCYHRRKDLERILLLAVVNQAVKMDYCQVEW  187

Query  747  IVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKSS  875
             +   +  +  FY +MG  I+ E+R  ++TGDAL+ +     S
Sbjct  188  ALLDRDVNAIKFYEEMGAPILAEWRICRITGDALRVHKNANES  230



>gb|EAZ25609.1| hypothetical protein OsJ_09436 [Oryza sativa Japonica Group]
Length=192

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 103/188 (55%), Gaps = 8/188 (4%)
 Frame = +3

Query  312  IHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIV  491
            + E+  LT L+  + + L   LF   P PPF S T L++++S +  PA     SG   I 
Sbjct  1    MAEFELLTDLFAATHELLTSTLFPSPPRPPFTSFTALILDLSPSPLPA-----SGPSTIA  55

Query  492  KE-FDLKA-PVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASY  665
                DL A P+AD E+ AF S         AG+   FPNYS F  KPG++ E ++ RA +
Sbjct  56   SHCLDLSASPLADPEAAAFASPRGGGR-VTAGFVICFPNYSTFLSKPGLYVEDIFVRAPW  114

Query  666  RKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDA  845
            R+ G+GR+M S VA  AA+ G   VE  V  WNK + DFY  MG E++ ++R  +LTG A
Sbjct  115  RRRGLGRMMLSAVAGKAAELGMGRVEWCVLDWNKNAIDFYEGMGAEVLPQWRICRLTGAA  174

Query  846  LQAYAKKK  869
            L  Y   +
Sbjct  175  LDKYKGNQ  182



>ref|XP_010517239.1| PREDICTED: L-ornithine N5-acetyltransferase NATA1-like [Camelina 
sativa]
Length=228

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 109/211 (52%), Gaps = 4/211 (2%)
 Frame = +3

Query  207  TGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKE  386
            T V  E  +    +++R+RLA  SDV+ I+KL +Q+  +  LTHL+  +E  L   LF  
Sbjct  14   TTVPAETSKTDHPVFSRIRLATPSDVTFIHKLIHQMAVFERLTHLFVATESGLASTLFNS  73

Query  387  NPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHE  566
             P   F + T+ L+E+S + F         F P ++  +   P+ D +S  F  +    +
Sbjct  74   RP---FQAVTVFLLEISRSPFSTTDATSPDFTPFLESHNGDLPIEDPDSQDFSPDKLK-D  129

Query  567  AYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEG  746
              +AG+  FFPNY  F  K   + E+++ R  YR+ G G+++ + VA  A   G   VE 
Sbjct  130  VVVAGFVLFFPNYPSFLAKQCFYIENIFVREPYRRKGFGKMLLTAVAKQAVKLGMGRVEW  189

Query  747  IVAVWNKKSYDFYVDMGVEIMDEFRYGKLTG  839
            IV  WN  +  FY  MG  + +E+R  +LTG
Sbjct  190  IVIDWNVNAIKFYEQMGAIVFNEWRLCRLTG  220



>ref|XP_008446873.1| PREDICTED: probable acetyltransferase NATA1-like [Cucumis melo]
Length=230

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 118/226 (52%), Gaps = 14/226 (6%)
 Frame = +3

Query  189  PPAVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLC  368
            PPA      +T     S  ++ R+RLA  SDV HI+KL +Q+  Y  LTHL+  +E SL 
Sbjct  10   PPA------STVPFHCSSPLFTRVRLAVTSDVPHIHKLIHQMAIYQRLTHLFSATESSLS  63

Query  369  KMLFKENPNPPFYSPTILLVEVSATEFPAPTPDES--GFEPIVKEFDLKAPVADDESDAF  542
              LF     PPF S T+ ++EVS   F   +P  S   + P+V+  D + PV D E + F
Sbjct  64   LNLFSS---PPFRSFTVFILEVSPIPFSENSPHNSNPNYTPVVRTLDSELPVDDPERENF  120

Query  543  RSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASY-RKLGMGRLMFSTVAANAA  719
            ++   D    +AG+  FFPN+     KPG F E++  R  Y RK  +GR++   V   A 
Sbjct  121  KAE--DENVVVAGFVLFFPNFPSLLGKPGFFVEAIAVRDCYRRKEDLGRILLLAVVNQAV  178

Query  720  DKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
               +  VE  V  W+  +  FY +MG  I+ E+R  ++  DAL+ +
Sbjct  179  KMDYCQVEWAVLDWDVNAIKFYEEMGAPILAEWRICRIICDALRVH  224



>ref|XP_001777294.1| predicted protein [Physcomitrella patens]
 gb|EDQ57949.1| predicted protein [Physcomitrella patens]
Length=212

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 107/211 (51%), Gaps = 10/211 (5%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            + A +RLA  +D   I KL  ++ ++  L+H   V+E+ L   L+K    PPF  PT+L+
Sbjct  5    LTATVRLATPADAPSIAKLIRELADFEELSHACVVTEEKLHSSLWK---LPPFQGPTVLM  61

Query  426  VEVSATEFPAPTPDESG------FEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYA  587
            +EV   E       E        FEPIV+   LK P+ D   + FRS        + G+ 
Sbjct  62   LEVCQQEENVVEVKEDWHAEGEVFEPIVRSVVLKNPIDDSAREGFRSPSTGTHTTV-GFV  120

Query  588  FFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNK  767
             FFPNYS F  K G + E LY R  YR  G+G ++  +V   A       VE  V  WN 
Sbjct  121  LFFPNYSTFLAKGGYYIEDLYVRKPYRGTGLGTILLKSVVQQAKKLRAGRVEWCVLDWNV  180

Query  768  KSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
             +  FY  +G ++M E+R  +LTG+AL+A A
Sbjct  181  NAIKFYEGLGAKVMPEWRICRLTGEALEACA  211



>ref|XP_004142493.1| PREDICTED: tyramine N-feruloyltransferase 4/11-like [Cucumis 
sativus]
 gb|KGN52262.1| hypothetical protein Csa_5G622770 [Cucumis sativus]
Length=230

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 116/223 (52%), Gaps = 8/223 (4%)
 Frame = +3

Query  216  TTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPN  395
            +T     S  ++ R+RLA  SD+ HI+ L +Q+  Y  LTHL+  ++ SL   LF    +
Sbjct  13   STVPFHCSAPLFTRIRLAVPSDIPHIHNLIHQMAVYQRLTHLFSATQSSLSANLFS---S  69

Query  396  PPFYSPTILLVEVSATEFPAPTPDES--GFEPIVKEFDLKAPVADDESDAFRSNVADHEA  569
            PPF S T+ ++EVS+  FP  +   S   + P+V   D + PV D  S+ F++   D   
Sbjct  70   PPFQSFTVFILEVSSIPFPQNSLHNSNPNYTPVVGILDSEPPVDDPGSEDFKAE--DENV  127

Query  570  YIAGYAFFFPNYSCFYDKPGIFFESLYFRASY-RKLGMGRLMFSTVAANAADKGFSSVEG  746
             +AG+  FFPN+     KPG F E++  R  Y R+  + R++   V   A    +  VE 
Sbjct  128  VVAGFVLFFPNFPSLLGKPGFFVEAIVVRDCYHRRKDLERILLLAVVNQAVKMDYCQVER  187

Query  747  IVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKSS  875
             +   +  +  FY +MG  I+ E+R  ++TGDAL+ +     S
Sbjct  188  ALLDRDVNAIKFYEEMGAPILGEWRICRITGDALRVHKNANES  230



>gb|ACG33599.1| N-acetyltransferase [Zea mays]
Length=227

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 113/208 (54%), Gaps = 6/208 (3%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            S  ++A LRLA   DV HI++L + + E+  LT L+  +E+ L   LF     PPF S T
Sbjct  11   SGDVWAELRLADARDVPHIHRLIHHMAEFELLTDLFAATEELLTSTLFPSPTPPPFTSFT  70

Query  417  ILLVEVSATEFPAPTPDESGFEPIVKEFDLKA-PVADDESDAFRSNVADHEAYIAGYAFF  593
             L++++S    P P   +S      +  DL A P+AD E+  F S         AG+   
Sbjct  71   ALVLDLS----PTPILPDSSSTIASRRLDLSASPLADPEAATFASPRGGGR-VTAGFVIC  125

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKS  773
            FPNYS F  KPG++ E ++ RA +R+ G+GR+M S VA  A + G   VE  V  W K +
Sbjct  126  FPNYSTFLSKPGLYVEDIFVRAPWRRRGLGRMMLSAVAGRAXELGMGRVEWCVLDWXKNA  185

Query  774  YDFYVDMGVEIMDEFRYGKLTGDALQAY  857
             DFY  MG +++ ++R  +L G AL  Y
Sbjct  186  IDFYEGMGXDVLPQWRICRLAGAALDKY  213



>ref|XP_010689389.1| PREDICTED: L-ornithine N5-acetyltransferase NATA1-like [Beta 
vulgaris subsp. vulgaris]
Length=238

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 115/220 (52%), Gaps = 9/220 (4%)
 Frame = +3

Query  222  EKLRISDK----IYARLRLAK-ESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFK-  383
            EK + SD     +Y R+RLA  ESDV  I+ L +++  ++ L+   + ++ +L   LF  
Sbjct  20   EKKQQSDHSDHILYVRVRLATDESDVPFIHGLIHKMAAFYHLSDECEATKPALSSTLFNS  79

Query  384  ENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADH  563
            + P  PF + T+ LVEVS+T F    P    F  I     L  P+ D E + FR+   + 
Sbjct  80   KTPFEPFKTVTVFLVEVSSTPFAPNHPSTQHFNHIETTLHLPHPINDPEMELFRT---EE  136

Query  564  EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVE  743
               IAG+  FFP+YS F  KP    E L+ R  YR  G G ++   VA+ A   G++ +E
Sbjct  137  GTIIAGFVIFFPSYSTFLSKPAFHVEDLFVREGYRGKGFGGMLMKAVASQAVKMGYARME  196

Query  744  GIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
              V  WN  S+ FY  +G  I+ ++R  +L  DAL +Y +
Sbjct  197  WTVTTWNVASHTFYEKLGAHILQDWRIFRLADDALLSYGR  236



>ref|XP_002981383.1| hypothetical protein SELMODRAFT_233690 [Selaginella moellendorffii]
 gb|EFJ17571.1| hypothetical protein SELMODRAFT_233690 [Selaginella moellendorffii]
Length=198

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 109/203 (54%), Gaps = 9/203 (4%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R+A   DV +I  +  Q+ ++  L      +E+     LF     P F   T+LL+E
Sbjct  4    ASVRIASPRDVPYIASMIAQLAKFERLADACVGTEEQYRSTLFNA---PAFQGLTVLLLE  60

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
            +S +        +       +E ++ A +AD + D F S   D    +AG+  FFPNYS 
Sbjct  61   ISRSSASNAAAGDC---LASQEVEIGAEIADPDKDFFTS---DSGRIVAGFVLFFPNYST  114

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  KPG++ E L+ R  YR+ G+GR++  TVA  AA++G   VE  V  WN+ +  FY +
Sbjct  115  FLAKPGLYIEDLFVREPYRRQGLGRILLRTVAKEAANRGLGRVEWCVLDWNENAIKFYQE  174

Query  792  MGVEIMDEFRYGKLTGDALQAYA  860
            MG  ++ E+R  +LTGDAL+AY 
Sbjct  175  MGALVLPEWRICRLTGDALKAYG  197



>ref|XP_002969906.1| hypothetical protein SELMODRAFT_231364 [Selaginella moellendorffii]
 gb|EFJ29030.1| hypothetical protein SELMODRAFT_231364 [Selaginella moellendorffii]
Length=196

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 109/203 (54%), Gaps = 9/203 (4%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R+A   DV +I  +  Q+ ++  L      +E+     LF     P F   T+LL+E
Sbjct  2    ASVRIASPRDVPYIASMIAQLAKFERLADACIGTEEQYRSTLFNA---PAFQGLTVLLLE  58

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
            +S +        +       +E ++ A +AD + D F S   D    +AG+  FFPNYS 
Sbjct  59   ISRSSASNAAAGDC---LASQEVEIGAEIADPDKDFFTS---DSGRIVAGFVLFFPNYST  112

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  KPG++ E L+ R  YR+ G+GR++  TVA  AA++G   VE  V  WN+ +  FY +
Sbjct  113  FLAKPGLYIEDLFVREPYRRQGLGRILLRTVAKEAANRGLGRVEWCVLDWNENAIKFYQE  172

Query  792  MGVEIMDEFRYGKLTGDALQAYA  860
            MG  ++ E+R  +LTGDAL+AY 
Sbjct  173  MGALVLPEWRICRLTGDALKAYG  195



>gb|KHN45195.1| Tyramine N-feruloyltransferase 4/11 [Glycine soja]
Length=202

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 113/228 (50%), Gaps = 31/228 (14%)
 Frame = +3

Query  177  TVMAPPAVIDTGVTTEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSE  356
            T  +PPA          L  +  ++AR+ LA  SDV HI+KL +Q+  +  LTHL+  +E
Sbjct  3    TAASPPAPTLASGPPATLPETTLLFARIHLATLSDVPHIHKLIHQMVIFKPLTHLFSATE  62

Query  357  DSLCKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESD  536
             SL   LF     PPF S TILL+E S T FP  TP+++                DD   
Sbjct  63   SSLSSTLFTS---PPFQSFTILLLEASPTPFPFTTPNKN---------------TDD---  101

Query  537  AFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANA  716
                        + G+  FF NY     KPG + E L+ R  YR+ G GR++ S V   A
Sbjct  102  ----------VIVVGFVLFFSNYLTSLRKPGFYVEGLFVRECYRRKGFGRMLLSAVTKQA  151

Query  717  ADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
               G+  V+ +V  WN  +  F  +MG E+++E+R  +LTG+ALQ Y 
Sbjct  152  VKMGYGRVDWVVLDWNVNTIRFDEEMGAEVLNEWRGCRLTGEALQVYG  199



>ref|XP_011077269.1| PREDICTED: probable acetyltransferase NATA1-like isoform X2 [Sesamum 
indicum]
Length=206

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 112/218 (51%), Gaps = 36/218 (17%)
 Frame = +3

Query  219  TEKLRISDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNP  398
            +E      +++ R+RLA   DV HI+KL +Q+  + SLTHL++ +  +L   LF  N  P
Sbjct  17   SEPTPCGHELFTRIRLATVEDVPHIHKLTHQLAVFESLTHLFQATPATLAATLFPPNAPP  76

Query  399  PFYSPTILLVEVSATEFPAPTPDES-GFEPIVKEFDLKAPVADD-ESDAFRSNVAD--HE  566
            PF S T+LL+E+S   FP   P E+  F P  K   L  P+ DD E +AFRSN  D   +
Sbjct  77   PFTSVTVLLLELSTLPFP---PSENPHFTPWHKSLHLDLPIDDDPEKEAFRSNAGDVNED  133

Query  567  AYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEG  746
              + G                            RK G+G+L+   VA  AA  G+  V+ 
Sbjct  134  VTVGG----------------------------RK-GLGKLLLWAVAEQAAKMGYGRVDW  164

Query  747  IVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
            +V  WN  +  FY  MG +I+ E R+ +LTG+AL+AYA
Sbjct  165  VVLDWNVNAITFYEGMGAKILPELRFCRLTGEALEAYA  202



>gb|AGJ98237.1| PIG03 N-acetyltransferase-like protein, partial [Petunia x hybrida]
Length=169

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 89/149 (60%), Gaps = 3/149 (2%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            + ++++R+RLA  +DV HI+KL +Q+  +  LTHL+  +E SL   LF +NP PPF S T
Sbjct  21   THQLFSRIRLATNTDVPHIHKLIHQMAVFEKLTHLFSATESSLSATLFPQNPPPPFTSFT  80

Query  417  ILLVEVSATEF-PAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFF  593
            I L+EVS   F P P      F PI K   L  P+ D E+D FRS+  D    +AG+  F
Sbjct  81   IFLLEVSPNPFLPIPQLTYPNFSPIHKSVILDVPITDPEADKFRSDGED--VTVAGFVLF  138

Query  594  FPNYSCFYDKPGIFFESLYFRASYRKLGM  680
            FPNYS F  K G + E ++ R  YRK G+
Sbjct  139  FPNYSSFLAKQGFYIEDIFVRECYRKEGL  167



>ref|XP_010693074.1| PREDICTED: probable acetyltransferase NATA1-like [Beta vulgaris 
subsp. vulgaris]
Length=212

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 117/220 (53%), Gaps = 21/220 (10%)
 Frame = +3

Query  219  TEKLRISD--KIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENP  392
            TE    SD   +Y R+R  K+SD+  I+KL +++ E+H+ T+  +V+E SL   LF  NP
Sbjct  7    TENTTKSDDHHLYTRIRAPKKSDIPSIHKLLHKMAEFHNATNC-QVTESSLNSTLFT-NP  64

Query  393  NPPFYSP-TILLVEVSATEFPAPTPDESGFEP--IVKEFDLKAPVADDESDAFRSNVADH  563
             P   +P  + ++EVS++  P          P  I K FDL  PV D E   F+S +   
Sbjct  65   QP---TPVNVFVLEVSSSPLP--------LHPSIIEKTFDLPRPVNDSEVLIFQSEIG--  111

Query  564  EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVE  743
               IAG+  F+P Y  F+ KPG   + L+ R SYR LG G L+   VA  A   G+  VE
Sbjct  112  -TTIAGFVLFYPTYCSFFGKPGFRIQDLFVRESYRSLGFGELLMKAVANEAVKLGYVKVE  170

Query  744  GIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
              V  WN  +  FY  +G  ++++++  +LT DAL +  K
Sbjct  171  WSVVDWNVGATKFYEKIGACVLEDWKTFELTNDALFSCGK  210



>ref|XP_008775354.1| PREDICTED: probable acetyltransferase NATA1-like [Phoenix dactylifera]
Length=263

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 118/221 (53%), Gaps = 21/221 (10%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++AR+RLA + DV  I++L  Q+  +    H++  +E SL   LF     PPF S T LL
Sbjct  33   VWARIRLADKQDVPIIHRLICQLTGFLHFNHVFSATESSLSSTLFPTPSPPPFLSLTALL  92

Query  426  VEVSATEFPAPTP--------------DESGFEPIVKEFDLKAPVADDESDAFRSNVADH  563
            +E+S    P+P P              +++G   +V+  +L AP+AD E++AF S     
Sbjct  93   LELS----PSPIPQRDLEDEKEEDREENKTGS--VVRRIELAAPMADPEAEAFASPRG-R  145

Query  564  EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVE  743
               +AG+   FP YS F  KPG++ E L+ R ++R+ G+GR++ S VA  AA      +E
Sbjct  146  GLVVAGFTLCFPKYSAFRAKPGLYVEGLFVREAWRRRGLGRMLLSAVATQAARMELPKME  205

Query  744  GIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKK  866
              V  WN  + +FY  MG     + R+ KL G+AL+ Y  +
Sbjct  206  WGVPNWNAGAVNFYEGMGAVEQRDGRHFKLCGEALKGYGTQ  246



>gb|AFK38887.1| unknown [Lotus japonicus]
Length=182

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 94/157 (60%), Gaps = 3/157 (2%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            ++ R+RLA  SDV HI+K+ YQ+  +  LTHL+  +E SL   LF  + N PF+S T+ +
Sbjct  27   VFTRIRLAVPSDVPHIHKMTYQMAVFERLTHLFATTESSLTSTLFSPD-NKPFHSFTVFI  85

Query  426  VEVSATEFPAPTPDESGF-EPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPN  602
            +EVS+  F     D   F +P+ K   L+ P+ D E + FR+ + + E ++AG+  F PN
Sbjct  86   LEVSSNPFTDTHFDNDPFYKPVTKTVHLELPLDDPEKETFRNQLGN-EVFVAGFVLFSPN  144

Query  603  YSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAAN  713
            YS F  KPG + E L+ R  YR+ G GR++ S VA  
Sbjct  145  YSTFLAKPGFYVEDLFVRECYRRKGFGRMLLSAVAKQ  181



>ref|XP_006294941.1| hypothetical protein CARUB_v10023995mg [Capsella rubella]
 gb|EOA27839.1| hypothetical protein CARUB_v10023995mg [Capsella rubella]
Length=183

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 93/181 (51%), Gaps = 4/181 (2%)
 Frame = +3

Query  321  YHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEF  500
            +  LTHL+  +E  L   LF   P   F + T+ L+E+S + F         F P  +  
Sbjct  4    FERLTHLFVATEAGLASTLFNSRP---FQAVTVFLLEISRSPFSTTDATSPDFTPFFETH  60

Query  501  DLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGM  680
            ++  P+ D ES  F  +  + +  +AG+  FFPNY  F  K G + E ++ R  YR+ G 
Sbjct  61   NVDLPIEDPESQDFSPDKLN-DVIVAGFVLFFPNYPSFLAKQGFYIEDIFVREPYRRKGF  119

Query  681  GRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYA  860
            G+++ + VA  A   G   VE IV  WN  + +FY  MG  +  E+R  +LTGDALQA  
Sbjct  120  GKMLLTAVAKQAVKLGVGRVEWIVIDWNVNAINFYEQMGATVFKEWRLCRLTGDALQAID  179

Query  861  K  863
            K
Sbjct  180  K  180



>ref|XP_002443698.1| hypothetical protein SORBIDRAFT_07g000540 [Sorghum bicolor]
 gb|EES13193.1| hypothetical protein SORBIDRAFT_07g000540 [Sorghum bicolor]
Length=234

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 112/214 (52%), Gaps = 5/214 (2%)
 Frame = +3

Query  237  SDKIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPT  416
            S  ++A LRL    DV HI++L YQ+ E+H LT ++  +++ L   LF      P ++  
Sbjct  11   SGDVWAELRLTDARDVPHIHRLIYQMAEFHLLTDVFAATQELLTSTLFPSPTPTPPFTSL  70

Query  417  ILLVEVSATEFPAPTPDESGFEPIVKEFDLKA--PVADDESDAFRSNVADHEAYIAGYAF  590
              L+ +  + +P   PD S      +  DL A  P+ D E+ A  ++        AG+  
Sbjct  71   TALI-LDVSRYPL-VPDSS-TTIASRRLDLSAFPPLEDPEAAAGFASPRGGGRVTAGFVI  127

Query  591  FFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKK  770
             FPNYS    KPG++ E ++ RA +R+ G+GR MFS +A  AA+ G   VE  V   NK 
Sbjct  128  CFPNYSAMLSKPGLYMEDIFVRAPWRRRGLGRTMFSAIAGKAAELGMGRVEWCVMDRNKN  187

Query  771  SYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKS  872
            + DFY  MG +++ ++R  +L G AL  Y    S
Sbjct  188  AIDFYEGMGADVLPQWRICRLAGAALDKYRSSHS  221



>ref|XP_010693079.1| PREDICTED: L-ornithine N5-acetyltransferase NATA1-like [Beta 
vulgaris subsp. vulgaris]
Length=233

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 112/220 (51%), Gaps = 6/220 (3%)
 Frame = +3

Query  213  VTTEKLRISDKI-YARLRLAK-ESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFK-  383
            V  E+   SD I Y R+RLA  E D   I+ L +++  ++ L+   + ++ +L   LF  
Sbjct  15   VQDEQSDHSDHILYVRVRLATDELDDPFIHGLIHKMAAFYHLSDECEATKPALSSTLFNS  74

Query  384  ENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADH  563
            + P  PF + T+ LVEVS+T F    P    F  I        P+ D E + FR+   + 
Sbjct  75   KTPFEPFKTVTVFLVEVSSTPFAPYHPSTQHFNHIETTLHFPHPINDPEMELFRT---EE  131

Query  564  EAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVE  743
               IAG+  FFP+YS F  KP    E L+ R  YR  G G ++   VA+ A   G++ +E
Sbjct  132  GTIIAGFVIFFPSYSTFLAKPAFHVEDLFVREGYRGKGFGGMLMKAVASQAVKMGYARME  191

Query  744  GIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
              V  WN  S+ FY  +G  I+ ++R  +L  DAL +Y +
Sbjct  192  WTVTTWNVASHTFYEKLGAHILQDWRIFRLDDDALLSYGR  231



>ref|NP_001048985.1| Os03g0151600 [Oryza sativa Japonica Group]
 dbj|BAF10899.1| Os03g0151600 [Oryza sativa Japonica Group]
 gb|EEC74530.1| hypothetical protein OsI_10047 [Oryza sativa Indica Group]
Length=165

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 74/126 (59%), Gaps = 2/126 (2%)
 Frame = +3

Query  483  PIVKEFDLKA-PVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRA  659
            P +   DL A P+AD E+ AF S         AG+   FPNYS F  KPG++ E ++ RA
Sbjct  27   PHIHALDLSASPLADPEAAAFASPRGGGR-VTAGFVICFPNYSTFLSKPGLYVEDIFVRA  85

Query  660  SYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTG  839
             +R+ G+GR+M S VA  AA+ G   VE  V  WNK + DFY  MG E++ ++R  +LTG
Sbjct  86   PWRRRGLGRMMLSAVAGKAAELGMGRVEWCVLDWNKNAIDFYEGMGAEVLPQWRICRLTG  145

Query  840  DALQAY  857
             AL  Y
Sbjct  146  AALDKY  151



>ref|XP_010693080.1| PREDICTED: probable acetyltransferase NATA1-like [Beta vulgaris 
subsp. vulgaris]
Length=184

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 88/174 (51%), Gaps = 4/174 (2%)
 Frame = +3

Query  345  KVSEDSLCKMLFK-ENPNPPFYSPTILLVEVSATEFPAPTPDESGFEPIVKEFDLKAPVA  521
            + ++ +L   LF  + P  PF + T+ LVEVS+T F    P    F  I     L  P+ 
Sbjct  12   EATKPALSSTLFNSKTPFEPFKTVTVFLVEVSSTPFAPNHPSTQHFNHIETTLHLPHPIN  71

Query  522  DDESDAFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFST  701
            D E + FR+        IAG+  FFP+YS F  K     E L+ R  YR  G G ++   
Sbjct  72   DPEMELFRTKEG---TIIAGFVIFFPSYSTFLSKHAFHVEDLFVREGYRGKGFGGMLMKA  128

Query  702  VAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAK  863
            VA+ A   G++ +E  V  WN  S+ FY  +G +I+ ++R  +L  DAL +Y +
Sbjct  129  VASQAVKMGYARMEWTVTTWNVASHTFYEKLGAQILQDWRIFRLADDALLSYGR  182



>ref|XP_001778322.1| predicted protein [Physcomitrella patens]
 gb|EDQ56870.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 103/205 (50%), Gaps = 6/205 (3%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            + A +RLA   DV  I  L Y++ E   +    K ++  L ++LF    + PF  PT+ +
Sbjct  1    MAATVRLATRLDVPLINALVYELAEVEEMRSSCKSTDIGLNELLFT---HAPFQGPTVFI  57

Query  426  VEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVAD--HEAYIAGYAFFFP  599
            +E+      A + ++   E +  EF   + V D + +AF+S   D  +   +AG+A  FP
Sbjct  58   LEIEEPTKEAASQNKDD-EAMSGEFSAGSLVEDPDREAFQSPCVDGKNSRIVAGFAHVFP  116

Query  600  NYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYD  779
            NYS +  KPG++ E+L+ R  YR++G+G +    +A  A   G   +E  +   N+ + +
Sbjct  117  NYSTYLAKPGLYMEALHIRKPYRRMGLGTMFLKKIAKEAVKLGMERIEWCLLHSNQPAIN  176

Query  780  FYVDMGVEIMDEFRYGKLTGDALQA  854
            FY   G  I   FR   + G+A  +
Sbjct  177  FYEGNGGRIKPGFRKCAIDGEAFNS  201



>ref|XP_002862906.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39165.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=143

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 64/104 (62%), Gaps = 0/104 (0%)
 Frame = +3

Query  561  HEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSV  740
            ++  +AG+  FFPNYS F  KPG + E ++ R  YR+ G G ++ + VA  A   G+  V
Sbjct  3    NDVVVAGFVLFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRV  62

Query  741  EGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKS  872
            E +V  WN  +  FY  MG +I+ E+R  +LTGDAL+A+ + +S
Sbjct  63   EWVVLDWNVNAIKFYEQMGAQILQEWRVCRLTGDALEAFDQNES  106



>ref|WP_031400004.1| MULTISPECIES: GCN5 family acetyltransferase [Burkholderia]
 gb|KEZ03888.1| GCN5 family acetyltransferase [Burkholderia sp. MSh2]
 gb|KFG95857.1| GCN5 family acetyltransferase [Burkholderia sp. MSh1]
Length=161

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 85/202 (42%), Gaps = 48/202 (24%)
 Frame = +3

Query  255  RLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEV  434
            R+R A+  DV  I  L  ++ E+  LTHL+  +E  L   LF E P              
Sbjct  6    RIRAAEARDVGAILALMRELAEFEKLTHLFVATEADLADALFGERP--------------  51

Query  435  SATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCF  614
                                              A  + VA+H+  I  YA FF NYS F
Sbjct  52   ----------------------------------AAEARVAEHDGEIVAYALFFHNYSTF  77

Query  615  YDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDM  794
              + G++ E LY R S R  G+G  M   +AA A ++     E  V  WN+ + DFY  M
Sbjct  78   LGRRGLYLEDLYVRPSQRGTGLGTAMLRHLAALAVERRCGRFEWSVLDWNQPAIDFYEKM  137

Query  795  GVEIMDEFRYGKLTGDALQAYA  860
            G  ++ ++R  +LTGDAL   A
Sbjct  138  GATVLPDWRIVRLTGDALDTLA  159



>ref|WP_035925447.1| GCN5 family acetyltransferase [Burkholderia glathei]
 gb|KDR43068.1| GCN5 family acetyltransferase [Burkholderia glathei]
 emb|CDY73757.1| Histone acetyltransferase HPA2 and related acetyltransferases 
[Burkholderia glathei]
Length=160

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 89/204 (44%), Gaps = 48/204 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A  +DVS IY L  ++ E+  LTHL+  +E+ +   LF   P               
Sbjct  5    IRAAAPADVSAIYALMMELAEFEKLTHLFIATEEGVRDALFGHRP---------------  49

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+    I GYA FF N+S F 
Sbjct  50   ---------------------------------AAEALVAEESGQIVGYALFFHNFSTFL  76

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             K G++ E LY R S R  G+G  M  T+AA A ++     E  V  WN+ + DFY  MG
Sbjct  77   GKRGLYLEDLYVRPSLRGTGLGTRMLRTLAALAVERKCGRFEWSVLDWNQPAIDFYEKMG  136

Query  798  VEIMDEFRYGKLTGDALQAYAKKK  869
              ++ ++R  ++TGD+L+  A+ +
Sbjct  137  ATVLPDWRIVRITGDSLETLARPQ  160



>ref|WP_025495639.1| hypothetical protein [Burkholderiales bacterium JGI 0001003-A5]
Length=173

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 95/206 (46%), Gaps = 40/206 (19%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV+ I  L   + E+  LTHL +V+ + L   LF E P          +VE  
Sbjct  6    IRPAELRDVAPIVSLIRDLAEFEKLTHLLQVTPEKLRPHLFGEKP----------VVEAM  55

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
              E PA                              ++V + E+ +  +A +F N+S F 
Sbjct  56   VAEVPA------------------------------ASVGEGESTVVAFALYFTNFSTFL  85

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             +PG++ E L+ + S+R  G+G  M + +A  AA++ +   E  V  WN+ +  FY   G
Sbjct  86   AQPGLYLEDLFVKPSHRASGIGEAMLTRLAKLAAERNYGRFEWSVLDWNESAIRFYEKFG  145

Query  798  VEIMDEFRYGKLTGDALQAYAKKKSS  875
              +M ++R  ++ GDAL A+ K  ++
Sbjct  146  ATVMPDWRICRIAGDALAAFGKPAAA  171



>ref|WP_014191977.1| GCN5 family N-acetyltransferase [Burkholderia sp. YI23]
 ref|YP_004977737.1| acetyltransferase, GnaT family [Burkholderia sp. YI23]
 gb|AET89760.1| acetyltransferase, GnaT family [Burkholderia sp. YI23]
Length=163

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 89/204 (44%), Gaps = 48/204 (24%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R A  +DV  I+ L +++ E+  LTHL+  +E  + + LF   P             
Sbjct  8    ATIRAATPADVPAIFGLMFELAEFEKLTHLFIATEAGVHEALFGARP-------------  54

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                               A  + VA+HE  I  YA FF N+S 
Sbjct  55   -----------------------------------AAEALVAEHEGEIVSYALFFQNFST  79

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  K G++ E LY R S R  G+G LM   +AA A ++     E  V  WN+ + DFY  
Sbjct  80   FLGKRGLYLEDLYVRPSMRGSGLGTLMLKQLAALAVERQCGRFEWSVLDWNQNAIDFYQK  139

Query  792  MGVEIMDEFRYGKLTGDALQAYAK  863
            MG  ++ ++R  ++TG+ L+  A+
Sbjct  140  MGATVLPDWRIVRVTGEPLERLAR  163



>ref|WP_008610194.1| GCN5 family N-acetyltransferase [Alishewanella aestuarii]
 gb|EJI83939.1| N-acetyltransferase GCN5 [Alishewanella aestuarii B11]
Length=163

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 89/206 (43%), Gaps = 48/206 (23%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +RLA ++DV  I K   ++ EY  L+     +E  L   LF   P               
Sbjct  6    IRLATQADVPLILKFIQELAEYEKLSDQVVATEQQLTTTLFSARPAA-------------  52

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                          E ++ E D +                      AG+A FF NYS F 
Sbjct  53   --------------EVVIAECDGQP---------------------AGFALFFHNYSTFL  77

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+    YR LG+G+L+ + +A  A D+G    E  V  WN+ + DFY   G
Sbjct  78   AKPGLYLEDLFVLPQYRALGLGKLLLTYLAKLAVDRGCGRFEWSVLDWNQPAIDFYQAQG  137

Query  798  VEIMDEFRYGKLTGDALQAYAKKKSS  875
              ++ ++R  ++TGD LQA A + S+
Sbjct  138  ATLLHDWRINRVTGDKLQALAAQYSA  163



>ref|WP_006578915.1| acetyltransferase N-acetyltransferase, spermidine/spermine acetyltransferase 
[Cupriavidus sp. HPC(L)]
 gb|ESJ20604.1| GCN5 family N-acetyltransferase [Cupriavidus sp. HPC(L)]
Length=168

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 86/204 (42%), Gaps = 44/204 (22%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A   D   + +L  ++ EY  LTHL + + + L + LF   P     S   +L EV 
Sbjct  8    LRPATTDDCDTLLRLIAELAEYEKLTHLVEATPEKLRQTLFGARP-----SAEAVLAEVP  62

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
              E P                                          G+A FF NYS F 
Sbjct  63   TAEGPRAI---------------------------------------GFALFFHNYSTFL  83

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E LY   ++R  G+G+ +   +A  A ++G    E  V  WN  S DFY  MG
Sbjct  84   AKPGLYLEDLYVEPAWRGHGIGKALLVHLAGLAVERGCGRFEWTVLDWNTPSIDFYRAMG  143

Query  798  VEIMDEFRYGKLTGDALQAYAKKK  869
              ++ ++R  ++TGDAL   A K+
Sbjct  144  ASVLPDWRICRVTGDALTEMAAKQ  167



>ref|WP_017423422.1| GCN5 family N-acetyltransferase [Burkholderia glumae]
Length=164

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 89/202 (44%), Gaps = 48/202 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A  SDV+ +  L  ++ E+ +LTHL+  +E  L   LF  NP               
Sbjct  5    IRDAAPSDVAALIALTRELAEFEALTHLFVATEADLADALFGPNP---------------  49

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA  E  + GYA +F NYS F 
Sbjct  50   ---------------------------------ATGALVATQEGDLIGYALYFQNYSTFV  76

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             K G++ E LY + + R  G+G  +   VAA A ++G    E  V  WN+++ +FY  MG
Sbjct  77   GKRGLYLEDLYVKPTCRGTGLGTRLLRAVAALAVERGCGRFEWTVLDWNRQAIEFYERMG  136

Query  798  VEIMDEFRYGKLTGDALQAYAK  863
              ++ ++R  ++TGDAL A A+
Sbjct  137  AVVLPDWRVVRVTGDALDALAQ  158



>ref|WP_012735004.1| GCN5 family N-acetyltransferase [Burkholderia glumae]
 ref|YP_002910820.1| histone acetyltransferase HPA [Burkholderia glumae BGR1]
 gb|ACR28116.1| Histone acetyltransferase HPA [Burkholderia glumae BGR1]
 gb|KHJ64635.1| GCN5 family acetyltransferase [Burkholderia glumae]
Length=164

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 90/202 (45%), Gaps = 48/202 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A  SDV+ +  L  ++ E+ +LTHL+  +E  L   LF   PNP             
Sbjct  5    IRDAAPSDVAALIALTRELAEFEALTHLFVATEADLADALF--GPNP-------------  49

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA  E  + GYA +F NYS F 
Sbjct  50   ---------------------------------AAGALVATQEGDLIGYALYFQNYSTFV  76

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             K G++ E LY + + R  G+G  +   VAA A ++G    E  V  WN+++ +FY  MG
Sbjct  77   GKRGLYLEDLYVKPTCRGTGLGTRLLRAVAALAVERGCGRFEWTVLDWNRQAIEFYERMG  136

Query  798  VEIMDEFRYGKLTGDALQAYAK  863
              ++ ++R  ++TGDAL A A+
Sbjct  137  AVVLPDWRVVRVTGDALDALAQ  158



>ref|WP_006753061.1| GCN5 family N-acetyltransferase [Burkholderia ambifaria]
 gb|EDT02559.1| GCN5-related N-acetyltransferase [Burkholderia ambifaria IOP40-10]
Length=161

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 85/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++ E+  LTHL+  S+  L   LF   P               
Sbjct  7    IRAAEARDVGAILALMRELAEFEKLTHLFVASDADLADALFGARP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+H+  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAEHDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLQHLAALAVERRCGRFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ E+R  ++TGDAL A A +
Sbjct  139  ASVLPEWRIVRVTGDALGALAAR  161



>ref|WP_021159712.1| Diamine acetyltransferase [Burkholderia sp. AU4i]
 gb|ERJ37850.1| Diamine acetyltransferase [Burkholderia sp. AU4i]
Length=161

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 84/201 (42%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+ SDV  I  L  ++ E+  LTHL+  +E  L   LF   P               
Sbjct  7    IRAAQASDVGAILALMRELAEFEKLTHLFVATEADLADALFGARP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+H+  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEARVAEHDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERSCGRFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ ++R  ++TGDAL   A
Sbjct  139  ATVLPDWRIVRVTGDALDTLA  159



>ref|WP_035501707.1| GCN5 family acetyltransferase [Burkholderia sp. MP-1]
 gb|KAK46980.1| GCN5 family acetyltransferase [Burkholderia sp. MP-1]
Length=163

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 90/204 (44%), Gaps = 48/204 (24%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R A  +DV+ I+ L Y++ E+  LTHL+  + + + + LF   P             
Sbjct  8    ATIRAATPADVAAIFGLMYELAEFEKLTHLFIATREGVHEALFGARP-------------  54

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                               A  + VA+ E  +  YA FF N+S 
Sbjct  55   -----------------------------------AAEALVAEQEGEVVSYALFFQNFST  79

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  K G++ E LY R S R  G+G LM   +AA A ++     E  V  WN+ + DFY  
Sbjct  80   FLGKRGLYLEDLYVRPSLRGSGLGTLMLKKLAALAVERQCGRFEWSVLDWNQNAIDFYEK  139

Query  792  MGVEIMDEFRYGKLTGDALQAYAK  863
            MG  ++ ++R  ++TG++L+  A+
Sbjct  140  MGATVLPDWRIVRVTGESLERLAQ  163



>ref|WP_006157544.1| GCN5 family N-acetyltransferase [Cupriavidus basilensis]
 gb|EHP43313.1| acetyltransferase protein [Cupriavidus basilensis OR16]
Length=167

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 87/197 (44%), Gaps = 44/197 (22%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A  +D   +  L   + EY  LTHL + + + L + LF   P+        +LVEV 
Sbjct  8    LRPATSNDCEALLALITGLAEYEKLTHLVEATPEKLREALFGTRPHA-----EAVLVEVP  62

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
             T+ P                                          G+A FF N+S F 
Sbjct  63   GTQGPQAV---------------------------------------GFALFFHNFSTFL  83

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E LY   ++R  G+G+++   +AA A ++G    E  V  WN  S DFY  MG
Sbjct  84   AKPGLYLEDLYVDPAWRGHGLGKVLLKHLAALAVERGCGRFEWSVLDWNTPSIDFYRAMG  143

Query  798  VEIMDEFRYGKLTGDAL  848
             ++M ++R  ++TGDAL
Sbjct  144  ADVMPDWRICRVTGDAL  160



>ref|WP_033350974.1| GCN5 family acetyltransferase, partial [Burkholderia kururiensis]
Length=159

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 89/205 (43%), Gaps = 48/205 (23%)
 Frame = +3

Query  246  IYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILL  425
            + A +R A  +DV  I+ L Y++ EY  LTHL+  +E  L   LF   P           
Sbjct  1    MTAVVRPATPADVGAIFALMYELAEYEKLTHLFVATEAGLNDALFGPRP-----------  49

Query  426  VEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNY  605
                                                 A  + VAD +  + GYA FF N+
Sbjct  50   -------------------------------------ASEALVADDDGRVVGYALFFHNF  72

Query  606  SCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFY  785
            S F  + G++ E LY + S R  G+G+ M S +AA A ++     E  V  WN+ + DFY
Sbjct  73   STFLGRRGLYLEDLYVQPSQRGTGLGKAMLSRLAALARERQCGRFEWSVLDWNQPAIDFY  132

Query  786  VDMGVEIMDEFRYGKLTGDALQAYA  860
              +G  ++ ++R  ++TGDA+   A
Sbjct  133  EKLGATVLPDWRIVRMTGDAIDRLA  157



>ref|WP_013697060.1| GCN5 family N-acetyltransferase [Burkholderia gladioli]
 ref|YP_004359663.1| Histone acetyltransferase HPA [Burkholderia gladioli BSR3]
 gb|AEA59707.1| Histone acetyltransferase HPA [Burkholderia gladioli BSR3]
Length=164

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 88/202 (44%), Gaps = 48/202 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV+ +  L  ++ ++ SLTHL+  +E  L   LF  NP       T+      
Sbjct  5    IRDAQPDDVADLVALTRELAQFESLTHLFVATEADLADALFGRNPAAGALVATL------  58

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                                    DHE  + GYA +F NYS F 
Sbjct  59   ----------------------------------------DHE--VVGYALYFQNYSTFV  76

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             K G++ E LY + + R  G+G  +   VAA A ++     E  V  WN+++ DFY  MG
Sbjct  77   GKRGLYLEDLYVKPACRGTGLGTRLLRAVAALAVERKCGRFEWTVLDWNRQAIDFYERMG  136

Query  798  VEIMDEFRYGKLTGDALQAYAK  863
              ++ ++R  ++TG+AL A A+
Sbjct  137  ATVLSDWRVVRVTGEALDALAQ  158



>ref|WP_027788021.1| GCN5 family acetyltransferase [Burkholderia cepacia]
 gb|AIO23598.1| acetyltransferase domain protein [Burkholderia cepacia ATCC 25416]
Length=161

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 84/201 (42%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+ SDV  I  L  ++ E+  LTHL+  +E  L   LF   P               
Sbjct  7    IRAAQASDVGAILALMRELAEFEKLTHLFVATEADLADALFGARP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+H+  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEARVAEHDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCGRFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ ++R  ++TGDAL   A
Sbjct  139  ATVLPDWRIVRVTGDALDTLA  159



>ref|WP_011351390.1| GCN5 family N-acetyltransferase [Burkholderia lata]
 ref|YP_368459.1| N-acetyltransferase GCN5 [Burkholderia lata]
 gb|ABB07815.1| GCN5-related N-acetyltransferase [Burkholderia lata]
Length=161

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 84/201 (42%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++ E+  LTHL+  +E  L   LF E P               
Sbjct  7    IRAAQAHDVGVILALMRELAEFEKLTHLFVATEADLADALFGEQP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+H+  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEARVAEHDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCGRFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ ++R  ++TGDAL   A
Sbjct  139  ATVLPDWRIVRVTGDALDTLA  159



>dbj|BAO87040.1| acetyltransferase, GnaT family [Burkholderia sp. RPE67]
Length=163

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 88/204 (43%), Gaps = 48/204 (24%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R A  +DV  I+ L +++ E+  LTHL+  +E  + + LF   P             
Sbjct  8    ATIRAATPADVPAIFGLMFELAEFEKLTHLFIATEAGVHEALFGARP-------------  54

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                               A  + VA+ E  I  YA FF N+S 
Sbjct  55   -----------------------------------AAEALVAEQEGEIVSYALFFQNFST  79

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  K G++ E LY R S R  G+G LM   +AA A ++     E  V  WN+ + DFY  
Sbjct  80   FLGKRGLYLEDLYVRPSMRGSGLGTLMLKQLAALAVERQCGRFEWSVLDWNQNAIDFYEK  139

Query  792  MGVEIMDEFRYGKLTGDALQAYAK  863
            MG  ++ ++R  ++TG+ L+  A+
Sbjct  140  MGATVLPDWRIVRVTGEPLERLAR  163



>ref|WP_027783916.1| GCN5 family acetyltransferase [Burkholderia cepacia]
Length=161

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 84/201 (42%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A   DV  I  L  ++ E+  LTHL+  +E  L   LF E+P               
Sbjct  7    IRAADTRDVGAILALMRELAEFEKLTHLFVATEADLADALFGEHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEARVAEQDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCARFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ E+R  ++TGDAL   A
Sbjct  139  ATVLPEWRIVRVTGDALDTLA  159



>ref|WP_028212918.1| GCN5 family acetyltransferase [Burkholderia mimosarum]
Length=165

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 86/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R A  +DV  ++ L Y++ E+  LTHL+  + + L   LF   P             
Sbjct  3    ATIRAATPADVGAMHALMYELAEFEKLTHLFTGTAEGLADALFGTRP-------------  49

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                               A  + VA+    I GYA FF NYS 
Sbjct  50   -----------------------------------AAEALVAEDAGRIVGYALFFHNYST  74

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  + G++ E LY + S R  G+G  M   +AA A ++G +  E  V  WN  +  FY  
Sbjct  75   FLSRRGLYLEDLYVQPSQRGSGLGTAMLRALAAIAVERGCARFEWTVLDWNTPAIGFYEK  134

Query  792  MGVEIMDEFRYGKLTGDALQAYA  860
            +G  ++ ++R  ++TGDAL+  A
Sbjct  135  LGATVLPDWRVVRMTGDALEKLA  157



>ref|WP_034206758.1| GCN5 family acetyltransferase [Burkholderia cepacia]
 gb|KGB98654.1| acetyltransferase domain protein [Burkholderia cepacia]
Length=161

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 84/201 (42%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A   DV  I  L  ++ E+  LTHL+  +E  L   LF E+P               
Sbjct  7    IRAADPRDVGAILALMRELAEFEKLTHLFVATEADLADALFGEHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEARVAEQDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCARFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ E+R  ++TGDAL   A
Sbjct  139  ATVLPEWRIVRVTGDALDTLA  159



>ref|WP_036052326.1| GCN5 family acetyltransferase [Burkholderia mallei]
 gb|KGC10062.1| acetyltransferase domain protein [Burkholderia mallei]
Length=164

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 88/202 (44%), Gaps = 48/202 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV+ +  L  ++ ++ SLTHL+  +E  L   LF  NP       T+      
Sbjct  5    IRDAQPDDVADLVALTRELAQFESLTHLFVATEADLADALFGLNPAAGALVATL------  58

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                                    DHE  + GYA +F NYS F 
Sbjct  59   ----------------------------------------DHE--VVGYALYFQNYSTFV  76

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             K G++ E LY + + R  G+G  +   VAA A ++     E  V  WN+++ DFY  MG
Sbjct  77   GKRGLYLEDLYVKPACRGTGLGTRLLRAVAALAVERKCGRFEWTVLDWNRQAIDFYERMG  136

Query  798  VEIMDEFRYGKLTGDALQAYAK  863
              ++ ++R  ++TG+AL A A+
Sbjct  137  ATVLSDWRVVRVTGEALDALAQ  158



>ref|WP_038712118.1| GCN5 family acetyltransferase [Burkholderia sp. lig30]
 gb|KDB08418.1| Diamine N-acetyltransferase [Burkholderia sp. lig30]
Length=160

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 85/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A LR A+  DV  I  L  ++ ++  LTHL+  + D L   LF   P+            
Sbjct  5    ATLRAAEARDVGAILALMRELADFEKLTHLFVATGDDLADALFGPRPSAE----------  54

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                                  + VA+ +  I GYA FF NYS 
Sbjct  55   --------------------------------------ALVAERDGAIVGYALFFHNYST  76

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + DFY  
Sbjct  77   FLGRRGLYLEDLYVQPSQRGTGLGTAMLKRLAALAVERRCARFEWSVLDWNQPAIDFYQK  136

Query  792  MGVEIMDEFRYGKLTGDALQAYA  860
            MG  +M ++R  ++TGDAL   A
Sbjct  137  MGATVMPDWRIVRVTGDALATLA  159



>ref|WP_011656330.1| GCN5 family N-acetyltransferase [Burkholderia ambifaria]
 ref|YP_772874.1| N-acetyltransferase GCN5 [Burkholderia ambifaria AMMD]
 gb|ABI86540.1| GCN5-related N-acetyltransferase [Burkholderia ambifaria AMMD]
Length=161

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 86/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++ E+  LTHL+  S+  L   LF  +P               
Sbjct  7    IRAAEARDVGAILALMRELAEFEKLTHLFVASDADLANALFGAHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLQHLAALAVERRCARFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ E+R  ++TGDAL A A +
Sbjct  139  ATVLPEWRIVRVTGDALDALAAR  161



>ref|WP_007741776.1| MULTISPECIES: GCN5 family N-acetyltransferase [Burkholderia]
 gb|EIM94088.1| GCN5-like N-acetyltransferase [Burkholderia terrae BS001]
 gb|EUC17587.1| Diamine N-acetyltransferase [Burkholderia sp. BT03]
Length=161

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 86/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R A   DV  +  L Y++ E+  LTHL+  +ED L   LF   P+            
Sbjct  3    ATIRAATPDDVGTMLALMYELAEFEKLTHLFIATEDGLRDALFGARPSA-----------  51

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                            E IV E D K                     + GYA FF NYS 
Sbjct  52   ----------------EAIVAERDGK---------------------MIGYALFFHNYST  74

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  + G++ E LY + + R  G+G  M   +AA A ++     E  V  WN+ + DFY  
Sbjct  75   FLGRRGLYLEDLYVQPTERGTGLGSKMLRYLAALAVERQCGRFEWSVLDWNQPAIDFYQK  134

Query  792  MGVEIMDEFRYGKLTGDALQAYA  860
            MG  ++ ++R  ++TGDAL   A
Sbjct  135  MGATVLPDWRVVRITGDALDQLA  157



>ref|WP_008342278.1| MULTISPECIES: GCN5 family N-acetyltransferase [Burkholderia]
 gb|EKS73061.1| acetyltransferase, GnaT family protein [Burkholderia sp. SJ98]
 gb|KDR28587.1| GCN5 family acetyltransferase [Burkholderia zhejiangensis]
Length=159

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 86/201 (43%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A  +DV+ I+ L Y++ E+  LTHL+  +E  +   LF   P               
Sbjct  6    IRAASPADVAAIFGLMYELAEFEKLTHLFIATEQGVHDALFGARP---------------  50

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ E  I  YA FF N+S F 
Sbjct  51   ---------------------------------AAEALVAEVEGEIVSYALFFQNFSTFL  77

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             K G++ E LY R S R  G+G LM   +AA A ++     E  V  WN+ + DFY  MG
Sbjct  78   GKRGLYLEDLYVRPSMRGSGLGTLMLKKLAALAVERQCGRFEWSVLDWNQNAIDFYEKMG  137

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ ++R  ++TG+ L+  A
Sbjct  138  ATVLPDWRIVRVTGEPLERLA  158



>ref|WP_012363390.1| GCN5 family N-acetyltransferase [Burkholderia ambifaria]
 ref|YP_001807692.1| N-acetyltransferase GCN5 [Burkholderia ambifaria MC40-6]
 gb|ACB63476.1| GCN5-related N-acetyltransferase [Burkholderia ambifaria MC40-6]
Length=161

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 85/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++ E+  LTHL+  S+  L   LF   P               
Sbjct  7    IRAAEARDVGAILALMRELAEFEKLTHLFVASDADLADALFGARP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLQHLAALAVERRCARFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ E+R  ++TGDAL A A +
Sbjct  139  ATVLPEWRIVRVTGDALGALAAR  161



>ref|WP_019508394.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=171

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/213 (29%), Positives = 94/213 (44%), Gaps = 48/213 (23%)
 Frame = +3

Query  255  RLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEV  434
            ++R A   DV HI+KL   + EY  L+H    + + L + LF        Y+        
Sbjct  6    QIRQAIADDVPHIFKLIEALAEYEKLSHQVTGTVEDLQEHLF----GSRVYA--------  53

Query  435  SATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCF  614
                           E IV E+D K                     I G+A FFPNYS F
Sbjct  54   ---------------EAIVTEWDGK---------------------IIGFALFFPNYSTF  77

Query  615  YDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDM  794
              KPGI+ E L+    YR+ G+G+ M + +   A ++    +E  V  WN+ +  FY DM
Sbjct  78   LTKPGIYLEDLFVLPEYRRRGIGKAMLAYLGKLAIERDAGRLEWSVLDWNESAIAFYQDM  137

Query  795  GVEIMDEFRYGKLTGDALQAYAKKKSS*FIYCK  893
            G +++ ++R  ++T DALQ  A+  ++    C 
Sbjct  138  GAKVLPDWRICRVTEDALQKLAECNTNSIKVCN  170



>ref|WP_006757678.1| GCN5 family N-acetyltransferase [Burkholderia ambifaria]
 gb|EDT42542.1| GCN5-related N-acetyltransferase [Burkholderia ambifaria MEX-5]
Length=161

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 86/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++ E+  LTHL+  S+  L   LF  +P               
Sbjct  7    IRAAEARDVGAILALMRELAEFEKLTHLFVASDADLADALFGAHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLQHLAALAVERRCARFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ E+R  ++TGDAL A A +
Sbjct  139  ATVLPEWRIVRVTGDALGALAAR  161



>ref|WP_016345900.1| GCN5-related N-acetyltransferase [Burkholderia sp. RPE64]
 ref|YP_008038146.1| GCN5-related N-acetyltransferase [Burkholderia sp. RPE64]
 dbj|BAN23750.1| GCN5-related N-acetyltransferase [Burkholderia sp. RPE64]
Length=166

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 87/203 (43%), Gaps = 48/203 (24%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R A  +D+  I+ L Y++ E+  LTHL+  +E+ +   LF   P             
Sbjct  11   ATIRAATPADIPAIFALMYELAEFEKLTHLFIATEEGVHDALFGARP-------------  57

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                               A  + VA+ +  I  YA FF N+S 
Sbjct  58   -----------------------------------AAEALVAERDGEIVSYALFFQNFST  82

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  K G++ E LY R S R  G+G LM   +AA A ++     E  V  WN+ + DFY  
Sbjct  83   FLGKRGLYLEDLYVRPSMRGSGLGTLMLKKLAALAVERQCGRFEWSVLDWNQNAIDFYEK  142

Query  792  MGVEIMDEFRYGKLTGDALQAYA  860
            MG  ++ ++R  ++TG+ L+  A
Sbjct  143  MGATVLPDWRIVRVTGEPLERLA  165



>ref|WP_034183081.1| GCN5 family acetyltransferase [Burkholderia pyrrocinia]
 gb|KFL51515.1| GCN5 family acetyltransferase [Burkholderia pyrrocinia]
Length=161

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 83/203 (41%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++ E+  LTHL+  +E  L   LF E P               
Sbjct  7    IRAAEARDVGAILALMRELAEFEKLTHLFVATEADLADALFGERP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+    I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERNGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRYLAALAVERRCGRFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ E+R  ++TGDAL   A +
Sbjct  139  ATVLPEWRIVRVTGDALDTLAGR  161



>ref|WP_036031788.1| GCN5 family acetyltransferase [Burkholderia gladioli]
 gb|KGE10871.1| GCN5 family acetyltransferase [Burkholderia gladioli]
Length=164

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 88/202 (44%), Gaps = 48/202 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV+ +  L  ++ ++ SLTHL+  +E  L   LF  NP       T+      
Sbjct  5    IRDAQPDDVADLVALTRELAQFESLTHLFVATEADLADALFGRNPAAGALVATL------  58

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                                    D+E  + GYA +F NYS F 
Sbjct  59   ----------------------------------------DNE--VVGYALYFQNYSTFV  76

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             K G++ E LY + + R  G+G  +   VAA A ++     E  V  WN+++ DFY  MG
Sbjct  77   GKRGLYLEDLYVKPACRGTGLGTRLLRAVAALAVERKCGRFEWTVLDWNRQAIDFYERMG  136

Query  798  VEIMDEFRYGKLTGDALQAYAK  863
              ++ ++R  ++TG+AL A A+
Sbjct  137  ATVLSDWRVVRVTGEALDALAQ  158



>ref|WP_026162414.1| acetyltransferase [Corynebacterium ulceribovis]
Length=174

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 92/203 (45%), Gaps = 30/203 (15%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A+  DV  I +L   + EY       K +E+SL   LF+ENP    +   I +V   
Sbjct  2    LRPAEPKDVPQILQLIKDLAEYEKEPDAVKATEESLHDHLFRENP--ALFGTVIEIVNKQ  59

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                   KA ++ D +D   ++V      +AG A +F N+S + 
Sbjct  60   -----------------------KAGISADAADGTDASVQ-----LAGMALWFLNFSTWE  91

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
               GI+ E LY R   R  G+G+ +  ++A    ++ +  +E  V  WNK S DFY  +G
Sbjct  92   CTHGIYLEDLYVRPELRGKGLGKQLLQSLAQICVERDYQRLEWCVLKWNKPSIDFYHRVG  151

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
               MDE+   +LTGDAL  +  K
Sbjct  152  AFPMDEWDTFRLTGDALTQFGAK  174



>ref|WP_023475861.1| Diamine acetyltransferase [Burkholderia cenocepacia]
 gb|ESS39893.1| Diamine acetyltransferase [Burkholderia cenocepacia KC-01]
Length=161

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 84/201 (42%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A   DV  I  L  ++ E+  LTHL+  +E  L   LF E+P               
Sbjct  7    IRAADPRDVGAILALMRELAEFEKLTHLFVATEADLADALFGEHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCARFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ E+R  ++TGDAL   A
Sbjct  139  ASVLPEWRIVRVTGDALDTLA  159



>ref|WP_028215970.1| GCN5 family acetyltransferase [Burkholderia oxyphila]
Length=165

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 85/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R A  +DVS ++ L Y++ E+  LTHL+  + + L   LF   P+            
Sbjct  3    ATIRAATPADVSAMHALMYELAEFEKLTHLFTGTPEGLADALFGARPSA-----------  51

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                                  + VA+    I GYA FF NYS 
Sbjct  52   -------------------------------------EALVAEEAGRIVGYALFFHNYST  74

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+ +  FY  
Sbjct  75   FLGRRGLYLEDLYVQPSQRGTGLGTAMLRALAAIAVERQCGRFEWTVLDWNEPAIRFYEK  134

Query  792  MGVEIMDEFRYGKLTGDALQAYA  860
            MG  ++ ++R  ++TGDAL   A
Sbjct  135  MGATVLPDWRVVRVTGDALDQLA  157



>ref|WP_011544925.1| GCN5 family N-acetyltransferase [Burkholderia cenocepacia]
 ref|YP_620509.1| N-acetyltransferase GCN5 [Burkholderia cenocepacia AU 1054]
 ref|YP_834751.1| GCN5-like N-acetyltransferase [Burkholderia cenocepacia HI2424]
 ref|YP_001764363.1| N-acetyltransferase GCN5 [Burkholderia cenocepacia MC0-3]
 gb|ABF75536.1| GCN5-related N-acetyltransferase [Burkholderia cenocepacia AU 
1054]
 gb|ABK07858.1| GCN5-related N-acetyltransferase [Burkholderia cenocepacia HI2424]
 gb|ACA90241.1| GCN5-related N-acetyltransferase [Burkholderia cenocepacia MC0-3]
 gb|KGY59297.1| GCN5 family acetyltransferase [Burkholderia cepacia]
Length=161

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 84/201 (42%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A   DV  I  L  ++ E+  LTHL+  +E  L   LF E+P               
Sbjct  7    IRAADPRDVGAILALMRELAEFEKLTHLFVATEADLADALFGEHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCARFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ E+R  ++TGDAL   A
Sbjct  139  ATVLPEWRIVRVTGDALDTLA  159



>ref|WP_026795041.1| MULTISPECIES: GNAT family acetyltransferase [Planktothrix]
Length=162

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 93/206 (45%), Gaps = 48/206 (23%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A LR A   D+S +++L   + EY  L+H    + ++L + LF      P Y+  IL   
Sbjct  5    ATLRPATIEDISVLFELIQALAEYEKLSHEVTGNAETLKQHLF----GSPCYAEAIL---  57

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                                     A+ E    G+A FF NYS 
Sbjct  58   -----------------------------------------AEIEGKAVGFALFFNNYST  76

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  +PG++ E L+  A YR+ G+G+ + + +A  A  +G+  +E  V  WN+ + +FY  
Sbjct  77   FLTQPGMYLEDLFVLAEYRRQGIGKALITYLAELAVSRGYGRLEWSVLEWNQPAINFYQK  136

Query  792  MGVEIMDEFRYGKLTGDALQAYAKKK  869
            +G +I+ ++R  +LTG++L  Y K K
Sbjct  137  IGAKILPDWRICRLTGESLTQYGKNK  162



>ref|WP_008983230.1| GCN5 family N-acetyltransferase [Alishewanella agri]
 gb|EIW90463.1| N-acetyltransferase GCN5 [Alishewanella agri BL06]
Length=168

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 84/203 (41%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +RLA  +DV  I K    + EY  L H    +E  L + LF   P               
Sbjct  10   IRLATVADVPLILKFIQGLAEYEKLAHEVVATEQKLTETLFSAQP---------------  54

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A    +A+++   AG+A FF NYS F 
Sbjct  55   ---------------------------------AAEVVIAEYQGQPAGFALFFHNYSTFL  81

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+    YR  G+G+L+ + +A  A D+G    E  V  WN+ + DFY   G
Sbjct  82   AKPGLYLEDLFVLPEYRGKGLGKLLLTYLAKLAVDRGCGRFEWSVLDWNQPAIDFYQAQG  141

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              +M ++R  ++TGD L A A +
Sbjct  142  AVLMHDWRINRVTGDKLTALASQ  164



>ref|WP_027810607.1| GCN5 family acetyltransferase [Burkholderia cenocepacia]
Length=161

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 84/201 (42%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A   DV  I  L  ++ E+  LTHL+  +E  L   LF E+P               
Sbjct  7    IRAADPRDVGAILVLMRELAEFEKLTHLFVATEADLADALFGEHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYLQPSQRGTGLGTAMLRHLAALAVERRCARFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ E+R  ++TGDAL   A
Sbjct  139  ATVLPEWRIVRVTGDALDILA  159



>ref|WP_034186484.1| GCN5 family acetyltransferase [Burkholderia cenocepacia]
 gb|KEA60418.1| GCN5 family acetyltransferase [Burkholderia cenocepacia]
Length=161

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 85/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++  +  LT L+  +E  L   LF E+P               
Sbjct  7    IRAAETRDVGAILALMRELAAFEKLTDLFVATEADLADALFGEHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+H+  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEARVAEHDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCARFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ E+R  ++TGDAL   A +
Sbjct  139  ATVLPEWRIVRVTGDALGTLAGQ  161



>gb|EAY62431.1| Histone acetyltransferase HPA13 [Burkholderia cenocepacia PC184]
Length=189

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 84/201 (42%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A   DV  I  L  ++ E+  LTHL+  +E  L   LF E+P               
Sbjct  35   IRAADPRDVGAILALMRELAEFEKLTHLFVATEADLADALFGEHP---------------  79

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  80   ---------------------------------AAEALVAERDGAIVAYALFFHNYSTFL  106

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + DFY  MG
Sbjct  107  GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCARFEWSVLDWNQPAIDFYEKMG  166

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ E+R  ++TGDAL   A
Sbjct  167  ATVLPEWRIVRVTGDALDTLA  187



>ref|WP_006401289.1| GCN5 family N-acetyltransferase [Burkholderia multivorans]
 gb|EED98768.1| acetyltransferase, gnat family [Burkholderia multivorans CGD1]
 gb|EEE03707.1| acetyltransferase, gnat family [Burkholderia multivorans CGD2]
 gb|EEE10998.1| acetyltransferase, gnat family [Burkholderia multivorans CGD2M]
 gb|EJO53195.1| FR47-like protein [Burkholderia multivorans ATCC BAA-247]
Length=161

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 84/203 (41%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A   DV  I  L  ++ E+  L HL+  +E  L   LF  +P               
Sbjct  7    IRAADARDVGAILALMRELAEFEKLAHLFVATEADLADALFGAHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+++ DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRQLAALAVERRCGRFEWSVLDWNQRAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ ++R  ++TGDAL A A +
Sbjct  139  ATVLPDWRIVRVTGDALDALAAR  161



>ref|WP_028206700.1| GCN5 family acetyltransferase [Burkholderia nodosa]
Length=165

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 83/194 (43%), Gaps = 48/194 (25%)
 Frame = +3

Query  279  DVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVSATEFPAP  458
            DV  ++ L Y++ E+  LTHL+  + D L   LF   P                      
Sbjct  12   DVGAMHALMYELAEFEKLTHLFTGTADGLADALFGTRPAA--------------------  51

Query  459  TPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFF  638
                   E +V E            DA R         I GYA FF NYS F  + G++ 
Sbjct  52   -------EALVAE------------DAGR---------IVGYALFFHNYSTFLSRRGLYL  83

Query  639  ESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEF  818
            E LY + S R  G+G  M   +AA A ++G +  E  V  WN  +  FY  +G  ++ ++
Sbjct  84   EDLYVQPSQRGTGLGTAMLRALAAIAVERGCARFEWTVLDWNTPAIGFYEKLGATVLPDW  143

Query  819  RYGKLTGDALQAYA  860
            R  ++TGDAL+  A
Sbjct  144  RVVRMTGDALEKLA  157



>ref|WP_012213804.1| GCN5 family N-acetyltransferase [Burkholderia multivorans]
 ref|YP_001580380.1| N-acetyltransferase GCN5 [Burkholderia multivorans ATCC 17616]
 ref|YP_001945523.1| putative N-acetyltransferase [Burkholderia multivorans ATCC 17616]
 gb|ABX15883.1| GCN5-related N-acetyltransferase [Burkholderia multivorans ATCC 
17616]
 dbj|BAG42987.1| putative N-acetyltransferase [Burkholderia multivorans ATCC 17616]
Length=161

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 84/203 (41%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A   DV  I  L  ++ E+  L HL+  +E  L   LF  +P               
Sbjct  7    IRAADARDVGAILALMRELAEFEKLAHLFVATEADLADALFGAHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+++ DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRQLAALAVERRCGRFEWSVLDWNQRAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ ++R  ++TGDAL A A +
Sbjct  139  ATVLPDWRIVRVTGDALDALAAR  161



>gb|KEI67893.1| GCN5-related N-acetyltransferase [Planktothrix agardhii NIVA-CYA 
126/8]
Length=162

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 93/206 (45%), Gaps = 48/206 (23%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A LR A   D+S +++L   + EY  L+H    + ++L + LF      P Y+  IL   
Sbjct  5    ATLRPATIEDISVLFELIQALAEYEKLSHEVTGNAETLKQHLF----GSPCYAEAIL---  57

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                                     A+ +    G+A FF NYS 
Sbjct  58   -----------------------------------------AEIQGKTVGFALFFNNYST  76

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  +PG++ E L+  A YR+ G+G+ + + +A  A  +G+  +E  V  WN+ + +FY  
Sbjct  77   FLTQPGMYLEDLFVLAEYRRQGIGKALITYLAELAVSRGYGRLEWSVLEWNQPAINFYQK  136

Query  792  MGVEIMDEFRYGKLTGDALQAYAKKK  869
            +G +I+ ++R  +LTG++L  Y K K
Sbjct  137  IGAKILPDWRICRLTGESLTQYGKNK  162



>ref|WP_010091812.1| GCN5 family N-acetyltransferase [Burkholderia ubonensis]
Length=161

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 86/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++ E+  LTHL+  +E  L   LF  +P               
Sbjct  7    IRAAEARDVGAILALMRELAEFEQLTHLFVATEHDLADALFGAHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  +  YA FF NYS F 
Sbjct  52   ---------------------------------AGEALVAERDGALVAYALFFHNYSTFV  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+++ DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRQLAALAVERRCARFEWSVLDWNQRAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ ++R  ++TGDAL   A +
Sbjct  139  ATVLPDWRIVRVTGDALDTLAGR  161



>ref|WP_028445713.1| hypothetical protein [Chitinimonas koreensis]
Length=166

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 87/204 (43%), Gaps = 44/204 (22%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  D   IY+L  ++ +Y  LTHL   + + L + L+   P               
Sbjct  7    VRDARPGDAEPIYRLVRELADYEKLTHLCTGNAEQLHEHLWGARPY--------------  52

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                          E +V E +                    + Y  G+A +F NYS F 
Sbjct  53   -------------IEALVAEVERAG-----------------QPYAVGFAIYFHNYSSFV  82

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+    YR+ G+G  MF  VAA A  +G    E  V  WN  + +FY  +G
Sbjct  83   AKPGLYLEDLFVLPEYRRNGIGEAMFREVAARAVARGCGRFEWAVLDWNAPALNFYRKLG  142

Query  798  VEIMDEFRYGKLTGDALQAYAKKK  869
              +M ++R  + TGD L+A A ++
Sbjct  143  ATVMPDWRICRATGDTLRAMAGQR  166



>ref|WP_035972783.1| GCN5 family acetyltransferase [Burkholderia dolosa]
 gb|ETP66013.1| GCN5 family N-acetyltransferase [Burkholderia dolosa PC543]
Length=161

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 85/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  +  L  ++ E+  LTHL+  ++  L   LF   P               
Sbjct  7    IRSAEARDVGAVLALMRELAEFEKLTHLFVATDADLADALFGARP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+++ DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCGRFEWSVLDWNRRAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ ++R  ++TGDAL A A +
Sbjct  139  ATVLPDWRIVRVTGDALDALAAR  161



>ref|WP_025098976.1| GCN5 family acetyltransferase [Burkholderia sp. A1]
Length=164

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 87/202 (43%), Gaps = 48/202 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV+ +  L  ++ ++ SLTHL+  +E  L   LF  NP       T+      
Sbjct  5    IRDAQPDDVADLVALTRELAQFESLTHLFVATEADLADALFGRNPAAGALVATL------  58

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                                    D+E  + GYA +F NYS F 
Sbjct  59   ----------------------------------------DNE--VVGYALYFQNYSTFV  76

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             K G++ E LY + + R  G+G  +   VAA A ++     E  V  WN+++ DFY  MG
Sbjct  77   GKRGLYLEDLYVKPACRGTGLGTRLLRAVAALAVERKCGRFEWTVLDWNRQAIDFYERMG  136

Query  798  VEIMDEFRYGKLTGDALQAYAK  863
              ++ ++R  ++TG+AL   A+
Sbjct  137  ATVLSDWRVVRVTGEALDTLAQ  158



>ref|WP_035990152.1| GCN5 family acetyltransferase [Burkholderia caribensis]
 gb|ETY78895.1| Histone acetyltransferase HPA2 [Burkholderia caribensis MBA4]
Length=161

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 84/203 (41%), Gaps = 48/203 (24%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R A   D   +  L Y++ E+  LTHL+  +ED L   LF   P+            
Sbjct  3    ATIRAATPDDAGTMLALMYELAEFEKLTHLFIATEDGLRDALFGARPSA-----------  51

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                            E IV E D K                       GYA FF NYS 
Sbjct  52   ----------------EAIVAERDGKT---------------------IGYALFFHNYST  74

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  + G++ E LY + + R  G+G  M   +AA A ++     E  V  WN+ + DFY  
Sbjct  75   FLGRRGLYLEDLYVQPTERGTGLGSKMLRYLAALAVERQCGRFEWSVLDWNQPAIDFYQK  134

Query  792  MGVEIMDEFRYGKLTGDALQAYA  860
            MG  ++ ++R  ++TGDAL   A
Sbjct  135  MGATVLPDWRVVRITGDALDQLA  157



>gb|KER71290.1| GCN5 family acetyltransferase [Burkholderia cepacia]
Length=161

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 84/201 (42%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++ E+  LTHL+  +E  L   LF  +P               
Sbjct  7    IRAAQARDVGAILALMRELAEFEKLTHLFVATEADLADALFGAHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEARVAERDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCARFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ ++R  ++TGDAL   A
Sbjct  139  ATVLPDWRIVRVTGDALDTLA  159



>ref|WP_011613738.1| GNAT family acetyltransferase [Trichodesmium erythraeum]
 ref|YP_723886.1| N-acetyltransferase GCN5 [Trichodesmium erythraeum IMS101]
 gb|ABG53413.1| GCN5-related N-acetyltransferase [Trichodesmium erythraeum IMS101]
Length=173

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 91/205 (44%), Gaps = 40/205 (20%)
 Frame = +3

Query  255  RLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEV  434
            +LR+AK +DVS ++ L   + EY +L+H    +  SL   LF E                
Sbjct  7    KLRVAKRADVSILFDLIKALAEYENLSHAVTGNVASLEAHLFGE----------------  50

Query  435  SATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCF  614
                   P  D S + P+ +                   +A+      G++ FF NYS F
Sbjct  51   -------PDSDRSNYRPMAEAI-----------------IAELTGKPVGFSLFFYNYSTF  86

Query  615  YDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDM  794
              +PGI+ E L+    YR  G+G+ + S +A  A  +    +E  V  WNK +  FY  M
Sbjct  87   LTQPGIYIEDLFVLPDYRGRGIGKRLISYLAQLAVSQNCGRLEWSVLDWNKPAIGFYKHM  146

Query  795  GVEIMDEFRYGKLTGDALQAYAKKK  869
            G  I+DE+R  ++T +AL   A ++
Sbjct  147  GASILDEWRICRVTDNALGKLASQQ  171



>gb|AIO32497.1| acetyltransferase domain protein [Burkholderia cenocepacia]
Length=161

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 86/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  +  L  ++ E+  LTHL+  +E  L   LF  +P               
Sbjct  7    IRAAEARDVGAMLALMRELAEFEQLTHLFVATEADLADALFGAHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  +  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGALVAYALFFHNYSTFV  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+++ +FY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLKRLAALAVERRCARFEWSVLDWNQRAIEFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ E+R  ++TGDAL   A +
Sbjct  139  ATVLPEWRIVRMTGDALDTLAGR  161



>ref|WP_039348442.1| GCN5 family acetyltransferase [Mumia flava]
 gb|KHL16015.1| GCN5 family acetyltransferase [Mumia flava]
Length=161

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 82/201 (41%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++ E+  L HL+  +E  L   LF E P               
Sbjct  7    IRAAQARDVGAILALMRELAEFEKLAHLFVATEADLADALFGEQP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+H+  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEARVAEHDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCGRFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ ++R  ++T DAL   A
Sbjct  139  ATVLPDWRIVRVTDDALDTLA  159



>gb|AIO75301.1| acetyltransferase domain protein [Burkholderia multivorans]
Length=161

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 84/203 (41%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A   DV  I  L  ++ E+  L HL+  +E  L   LF  +P               
Sbjct  7    IRAADARDVGAILALMRELAEFEKLAHLFVATEADLADALFGTHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  +  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGALVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+++ DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRQLAALAVERRCGRFEWSVLDWNQRAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ ++R  ++TGDAL A A +
Sbjct  139  ATVLPDWRIVRVTGDALDALAAR  161



>ref|WP_023175246.1| GCN5-related N-acetyltransferase [Gloeobacter kilaueensis]
 ref|YP_008713637.1| GCN5-related N-acetyltransferase [Gloeobacter kilaueensis JS1]
 gb|AGY59930.1| GCN5-related N-acetyltransferase [Gloeobacter kilaueensis JS1]
Length=162

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 89/202 (44%), Gaps = 48/202 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A+++DV  I+ L  ++ +Y  L+H    SE  L   LF                   
Sbjct  5    LRPARQADVPLIFALIAELADYEKLSHALIGSEQLLAAHLF-------------------  45

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                  PTP    F  ++                    +A+ EA  AG+A +F NYS F 
Sbjct  46   -----GPTP----FARVI--------------------LAEVEAQTAGFALYFFNYSTFL  76

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             +PGI+ E LY RA +R  G+G  +   +A  A   G   +E  V  WN  +  FY  +G
Sbjct  77   TRPGIYLEDLYVRADWRGCGVGTALLRHLAHEAVAAGCGRIEWSVLDWNATAIRFYQKIG  136

Query  798  VEIMDEFRYGKLTGDALQAYAK  863
              I+D++R  +L+G+AL   A+
Sbjct  137  AVILDDWRQCRLSGEALLQLAE  158



>ref|WP_008960816.1| N-acetyltransferase GCN5 [Bradyrhizobium sp. STM 3809]
 emb|CCD98206.1| putative acetyltransferase family protein; spermidine/spermine 
acetyltransferase [Bradyrhizobium sp. STM 3809]
Length=161

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 74/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  480  EPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRA  659
            E +  E D+ + +  D    F  ++A+    +AG+A +F N+S F  KPGI+ E L+ R 
Sbjct  32   EVVASEADIASALFCDHPTLF-CDLAEWNGAVAGFAVWFVNFSTFAGKPGIYLEDLFVRP  90

Query  660  SYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTG  839
             +R+ G+G+ +   +A    +KG++ ++  V  WN  S  FY  +G E++DE++  K+TG
Sbjct  91   VFRRNGIGQALLGHLARTCVEKGWARLQWSVLDWNAPSITFYKSLGAEMLDEWKLCKVTG  150

Query  840  DALQAYAKK  866
             AL   A++
Sbjct  151  PALTQLAER  159



>ref|WP_006764811.1| GCN5 family N-acetyltransferase [Burkholderia dolosa]
 gb|EAY69361.1| Histone acetyltransferase HPA10 [Burkholderia dolosa AUO158]
Length=189

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 85/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  +  L  ++ E+  LTHL+  ++  L   LF   P               
Sbjct  35   IRSAEARDVGAVLALMRELAEFEKLTHLFVATDADLADALFGARP---------------  79

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  80   ---------------------------------AAEALVAERDGAIVAYALFFHNYSTFL  106

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+++ DFY  MG
Sbjct  107  GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCGRFEWSVLDWNRRAIDFYEKMG  166

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ ++R  ++TGDAL A A +
Sbjct  167  ATVLPDWRIVRVTGDALDALAAR  189



>ref|WP_035547399.1| GCN5 family acetyltransferase [Burkholderia sp. 9120]
Length=162

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 88/208 (42%), Gaps = 48/208 (23%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R A  +D S I+ L Y++ E+ SLTH++  +ED L   LF   P+            
Sbjct  3    AAIRAATPADTSAIFALTYELAEFESLTHVFVATEDGLRDALFGTRPS------------  50

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                                  + VA+ E  I GYA FF NYS 
Sbjct  51   ------------------------------------IEALVAEQEGRIVGYALFFHNYSS  74

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F    G++ E +Y + S R  G+G  +   +AA A ++     E  V  WN+ + +FY  
Sbjct  75   FVGTRGLYLEDVYVQPSRRGSGLGSALLQRLAALAVERQCGRFEWTVLDWNQPAINFYEK  134

Query  792  MGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            MG  +M ++R  +LTGDAL   A    +
Sbjct  135  MGATVMPDWRVVRLTGDALAKLAAGTGA  162



>ref|WP_012029159.1| N-acetyltransferase GCN5 [Bradyrhizobium sp. ORS 278]
 ref|YP_001207466.1| acetyltransferase [Bradyrhizobium sp. ORS 278]
 emb|CAL79249.1| Putative acetyltransferase family protein; putative spermidine/spermine 
acetyltransferase [Bradyrhizobium sp. ORS 278]
Length=161

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 73/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  480  EPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRA  659
            E +  E D+ A +  D    F  ++A+    +AG+A +F N+S F  KPGI+ E L+ R 
Sbjct  32   EVVASEADIAAALFCDHPTLF-CDLAEWNGAVAGFAVWFVNFSTFAGKPGIYLEDLFVRP  90

Query  660  SYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTG  839
             +R+ G+G+ +   +A     KG++ ++  V  WN  S  FY  +G E+MD+++  K+TG
Sbjct  91   VFRRNGIGQALLGHLARTCVAKGWARMQWSVLDWNAPSITFYKSLGAELMDDWKLCKVTG  150

Query  840  DALQAYAKK  866
             AL   A++
Sbjct  151  PALTQLAER  159



>ref|WP_035949763.1| GCN5 family acetyltransferase [Burkholderia multivorans]
 gb|KGC02932.1| acetyltransferase domain protein [Burkholderia multivorans]
Length=161

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 84/203 (41%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A   DV  I  L  ++ E+  L HL+  +E  L   LF  +P               
Sbjct  7    IRAADARDVGAILALMRELAEFEKLAHLFVATEADLADALFGAHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  +  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGALVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+++ DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRQLAALAIERRCGRFEWSVLDWNQRAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ ++R  ++TGDAL A A +
Sbjct  139  ATVLPDWRIVRVTGDALDALAAR  161



>ref|WP_026788245.1| MULTISPECIES: GNAT family acetyltransferase [Planktothrix]
Length=162

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 92/206 (45%), Gaps = 48/206 (23%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A LR A   D+S +++L   + EY  L+H    + ++L + LF      P Y+  IL   
Sbjct  5    ATLRPATIEDISVLFELIQALAEYEKLSHEVTGNAETLKQHLF----GSPCYAEAIL---  57

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                                     A+ E    G+A FF NYS 
Sbjct  58   -----------------------------------------AEIEGKAVGFALFFNNYST  76

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  +PG++ E L+    YR+ G+G+ + + +A  A  +G+  +E  V  WN+ + +FY  
Sbjct  77   FLTQPGMYLEDLFVLPEYRRQGIGKALITYLAELAVSRGYGRLEWSVLDWNQPAINFYQK  136

Query  792  MGVEIMDEFRYGKLTGDALQAYAKKK  869
            +G +I+ ++R  +LTG++L  Y K K
Sbjct  137  IGAKILPDWRICRLTGESLTQYGKNK  162



>ref|WP_011489409.1| GCN5 family N-acetyltransferase [Burkholderia xenovorans]
 ref|YP_559942.1| acetyltransferase [Burkholderia xenovorans LB400]
 gb|ABE31890.1| Putative acetyltransferase [Burkholderia xenovorans LB400]
 gb|AIP30910.1| acetyltransferase domain protein [Burkholderia xenovorans LB400]
Length=174

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 90/203 (44%), Gaps = 48/203 (24%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R A  +D   I+ L Y++ E+ SLTH++  +E+ L   LF   P+            
Sbjct  3    ATIRAATPADTGAIFALTYELAEFESLTHVFVATEEGLHDALFGARPS------------  50

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                                  + VA++E+ I GYA FF NYS 
Sbjct  51   ------------------------------------IEALVAENESRIVGYALFFHNYSS  74

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  K G++ E +Y + S R  G+G  +   +AA A ++     E  V  WN+++  FY  
Sbjct  75   FVGKRGLYLEDVYVQPSQRGSGLGTALLRRLAALAVERQCGRFEWTVLDWNRQAISFYEK  134

Query  792  MGVEIMDEFRYGKLTGDALQAYA  860
            MG  +M ++R  +LTG+AL+  A
Sbjct  135  MGATVMPDWRVVRLTGNALEQLA  157



>ref|WP_013320181.1| GNAT family acetyltransferase [Cyanothece sp. PCC 7822]
 ref|YP_003885346.1| N-acetyltransferase GCN5 [Cyanothece sp. PCC 7822]
 gb|ADN12071.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 7822]
Length=162

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 63/105 (60%), Gaps = 0/105 (0%)
 Frame = +3

Query  552  VADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGF  731
            VA+ E+ I G+A FFPNYS F  KPGI+ E L+    YR+ G+G+ +   +A  A ++  
Sbjct  57   VAEWESKIVGFALFFPNYSTFLTKPGIYLEDLFVLPEYRRKGIGKALLMYLAQLALERKA  116

Query  732  SSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKK  866
              +E  V  WN+ + DFY  +G  ++ ++R  ++TG+AL   A K
Sbjct  117  GRLEWSVLDWNQPAIDFYQSIGASVLPDWRICRVTGNALSQLALK  161



>ref|WP_015227047.1| N-acetyltransferase GCN5 [Halothece sp. PCC 7418]
 ref|YP_007169389.1| N-acetyltransferase GCN5 [Halothece sp. PCC 7418]
 gb|AFZ45175.1| GCN5-related N-acetyltransferase [Halothece sp. PCC 7418]
Length=167

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 87/204 (43%), Gaps = 48/204 (24%)
 Frame = +3

Query  255  RLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEV  434
            ++R A+  DVS I  L   +  Y  L+     + ++L + LF E P    Y+  +     
Sbjct  8    QIRSAQREDVSAIMGLIEALAAYEHLSDAVTGNAETLAEHLFGETP----YAEVL-----  58

Query  435  SATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCF  614
                                                   VA+    I G+A FF NYS F
Sbjct  59   ---------------------------------------VAEWGEIIVGFALFFSNYSTF  79

Query  615  YDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDM  794
              +PGI+ E L+  + YR  G+GR + S VA  A  +G   +E  V  WN+ + DFY  M
Sbjct  80   LTQPGIYLEDLFVLSEYRGCGVGRALISAVATIAHQRGAGRLEWSVLDWNQPAIDFYQAM  139

Query  795  GVEIMDEFRYGKLTGDALQAYAKK  866
            G +++ ++R  ++TG A+   A +
Sbjct  140  GAQVLPDWRICRVTGSAIAQLATQ  163



>ref|WP_011517457.1| GCN5 family N-acetyltransferase [Cupriavidus metallidurans]
 ref|YP_585052.1| GCN5-related N-acetyltransferase [Cupriavidus metallidurans CH34]
 gb|ABF09783.1| GCN5-related N-acetyltransferase [Cupriavidus metallidurans CH34]
Length=163

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 90/197 (46%), Gaps = 44/197 (22%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A  +D   +Y L   + EY  LTHL + +   LC  LF  +P        ++++EV 
Sbjct  6    IRPAAPADSETLYNLISALAEYEKLTHLVEATPQKLCDALFGAHPGA-----EVVILEVD  60

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                      ESG  P+                              G+A FF N+S F 
Sbjct  61   T---------ESGKLPV------------------------------GFALFFHNFSTFL  81

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+   ++R  G+G+ +   +AA A ++G    E  V  WN+ S DFY  MG
Sbjct  82   AKPGLYLEDLFVDPAWRGHGLGKALLKHLAALAVERGCGRFEWSVLDWNQPSIDFYRAMG  141

Query  798  VEIMDEFRYGKLTGDAL  848
             ++M ++R  ++TGDAL
Sbjct  142  ADVMPDWRICRVTGDAL  158



>ref|WP_009029395.1| N-acetyltransferase GCN5 [Bradyrhizobium sp. ORS 375]
 emb|CCD94458.1| putative acetyltransferase family protein; spermidine/spermine 
acetyltransferase [Bradyrhizobium sp. ORS 375]
Length=161

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 91/203 (45%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+ +D+  ++ L  ++ +Y  L+H    SE  +   LF ++P       T+L     
Sbjct  5    IRSARPADIGVVFALIRELADYEKLSHEVVASEADIAAALFCDHP-------TLL-----  52

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                                 ++A+    +AG+A +F N+S F 
Sbjct  53   ------------------------------------CDLAEWNGAVAGFAVWFVNFSTFA  76

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPGI+ E L+ R  +R+ G+G+ +   +A    +KG++ ++  V  WN  S  FY  +G
Sbjct  77   GKPGIYLEDLFVRPVFRRNGIGQALLGHLARTCVEKGWARLQWSVLDWNAPSITFYKSLG  136

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
             E+M+E+   K+TG AL   A +
Sbjct  137  AELMEEWTVCKVTGPALTQLAGR  159



>ref|WP_028367666.1| GCN5 family acetyltransferase [Burkholderia sp. UYPR1.413]
Length=162

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/208 (28%), Positives = 86/208 (41%), Gaps = 48/208 (23%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R A   DV  +  L +++ E+  LTHL+  +E  L   LF   P+            
Sbjct  3    ATIRAATRDDVGAMLALMHELAEFEKLTHLFIATEADLGDALFGARPSA-----------  51

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                            E IV E D K                     + GYA FF NYS 
Sbjct  52   ----------------EAIVAERDGK---------------------MIGYALFFHNYST  74

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  + G++ E LY + + R  G+G  M   +AA A ++     E  V  WN+ + DFY  
Sbjct  75   FLGRRGLYLEDLYVQPAERGTGLGSKMLRYLAALAVERQCGRFEWSVLDWNQPAIDFYQK  134

Query  792  MGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            MG  ++ ++R  ++TGDAL   A   + 
Sbjct  135  MGATVLPDWRIVRITGDALDQLAASAAG  162



>ref|WP_026229823.1| GCN5 family acetyltransferase [Burkholderia sp. JPY347]
Length=156

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 86/202 (43%), Gaps = 48/202 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  +  L  ++ E+  LTHL+  +E SL + LF   P               
Sbjct  1    MRPAEPRDVGPMLALMRELAEFEKLTHLFVATEHSLSEALFGGRPAA-------------  47

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                          E +V E D                       + GYA FF N+S F 
Sbjct  48   --------------EALVAELD---------------------GRLVGYALFFHNFSTFL  72

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + + R  G+G  +   VAA A ++     E  V  WN+++ DFY  MG
Sbjct  73   SRRGLYLEDLYVQPALRGSGLGTALLRRVAALAVERRCGRFEWSVLDWNQRAIDFYTKMG  132

Query  798  VEIMDEFRYGKLTGDALQAYAK  863
              ++ ++R  ++TGD+L   A+
Sbjct  133  ATVLPDWRIVRVTGDSLAELAQ  154



>gb|KIG04486.1| Diamine N-acetyltransferase [Burkholderia sp. MR1]
Length=162

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 83/195 (43%), Gaps = 48/195 (25%)
 Frame = +3

Query  279  DVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVSATEFPAP  458
            DV  I+ L Y++ E+  LTHL+  +E +L + LF   P                      
Sbjct  13   DVGAIFALMYELAEFEKLTHLFVATESALHEALFGARP----------------------  50

Query  459  TPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFF  638
                                      A  + VA+    I GYA FF N+S F  + G++ 
Sbjct  51   --------------------------AAEALVAEQAGEIVGYALFFHNFSTFLARRGLYL  84

Query  639  ESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEF  818
            E LY R + R  G+G ++   +AA A ++     E  V  WN+ + DFY  MG  ++ ++
Sbjct  85   EDLYVRPAMRGSGLGTMLLKKLAALAVERQCGRFEWSVLDWNQNAIDFYEKMGATVLPDW  144

Query  819  RYGKLTGDALQAYAK  863
            R  ++TGD+L   A 
Sbjct  145  RVVRVTGDSLDRLAN  159



>gb|EGC98457.1| GCN5-related N-acetyltransferase [Burkholderia sp. TJI49]
Length=161

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 85/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  +  L  ++ E+  LTHL+  +E  L   LF  +P               
Sbjct  7    IRAAEARDVGAMLALMRELAEFEQLTHLFVATEADLADALFGAHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  +  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGALVAYALFFHNYSTFV  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++  +  E  V  WN+ + +FY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLKRLAALAVERRCARFEWSVLDWNQPAIEFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ E+R  ++TGDAL   A +
Sbjct  139  ATVLPEWRIVRMTGDALDTLAGR  161



>ref|WP_014897673.1| GCN5 family N-acetyltransferase [Burkholderia cepacia]
 ref|YP_006616516.1| N-acetyltransferase GCN5 [Burkholderia cepacia GG4]
 gb|AFQ48822.1| N-acetyltransferase GCN5 [Burkholderia cepacia GG4]
Length=161

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 82/201 (41%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++ E+  LTHL+  ++  L   LF E P               
Sbjct  7    IRTAEARDVGAILALMRELAEFEKLTHLFVATDADLADALFGERPAA-------------  53

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                          E +V E D                       I  YA FF NYS F 
Sbjct  54   --------------EALVAELD---------------------GAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRHLAALAVERRCGRFEWSVLDWNQPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ E+R  ++T DAL+  A
Sbjct  139  ATVLPEWRIVRVTDDALRTLA  159



>ref|WP_021195864.1| GCN5 family N-acetyltransferase [Ralstonia sp. AU12-08]
 gb|EPX96560.1| GCN5 family N-acetyltransferase [Ralstonia sp. AU12-08]
Length=174

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 83/201 (41%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A   D + + +L   + EY  LTHL + + ++L  MLF   P    Y   +L     
Sbjct  12   LRPATPDDCAALVRLITALAEYEKLTHLVQTTPEALATMLFGPRP----YCEAVL-----  62

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                                   A+ E    G+A FF N+S F 
Sbjct  63   ---------------------------------------AEVEGQAVGFALFFHNFSTFL  83

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+   ++R LG+GR +   +A  A ++     E  V  WN  S  FY  MG
Sbjct  84   CKPGLYLEDLFVEPAHRGLGIGRALLVHLARLAQERDCGRFEWSVLDWNTPSIAFYEAMG  143

Query  798  VEIMDEFRYGKLTGDALQAYA  860
             +++ E+R  + TGDAL   A
Sbjct  144  ADVLPEWRICRATGDALDKMA  164



>ref|WP_035867419.1| GCN5 family acetyltransferase [Cupriavidus sp. SK-3]
 gb|KDP86170.1| GCN5 family acetyltransferase [Cupriavidus sp. SK-3]
Length=167

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 86/197 (44%), Gaps = 44/197 (22%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A   D   +  L   + EY  LTHL + + + L + LF   P+        +LVEV 
Sbjct  8    LRPATPDDCESLLALITGLAEYEKLTHLVEATPEKLREALFGARPHA-----EAVLVEV-  61

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                    P   G                              A   G+A FF N+S F 
Sbjct  62   --------PGAQG------------------------------AKAVGFALFFHNFSTFL  83

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E LY   ++R  G+G+++   +AA A ++G    E  V  WN  S +FY  MG
Sbjct  84   AKPGLYLEDLYVDPAWRGHGLGKMLLKHLAALAVERGCGRFEWSVLDWNTPSIEFYRAMG  143

Query  798  VEIMDEFRYGKLTGDAL  848
             ++M ++R  ++TG+AL
Sbjct  144  ADVMPDWRICRVTGEAL  160



>ref|WP_024569078.1| MULTISPECIES: GCN5 family acetyltransferase [Cupriavidus]
Length=163

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 86/197 (44%), Gaps = 44/197 (22%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A  +D   +Y L   + EY  LTHL + +   LC  LF  +P               
Sbjct  6    IRPAAPADSETLYNLISALAEYEKLTHLVEATPQKLCDALFGAHP---------------  50

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                        G E ++ E D                  D      G+A FF N+S F 
Sbjct  51   ------------GAEAVILEVD-----------------TDSGKLPVGFALFFHNFSTFL  81

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+   ++R  G+G+ +   +AA A ++G    E  V  WN+ S DFY  MG
Sbjct  82   AKPGLYLEDLFVDPAWRGHGLGKALLKHLAALAVERGCGRFEWSVLDWNQPSIDFYRAMG  141

Query  798  VEIMDEFRYGKLTGDAL  848
             ++M ++R  ++TGDAL
Sbjct  142  ADVMPDWRICRVTGDAL  158



>ref|WP_009241398.1| MULTISPECIES: GCN5 family N-acetyltransferase [Ralstonia]
 gb|EFP65466.1| acetyltransferase, GNAT family [Ralstonia sp. 5_7_47FAA]
 gb|EGY66561.1| hypothetical protein HMPREF0989_00967 [Ralstonia sp. 5_2_56FAA]
 gb|KFL21221.1| acetyltransferase domain protein [Ralstonia pickettii]
 gb|KIE32206.1| GCN5 family acetyltransferase [Streptomyces pluripotens]
Length=175

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 83/201 (41%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A   D + + +L   + EY  LTHL + + ++L  MLF   P               
Sbjct  11   LRPATPDDCASLVRLISALAEYEKLTHLVRTTPEALATMLFGPRPY--------------  56

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                          E ++ E D +A                      G+A FF N+S F 
Sbjct  57   -------------CEAVLAEVDGRA---------------------VGFALFFHNFSTFL  82

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+    YR LG+G+ +   +A  A ++     E  V  WN  S  FY  MG
Sbjct  83   CKPGLYLEDLFVEPEYRGLGIGKALLIHLARLAQERDCGRFEWSVLDWNAPSIAFYEAMG  142

Query  798  VEIMDEFRYGKLTGDALQAYA  860
             +++ E+R  + TGDAL   A
Sbjct  143  ADVLPEWRICRATGDALTKLA  163



>ref|WP_019448176.1| GCN5 family N-acetyltransferase [Cupriavidus sp. BIS7]
Length=164

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 90/197 (46%), Gaps = 44/197 (22%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A  +D   +++L   + EY  LTHL + +   LC  LF  +P               
Sbjct  6    IRPAAPTDSETLFRLISALAEYEKLTHLVEATPQKLCDALFGAHP---------------  50

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                        G E +V E D         +D  R  V        G+A FF N+S F 
Sbjct  51   ------------GAEAVVVEVD---------TDGSRLAV--------GFALFFHNFSTFL  81

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+   ++R  G+G+ +   +AA A ++G    E  V  WN+ S DFY  MG
Sbjct  82   AKPGLYLEDLFVDPAWRGHGLGKALLKHLAALAVERGCGRFEWSVLDWNQPSIDFYQAMG  141

Query  798  VEIMDEFRYGKLTGDAL  848
             ++M ++R  ++TG+AL
Sbjct  142  ADVMPDWRICRVTGEAL  158



>ref|WP_036213000.1| GCN5 family acetyltransferase [Massilia sp. LC238]
 gb|KFC67811.1| Acetyltransferase GNAT family protein [Massilia sp. LC238]
Length=163

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 88/205 (43%), Gaps = 48/205 (23%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+ +DV+HI+ +  ++  +  L HL   +ED L + LF   P+              
Sbjct  7    IRPAQPTDVTHIHSMIVELAVFEKLEHLVVATEDLLHEGLFGSRPSC-------------  53

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                          E I+ E D                       +  +A FF N+S F 
Sbjct  54   --------------EAIIGEED---------------------GEVVCFALFFHNFSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             K G++ E LY R S+R  G G  M + +A  A ++     E  V  WN  +  FY  MG
Sbjct  79   TKKGLYLEDLYVRQSHRGKGYGTRMLTRLAQIAVERNCGRFEWSVLDWNAPAIGFYQQMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKKKS  872
             +I+ ++R  +LTGD L A A++++
Sbjct  139  ADILPDWRICRLTGDTLTALAERRA  163



>ref|WP_008949432.1| GCN5 family N-acetyltransferase [Alishewanella jeotgali]
 gb|EHR42016.1| N-acetyltransferase GCN5 [Alishewanella jeotgali KCTC 22429]
Length=164

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 84/203 (41%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +RLA  +DV  I K    + EY  L H    +E  L + LF   P               
Sbjct  6    IRLATVADVPLILKFIQGLAEYEKLAHEVVATEQKLTETLFSARP---------------  50

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A    +A+++   AG+A FF NYS F 
Sbjct  51   ---------------------------------AAEVVIAEYQGQPAGFALFFHNYSTFL  77

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+    +R  G+G+L+ + +A  A D+G    E  V  WN+ + DFY   G
Sbjct  78   AKPGLYLEDLFVLPQFRGQGLGKLLLTYLAKLAVDRGCGRFEWSVLDWNQPAIDFYQAQG  137

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ ++R  ++TG+ L A A +
Sbjct  138  ATLLHDWRINRVTGEKLTALAAQ  160



>ref|WP_029212497.1| GCN5 family acetyltransferase [Arsenicicoccus bolidensis]
Length=162

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 71/123 (58%), Gaps = 1/123 (1%)
 Frame = +3

Query  501  DLKAPVADDESD-AFRSNVADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLG  677
            DL+A +  D  D A  ++VA+ +  + G A +F  +S +  + GI+ E L+    +R  G
Sbjct  35   DLQAALFPDHGDPAVHADVAEVDGEVVGLAVWFLTFSTWTGRHGIWLEDLFVEPEHRGAG  94

Query  678  MGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAY  857
            +GR++   +AA A ++G++ VE  V  WN  +  FY  +G E ++E+R  +L GDAL   
Sbjct  95   LGRMLLEGLAARAVERGYTRVEWTVLDWNAPAIRFYRSLGAEPLEEWRTQRLHGDALARV  154

Query  858  AKK  866
            A++
Sbjct  155  ARR  157



>ref|WP_018421300.1| GCN5 family N-acetyltransferase [Burkholderia sp. WSM4176]
Length=160

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 88/197 (45%), Gaps = 48/197 (24%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R AK +D   I+ L Y++ ++ +LTH++  +EDSL   LF   P+            
Sbjct  3    ATIRAAKPADTGAIFALTYELAQFENLTHIFVATEDSLRDALFGARPS------------  50

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                    ++A VA+D               I GYA FF N+S 
Sbjct  51   ------------------------IEALVAEDAGS------------IVGYALFFHNFSS  74

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  + G++ E +Y + + R  G+G  +   VAA A ++  +  E  V  WN+ +  FY  
Sbjct  75   FAGRRGLYLEDVYVQPAQRGSGLGTALLRHVAALAVERQCARFEWTVLDWNQPAISFYQK  134

Query  792  MGVEIMDEFRYGKLTGD  842
            MG  ++ ++R  ++TGD
Sbjct  135  MGATVLPDWRVVRVTGD  151



>ref|WP_035150482.1| GNAT family acetyltransferase [Calothrix sp. 336/3]
 gb|KFB82289.1| GNAT family acetyltransferase [Calothrix sp. 336/3]
Length=162

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 83/197 (42%), Gaps = 48/197 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  D + ++ L   + EY  L+H    S   L K LF      P Y+   LL E+S
Sbjct  6    IRAAEPGDCATLFHLIKALAEYEKLSHTVTGSAGDLEKHLF----GTPQYAEA-LLAEIS  60

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                                           G+A FFPNYS F 
Sbjct  61   GQA-------------------------------------------VGFALFFPNYSTFL  77

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             +PGI+ E ++    YR+ G+G+ + +TVA  A  +    +E  V  WN+ +  FY  MG
Sbjct  78   TQPGIYLEDIFVLPEYRRQGIGKALLTTVAQIAVARNCGRLEWSVLDWNQPAQAFYRQMG  137

Query  798  VEIMDEFRYGKLTGDAL  848
              I+DE+R  ++TG AL
Sbjct  138  ASILDEWRICRVTGTAL  154



>ref|WP_027680645.1| GCN5 family acetyltransferase [Ralstonia sp. UNC404CL21Col]
Length=175

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 83/201 (41%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A   D + + +L   + EY  LTHL + + ++L  MLF   P               
Sbjct  11   LRPATPDDCASLVRLISALAEYEKLTHLVRTTPEALATMLFGPRPY--------------  56

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                          E ++ E D +A                      G+A FF N+S F 
Sbjct  57   -------------CEAVLAEVDGRA---------------------VGFALFFHNFSTFL  82

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+    YR LG+G+ +   +A  A ++     E  V  WN  S  FY  MG
Sbjct  83   CKPGLYLEDLFVEPEYRGLGIGKALLIHLARLAQERDCGRFEWSVLDWNAPSIAFYEAMG  142

Query  798  VEIMDEFRYGKLTGDALQAYA  860
             +++ E+R  + TGDAL   A
Sbjct  143  ADVLPEWRICRATGDALTKLA  163



>ref|WP_039225236.1| GCN5 family acetyltransferase [Burkholderia multivorans]
 gb|KHS12316.1| GCN5 family acetyltransferase [Burkholderia multivorans]
 gb|KHS12946.1| GCN5 family acetyltransferase [Burkholderia multivorans]
Length=161

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 83/203 (41%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A   DV  I  L  ++ E+  L HL+  +E  L   LF  +P               
Sbjct  7    IRAADARDVGAILALMRELAEFEKLAHLFVATEADLADALFGAHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGAIVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+++ DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRQLAALAVERRCGRFEWSVLDWNQRAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ ++R  ++T DAL A A +
Sbjct  139  ATVLPDWRIVRVTDDALDALAAR  161



>ref|WP_029307178.1| GCN5 family acetyltransferase [Cupriavidus metallidurans]
Length=163

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 88/200 (44%), Gaps = 50/200 (25%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A  +D   +Y L   + EY  LTHL + +   LC  LF  +P               
Sbjct  6    IRPAAPADSETLYNLISALAEYEKLTHLVEATPQKLCDALFGAHP---------------  50

Query  438  ATEFPAPTPDESGFEPIVKEFDL---KAPVADDESDAFRSNVADHEAYIAGYAFFFPNYS  608
                        G E ++ E D    K PV                    G+A FF N+S
Sbjct  51   ------------GAEAVILEVDTESGKLPV--------------------GFALFFHNFS  78

Query  609  CFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYV  788
             F  KPG++ E L+   ++R  G+G+ +   +AA A ++G    E  V  WN+ S DFY 
Sbjct  79   TFLAKPGLYLEDLFVDPAWRGHGLGKALLKHLAALAVERGCGRFEWSVLDWNQPSIDFYR  138

Query  789  DMGVEIMDEFRYGKLTGDAL  848
             MG ++M ++R  ++TGDAL
Sbjct  139  AMGADVMPDWRICRVTGDAL  158



>ref|WP_012598416.1| GNAT family acetyltransferase [Cyanothece sp. PCC 7424]
 ref|YP_002376337.1| N-acetyltransferase GCN5 [Cyanothece sp. PCC 7424]
 gb|ACK69469.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 7424]
Length=165

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/206 (28%), Positives = 88/206 (43%), Gaps = 48/206 (23%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A  +DV  I+ L   + EY  L+HL   + D L + LF E P    Y+  IL     
Sbjct  5    IRPATPADVPVIFSLIKALAEYEKLSHLVSGNADLLQEHLFGERP----YAEAIL-----  55

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                                   A+ E  I G+A F PNYS F 
Sbjct  56   ---------------------------------------AEWETKIVGFALFIPNYSTFL  76

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPGI+ E L+    YR+ G+G+ +   +A  A ++    +E  V  WN+ + +FY  +G
Sbjct  77   TKPGIYLEDLFVLPEYRRQGIGKALLIYLAQLALERDAGRLEWSVLDWNQPAIEFYQSIG  136

Query  798  VEIMDEFRYGKLTGDALQAYAKKKSS  875
              I+ ++R  ++TG AL   A +  +
Sbjct  137  ASILPDWRICRVTGLALSELADQDEN  162



>ref|WP_014428055.1| GCN5 family N-acetyltransferase [Rubrivivax gelatinosus]
 ref|YP_005436691.1| putative diamine acetyltransferase [Rubrivivax gelatinosus IL144]
 dbj|BAL95192.1| putative diamine acetyltransferase [Rubrivivax gelatinosus IL144]
Length=161

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 89/202 (44%), Gaps = 48/202 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A+  D+  I  L  ++ E+  L+HL   + ++L   LF E P               
Sbjct  8    LRPAERRDLPAIVGLIRELAEFEQLSHLCHATPEALEPHLFGERP---------------  52

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                      VA+       + VA+    + G+A FF N+S F 
Sbjct  53   --------------------------VAE-------AVVAEGGGAVIGFALFFTNFSTFL  79

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             +PG++ E LY + ++R  G+G+ +   + A A ++G    E  V  WN+ +  FY  MG
Sbjct  80   ARPGLYLEDLYVQPAWRSHGIGQALLEHLGALAVERGCGRFEWSVLDWNENAIGFYRRMG  139

Query  798  VEIMDEFRYGKLTGDALQAYAK  863
              +M ++R  ++ G+ALQ +A+
Sbjct  140  ATVMPDWRICRVAGEALQRFAR  161



>ref|WP_012593544.1| MULTISPECIES: GNAT family acetyltransferase [Cyanothece]
 ref|YP_002370423.1| N-acetyltransferase [Cyanothece sp. PCC 8801]
 ref|YP_003135964.1| N-acetyltransferase GCN5 [Cyanothece sp. PCC 8802]
 gb|ACK64267.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 8801]
 gb|ACU99128.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 8802]
Length=162

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 89/198 (45%), Gaps = 48/198 (24%)
 Frame = +3

Query  255  RLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEV  434
            ++R A+ SDVS ++ L   + EY  L+H    +E++L + LF E P    Y+  IL    
Sbjct  6    KIRPAQPSDVSVLFTLIKALAEYEKLSHQVTGNEEALHQHLFGERP----YAEAIL----  57

Query  435  SATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCF  614
                                     A    D                 G+A FFPNYS F
Sbjct  58   -------------------------AQWGHD---------------CVGFALFFPNYSTF  77

Query  615  YDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDM  794
              KPGI+ E ++   +YR+ G+G+ +   +A  A  +G   +E  V  WN  + +FY  +
Sbjct  78   LTKPGIYLEDVFVLPNYRRRGIGKALLLYIAQLATQRGVGRLEWSVLDWNSPAIEFYQKI  137

Query  795  GVEIMDEFRYGKLTGDAL  848
            G +++ ++R  ++TG +L
Sbjct  138  GADVLPDWRICRVTGQSL  155



>ref|WP_011402140.1| GCN5 family N-acetyltransferase [Burkholderia thailandensis]
 ref|YP_442237.1| acetyltransferase [Burkholderia thailandensis E264]
 gb|ABC37119.1| acetyltransferase, GNAT family [Burkholderia thailandensis E264]
Length=160

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 84/205 (41%), Gaps = 48/205 (23%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A ++DV  +  L  ++ E+  LTHL+  +E  L   LF   P+              
Sbjct  4    IRAAAQADVPAMLALMRELAEFEQLTHLFVATEADLADALFGARPSAE------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                                + VA +   I GYA +F NYS F 
Sbjct  52   ------------------------------------ALVAVNGGAIVGYALYFHNYSTFV  75

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+ + DFY  MG
Sbjct  76   GRRGLYLEDLYVQPSQRGTGLGTRMLRRLAAIAVERRCGRFEWTVLDWNQPAIDFYRKMG  135

Query  798  VEIMDEFRYGKLTGDALQAYAKKKS  872
             ++M ++R  ++ GDAL   A   +
Sbjct  136  ADVMPDWRVVRVAGDALARLANGGA  160



>ref|WP_015138713.1| acetyltransferase [Nostoc sp. PCC 7524]
 ref|YP_007075868.1| acetyltransferase [Nostoc sp. PCC 7524]
 gb|AFY48271.1| acetyltransferase [Nostoc sp. PCC 7524]
Length=165

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +3

Query  552  VADHEAYIAGYAFFFPNYSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGF  731
            +A++     G+A FF NYS F  KPGI+ E L+    YR+ G+G+ + S VA  A  +G 
Sbjct  59   LAEYAGKAVGFALFFHNYSTFLTKPGIYLEDLFVLPEYRRQGIGKALLSKVAKIAVARGC  118

Query  732  SSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLTGDALQAYAKKKS  872
              +E  V  WN+ +  FY  MG  I+D++R  ++TG+++   A K+S
Sbjct  119  GRLEWSVLDWNESAQAFYRSMGASILDDWRICRVTGESIIQLAAKES  165



>ref|WP_006098026.1| GNAT family acetyltransferase [Coleofasciculus chthonoplastes]
 gb|EDX78551.1| acetyltransferase, GNAT family [Coleofasciculus chthonoplastes 
PCC 7420]
Length=165

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/204 (26%), Positives = 88/204 (43%), Gaps = 48/204 (24%)
 Frame = +3

Query  255  RLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEV  434
            ++R A  +DV  +++L   + EY  L+HL   + D+L   LF   P    Y   IL    
Sbjct  5    KIRPATPTDVPVLFELIQALAEYEKLSHLVTGTMDALQDHLFGAKP----YVEAIL----  56

Query  435  SATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCF  614
                                                    A++E    G+  FF NYS F
Sbjct  57   ----------------------------------------AEYEGQTVGFTLFFSNYSTF  76

Query  615  YDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDM  794
              KPGI+ E L+ R  +R+ G+G+ + + +A  A ++    +E  V  WN+ +  FY  +
Sbjct  77   LTKPGIYIEDLFVRPEFRRQGIGKALLTYIAQLAVERDCGRLEWSVLDWNEPAIAFYQRL  136

Query  795  GVEIMDEFRYGKLTGDALQAYAKK  866
            G  ++ ++R  ++TGDAL   A +
Sbjct  137  GATVLPDWRICRVTGDALPQLATQ  160



>ref|WP_012762773.1| GCN5 family N-acetyltransferase [Ralstonia pickettii]
 ref|YP_002982376.1| N-acetyltransferase GCN5 [Ralstonia pickettii 12D]
 gb|ACS63704.1| GCN5-related N-acetyltransferase [Ralstonia pickettii 12D]
Length=176

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 83/201 (41%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A   D + + +L   + EY  LTHL + + ++L  MLF   P               
Sbjct  12   LRPATPDDCASLVRLISALAEYEKLTHLVQTTPEALATMLFGPRPY--------------  57

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                          E ++ E D +A                      G+A FF N+S F 
Sbjct  58   -------------CEAVLAEVDGRA---------------------VGFALFFHNFSTFL  83

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+    YR LG+G+ +   +A  A ++     E  V  WN  S  FY  MG
Sbjct  84   CKPGLYLEDLFVEPEYRGLGIGKALLIHLARLAQERDCGRFEWSVLDWNAPSIAFYEAMG  143

Query  798  VEIMDEFRYGKLTGDALQAYA  860
             +++ E+R  + TGDAL   A
Sbjct  144  ADVLPEWRICRATGDALTKLA  164



>ref|WP_004631744.1| acetyltransferase [Ralstonia pickettii]
 gb|ENZ76860.1| acetyltransferase [Ralstonia pickettii OR214]
Length=175

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 83/201 (41%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A   D + + +L   + EY  LTHL + + ++L  MLF   P               
Sbjct  11   LRPATPDDCASLVRLISALAEYEKLTHLVQTTPEALATMLFGPRPY--------------  56

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                          E ++ E D +A                      G+A FF N+S F 
Sbjct  57   -------------CEAVLAEVDGRA---------------------VGFALFFHNFSTFL  82

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+    YR LG+G+ +   +A  A ++     E  V  WN  S  FY  MG
Sbjct  83   CKPGLYLEDLFVEPEYRGLGIGKALLIHLARLAQERDCGRFEWSVLDWNAPSIAFYEAMG  142

Query  798  VEIMDEFRYGKLTGDALQAYA  860
             +++ E+R  + TGDAL   A
Sbjct  143  ADVLPEWRICRATGDALTKLA  163



>ref|WP_011883923.1| GCN5 family N-acetyltransferase [Burkholderia vietnamiensis]
 ref|YP_001118871.1| GCN5-like N-acetyltransferase [Burkholderia vietnamiensis G4]
 gb|ABO54036.1| GCN5-related N-acetyltransferase [Burkholderia vietnamiensis 
G4]
Length=161

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 86/203 (42%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++ E+  LTHL+  +E  L   LF E P               
Sbjct  7    IRPAQARDVGAIVALMRELAEFEKLTHLFVATEADLADALFGERP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+H   I  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAEHGGAIVAYALFFHNYSTFV  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + + R  G+G  +   +AA A ++  +  E  V  WN+ + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPAQRGTGLGTALLRHLAALAVERRCARFEWSVLDWNRPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ ++R  ++TGDAL A A +
Sbjct  139  ATVLPDWRIVRMTGDALHALAAR  161



>ref|WP_012436324.1| MULTISPECIES: GCN5 family N-acetyltransferase [Ralstonia]
 ref|YP_001900393.1| N-acetyltransferase GCN5 [Ralstonia pickettii 12J]
 gb|ACD27961.1| GCN5-related N-acetyltransferase [Ralstonia pickettii 12J]
Length=176

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 83/201 (41%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A   D + + +L   + EY  LTHL + + ++L  MLF   P               
Sbjct  12   LRPATPDDCTSLVRLISALAEYEKLTHLVQTTPEALATMLFGPRPY--------------  57

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                          E ++ E D +A                      G+A FF N+S F 
Sbjct  58   -------------CEAVLAEVDGRA---------------------VGFALFFHNFSTFL  83

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+    YR LG+G+ +   +A  A ++     E  V  WN  S  FY  MG
Sbjct  84   CKPGLYLEDLFVEPEYRGLGIGKALLIHLARLAQERDCGRFEWSVLDWNAPSIAFYEAMG  143

Query  798  VEIMDEFRYGKLTGDALQAYA  860
             +++ E+R  + TGDAL   A
Sbjct  144  ADVLPEWRICRATGDALTKLA  164



>ref|WP_009889958.1| GCN5 family N-acetyltransferase [Burkholderia thailandensis]
 gb|AHI63128.1| acetyltransferase domain protein [Burkholderia thailandensis 
H0587]
 gb|AHI73940.1| acetyltransferase domain protein [Burkholderia thailandensis 
2002721723]
 gb|AHI80398.1| acetyltransferase domain protein [Burkholderia thailandensis 
E444]
 gb|AIC87654.1| acetyltransferase domain protein [Burkholderia thailandensis 
USAMRU Malaysia #20]
 gb|AIP26710.1| acetyltransferase domain protein [Burkholderia thailandensis 
E264]
 gb|AIP62449.1| acetyltransferase domain protein [Burkholderia thailandensis]
 gb|AIS96537.1| acetyltransferase domain protein [Burkholderia thailandensis 
MSMB59]
 gb|AIT20411.1| acetyltransferase domain protein [Burkholderia thailandensis 
E254]
Length=167

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 84/205 (41%), Gaps = 48/205 (23%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A ++DV  +  L  ++ E+  LTHL+  +E  L   LF   P+              
Sbjct  11   IRAAAQADVPAMLALMRELAEFEQLTHLFVATEADLADALFGARPSAE------------  58

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                                + VA +   I GYA +F NYS F 
Sbjct  59   ------------------------------------ALVAVNGGAIVGYALYFHNYSTFV  82

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+ + DFY  MG
Sbjct  83   GRRGLYLEDLYVQPSQRGTGLGTRMLRRLAAIAVERRCGRFEWTVLDWNQPAIDFYRKMG  142

Query  798  VEIMDEFRYGKLTGDALQAYAKKKS  872
             ++M ++R  ++ GDAL   A   +
Sbjct  143  ADVMPDWRVVRVAGDALARLANGGA  167



>ref|WP_007180956.1| GCN5 family N-acetyltransferase [Burkholderia sp. Ch1-1]
 gb|EIF30234.1| acetyltransferase [Burkholderia sp. Ch1-1]
Length=174

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 90/208 (43%), Gaps = 48/208 (23%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            A +R A  +D   I+ L Y++ E+ SLTH++  +ED L   LF   P+            
Sbjct  3    ATIRAATPADTGAIFALTYELAEFESLTHVFVATEDGLHDALFGARPS------------  50

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                                  + VA++E  + GYA FF NYS 
Sbjct  51   ------------------------------------IEALVAENEGRVVGYALFFHNYSS  74

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            F  K G++ E +Y + + R  G+G  +   +AA A ++     E  V  WN+++  FY  
Sbjct  75   FVGKRGLYLEDVYVQPAQRGGGLGTALLRRLAALAVERQCGRFEWTVLDWNQQAISFYEK  134

Query  792  MGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            MG  +M ++R  +L G+AL+  A   ++
Sbjct  135  MGATVMPDWRVVRLAGNALEQLAAGANA  162



>gb|AIO41211.1| acetyltransferase domain protein [Burkholderia cenocepacia]
Length=161

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 83/201 (41%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV  I  L  ++ E+  LTHL+  ++  L   LF  +P               
Sbjct  7    IRAAELRDVGAILALMRELAEFEKLTHLFVATDADLADALFGAHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  +  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGAVVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN  + DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGSGLGTAMLRHLAALAVERRCGRFEWSVLDWNTPAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYA  860
              ++ E+R  ++TGDAL A A
Sbjct  139  ATVLPEWRIVRVTGDALDALA  159



>ref|WP_039600089.1| GCN5 family acetyltransferase [Ralstonia sp. A12]
 gb|KHK50716.1| GCN5 family acetyltransferase [Ralstonia sp. A12]
Length=174

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 81/201 (40%), Gaps = 48/201 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A   D + + +L   + EY  LTHL + + ++L  MLF   P    Y   +L     
Sbjct  12   LRPATPDDCAALVRLITALAEYEKLTHLVQTTPEALATMLFGPRP----YCEAVL-----  62

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                                   A+ E    G+A FF N+S F 
Sbjct  63   ---------------------------------------AEVEGRAVGFALFFHNFSTFL  83

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             KPG++ E L+     R LG+GR +   +A  A ++     E  V  WN  S  FY  MG
Sbjct  84   CKPGLYLEDLFVEPEQRGLGIGRALLVHLARLAQERDCGRFEWSVLDWNAPSIAFYEAMG  143

Query  798  VEIMDEFRYGKLTGDALQAYA  860
             +++ E+R  + TGDAL   A
Sbjct  144  ADVLPEWRICRATGDALDKMA  164



>ref|WP_027865519.1| GCN5 family acetyltransferase [Massilia alkalitolerans]
Length=163

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 88/205 (43%), Gaps = 48/205 (23%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+ +DV+HI+ +  ++  +  L HL   +ED L + LF   P+              
Sbjct  7    IRPAQPTDVTHIHSMIVELAVFEKLEHLVVATEDLLHEGLFGSRPSC-------------  53

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                          E I+ E D                       +  +A FF N+S F 
Sbjct  54   --------------EAIIGEED---------------------GEVVCFALFFHNFSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             K G++ E LY R S+R  G G  M + +A  A ++     E  V  WN  +  FY  MG
Sbjct  79   TKKGLYLEDLYVRQSHRGKGYGTRMLTRLAQIAVERNCGRFEWSVLDWNAPAIGFYQQMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKKKS  872
             +I+ ++R  ++TGD L A A++++
Sbjct  139  ADILPDWRICRVTGDTLTALAERRA  163



>ref|WP_006415185.1| GCN5 family N-acetyltransferase [Burkholderia multivorans]
 gb|EJO56015.1| FR47-like protein [Burkholderia multivorans CF2]
Length=161

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 83/203 (41%), Gaps = 48/203 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A   D   I  L  ++ E+  L HL+  +E  L   LF  +P               
Sbjct  7    IRAADARDGGAILALMRELAEFEKLAHLFVATEADLADALFGAHP---------------  51

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                             A  + VA+ +  +  YA FF NYS F 
Sbjct  52   ---------------------------------AAEALVAERDGALVAYALFFHNYSTFL  78

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY + S R  G+G  M   +AA A ++     E  V  WN+++ DFY  MG
Sbjct  79   GRRGLYLEDLYVQPSQRGTGLGTAMLRQLAALAIERRCGRFEWSVLDWNQRAIDFYEKMG  138

Query  798  VEIMDEFRYGKLTGDALQAYAKK  866
              ++ ++R  ++TGDAL A A +
Sbjct  139  ATVLPDWRIVRVTGDALDALAAR  161



>ref|WP_005458921.1| N-acetyltransferase GCN5 [Saccharomonospora cyanea]
 gb|EHR62910.1| sortase-like acyltransferase [Saccharomonospora cyanea NA-134]
Length=163

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/208 (26%), Positives = 89/208 (43%), Gaps = 49/208 (24%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            +R+R  +E+DV  + +L +++ EY    H   ++ + L   LF ENP             
Sbjct  3    SRIRRVREADVDTVVELVHELAEYEKAPHECHLTAEQLHTALFGENP-------------  49

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                                               A   +VA+ E  + G+A +F N+S 
Sbjct  50   -----------------------------------ALYGHVAEVEGRVVGFALWFLNFST  74

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            +    GI+ E LY R   R  G+G+ + +T+A    D+G++ +E  V  WN  +  FY  
Sbjct  75   WRGVHGIYLEDLYVRPEMRGTGLGKALLATLAKECVDRGYARLEWWVLNWN-PAVGFYKS  133

Query  792  MGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            +G E MDE+   +LT + L A A + S 
Sbjct  134  LGAEAMDEWTVYRLTDEPLAALASEVSG  161



>ref|WP_009631895.1| acetyltransferase [Synechocystis sp. PCC 7509]
Length=162

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 87/203 (43%), Gaps = 48/203 (24%)
 Frame = +3

Query  243  KIYARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTIL  422
            +I  +LR A   DV  ++ L   + EY  L H    S ++L + LF  +P          
Sbjct  2    EINLKLRPAALDDVGKLFGLIQALAEYEKLAHAVTGSVEALQEHLFGSHPY---------  52

Query  423  LVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPN  602
                               E I+ E+D                        AG+A FFPN
Sbjct  53   ------------------VEAIIAEYD---------------------GETAGFALFFPN  73

Query  603  YSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDF  782
            YS F  +PGI+ E L+    YR+ G+G+ +   +A    ++G+  +E  V  WN  +  F
Sbjct  74   YSTFLTQPGIYLEDLFVLPKYRRQGIGKEILGYLAKLTVERGYGRLEWSVLDWNSDAITF  133

Query  783  YVDMGVEIMDEFRYGKLTGDALQ  851
            Y  MG E++ ++R  ++TG++L 
Sbjct  134  YERMGAEVLPDWRICRVTGESLN  156



>ref|WP_029823581.1| GCN5 family acetyltransferase [Vibrio parahaemolyticus]
Length=161

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 70/129 (54%), Gaps = 6/129 (5%)
 Frame = +3

Query  495  EFDLKAPVADDESDAFRSNVADHE--AYIA----GYAFFFPNYSCFYDKPGIFFESLYFR  656
            E ++KA V D +   F  +   H    Y+     G+A +F NYS +  K G++ E LY  
Sbjct  32   EHEVKASVEDVDRAIFGEDSTTHAVICYVNEEPIGFAVYFFNYSTWLGKNGLYLEDLYVS  91

Query  657  ASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMGVEIMDEFRYGKLT  836
            + YR +G G+ +   +A  A D+G    E  V  WN+ + DFY  +G E  DE++  +LT
Sbjct  92   SEYRNVGAGKALLKHLANIAVDRGCGRFEWAVLDWNQPAIDFYQSIGAEPQDEWKIYRLT  151

Query  837  GDALQAYAK  863
            GDALQ +AK
Sbjct  152  GDALQRFAK  160



>ref|WP_009856394.1| GCN5 family N-acetyltransferase [Rubrivivax benzoatilyticus]
 gb|EGJ09828.1| acetyltransferase N-acetyltransferase, spermidine/spermine acetyltransferase 
[Rubrivivax benzoatilyticus JA2 = ATCC BAA-35]
Length=161

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 91/202 (45%), Gaps = 48/202 (24%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            LR A+  D+  I  L  ++ E+  L+H+ + + ++L   LF E P               
Sbjct  8    LRPAERRDLPAITALIRELAEFERLSHVCQATPEALEPHLFGERP---------------  52

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                                      VA+       + VA+    + G+A FF N+S F 
Sbjct  53   --------------------------VAE-------AVVAEGGGEVIGFALFFTNFSTFM  79

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             +PG++ E LY + ++R  G+G+ +   + A A ++G    E  V  WN+ +  FY  MG
Sbjct  80   ARPGLYLEDLYVQPAWRGHGIGQALLEHLGALAVERGCGRFEWSVLDWNENAIGFYRRMG  139

Query  798  VEIMDEFRYGKLTGDALQAYAK  863
              ++ ++R  +++G+ALQ +A+
Sbjct  140  ATVLPDWRICRVSGEALQRFAR  161



>ref|XP_007722606.1| hypothetical protein A1O1_03513 [Capronia coronata CBS 617.96]
 gb|EXJ90412.1| hypothetical protein A1O1_03513 [Capronia coronata CBS 617.96]
Length=196

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 94/211 (45%), Gaps = 32/211 (15%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNP-----PFYSPTIL  422
            +R A++SDV  I ++  ++ +Y    H    +E+SL K L   +P       P Y+ T+L
Sbjct  11   IRYARQSDVPTILQMIQELADYEKALHEVLATEESLLKTLSFPDPESETGFTPGYAKTLL  70

Query  423  LVEVSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPN  602
            +V           P+ SG    V++     P    E         +    +AG A +F N
Sbjct  71   IV-----------PNNSGSAGTVQQ-----PQQSTE---------ESSPAVAGMALYFHN  105

Query  603  YSCFYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDF  782
            YS +   PGI+ E L+ R  YR  G G+ +   +A      G   ++  V  WNK S DF
Sbjct  106  YSTWTAAPGIYLEDLFVRPQYRGTGFGKALIQALARECLRLGCKRLDWSVLKWNKPSIDF  165

Query  783  YVD--MGVEIMDEFRYGKLTGDALQAYAKKK  869
            YV   +G   M+E+   ++ G+ L   A + 
Sbjct  166  YVSEVIGATRMEEWVGMRVDGEKLAKLAGRN  196



>ref|WP_036251230.1| GCN5 family acetyltransferase [Massilia sp. BSC265]
 gb|KFI05949.1| GCN5 family acetyltransferase [Massilia sp. BSC265]
Length=162

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 89/205 (43%), Gaps = 48/205 (23%)
 Frame = +3

Query  258  LRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVEVS  437
            +R A+  DV+HI+ +  ++  +  L HL   +ED L + LF E P+              
Sbjct  6    IRPAQPLDVTHIHSMIVELAVFEKLEHLVVATEDLLHEGLFGERPSC-------------  52

Query  438  ATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSCFY  617
                          E I+ E D                       +  +A FF N+S F 
Sbjct  53   --------------EAIIGEED---------------------GEVVCFALFFHNFSTFL  77

Query  618  DKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVDMG  797
             + G++ E LY R S+R  G G  M + +A  A ++     E  V  WN+ +  FY  MG
Sbjct  78   TRKGLYLEDLYVRQSHRGKGYGTKMLTRLARIAVERNCGRFEWSVLDWNEPAIRFYKQMG  137

Query  798  VEIMDEFRYGKLTGDALQAYAKKKS  872
             +I+ ++R  +LTG+ L A A++++
Sbjct  138  ADILPDWRICRLTGETLTALAERRT  162



>ref|WP_005266656.1| N-acetyltransferase GCN5 [Arthrobacter crystallopoietes]
 gb|EMY35900.1| N-acetyltransferase GCN5 [Arthrobacter crystallopoietes BAB-32]
Length=165

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 89/208 (43%), Gaps = 48/208 (23%)
 Frame = +3

Query  252  ARLRLAKESDVSHIYKLFYQIHEYHSLTHLYKVSEDSLCKMLFKENPNPPFYSPTILLVE  431
            +R+R A+E+DV  I +L +++  Y       K +E  L   LF                 
Sbjct  2    SRIRPAQEADVPVILELIHELARYEKEPDAVKTTEAQLHSALF-----------------  44

Query  432  VSATEFPAPTPDESGFEPIVKEFDLKAPVADDESDAFRSNVADHEAYIAGYAFFFPNYSC  611
                    PTP                        A  ++VA+ +  + G+A +F N+S 
Sbjct  45   -------GPTP------------------------AVFAHVAEDDGTVQGFALWFRNFST  73

Query  612  FYDKPGIFFESLYFRASYRKLGMGRLMFSTVAANAADKGFSSVEGIVAVWNKKSYDFYVD  791
            +    GI+ E LY R   R  G G+ +  T+A +A D G++ VE  V  WN+ S  FY  
Sbjct  74   WEGVHGIYLEDLYVRPEARGAGHGKALLQTLARHAVDHGYARVEWAVLNWNEPSIGFYRS  133

Query  792  MGVEIMDEFRYGKLTGDALQAYAKKKSS  875
            +G    DE+   +LTG+AL+ +   + +
Sbjct  134  LGARPQDEWSTFRLTGEALREFGAARPA  161



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2508968796672