BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c41881_g1_i1 len=1330 path=[1:0-1329]

Length=1330
                                                                      Score     E

dbj|BAL22345.1|  oxidoreductase                                         533   0.0      
dbj|BAL22344.1|  oxidoreductase                                         531   0.0      
dbj|BAL22343.1|  oxidoreductase                                         529   0.0      
ref|XP_009588065.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    523   0.0      
emb|CDP17661.1|  unnamed protein product                                522   0.0      
ref|XP_009758809.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    516   6e-179   
ref|XP_009620118.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    516   7e-179   
ref|XP_009588687.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    516   1e-178   
gb|AIR07875.1|  F6'H1                                                   513   2e-177   
ref|XP_009763424.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    511   7e-177   
ref|XP_002299115.2|  oxidoreductase family protein                      509   4e-176   Populus trichocarpa [western balsam poplar]
emb|CDP19904.1|  unnamed protein product                                509   4e-176   
ref|XP_009613663.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    508   2e-175   
ref|XP_009771649.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    507   4e-175   
ref|XP_009798906.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    506   6e-175   
ref|XP_008218314.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    506   1e-174   
ref|XP_011048230.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    506   1e-174   
ref|XP_007208198.1|  hypothetical protein PRUPE_ppa020537mg             505   2e-174   
ref|XP_008232563.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    501   9e-173   
ref|XP_006340084.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    501   1e-172   
dbj|BAL22346.1|  oxidoreductase                                         500   2e-172   
gb|AFK37640.1|  unknown                                                 499   4e-172   
ref|XP_004296193.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    499   7e-172   
ref|XP_008359473.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    498   9e-172   
ref|XP_006355251.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    498   1e-171   
dbj|BAL22347.1|  oxidoreductase                                         498   2e-171   
ref|XP_009345720.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    498   2e-171   
ref|XP_002285698.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        497   2e-171   Vitis vinifera
ref|NP_175925.1|  feruloyl CoA ortho-hydroxylase 2                      497   3e-171   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38706.1|  hypothetical protein AALP_AA3G149300                    497   3e-171   
dbj|BAL22348.1|  oxidoreductase                                         496   5e-171   
ref|XP_003530089.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        496   7e-171   
emb|CDY60812.1|  BnaA01g37310D                                          496   8e-171   
ref|XP_006488907.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    494   3e-170   
emb|CDX75720.1|  BnaC03g38030D                                          494   5e-170   
ref|XP_006407193.1|  hypothetical protein EUTSA_v10021003mg             493   7e-170   
ref|XP_007014695.1|  Leucoanthocyanidin dioxygenase, putative           491   4e-169   
ref|XP_002285699.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        491   6e-169   Vitis vinifera
ref|XP_009146469.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        491   7e-169   
ref|XP_006445642.1|  hypothetical protein CICLE_v10015715mg             491   9e-169   
emb|CDY23625.1|  BnaC05g39690D                                          489   2e-168   
emb|CDY37479.1|  BnaC01g37530D                                          489   4e-168   
gb|KHN27813.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        486   2e-167   
ref|XP_010277719.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    487   3e-167   
ref|XP_010487121.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    487   3e-167   
ref|XP_006299806.1|  hypothetical protein CARUB_v10016002mg             487   3e-167   
ref|XP_002885061.1|  oxidoreductase                                     486   1e-166   
ref|XP_010465206.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        485   1e-166   
ref|XP_010500769.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    485   2e-166   
emb|CDX82531.1|  BnaA03g32900D                                          484   3e-166   
ref|XP_010462374.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2        484   5e-166   
ref|XP_009135312.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    483   1e-165   
ref|XP_003520370.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    482   2e-165   
ref|XP_006445643.1|  hypothetical protein CICLE_v10018343mg             480   1e-164   
ref|XP_010327291.1|  PREDICTED: LOW QUALITY PROTEIN: feruloyl CoA...    480   1e-164   
ref|XP_006445647.1|  hypothetical protein CICLE_v10015700mg             480   1e-164   
ref|XP_002882832.1|  oxidoreductase                                     480   2e-164   
ref|XP_010534882.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    480   2e-164   
ref|XP_009117633.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    479   2e-164   
ref|XP_002297642.1|  oxidoreductase family protein                      479   4e-164   Populus trichocarpa [western balsam poplar]
ref|XP_006488902.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    478   6e-164   
ref|NP_187970.1|  feruloyl CoA ortho-hydroxylase 1                      477   2e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011048234.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    476   4e-163   
gb|KHN30847.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        474   1e-162   
gb|AER36089.1|  citrus dioxygenase                                      475   1e-162   
ref|XP_002525827.1|  leucoanthocyanidin dioxygenase, putative           474   4e-162   Ricinus communis
ref|XP_006368541.1|  hypothetical protein POPTR_0001s04390g             473   5e-162   
ref|XP_002525830.1|  leucoanthocyanidin dioxygenase, putative           473   8e-162   Ricinus communis
gb|KDP40921.1|  hypothetical protein JCGZ_24920                         473   9e-162   
ref|XP_002525828.1|  leucoanthocyanidin dioxygenase, putative           472   2e-161   Ricinus communis
ref|XP_007134307.1|  hypothetical protein PHAVU_010G036100g             467   2e-159   
ref|XP_002525829.1|  leucoanthocyanidin dioxygenase, putative           467   2e-159   Ricinus communis
ref|XP_009375631.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    466   6e-159   
gb|KDP40923.1|  hypothetical protein JCGZ_24922                         465   1e-158   
gb|ADV77970.1|  putative oxoglutarate dependent dioxygenase             458   5e-156   
gb|ADV77968.1|  putative dioxoglutarate dependent dioxygenase           454   4e-154   
ref|XP_006423466.1|  hypothetical protein CICLE_v10029948mg             451   2e-153   
ref|XP_004228966.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    451   5e-153   
ref|XP_006445646.1|  hypothetical protein CICLE_v10017914mg             449   8e-153   
gb|KDP40922.1|  hypothetical protein JCGZ_24921                         456   2e-152   
gb|ADV77969.1|  putative oxoglutarate dependent dioxygenase             443   7e-150   
ref|XP_010552260.1|  PREDICTED: LOW QUALITY PROTEIN: feruloyl CoA...    441   2e-149   
emb|CDP17662.1|  unnamed protein product                                437   4e-148   
ref|XP_009764115.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    434   9e-147   
ref|XP_006446357.1|  hypothetical protein CICLE_v10015758mg             434   1e-146   
gb|KDO66421.1|  hypothetical protein CISIN_1g018488mg                   433   3e-146   
gb|KDP34560.1|  hypothetical protein JCGZ_11110                         432   6e-146   
ref|XP_006470506.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    431   1e-145   
ref|XP_007015337.1|  Leucoanthocyanidin dioxygenase, putative           429   8e-145   
emb|CDP05588.1|  unnamed protein product                                423   2e-142   
gb|KHG00946.1|  hypothetical protein F383_06437                         420   4e-141   
ref|XP_011090260.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    419   2e-140   
ref|XP_010673493.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    418   2e-140   
ref|XP_006340349.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    412   5e-138   
ref|XP_004251238.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    407   5e-136   
emb|CDP09714.1|  unnamed protein product                                405   2e-135   
gb|AFK44895.1|  unknown                                                 405   3e-135   
ref|NP_001240180.1|  1-aminocyclopropane-1-carboxylate oxidase ho...    404   5e-135   
gb|KEH33527.1|  2OG-Fe(II) oxygenase family oxidoreductase              404   6e-135   
ref|XP_003599720.1|  Flavonol synthase/flavanone 3-hydroxylase          402   6e-134   
ref|XP_007146231.1|  hypothetical protein PHAVU_006G023200g             401   1e-133   
ref|XP_011010706.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    396   7e-133   
gb|AES69971.2|  2OG-Fe(II) oxygenase family oxidoreductase              395   3e-131   
ref|XP_010093053.1|  1-aminocyclopropane-1-carboxylate oxidase-3-...    385   3e-127   
ref|XP_006489000.1|  PREDICTED: LOW QUALITY PROTEIN: feruloyl CoA...    383   1e-126   
ref|XP_010536147.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    382   4e-126   
ref|XP_006364250.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    380   2e-125   
gb|KDP25105.1|  hypothetical protein JCGZ_22640                         379   4e-125   
ref|XP_004250780.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        378   2e-124   
emb|CDP17396.1|  unnamed protein product                                374   4e-123   
ref|XP_010534761.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        374   6e-123   
gb|KHG03924.1|  1-aminocyclopropane-1-carboxylate oxidase               374   9e-123   
ref|XP_009628264.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        373   2e-122   
ref|XP_008226098.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        373   2e-122   
emb|CDY70527.1|  BnaCnng68740D                                          372   2e-122   
ref|XP_007213898.1|  hypothetical protein PRUPE_ppa007382mg             372   5e-122   
ref|XP_010499635.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    371   9e-122   
gb|AFK49211.1|  unknown                                                 370   2e-121   
ref|XP_010465070.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    370   2e-121   
ref|NP_187896.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    369   3e-121   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28555.1|  unknown                                                 369   3e-121   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08394.1|  BnaA05g26300D                                          368   1e-120   
ref|XP_002306414.1|  oxidoreductase family protein                      368   1e-120   Populus trichocarpa [western balsam poplar]
ref|XP_010487018.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    367   2e-120   
gb|AFK39991.1|  unknown                                                 368   2e-120   
ref|XP_009135260.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    367   3e-120   
ref|NP_001242438.1|  uncharacterized protein LOC100803722               367   3e-120   
ref|XP_002882794.1|  oxidoreductase                                     367   4e-120   
ref|XP_010647291.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    367   4e-120   
ref|XP_008372034.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        366   6e-120   
emb|CDP09718.1|  unnamed protein product                                366   2e-119   
ref|XP_007022206.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    367   2e-119   
ref|XP_007146232.1|  hypothetical protein PHAVU_006G023300g             363   3e-119   
emb|CDY24239.1|  BnaC01g38190D                                          364   4e-119   
gb|KFK38632.1|  hypothetical protein AALP_AA3G139200                    363   5e-119   
ref|XP_009124685.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    363   5e-119   
emb|CDP20007.1|  unnamed protein product                                364   6e-119   
ref|XP_009146572.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    363   6e-119   
ref|XP_006407284.1|  hypothetical protein EUTSA_v10020841mg             365   1e-118   
ref|XP_011022120.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        362   2e-118   
ref|XP_007022209.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    363   2e-118   
ref|XP_007022212.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    362   2e-118   
ref|XP_010647147.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    362   3e-118   
ref|XP_007149304.1|  hypothetical protein PHAVU_005G059100g             362   4e-118   
emb|CDY57297.1|  BnaC03g73320D                                          360   7e-118   
emb|CDY57296.1|  BnaC03g73310D                                          360   9e-118   
ref|XP_009764116.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    360   1e-117   
ref|XP_009361814.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    360   1e-117   
ref|XP_006828760.1|  hypothetical protein AMTR_s00001p00076430          360   1e-117   
ref|XP_010468586.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    360   2e-117   
ref|XP_009613782.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    359   4e-117   
ref|XP_006340353.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    357   3e-116   
emb|CAN80862.1|  hypothetical protein VITISV_011327                     357   4e-116   Vitis vinifera
ref|XP_010644912.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        357   4e-116   
ref|XP_009776994.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        357   5e-116   
ref|XP_006340355.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    355   9e-116   
emb|CDP13111.1|  unnamed protein product                                355   1e-115   
ref|XP_004488807.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    355   2e-115   
ref|XP_006422215.1|  hypothetical protein CICLE_v10006882mg             355   2e-115   
ref|XP_006422213.1|  hypothetical protein CICLE_v10007156mg             353   5e-115   
ref|XP_006340351.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    353   6e-115   
gb|KDO61641.1|  hypothetical protein CISIN_1g017959mg                   353   8e-115   
ref|XP_003625733.1|  1-aminocyclopropane-1-carboxylate oxidase          351   2e-114   
gb|KDO61642.1|  hypothetical protein CISIN_1g046101mg                   352   3e-114   
ref|XP_010519828.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2        351   6e-114   
ref|XP_004251440.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    350   8e-114   
ref|XP_004251239.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    349   2e-113   
ref|XP_007022207.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    349   3e-113   
ref|XP_006340352.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    348   6e-113   
ref|XP_002513396.1|  leucoanthocyanidin dioxygenase, putative           357   4e-112   Ricinus communis
gb|KHN26841.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        344   2e-111   
ref|XP_006585413.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    344   2e-111   
gb|KFK24987.1|  hypothetical protein AALP_AA8G051800                    344   3e-111   
gb|ACU16692.1|  unknown                                                 340   4e-111   Glycine max [soybeans]
emb|CBI21735.3|  unnamed protein product                                347   6e-111   
ref|XP_006409269.1|  hypothetical protein EUTSA_v10023159mg             343   7e-111   
gb|KDP25104.1|  hypothetical protein JCGZ_22639                         343   7e-111   
gb|KGN59447.1|  hypothetical protein Csa_3G821020                       342   1e-110   
gb|KHG29594.1|  hypothetical protein F383_14046                         342   2e-110   
emb|CDX82570.1|  BnaA03g32510D                                          337   3e-108   
ref|XP_003596148.1|  1-aminocyclopropane-1-carboxylate oxidase          337   6e-108   
ref|XP_006399742.1|  hypothetical protein EUTSA_v10013937mg             335   1e-107   
gb|AES66399.2|  leucoanthocyanidin dioxygenase-like protein             335   1e-107   
ref|XP_006286652.1|  hypothetical protein CARUB_v10002551mg             335   2e-107   
ref|XP_006367566.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    333   3e-107   
gb|KHG24468.1|  hypothetical protein F383_30436                         332   2e-106   
ref|XP_009125855.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    330   7e-106   
emb|CDX85693.1|  BnaA02g01200D                                          330   7e-106   
ref|XP_010274088.1|  PREDICTED: LOW QUALITY PROTEIN: feruloyl CoA...    328   3e-105   
emb|CDX91167.1|  BnaC02g04300D                                          327   1e-104   
ref|XP_010453293.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    326   4e-104   
ref|XP_006828756.1|  hypothetical protein AMTR_s00001p00072200          324   1e-103   
ref|XP_010491986.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    323   3e-103   
emb|CDX68770.1|  BnaC01g06830D                                          322   1e-102   
ref|XP_010419817.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    321   3e-102   
ref|XP_002873560.1|  oxidoreductase                                     320   5e-102   
ref|XP_009101685.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    319   1e-101   
ref|XP_010491985.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    318   4e-101   
emb|CDP17660.1|  unnamed protein product                                314   4e-101   
ref|NP_568260.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    316   2e-100   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85696.1|  BnaA02g01170D                                          315   3e-100   
ref|XP_009125854.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    313   2e-99    
gb|KFK25503.1|  hypothetical protein AALP_AA8G123100                    313   2e-99    
emb|CDY43392.1|  BnaA01g30230D                                          301   1e-95    
emb|CDP09713.1|  unnamed protein product                                299   2e-95    
gb|KFK42053.1|  hypothetical protein AALP_AA2G205200                    301   4e-94    
ref|XP_010266348.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    297   5e-93    
ref|XP_006445648.1|  hypothetical protein CICLE_v10018321mg             293   2e-92    
gb|KHG22041.1|  Deacetoxyvindoline 4-hydroxylase                        284   2e-88    
ref|XP_009588068.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    279   3e-88    
emb|CDP22154.1|  unnamed protein product                                279   5e-87    
emb|CBI16506.3|  unnamed protein product                                277   1e-86    
emb|CBI16504.3|  unnamed protein product                                273   1e-85    
ref|XP_006300271.1|  hypothetical protein CARUB_v100140881mg            266   2e-82    
ref|XP_008352041.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    275   2e-81    
gb|KHM99648.1|  1-aminocyclopropane-1-carboxylate oxidase like 6        262   1e-80    
gb|AES66396.2|  leucoanthocyanidin dioxygenase-like protein             254   2e-77    
ref|XP_002989580.1|  2-oxoglutarate-iron(II)-dependent oxygenase        254   2e-76    
dbj|BAB17023.1|  1-aminocyclopropane-1-carboxylate oxidase-like p...    251   4e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002964234.1|  oxidoreductase                                     250   7e-75    
gb|KDO63054.1|  hypothetical protein CISIN_1g046644mg                   244   2e-74    
ref|XP_002983443.1|  oxidoreductase                                     243   3e-72    
ref|XP_002975246.1|  2-oxoacid-dependent dioxygenase                    241   1e-71    
ref|XP_009607354.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    234   2e-71    
ref|XP_002983526.1|  2-oxoglutarate-Iron(II)-dependent oxygenase        241   3e-71    
ref|XP_002983428.1|  2-oxoglutarate-iron(II)-dependent oxygenase        240   3e-71    
ref|XP_002973855.1|  2-oxoglutarate-iron(II)-dependent oxygenase        236   1e-69    
ref|XP_004251240.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    229   2e-68    
gb|KDO63049.1|  hypothetical protein CISIN_1g046402mg                   228   8e-68    
ref|XP_007152332.1|  hypothetical protein PHAVU_004G121000g             231   2e-67    
ref|XP_002983440.1|  2-oxoglutarate-Iron(II)-dependent oxygenase        230   2e-67    
ref|XP_002974207.1|  oxidoreductase                                     230   3e-67    
gb|KHN26844.1|  1-aminocyclopropane-1-carboxylate oxidase like 5        225   3e-67    
ref|XP_003548216.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    229   7e-67    
ref|XP_002965941.1|  2-oxoacid-dependent dioxygenase                    227   2e-66    
ref|XP_002965940.1|  2-oxoacid-dependent dioxygenase                    226   5e-66    
ref|XP_002968370.1|  2-oxoacid dioxygenase                              226   7e-66    
ref|XP_002965939.1|  2-oxoacid-dependent dioxygenase                    225   1e-65    
ref|XP_002975060.1|  2-oxoacid-dependent dioxygenase                    226   1e-65    
ref|XP_010692279.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    226   1e-65    
ref|XP_002315859.2|  hypothetical protein POPTR_0010s11780g             227   2e-65    Populus trichocarpa [western balsam poplar]
gb|ABK96576.1|  unknown                                                 227   2e-65    Populus trichocarpa x Populus deltoides
ref|XP_004296614.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    225   3e-65    
ref|XP_011021786.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    226   6e-65    
ref|XP_002278004.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    222   2e-64    Vitis vinifera
ref|XP_002968365.1|  2-oxoacid-dependent dioxygenase                    223   2e-64    
ref|XP_002974050.1|  2-oxoglutarate-iron(II)-dependent oxygenase        222   3e-64    
ref|XP_010313495.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    217   4e-64    
ref|XP_004960372.1|  PREDICTED: protein SRG1-like                       222   5e-64    
gb|KDP38107.1|  hypothetical protein JCGZ_04750                         222   5e-64    
ref|XP_002968368.1|  2-oxoacid-dependent dioxygenase                    222   5e-64    
ref|XP_006411026.1|  hypothetical protein EUTSA_v10016867mg             221   8e-64    
ref|XP_007152331.1|  hypothetical protein PHAVU_004G120900g             221   1e-63    
emb|CDY07746.1|  BnaA03g17650D                                          220   2e-63    
ref|XP_009133236.1|  PREDICTED: protein SRG1-like                       219   3e-63    
ref|XP_002440516.1|  hypothetical protein SORBIDRAFT_09g002350          219   4e-63    Sorghum bicolor [broomcorn]
ref|XP_010253753.1|  PREDICTED: protein SRG1-like                       219   6e-63    
ref|XP_002983535.1|  2-oxoglutarate-Iron(II)-dependent oxygenase        218   6e-63    
ref|XP_004985921.1|  PREDICTED: flavanone 3-dioxygenase-like            218   7e-63    
ref|XP_009141728.1|  PREDICTED: protein SRG1-like                       218   7e-63    
ref|NP_181359.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    218   8e-63    Arabidopsis thaliana [mouse-ear cress]
gb|AAM63604.1|  putative anthocyanidin synthase                         218   9e-63    Arabidopsis thaliana [mouse-ear cress]
gb|AES66420.2|  2OG-Fe(II) oxygenase family oxidoreductase              219   9e-63    
ref|XP_004499952.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    218   1e-62    
ref|XP_002862263.1|  oxidoreductase                                     218   1e-62    
ref|XP_002317046.2|  hypothetical protein POPTR_0011s15310g             217   2e-62    Populus trichocarpa [western balsam poplar]
ref|XP_007149298.1|  hypothetical protein PHAVU_005G058500g             218   2e-62    
emb|CDY14476.1|  BnaC03g21190D                                          217   2e-62    
ref|XP_002881570.1|  oxidoreductase                                     217   2e-62    
gb|EYU25981.1|  hypothetical protein MIMGU_mgv1a008542mg                218   2e-62    
ref|XP_006448177.1|  hypothetical protein CICLE_v10015577mg             218   2e-62    
ref|XP_006294411.1|  hypothetical protein CARUB_v10023429mg             218   2e-62    
ref|XP_002278024.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    217   3e-62    Vitis vinifera
ref|XP_010031167.1|  PREDICTED: protein SRG1-like                       217   3e-62    
gb|AGX27514.1|  PRXQ2                                                   216   4e-62    
ref|XP_010920852.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    216   5e-62    
ref|XP_010505441.1|  PREDICTED: protein SRG1-like                       216   5e-62    
ref|XP_002312162.1|  oxidoreductase family protein                      216   5e-62    Populus trichocarpa [western balsam poplar]
gb|AFK38415.1|  unknown                                                 216   6e-62    
ref|XP_003577163.2|  PREDICTED: protein SRG1                            216   6e-62    
ref|XP_003596174.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    216   6e-62    
ref|XP_006352127.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    211   6e-62    
gb|EMS68938.1|  putative 2-oxoglutarate/Fe(II)-dependent dioxygenase    216   6e-62    
ref|XP_002525989.1|  Desacetoxyvindoline 4-hydroxylase, putative        216   6e-62    
ref|XP_003596176.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    216   7e-62    
ref|XP_010251334.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    216   8e-62    
ref|XP_003626775.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    216   1e-61    
ref|XP_009119045.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    216   1e-61    
ref|XP_010920851.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    215   1e-61    
ref|XP_010093755.1|  1-aminocyclopropane-1-carboxylate oxidase-1-...    216   1e-61    
emb|CDY34450.1|  BnaC01g21830D                                          214   1e-61    
emb|CDY68873.1|  BnaCnng60860D                                          214   3e-61    
gb|EMT13404.1|  Protein SRG1                                            214   3e-61    
gb|KFK36717.1|  hypothetical protein AALP_AA4G160400                    214   4e-61    
ref|XP_002990551.1|  2-oxoacid-dependent dioxygenase                    213   4e-61    
ref|XP_006469242.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    214   5e-61    
ref|XP_010106329.1|  hypothetical protein L484_004728                   209   6e-61    
ref|XP_002965938.1|  2-oxoacid-dependent dioxygenase                    214   6e-61    
ref|XP_010463461.1|  PREDICTED: uncharacterized protein LOC104744147    214   7e-61    
ref|XP_010556890.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    213   7e-61    
ref|XP_002515091.1|  1-aminocyclopropane-1-carboxylate oxidase, p...    213   8e-61    
ref|XP_009402233.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    213   8e-61    
gb|KEH22083.1|  2OG-Fe(II) oxygenase family oxidoreductase              213   1e-60    
emb|CDO99213.1|  unnamed protein product                                213   1e-60    
ref|XP_009131989.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    213   1e-60    
ref|XP_007045252.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    213   1e-60    
ref|XP_004299419.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    213   1e-60    
ref|XP_002284582.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    213   2e-60    
ref|XP_010509205.1|  PREDICTED: protein SRG1-like                       214   2e-60    
gb|AHW42451.1|  GA2ox1                                                  212   2e-60    
dbj|BAJ85376.1|  predicted protein                                      212   2e-60    
ref|XP_004297444.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    212   2e-60    
gb|ABK26685.1|  unknown                                                 212   3e-60    
ref|XP_007141760.1|  hypothetical protein PHAVU_008G223500g             211   3e-60    
ref|XP_003626795.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    212   3e-60    
ref|XP_004488811.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    212   3e-60    
ref|XP_007149297.1|  hypothetical protein PHAVU_005G058400g             212   3e-60    
emb|CDP15734.1|  unnamed protein product                                211   4e-60    
ref|XP_002533635.1|  Leucoanthocyanidin dioxygenase, putative           211   5e-60    
ref|XP_011047646.1|  PREDICTED: leucoanthocyanidin dioxygenase-li...    211   6e-60    
emb|CDP06475.1|  unnamed protein product                                211   6e-60    
ref|XP_006420190.1|  hypothetical protein CICLE_v10005210mg             211   6e-60    
ref|XP_003626788.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    211   6e-60    
ref|XP_007223369.1|  hypothetical protein PRUPE_ppa007487mg             211   6e-60    
ref|NP_172147.2|  2-oxoglutarate-dependent dioxygenase-like protein     211   7e-60    
ref|XP_009397555.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    211   7e-60    
ref|XP_003596162.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    211   7e-60    
emb|CBI34622.3|  unnamed protein product                                209   8e-60    
ref|XP_010265452.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    212   9e-60    
ref|XP_010920850.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    210   9e-60    
ref|XP_007035072.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    211   9e-60    
ref|XP_010904577.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    210   9e-60    
gb|KEH18776.1|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    210   1e-59    
ref|XP_009399997.1|  PREDICTED: protein SRG1-like                       210   1e-59    
ref|XP_004142373.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    211   1e-59    
ref|XP_004309513.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          209   1e-59    
ref|XP_010517112.1|  PREDICTED: protein SRG1-like                       209   1e-59    
ref|XP_009409556.1|  PREDICTED: protein SRG1-like                       210   1e-59    
ref|NP_001044707.1|  Os01g0832600                                       210   1e-59    
ref|XP_009146096.1|  PREDICTED: leucoanthocyanidin dioxygenase          209   2e-59    
gb|KDP27711.1|  hypothetical protein JCGZ_19834                         209   2e-59    
ref|XP_010920849.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    210   2e-59    
ref|XP_008243522.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    210   2e-59    
ref|XP_006489565.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    209   2e-59    
ref|XP_009799787.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    202   2e-59    
ref|XP_008650338.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    209   2e-59    
ref|XP_002300519.1|  hypothetical protein POPTR_0001s45610g             209   2e-59    
ref|XP_010070067.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    209   2e-59    
gb|ABK22784.1|  unknown                                                 209   2e-59    
ref|XP_002529304.1|  Desacetoxyvindoline 4-hydroxylase, putative        209   2e-59    
ref|XP_007035064.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    209   3e-59    
ref|XP_009411417.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    209   3e-59    
gb|ABK26232.1|  unknown                                                 209   3e-59    
ref|XP_006354515.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    209   3e-59    
emb|CAN66433.1|  hypothetical protein VITISV_027452                     209   3e-59    
ref|XP_006489567.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    209   3e-59    
ref|XP_010040506.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    209   3e-59    
ref|XP_007134370.1|  hypothetical protein PHAVU_010G042000g             209   3e-59    
ref|XP_008365367.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    209   4e-59    
gb|ABK23053.1|  unknown                                                 209   4e-59    
ref|XP_009379006.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    209   4e-59    
ref|XP_009404656.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    208   4e-59    
gb|EYU32964.1|  hypothetical protein MIMGU_mgv1a025231mg                209   4e-59    
ref|XP_006340354.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    204   4e-59    
gb|EYU22100.1|  hypothetical protein MIMGU_mgv1a008645mg                209   5e-59    
gb|KDO49904.1|  hypothetical protein CISIN_1g0442571mg                  202   5e-59    
ref|XP_006598206.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    209   6e-59    
ref|XP_008438869.1|  PREDICTED: protein SRG1                            208   6e-59    
ref|XP_008221470.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    209   6e-59    
ref|XP_003626790.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    208   7e-59    
ref|XP_007211193.1|  hypothetical protein PRUPE_ppa008100mg             207   7e-59    
ref|XP_010274816.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    209   8e-59    
ref|XP_010270531.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    208   8e-59    
ref|XP_004984849.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     208   8e-59    
ref|XP_004296613.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    208   9e-59    
ref|XP_009335249.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    207   9e-59    
ref|XP_010259688.1|  PREDICTED: protein SRG1-like                       208   9e-59    
ref|XP_006421688.1|  hypothetical protein CICLE_v10005149mg             209   9e-59    
ref|XP_002988299.1|  2-oxoacid-dependent dioxygenase                    207   9e-59    
gb|KFK27480.1|  hypothetical protein AALP_AA8G389000                    208   1e-58    
ref|XP_007223354.1|  hypothetical protein PRUPE_ppa007450mg             208   1e-58    
ref|XP_009372512.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    208   1e-58    
ref|XP_007209285.1|  hypothetical protein PRUPE_ppa008091mg             207   1e-58    
ref|XP_002985781.1|  2-oxoacid-dependent dioxygenase                    207   1e-58    
ref|XP_004510134.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    207   1e-58    
ref|XP_008805016.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    207   1e-58    
ref|XP_006304979.1|  hypothetical protein CARUB_v10011473mg             207   1e-58    
gb|AFK38092.1|  unknown                                                 208   1e-58    
ref|XP_004299716.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    207   1e-58    
ref|XP_004134481.1|  PREDICTED: protein SRG1-like                       207   1e-58    
gb|KFK31253.1|  hypothetical protein AALP_AA6G088500                    207   1e-58    
ref|NP_001267994.1|  uncharacterized protein LOC100854106               207   1e-58    
ref|XP_008367169.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    207   2e-58    
emb|CDX88708.1|  BnaA03g09410D                                          207   2e-58    
ref|XP_010650057.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    207   2e-58    
ref|XP_002273640.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    206   2e-58    
ref|XP_006352055.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    207   2e-58    
emb|CDY32234.1|  BnaA01g17500D                                          206   2e-58    
gb|ABK21461.1|  unknown                                                 207   2e-58    
ref|XP_002974642.1|  2-oxoacid-dependent dioxygenase                    207   2e-58    
ref|XP_002315711.2|  hypothetical protein POPTR_0010s08380g             207   2e-58    
ref|XP_006578869.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    206   2e-58    
ref|XP_009141108.1|  PREDICTED: probable 2-oxoacid dependent diox...    207   2e-58    
ref|XP_009783758.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    207   2e-58    
ref|XP_004159844.1|  PREDICTED: LOW QUALITY PROTEIN: protein SRG1...    206   2e-58    
ref|XP_010922560.1|  PREDICTED: protein SRG1-like                       206   2e-58    
ref|XP_006356486.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    207   3e-58    
ref|XP_002881136.1|  hypothetical protein ARALYDRAFT_482001             207   3e-58    
ref|XP_008392657.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          206   3e-58    
ref|XP_004976588.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    206   3e-58    
ref|XP_004303540.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    207   3e-58    
ref|XP_002518945.1|  1-aminocyclopropane-1-carboxylate oxidase, p...    206   3e-58    
gb|AHU88620.1|  anthocyanidin synthase                                  206   3e-58    
ref|XP_008245738.1|  PREDICTED: hyoscyamine 6-dioxygenase-like is...    206   3e-58    
ref|XP_011091193.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    206   3e-58    
gb|ABK96309.1|  unknown                                                 206   3e-58    
ref|XP_009761509.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    206   3e-58    
ref|XP_003519993.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    207   3e-58    
ref|XP_010264624.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    206   4e-58    
emb|CDO99214.1|  unnamed protein product                                207   4e-58    
ref|XP_010040086.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    206   4e-58    
ref|XP_004971189.1|  PREDICTED: protein SRG1-like                       206   5e-58    
ref|XP_011095018.1|  PREDICTED: leucoanthocyanidin dioxygenase          206   5e-58    
emb|CAN80594.1|  hypothetical protein VITISV_017626                     206   5e-58    
ref|XP_002889610.1|  predicted protein                                  206   5e-58    
gb|KDO65452.1|  hypothetical protein CISIN_1g019027mg                   205   5e-58    
ref|XP_010650062.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    206   6e-58    
ref|XP_011038018.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          205   6e-58    
ref|XP_002267625.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    205   6e-58    
ref|XP_009384795.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    206   6e-58    
ref|XP_011006564.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     206   6e-58    
ref|XP_006490103.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          205   6e-58    
ref|XP_008783539.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    205   6e-58    
gb|ACG44904.1|  flavonol synthase/flavanone 3-hydroxylase               207   7e-58    
ref|XP_008382881.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    206   7e-58    
ref|XP_007035074.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    206   7e-58    
ref|XP_008224380.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    206   7e-58    
ref|XP_009610251.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    206   7e-58    
gb|EMT24263.1|  Protein SRG1                                            206   8e-58    
ref|XP_009626185.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    206   8e-58    
ref|XP_003602395.1|  1-aminocyclopropane-1-carboxylate oxidase          204   9e-58    
gb|EMS54967.1|  Protein SRG1                                            205   9e-58    
ref|XP_010111897.1|  1-aminocyclopropane-1-carboxylate oxidase-1-...    205   1e-57    
ref|XP_008660253.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    206   1e-57    
ref|XP_002963353.1|  oxidoreductase                                     205   1e-57    
gb|EEE61552.1|  hypothetical protein OsJ_15896                          204   1e-57    
ref|XP_007026685.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    205   1e-57    
ref|NP_001234624.1|  2-oxoglutarate-dependent dioxygenase               205   1e-57    
ref|XP_010040087.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    204   1e-57    
ref|XP_003544081.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     205   1e-57    
ref|XP_006851304.1|  hypothetical protein AMTR_s00050p00146920          205   1e-57    
ref|XP_011019103.1|  PREDICTED: thebaine 6-O-demethylase-like           205   1e-57    
gb|KHN20840.1|  Codeine O-demethylase                                   205   1e-57    
ref|XP_011030519.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    205   1e-57    
ref|XP_010241045.1|  PREDICTED: hyoscyamine 6-dioxygenase-like is...    204   1e-57    
emb|CDM86075.1|  unnamed protein product                                205   1e-57    
ref|XP_010922559.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    205   1e-57    
ref|XP_004247713.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    204   1e-57    
ref|XP_010043944.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    205   1e-57    
gb|AFK35571.1|  unknown                                                 205   1e-57    
ref|XP_009400200.1|  PREDICTED: flavanone 3-dioxygenase-like            204   1e-57    
ref|XP_007226473.1|  hypothetical protein PRUPE_ppa027196mg             205   1e-57    
ref|XP_010483593.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    205   1e-57    
ref|XP_004165509.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    204   1e-57    
emb|CDX71103.1|  BnaC03g11870D                                          204   2e-57    
ref|XP_006354512.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    205   2e-57    
ref|XP_010040043.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    204   2e-57    
ref|XP_002323582.1|  hypothetical protein POPTR_0016s12440g             204   2e-57    
gb|EEC74418.1|  hypothetical protein OsI_09784                          204   2e-57    
ref|XP_010034909.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    204   2e-57    
ref|XP_004145878.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    204   2e-57    
emb|CAN63747.1|  hypothetical protein VITISV_009059                     204   2e-57    
ref|XP_006351987.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    204   2e-57    
ref|XP_002970071.1|  2-oxoglutarate-iron(II)-dependent oxygenase        204   2e-57    
ref|XP_002465421.1|  hypothetical protein SORBIDRAFT_01g038520          205   2e-57    
gb|ABK22814.1|  unknown                                                 204   2e-57    
dbj|BAJ98644.1|  predicted protein                                      204   2e-57    
gb|KDP37330.1|  hypothetical protein JCGZ_06784                         204   2e-57    
ref|XP_010650061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    204   2e-57    
ref|XP_008789107.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    204   3e-57    
ref|XP_009406925.1|  PREDICTED: protein SRG1-like                       204   3e-57    
ref|XP_010039168.1|  PREDICTED: protein SRG1                            204   3e-57    
gb|KCW49451.1|  hypothetical protein EUGRSUZ_K02978                     204   3e-57    
ref|XP_002985262.1|  2-oxoglutarate-iron(II)-dependent oxygenase        204   3e-57    
ref|XP_009802072.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    204   3e-57    
ref|NP_001053651.1|  Os04g0581000                                       203   3e-57    
emb|CDP21791.1|  unnamed protein product                                198   3e-57    
ref|XP_006420185.1|  hypothetical protein CICLE_v10005194mg             204   3e-57    
ref|XP_010650059.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    204   3e-57    
ref|XP_002459057.1|  hypothetical protein SORBIDRAFT_03g045170          204   3e-57    
gb|KDP30058.1|  hypothetical protein JCGZ_18383                         203   3e-57    
ref|XP_006478091.1|  PREDICTED: flavanone 3-dioxygenase-like            203   3e-57    
ref|XP_009348691.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          203   3e-57    
ref|XP_002278096.3|  PREDICTED: protein SRG1-like                       204   3e-57    
ref|XP_003596159.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    204   3e-57    
ref|XP_010039651.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    203   3e-57    
ref|XP_002993848.1|  2-oxoacid-dependent dioxygenase                    203   4e-57    
ref|XP_008222545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    204   4e-57    
gb|KCW45529.1|  hypothetical protein EUGRSUZ_L00738                     202   4e-57    
ref|XP_009347731.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    204   4e-57    



>dbj|BAL22345.1| oxidoreductase [Ipomoea batatas]
Length=358

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/357 (69%), Positives = 299/357 (84%), Gaps = 3/357 (1%)
 Frame = -3

Query  1238  PAALSESES-VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTID  1062
             PA LS   S + DFVV+EG GVKGL+DMG+++LP QYIQP +ERI  + ++ DD+IP ID
Sbjct  2     PAVLSSVLSNITDFVVHEGNGVKGLADMGLQSLPKQYIQPAEERITTSTVIVDDTIPVID  61

Query  1061  ISNW-DDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             +S W  DP V   +CEAAE+WGFFQI+NHGVP+E+LE +K ATYRFF+LP EEK K+SK 
Sbjct  62    LSEWGSDPKVGDLICEAAEKWGFFQIVNHGVPLEVLEEVKAATYRFFRLPAEEKNKHSKD  121

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             NSPS NVRYGTSF+P +EK LEWKD+LSLFYVSD+EAAALWP ACR EA+ +M  C+A+I
Sbjct  122   NSPSNNVRYGTSFTPHAEKALEWKDFLSLFYVSDEEAAALWPSACRDEALTFMRNCDAVI  181

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             K LL+ LM GLN+ E +D +KE L MG+KRIN NYYPKCPNPEL VGVGRHSD+ST+T+L
Sbjct  182   KRLLKSLMKGLNVTE-IDGTKESLLMGSKRINMNYYPKCPNPELTVGVGRHSDVSTLTIL  240

Query  524   LQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             LQD IGGL+VRKL+SDTWVHVPP++GA+VIN+GDALQILSNGRYKS EHRV ANG ++RI
Sbjct  241   LQDQIGGLYVRKLDSDTWVHVPPINGAIVINVGDALQILSNGRYKSIEHRVIANGSNNRI  300

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             SVPIFV P P   +GPLPE+L  GEK +YK ++YSDY++HFF KAHDGKET++FAKI
Sbjct  301   SVPIFVNPRPNDIIGPLPELLESGEKAVYKNVLYSDYVKHFFRKAHDGKETVDFAKI  357



>dbj|BAL22344.1| oxidoreductase [Ipomoea batatas]
Length=358

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/357 (69%), Positives = 298/357 (83%), Gaps = 3/357 (1%)
 Frame = -3

Query  1238  PAALSESES-VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTID  1062
             PA LS   S + DFVV+EG GVKGL+DMG++ALP QY+QP +ERI  + ++ DD+IP ID
Sbjct  2     PAVLSSVLSNITDFVVHEGNGVKGLADMGLEALPKQYVQPEEERITTSTVIVDDTIPVID  61

Query  1061  ISNW-DDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             +S W  DP V   +CEAAE+WGFFQI+NHGVP+E+LE +K ATYRFF+LP EEK K+ K 
Sbjct  62    LSEWGSDPKVGDMICEAAEKWGFFQIVNHGVPLEVLEEVKAATYRFFRLPAEEKNKHCKD  121

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             NSPS NVRYGTSF+P +EK LEWKD+LSLFYVSD+EAAALWP ACR EA+ +M  C+A+I
Sbjct  122   NSPSNNVRYGTSFTPHAEKALEWKDFLSLFYVSDEEAAALWPSACRDEALTFMRNCDAVI  181

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             K LL+ LM GLN+ E +D +KE L MG+KRIN NYYPKCPNPEL VGVGRHSD+ST+T+L
Sbjct  182   KRLLKSLMKGLNVTE-IDGTKESLLMGSKRINMNYYPKCPNPELTVGVGRHSDVSTLTIL  240

Query  524   LQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             LQD IGGL+VRKL+SDTWVHVPP++GA+VIN+GDALQILSNGRYKS EHRV ANG ++RI
Sbjct  241   LQDQIGGLYVRKLDSDTWVHVPPINGAIVINVGDALQILSNGRYKSIEHRVIANGSNNRI  300

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             SVPIFV P P   +GPLPE+L  GEK +YK ++YSDY++HFF KAHDGKET++FAKI
Sbjct  301   SVPIFVNPRPNDIIGPLPELLESGEKAVYKNVLYSDYVKHFFRKAHDGKETVDFAKI  357



>dbj|BAL22343.1| oxidoreductase [Ipomoea batatas]
Length=358

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/357 (69%), Positives = 297/357 (83%), Gaps = 3/357 (1%)
 Frame = -3

Query  1238  PAALSESES-VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTID  1062
             PA LS   S + DFVV+EG GVKGL+DMG++ALP QY+QP +ERI  + ++ DD+IP ID
Sbjct  2     PAVLSSVLSNITDFVVHEGNGVKGLADMGLEALPKQYVQPEEERITTSTVIVDDTIPVID  61

Query  1061  ISNW-DDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             +S W  DP V    CEAAE+WGFFQI+NHGVP+E+LE +K ATYRFF+LP EEK K+SK 
Sbjct  62    LSEWGSDPKVGDMNCEAAEKWGFFQIVNHGVPLEVLEEVKAATYRFFRLPAEEKNKHSKD  121

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             NSPS NVRYGTSF+P +EK LEWKD+LSLFYVSD+EAAALWP ACR EA+ +M  C+A+I
Sbjct  122   NSPSNNVRYGTSFTPHAEKALEWKDFLSLFYVSDEEAAALWPSACRDEALTFMRNCDAVI  181

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             K LL+ LM GLN+ E +D +KE L MG+KRIN NYYPKCPNPEL VGVGRHSD+ST+T+L
Sbjct  182   KRLLKSLMKGLNVTE-IDGTKESLLMGSKRINMNYYPKCPNPELTVGVGRHSDVSTLTIL  240

Query  524   LQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             LQD IGGL+VRKL+SD WVHVPP++GA+VIN+GDALQILSNGRYKS EHRV ANG ++RI
Sbjct  241   LQDQIGGLYVRKLDSDEWVHVPPINGAIVINVGDALQILSNGRYKSIEHRVIANGSNNRI  300

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             SVPIFV P P   +GPLPE+L  GEK +YK ++YSDY++HFF KAHDGKET++FAKI
Sbjct  301   SVPIFVNPRPNDVIGPLPELLESGEKAVYKNVLYSDYVKHFFRKAHDGKETVDFAKI  357



>ref|XP_009588065.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Nicotiana tomentosiformis]
Length=360

 Score =   523 bits (1348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/359 (66%), Positives = 300/359 (84%), Gaps = 5/359 (1%)
 Frame = -3

Query  1238  PAALSE--SESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             P  LS   S ++ +FV+NEG GVKGLS++G+K LP QYIQP +ERI  + I+ DDSIP I
Sbjct  2     PTTLSSNVSNNITEFVLNEGNGVKGLSELGLKTLPKQYIQPLQERITTSTIIVDDSIPII  61

Query  1064  DISNWDD--PAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
             D+SNWDD  P +   +C+AAE+WGFFQIINHG+P+E+L+++K ATYRFF+   EEK K+S
Sbjct  62    DMSNWDDNNPIICEKICDAAEKWGFFQIINHGIPLEVLDTVKAATYRFFRQSAEEKNKHS  121

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             K NS + NVRYGTSF+P++EK LEWKDYLSLFYVSD+E+AALWP ACR EA+E++     
Sbjct  122   KENSTTNNVRYGTSFTPQAEKALEWKDYLSLFYVSDEESAALWPSACRDEALEFLRNSEI  181

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             +IK LL+ LM GLNI E +D++KE L MG+KRIN NYYPKCPNPEL VGVGRHSD+ST+T
Sbjct  182   VIKKLLKALMKGLNINE-IDQTKESLLMGSKRINLNYYPKCPNPELTVGVGRHSDVSTLT  240

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +LLQD+IGGL+V+KL+S++WVH+PP+DGA+VINIGDALQI+SNG+YKS EHRV ANG ++
Sbjct  241   ILLQDNIGGLYVKKLDSNSWVHIPPIDGAIVINIGDALQIMSNGKYKSIEHRVMANGCNN  300

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             RISVPIFV P P   +GPLPEV+  GEK +YK+++YSDY++HFF KAHDGKET++FAKI
Sbjct  301   RISVPIFVNPKPNDLIGPLPEVVKNGEKAIYKQVLYSDYVKHFFRKAHDGKETVDFAKI  359



>emb|CDP17661.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   522 bits (1345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 233/356 (65%), Positives = 298/356 (84%), Gaps = 1/356 (0%)
 Frame = -3

Query  1241  APAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTID  1062
             +P+  S+S  V+ F V++G GVKGL+D+G++ LP QYIQPP+E+I  + +V DDSIP ID
Sbjct  4     SPSMDSKSWDVISFAVDKGHGVKGLADLGLETLPKQYIQPPEEKITNSTVVTDDSIPVID  63

Query  1061  ISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKAN  882
             +SNW DP V+  +C AAE+WGFFQI+NHG+P+E+LE +K AT RFF  P E+K K+SK N
Sbjct  64    LSNWTDPKVAEQICHAAEKWGFFQIVNHGIPIEVLEDVKEATRRFFDSPAEQKNKHSKDN  123

Query  881   SPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIK  702
             SP+ NVRYGTSF+P++EK LEWKD+LSLFY SDDEAAA WP ACR+EA+++M +   +I+
Sbjct  124   SPTNNVRYGTSFTPKAEKALEWKDFLSLFYASDDEAAAQWPSACRNEALDFMKKSEFVIR  183

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              L+E LM GLN++E +D +KE L MG+KRIN NYYPKCP PEL VGVGRHSD+ST+T+LL
Sbjct  184   RLMEALMKGLNVKE-IDGTKESLLMGSKRINLNYYPKCPEPELTVGVGRHSDVSTLTILL  242

Query  521   QDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRIS  342
             QD IGGL+V+KL+SD+WVHVPP++GA+VIN+GDALQILSNGRYKS EHRV ANG  +R+S
Sbjct  243   QDDIGGLYVKKLDSDSWVHVPPINGAIVINVGDALQILSNGRYKSIEHRVIANGIKNRVS  302

Query  341   VPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             VPIFV P P   +GPLPEVL GGEKP+YK+++YSDY++HFF KAHDGKET++FAKI
Sbjct  303   VPIFVNPRPSDAIGPLPEVLEGGEKPIYKKVLYSDYVKHFFRKAHDGKETVDFAKI  358



>ref|XP_009758809.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Nicotiana sylvestris]
Length=360

 Score =   516 bits (1330),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 234/359 (65%), Positives = 299/359 (83%), Gaps = 5/359 (1%)
 Frame = -3

Query  1238  PAALSE--SESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             P  LS   S ++ +FVVNEG GVKGLS++G+K LP QYIQP +ERI  + I+ DDSIP I
Sbjct  2     PTTLSSNFSNNIKEFVVNEGNGVKGLSELGLKTLPKQYIQPLEERITTSTIIVDDSIPII  61

Query  1064  DISNWD--DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
             D+SNWD  +  V   +C AAE+WGFFQIINHG+P+E+L+++K ATYRFF+   E+K K+S
Sbjct  62    DMSNWDENNTKVCEKICNAAEKWGFFQIINHGIPLEVLDAVKDATYRFFRQSAEKKNKHS  121

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             K NS + NVRYGTSF+P++EK LEWKDYLSLFYVSDDEAAALWP ACR E++E++   + 
Sbjct  122   KENSTTNNVRYGTSFTPQAEKALEWKDYLSLFYVSDDEAAALWPSACRDESLEFLRNSDI  181

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             +IK LL+ LM GLNI + +D++KE L MG+KRIN NYYPKCPNPEL VGVGRHSD+ST+T
Sbjct  182   VIKKLLKALMKGLNINQ-IDQTKESLLMGSKRINLNYYPKCPNPELTVGVGRHSDVSTLT  240

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +LLQD+IGGL+V+KL+S++WVHVPP+DGA+VINIGDALQ++SNG+YKS EHRV ANG ++
Sbjct  241   ILLQDNIGGLYVKKLDSNSWVHVPPIDGAIVINIGDALQLMSNGKYKSIEHRVMANGCNN  300

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             RISVPIFV P P   +GPLPEV+  GEK +YK+++YSDY++HFF KAH+GKET++FAKI
Sbjct  301   RISVPIFVNPKPNDLIGPLPEVIKNGEKAIYKQVLYSDYVKHFFRKAHNGKETVDFAKI  359



>ref|XP_009620118.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Nicotiana tomentosiformis]
Length=359

 Score =   516 bits (1330),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 232/352 (66%), Positives = 293/352 (83%), Gaps = 1/352 (0%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW  1050
             LS SE+V DFVVNEG GVKGLSDMGI+ALP QYIQP +ERI  + ++ DDSIP ID SNW
Sbjct  9     LSNSENVFDFVVNEGNGVKGLSDMGIQALPDQYIQPLEERITTSTVITDDSIPIIDASNW  68

Query  1049  DDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSE  870
             +DP V+  +C+AA+ WGFFQ+INHGVP+E+L+++K  ++RFF LP EEK+KYSK NS S 
Sbjct  69    NDPKVADQICKAAQNWGFFQVINHGVPIEVLDNIKETSHRFFSLPAEEKKKYSKENSISS  128

Query  869   NVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLE  690
             NVRYGTSF+PE+EKTL W+DYLSL ++SDDEAA  WPP C+ EA+EY+ +C+ +I+ +L+
Sbjct  129   NVRYGTSFTPEAEKTLGWRDYLSLVHISDDEAAEFWPPPCKEEALEYLKRCDTVIRKILK  188

Query  689   MLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHI  510
             +LM GLN+ + +D+ KE L MG+KRINFNYYPKCPNPEL+VGV RHSDISTIT LLQD I
Sbjct  189   VLMEGLNV-KTIDEEKEDLLMGSKRINFNYYPKCPNPELSVGVARHSDISTITFLLQDDI  247

Query  509   GGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIF  330
             GGL+V+KL+S+ W+HVPP++GALVINIGDALQI+SN +YKS EHRV ANG  +R+SVPIF
Sbjct  248   GGLYVKKLDSNAWIHVPPINGALVINIGDALQIMSNDKYKSVEHRVIANGSKNRVSVPIF  307

Query  329   VTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             + P P   +GPL EVL  GEKP+YK+++Y+DY + FF K HDGK+TIE AKI
Sbjct  308   LHPKPSSVIGPLQEVLDKGEKPIYKQILYADYTKIFFSKGHDGKDTIECAKI  359



>ref|XP_009588687.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Nicotiana tomentosiformis]
Length=358

 Score =   516 bits (1328),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 234/357 (66%), Positives = 294/357 (82%), Gaps = 3/357 (1%)
 Frame = -3

Query  1238  PAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDI  1059
             P  +S   ++ DFVVNEG GVKGLS+MG++ LP QYIQP +ERI    ++ DD IP ID+
Sbjct  2     PTTVSVLSNITDFVVNEGHGVKGLSEMGLQTLPKQYIQPLEERITPTTVILDDQIPVIDM  61

Query  1058  SNWDDPA--VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             SNWD+    +   +C AAE+WGFFQIINH + +++LES+K ATYRFF+ P EEK K+SK 
Sbjct  62    SNWDNDTKLIGEKICNAAEKWGFFQIINHDISLDVLESVKEATYRFFRQPAEEKNKHSKE  121

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             NS + NVRYGTSF+P++EK LEWKDYLSLFYVSD+EAAALWP A R EA++++     +I
Sbjct  122   NSSTNNVRYGTSFTPKAEKALEWKDYLSLFYVSDEEAAALWPSALREEALDFLRNSEIVI  181

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             K LLE LM GLN++E +D++KE + MG+KRIN NYYPKCPNPEL VGVGRHSD+ST+T+L
Sbjct  182   KKLLEALMKGLNVKE-IDETKESVLMGSKRINVNYYPKCPNPELTVGVGRHSDVSTLTIL  240

Query  524   LQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             LQD+IGGL+V+KL+S+TWVHVPP+DGALVINIGDALQI+SNGRYKS EHRV ANG ++RI
Sbjct  241   LQDNIGGLYVKKLDSETWVHVPPIDGALVINIGDALQIMSNGRYKSIEHRVMANGSNNRI  300

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             SVPIFV P P   +GPL EVL  GE+P+YK+L+YSDY++HFF KAHDGK+T++FAKI
Sbjct  301   SVPIFVNPKPSDVIGPLAEVLENGEEPIYKQLLYSDYVKHFFRKAHDGKDTVDFAKI  357



>gb|AIR07875.1| F6'H1 [Nicotiana attenuata]
Length=358

 Score =   513 bits (1320),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 233/357 (65%), Positives = 292/357 (82%), Gaps = 3/357 (1%)
 Frame = -3

Query  1238  PAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDI  1059
             P  +S   ++ DFVVNEG GVKGLS+MG++ LP QYIQP +ERI    ++ DD IP ID+
Sbjct  2     PTTVSILSNITDFVVNEGHGVKGLSEMGLQTLPKQYIQPIEERITPTTVILDDQIPVIDM  61

Query  1058  SNWDDPA--VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
              NWD+    +   +C AAE+WGFFQIINH + +++LES+K ATY FF+ P EEK KYSK 
Sbjct  62    YNWDNETKLIGEKICNAAEKWGFFQIINHDISLDVLESVKEATYTFFRQPAEEKNKYSKE  121

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             NS S NVRYGTSF+P++EK LEWKDYLSLFYVSD+EAAALWP A R EA++++     +I
Sbjct  122   NSSSNNVRYGTSFTPKAEKALEWKDYLSLFYVSDEEAAALWPSALREEALDFLKNSEIVI  181

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             K LLE LM GLN++E +D++KE L MG+KRIN NYYPKCPNPEL VGVGRHSD+ST+T+L
Sbjct  182   KKLLEALMKGLNVKE-IDQTKESLLMGSKRINVNYYPKCPNPELTVGVGRHSDVSTLTIL  240

Query  524   LQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             LQD+IGGL+V+KL+S+TWVHVPP++GALVINIGDALQI+SNGRYKS EHRV ANG ++RI
Sbjct  241   LQDNIGGLYVKKLDSETWVHVPPINGALVINIGDALQIMSNGRYKSIEHRVMANGSNNRI  300

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             SVPIFV P P   +GPL EVL  GE+P+YK+++YSDY++HFF KAHDGK+T++FAKI
Sbjct  301   SVPIFVNPKPSDVIGPLAEVLENGEEPIYKQVLYSDYVKHFFRKAHDGKDTVDFAKI  357



>ref|XP_009763424.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Nicotiana sylvestris]
Length=358

 Score =   511 bits (1316),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 233/357 (65%), Positives = 292/357 (82%), Gaps = 3/357 (1%)
 Frame = -3

Query  1238  PAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDI  1059
             P  +S   ++ DFVVNEG GVKGLS+MG++ LP QYIQP +ERI    ++ DD IP ID+
Sbjct  2     PTTVSILSNITDFVVNEGHGVKGLSEMGLQTLPKQYIQPIEERITPTTVILDDQIPVIDM  61

Query  1058  SNWDDPA--VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             SNWD+    +   +C AAE+WGFFQIINH + +++LES+K ATYRFF+   EEK K+SK 
Sbjct  62    SNWDNDTKLIGEKICNAAEKWGFFQIINHDISLDVLESVKEATYRFFRQTAEEKNKHSKE  121

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             NS S NVRYGTSF+P++EK LEWKDYLSLFYVSD+EAAALWP A R EA++++     +I
Sbjct  122   NSSSNNVRYGTSFTPKAEKALEWKDYLSLFYVSDEEAAALWPSALREEALDFLRNSEIVI  181

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             K LLE LM GLN++E +D++KE L MG+KRIN NYYPKCPNPEL VGVGRHSD+ST+T+L
Sbjct  182   KKLLEALMKGLNVKE-IDQTKESLLMGSKRINVNYYPKCPNPELTVGVGRHSDVSTLTIL  240

Query  524   LQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             LQD+IGGL+V+KL+S+TWVHVPP+ GALVINIGDALQI+SNGRYKS EHRV ANG ++RI
Sbjct  241   LQDNIGGLYVKKLDSETWVHVPPIHGALVINIGDALQIMSNGRYKSIEHRVMANGSNNRI  300

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             SVPIFV P P   +GPL EVL  GE+P+YK+++YSDY++HFF KAHDGK+T++FAKI
Sbjct  301   SVPIFVNPKPSDVIGPLAEVLENGEEPIYKQVLYSDYVKHFFRKAHDGKDTVDFAKI  357



>ref|XP_002299115.2| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE83920.2| oxidoreductase family protein [Populus trichocarpa]
Length=358

 Score =   509 bits (1312),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 232/360 (64%), Positives = 297/360 (83%), Gaps = 5/360 (1%)
 Frame = -3

Query  1244  MAPA---ALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSI  1074
             MAP    + ++S  + DFV+N+G GVKGLS+MG+++LP QYIQP +ER+    I++ +SI
Sbjct  1     MAPTLAVSFNDSSDITDFVLNKGNGVKGLSEMGLESLPKQYIQPLEERMCGTKIMSHESI  60

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+S WDDP V+ A+CEAAE+WGFFQIINHGVP+E+LE++K AT++FF+LP EEKRKY
Sbjct  61    PIIDMSKWDDPKVAEAICEAAEKWGFFQIINHGVPIEVLENVKEATHQFFRLPAEEKRKY  120

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS NVR+GTSFSPE+EK LEWKDYLSLFYVS+DEA+ALWP  C+ + +EYM +  
Sbjct  121   LKEFSPSNNVRFGTSFSPEAEKALEWKDYLSLFYVSEDEASALWPAVCKDQVLEYMKRSE  180

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              +I+ LL++LM  LN+ E +D++KE L MG+KR N NYYP CPNPEL VGVGRHSD+ST+
Sbjct  181   TVIRKLLDVLMKNLNVTE-IDETKESLLMGSKRTNLNYYPICPNPELTVGVGRHSDVSTL  239

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T LLQD IGGL+VR  N+D+W+HVPPV G++VIN+GDALQI+SNGRYKS EHRV ANG +
Sbjct  240   TFLLQDDIGGLYVRG-NNDSWIHVPPVSGSIVINVGDALQIMSNGRYKSIEHRVIANGSN  298

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIF+ P P  ++ P PEVLAGGEK +YKE++YSDY++HFF KAHDGK+TI+ AKI
Sbjct  299   NRISVPIFINPMPSDKISPFPEVLAGGEKAVYKEVLYSDYVKHFFRKAHDGKKTIDLAKI  358



>emb|CDP19904.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   509 bits (1311),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 230/359 (64%), Positives = 300/359 (84%), Gaps = 3/359 (1%)
 Frame = -3

Query  1244  MAPAALSESES--VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIP  1071
             MAP+   +  +  V+ F V++G GVKGL+D+G++ LP QYIQPP+E+I  + +V ++SIP
Sbjct  1     MAPSLPMDPNTWDVISFAVDKGHGVKGLADLGLETLPKQYIQPPEEQIIHSTVVTENSIP  60

Query  1070  TIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
              ID+SNW+DP V+  +C AAE+WGFFQI+NHG+P+E+ E++K AT +FF LP E+K K+S
Sbjct  61    VIDLSNWNDPMVAEQICNAAEKWGFFQIVNHGIPIEVSENVKEATRQFFGLPAEQKNKHS  120

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             K NSP+ NVRYGTSF+P++EK LEWKD+LSLFYVSDDEAAA WP A R+EA+++M +   
Sbjct  121   KDNSPTNNVRYGTSFTPKAEKALEWKDFLSLFYVSDDEAAAQWPSAFRNEALDFMKKSEF  180

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             +I+ LL+ LM GLN++E +D++KE LFMG+KRIN NYYPKCP PEL VGVGRHSD+ST+T
Sbjct  181   VIRRLLQALMKGLNVKE-IDETKESLFMGSKRINLNYYPKCPEPELTVGVGRHSDVSTLT  239

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +LLQD IGGL+V+KL+SD WVHVPP++GA+VIN+GDALQILSNG+YKS EHRV ANG  +
Sbjct  240   ILLQDDIGGLYVKKLDSDAWVHVPPINGAIVINVGDALQILSNGKYKSVEHRVIANGIKN  299

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             RISVPIFV P P   +GPLPEVL  GEKP+YK+++YSDY++HFF KAHDGKET++FAKI
Sbjct  300   RISVPIFVNPRPSDIIGPLPEVLESGEKPIYKQVLYSDYVKHFFRKAHDGKETVDFAKI  358



>ref|XP_009613663.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Nicotiana tomentosiformis]
Length=363

 Score =   508 bits (1308),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 234/354 (66%), Positives = 299/354 (84%), Gaps = 4/354 (1%)
 Frame = -3

Query  1226  SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADD-SIPTIDISN  1053
             S + +V +FVVNEG GVKGL+DMGI+ LP QYIQP +ERI  +N  +A++ SIP ID+SN
Sbjct  11    SNTWNVKNFVVNEGHGVKGLADMGIQTLPKQYIQPLEERIYVSNVKLAEELSIPVIDMSN  70

Query  1052  WDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPS  873
             ++DP V+ ++C AAEEWGFFQI+NHG+P+++ E++K AT+RFF LP EEKRKYSK  S +
Sbjct  71    FNDPKVANSICNAAEEWGFFQIVNHGIPIQVFENVKDATHRFFALPAEEKRKYSKDYSST  130

Query  872   ENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLL  693
              NVR+GTSF+P++EK LEWKDYLSLFYVSD+EAA  WPPACR EA+++M +   +IK L+
Sbjct  131   NNVRFGTSFTPQAEKALEWKDYLSLFYVSDEEAADFWPPACRDEALQFMKKAELVIKRLM  190

Query  692   EMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDH  513
             E LM GLN++E +D++KE L MG+KRIN NYYPKCPNPEL VGVGRHSD+ST+T+LLQD+
Sbjct  191   EALMKGLNVKE-IDEAKESLLMGSKRINLNYYPKCPNPELTVGVGRHSDVSTLTILLQDN  249

Query  512   IGGLHVRKLNSD-TWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVP  336
             IGGL+VRKL++D TW+ VPP++GALVIN+GDALQILSNGRYKS EHRV ANG ++R+SVP
Sbjct  250   IGGLYVRKLDNDSTWLSVPPINGALVINVGDALQILSNGRYKSIEHRVVANGSNNRVSVP  309

Query  335   IFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             IFV P P   +GPL EVL  GEKP YK+++YSDY++HFF KAHDGK+T++FAKI
Sbjct  310   IFVNPKPNDVIGPLQEVLESGEKPAYKQVLYSDYVKHFFRKAHDGKDTVDFAKI  363



>ref|XP_009771649.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Nicotiana sylvestris]
Length=359

 Score =   507 bits (1305),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 230/352 (65%), Positives = 289/352 (82%), Gaps = 1/352 (0%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW  1050
             LS S++V DFVVNEG GVKGLSDMGI+ LP QYIQP +ERI  + ++ DDSIP ID SNW
Sbjct  9     LSNSKNVFDFVVNEGNGVKGLSDMGIQTLPHQYIQPLEERITTSTVITDDSIPIIDASNW  68

Query  1049  DDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSE  870
             +DP V+  +C AA+ WGFFQIINHGVP+E+L+++K  ++RFF LP EEK+ YSK +S S 
Sbjct  69    NDPKVAEQICMAAQNWGFFQIINHGVPIEVLDNIKETSHRFFSLPAEEKKMYSKEDSISS  128

Query  869   NVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLE  690
             NVRYGTSF+PE+EKTL W+DYLSL +VSDDEAA  WPP CR EA+EY+ +C+ +I+ +L+
Sbjct  129   NVRYGTSFTPEAEKTLGWRDYLSLVHVSDDEAAEFWPPPCREEALEYLKRCDPVIRKILK  188

Query  689   MLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHI  510
             +LM GLN+ + +D+ KE   MG+KRINFNYYPKCPNPEL+VGV RHSDISTIT LLQD I
Sbjct  189   VLMGGLNV-KTIDEEKEDFLMGSKRINFNYYPKCPNPELSVGVARHSDISTITFLLQDEI  247

Query  509   GGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIF  330
             GGL+V+KL+S+ W+HVPP++GALVINIGDALQI+SN +YKS EHRV ANG  +R+SVPIF
Sbjct  248   GGLYVKKLDSNAWIHVPPINGALVINIGDALQIMSNDKYKSVEHRVIANGSKNRVSVPIF  307

Query  329   VTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             + P P   +GPL EVL  GEKP+YK+++Y+DY + FF K HDGK+TIE AKI
Sbjct  308   LHPKPSRVIGPLREVLEKGEKPIYKQILYADYTKIFFSKGHDGKDTIECAKI  359



>ref|XP_009798906.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Nicotiana sylvestris]
Length=363

 Score =   506 bits (1304),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 233/354 (66%), Positives = 300/354 (85%), Gaps = 4/354 (1%)
 Frame = -3

Query  1226  SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADD-SIPTIDISN  1053
             S + +V +FVVNEG GVKGL+DMGI+ LP QYIQP +ERI  +N  +A++ SIP ID+SN
Sbjct  11    SNTWNVKNFVVNEGHGVKGLADMGIETLPKQYIQPLEERIYTSNVKLAEELSIPVIDMSN  70

Query  1052  WDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPS  873
             W+DP V+ ++C AAE+WGFFQI+NHG+P+++ E++K AT+RFF LP EEK KYSK  S +
Sbjct  71    WNDPNVANSICNAAEKWGFFQIVNHGIPIQVFENVKDATHRFFALPAEEKIKYSKEYSST  130

Query  872   ENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLL  693
              NVR+GTSF+P++E+ LEWKDYLSLFYVSD+EAA  WPPACR EA+++M + N +IK L+
Sbjct  131   NNVRFGTSFTPQAEQALEWKDYLSLFYVSDEEAADFWPPACRDEALQFMKKANLVIKRLM  190

Query  692   EMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDH  513
             E LM GLN++E +D++KE L MG+KRIN NYYPKCPNPEL VGVGRHSD+ST+T+LLQD+
Sbjct  191   EALMKGLNVKE-VDEAKESLLMGSKRINLNYYPKCPNPELTVGVGRHSDVSTLTILLQDN  249

Query  512   IGGLHVRKLNSD-TWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVP  336
             IGGL+VRKL++D TW+ VPP++GALVIN+GDALQILSNGRYKS EHRV ANG ++R+SVP
Sbjct  250   IGGLYVRKLDNDSTWLPVPPINGALVINVGDALQILSNGRYKSIEHRVIANGSNNRVSVP  309

Query  335   IFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             IFV P P   +GPL EVL  GEKP+YK+++YSDY++HFF KAHDGK+T++FAKI
Sbjct  310   IFVNPKPNDVIGPLQEVLENGEKPVYKQVLYSDYVKHFFRKAHDGKDTVDFAKI  363



>ref|XP_008218314.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Prunus mume]
Length=359

 Score =   506 bits (1302),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 232/358 (65%), Positives = 295/358 (82%), Gaps = 5/358 (1%)
 Frame = -3

Query  1235  AALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAI---VADDSIPTI  1065
             + ++   S++DFV+N+G GVKGLSD+G+K+LP QYIQP +ERI+  +     +++S+P I
Sbjct  3     STMTSPSSIIDFVINKGNGVKGLSDLGLKSLPKQYIQPLEERISTASFGIKNSEESVPII  62

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D+SNWDDP V+ A+C AAE+WGFFQ++NHGVP+E+LE+++ AT+RFF+LP EEK K SK 
Sbjct  63    DMSNWDDPKVAEAICSAAEKWGFFQLVNHGVPIEVLENVEEATHRFFELPAEEKSKNSKE  122

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             +S S NVR+GTSFSP++EK LEWKDYLSLFYVS+DEA+ALWPPAC+ E +EYM     +I
Sbjct  123   HSCSNNVRFGTSFSPQAEKALEWKDYLSLFYVSEDEASALWPPACKDEVLEYMKNSEILI  182

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             K LL+MLM  LN++E +D+ KE L MG++RIN NYYP CPNPEL VGVGRHSD+ST+TVL
Sbjct  183   KRLLDMLMKRLNVKE-IDQEKEGLLMGSRRINLNYYPICPNPELTVGVGRHSDVSTLTVL  241

Query  524   LQDHIGGLHVR-KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDR  348
             LQD IGGL+VR   +  +W+HVPPV G+LVINIGDALQI+SNGRYKS EHRV+ANG  +R
Sbjct  242   LQDQIGGLYVRGGTDKKSWIHVPPVKGSLVINIGDALQIMSNGRYKSIEHRVAANGSKNR  301

Query  347   ISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             ISVPIFV P P   + PLPEVLA GEK +YK+++YSDY++HFF KAHDGK TIEFAKI
Sbjct  302   ISVPIFVNPRPSDLISPLPEVLASGEKAVYKQVLYSDYVKHFFRKAHDGKSTIEFAKI  359



>ref|XP_011048230.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Populus euphratica]
Length=358

 Score =   506 bits (1302),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 231/360 (64%), Positives = 295/360 (82%), Gaps = 5/360 (1%)
 Frame = -3

Query  1244  MAPA---ALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSI  1074
             MAP    + ++S  + DFV+N+G GVKGLS+MG+++LP QYIQP +ER+    I+  +SI
Sbjct  1     MAPTLAVSFNDSSDITDFVLNKGNGVKGLSEMGLESLPKQYIQPLEERMCGTKIMPHESI  60

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+S WDDP V+ A+CEAAE+WGFFQIINHGVP+E+LE++K AT++FF+LP EEKRKY
Sbjct  61    PIIDMSKWDDPKVAEAICEAAEKWGFFQIINHGVPIEVLENVKEATHQFFRLPAEEKRKY  120

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS NVR+GTSFSPESEK LEWKDYLSLFYVS+DEA+ALWP  C+ + +EYM +  
Sbjct  121   LKEFSPSNNVRFGTSFSPESEKALEWKDYLSLFYVSEDEASALWPAVCKDQVLEYMNRSE  180

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              +I+ LL++L+  LN+ E +D++KE L MG+KR N NYYP CPNPEL VGVGRHSD+ST+
Sbjct  181   IVIRKLLDVLLKNLNVTE-IDETKESLLMGSKRTNLNYYPICPNPELTVGVGRHSDVSTL  239

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T LLQD IGGL+VR  N+D+W+HVPPV G++VIN+GDALQI+SNGRYKS EHRV ANG +
Sbjct  240   TFLLQDDIGGLYVRG-NNDSWIHVPPVSGSIVINVGDALQIMSNGRYKSIEHRVIANGNN  298

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIF+ P P  ++ P PEVLA GEK +YKE++YSDY++HFF KAHDGK+TI+ AKI
Sbjct  299   NRISVPIFINPRPSDKISPFPEVLASGEKAVYKEVLYSDYVKHFFRKAHDGKKTIDMAKI  358



>ref|XP_007208198.1| hypothetical protein PRUPE_ppa020537mg [Prunus persica]
 gb|EMJ09397.1| hypothetical protein PRUPE_ppa020537mg [Prunus persica]
Length=359

 Score =   505 bits (1300),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 237/361 (66%), Positives = 292/361 (81%), Gaps = 6/361 (2%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAI---VADDSI  1074
             M P   S S  + +FV+N G GVKGLS+MG+K+LP QYIQP +ERI+  +     +++++
Sbjct  1     MVPTMTSPS-GITNFVINNGNGVKGLSEMGLKSLPKQYIQPLEERISTASFGIKNSEETV  59

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+SNWDDP V+ A+C AAE+WGFFQ++NHGVPVE+LE++K AT+RFF+LP EEK K 
Sbjct  60    PIIDMSNWDDPKVAEAICSAAEKWGFFQLVNHGVPVEVLENVKEATHRFFELPAEEKSKN  119

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             SK  S S NVR+GTSFSP++EK LEWKDYLSLFYVS+DEA+ALWPPAC+ E +EYM +  
Sbjct  120   SKERSCSNNVRFGTSFSPQAEKALEWKDYLSLFYVSEDEASALWPPACKDEVLEYMKKSE  179

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              +IK LLEMLM  LN++E +D+ KE L MG+ RIN NYYP CPNPEL VGVGRHSD+ST+
Sbjct  180   ILIKRLLEMLMKRLNVKE-IDQEKEGLLMGSMRINLNYYPICPNPELTVGVGRHSDVSTL  238

Query  533   TVLLQDHIGGLHVR-KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGG  357
             TVLLQD IGGL+VR   +  TW+HVPPV G+LVINIGDALQI+SNGRYKS EHRV+ANG 
Sbjct  239   TVLLQDQIGGLYVRGGTDKKTWIHVPPVKGSLVINIGDALQIMSNGRYKSIEHRVAANGS  298

Query  356   SDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
              +RISVPIFV P P   + PLPEVLA GEK +YK+++YSDY++HFF KAHDGK TIEFAK
Sbjct  299   KNRISVPIFVNPRPSDLISPLPEVLASGEKAVYKQVLYSDYVKHFFRKAHDGKSTIEFAK  358

Query  176   I  174
             I
Sbjct  359   I  359



>ref|XP_008232563.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Prunus mume]
Length=359

 Score =   501 bits (1289),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 236/361 (65%), Positives = 293/361 (81%), Gaps = 6/361 (2%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAI---VADDSI  1074
             MAP   S S  + +FV+N+G GVKGLS+MG+K+LP QYIQP +ERI+  +     +++S+
Sbjct  1     MAPTMTSPS-GITNFVINKGNGVKGLSEMGLKSLPKQYIQPLEERISTASFGIKNSEESV  59

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+SNWDDP V+ A+C AAE+WGFFQ++NHGVP+E+LE++K AT+RFF+LP EEK K 
Sbjct  60    PIIDMSNWDDPKVAEAICSAAEKWGFFQLVNHGVPIEVLENVKEATHRFFELPAEEKSKN  119

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             SK  S S NVR+GTSFSP++EK LEWKDYLSLFYVS+DEA+ALWPPAC+ E +EY  +  
Sbjct  120   SKERSCSNNVRFGTSFSPQAEKALEWKDYLSLFYVSEDEASALWPPACKDEVLEYRKKSE  179

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              +IK LLEMLM  LN++E +D+ KE L MG+ RIN NYYP CPNPEL VGVGRHSD+ST+
Sbjct  180   ILIKRLLEMLMKRLNVKE-IDQEKEGLLMGSMRINLNYYPICPNPELTVGVGRHSDVSTL  238

Query  533   TVLLQDHIGGLHVR-KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGG  357
             TVLLQD IGGL+VR   +  +W+HVPPV G+LVINIGDALQI+SNGRYKS EHRV+ANG 
Sbjct  239   TVLLQDQIGGLYVRGGTDKKSWIHVPPVKGSLVINIGDALQIMSNGRYKSIEHRVAANGI  298

Query  356   SDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
              +RISVPIFV P P   + PLPEVLA GEK +YK+++YSDY++HFF KAHDGK TIEFAK
Sbjct  299   KNRISVPIFVNPRPLDLISPLPEVLASGEKAVYKQVLYSDYVKHFFRKAHDGKSTIEFAK  358

Query  176   I  174
             I
Sbjct  359   I  359



>ref|XP_006340084.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Solanum tuberosum]
Length=363

 Score =   501 bits (1289),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 230/361 (64%), Positives = 296/361 (82%), Gaps = 4/361 (1%)
 Frame = -3

Query  1247  TMAPAAL-SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADD--S  1077
             T+A  ++ S +  V +FVVNEG GVKGL+DMGI+ LP QYIQP +ERI ++ +V D+   
Sbjct  4     TLATISINSNTWDVKNFVVNEGHGVKGLADMGIQTLPKQYIQPLEERITSSDVVVDEEQC  63

Query  1076  IPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             IP ID+SNW+D  V   +C AAE+WGFFQI+NHG+P+++ E++K AT+RFF L  +EK K
Sbjct  64    IPVIDLSNWNDTKVDNMICNAAEKWGFFQIVNHGIPIKVFENVKDATHRFFALSAQEKNK  123

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             YSK  S + NVR+GTSF+P++EK LEWKDYLSLFYVSD+EA+ALWPPACR EA+E+M + 
Sbjct  124   YSKDYSCTNNVRFGTSFTPQAEKALEWKDYLSLFYVSDEEASALWPPACRDEALEFMKKT  183

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               +IK L+E LM GLN++E +D+ +E L MG+KRIN NYYPKCPNPEL VGVGRHSD+ST
Sbjct  184   ELVIKRLMESLMKGLNVKE-IDEDRESLLMGSKRINLNYYPKCPNPELTVGVGRHSDVST  242

Query  536   ITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGG  357
             +T+LLQD+IGGL+V+KL ++TW+ VPP+ GALVINIGDALQILSNGRYKS EHRV ANG 
Sbjct  243   LTILLQDNIGGLYVKKLGNETWLPVPPISGALVINIGDALQILSNGRYKSIEHRVIANGS  302

Query  356   SDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             ++R+SVPIFV P P   +GPL EVL  GEK +YK+++YSDY++HFF KAHDGK+T++FAK
Sbjct  303   NNRVSVPIFVNPKPNDVIGPLQEVLESGEKAVYKQVLYSDYVKHFFRKAHDGKDTVDFAK  362

Query  176   I  174
             I
Sbjct  363   I  363



>dbj|BAL22346.1| oxidoreductase [Ipomoea batatas]
Length=358

 Score =   500 bits (1287),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 225/344 (65%), Positives = 284/344 (83%), Gaps = 1/344 (0%)
 Frame = -3

Query  1205  DFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRA  1026
             DFVV +G GVKGLS++G++ LP+QY+ PP+ER+++  +V+DDSIP ID+SNW+DP V++ 
Sbjct  15    DFVVKQGHGVKGLSELGLQTLPNQYVHPPEERLSSMDVVSDDSIPVIDVSNWEDPKVAKL  74

Query  1025  VCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSF  846
             +C+AAE+ GFFQI+NHG+P+E+LE  K ATYRFF+ P EEK+KYSK N P+ +VRY TSF
Sbjct  75    ICDAAEKRGFFQIVNHGIPIEMLEKAKAATYRFFREPAEEKKKYSKENCPTSHVRYSTSF  134

Query  845   SPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNI  666
              P+ EK LEWKD+LS+FYVSD+EAA  WPP+CR +A+EY+  C  + + LLE LM GLN+
Sbjct  135   LPQIEKALEWKDHLSMFYVSDEEAAQYWPPSCRDDAVEYLKSCEMVSRKLLEALMQGLNV  194

Query  665   EERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKL  486
              + +D SKE L MG++RIN NYYPKCPNP+L VGVGRHSDIST+T+LLQD IGGL+VRKL
Sbjct  195   NQ-IDDSKESLLMGSRRININYYPKCPNPDLTVGVGRHSDISTLTLLLQDDIGGLYVRKL  253

Query  485   NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECR  306
               + W HVPPV GALVINIGDALQI+SNGRYKS EHRV AN  +DRISVP+FV P P   
Sbjct  254   EHEAWSHVPPVKGALVINIGDALQIMSNGRYKSIEHRVMANESNDRISVPVFVNPRPNDI  313

Query  305   VGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             VGPLPEVLA GEKP+YK ++YSDY +HF+ KAH+GK+TI FA+I
Sbjct  314   VGPLPEVLASGEKPVYKPVLYSDYAKHFYRKAHNGKDTIAFARI  357



>gb|AFK37640.1| unknown [Lotus japonicus]
Length=361

 Score =   499 bits (1285),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 229/362 (63%), Positives = 291/362 (80%), Gaps = 6/362 (2%)
 Frame = -3

Query  1244  MAPAALSES-----ESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADD  1080
             MAP  ++ +       + +FV+ +G GVKGLS+MG+K+LP QYIQP +ER     +V  +
Sbjct  1     MAPVTVATTPNTTRSDLTEFVMLKGNGVKGLSEMGLKSLPVQYIQPLEERTCMIQVVPQE  60

Query  1079  SIPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKR  900
             SIP ID+SNWDDP V  A+CEAA++WGFFQIINHGVP+++LE++K ATYRF++LP E+K 
Sbjct  61    SIPIIDMSNWDDPKVGDAICEAAQKWGFFQIINHGVPLQVLENVKDATYRFYELPAEQKL  120

Query  899   KYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQ  720
             KY+K NSPS++VRYG+SFSPE+EK LEWKDYLSLF+VS+ EA A WPPACR EA+EYM +
Sbjct  121   KYTKENSPSKDVRYGSSFSPEAEKALEWKDYLSLFFVSEAEAVATWPPACRDEALEYMKR  180

Query  719   CNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIS  540
                +IK LL +LM GLN+EE +D++ E L MG+KRIN NYYP CP+ +L V +GRHSD+S
Sbjct  181   SETVIKQLLTVLMKGLNVEE-IDETNESLLMGSKRINLNYYPVCPSHDLTVAIGRHSDVS  239

Query  539   TITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANG  360
             T+T+LLQD  GGL+VR ++S  W+HVPP+ GALVINIGDALQI+SNGRYKS EHRV+ANG
Sbjct  240   TLTILLQDQTGGLYVRAVDSQGWIHVPPISGALVINIGDALQIMSNGRYKSIEHRVTANG  299

Query  359   GSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFA  180
                R+SVPIFV P P   +GPLP+VLAGGEK +YK ++YSDY+R+FF KAHDGK TIE A
Sbjct  300   SKVRVSVPIFVNPRPIDVIGPLPQVLAGGEKAMYKNVLYSDYVRYFFKKAHDGKATIEHA  359

Query  179   KI  174
             KI
Sbjct  360   KI  361



>ref|XP_004296193.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Fragaria vesca 
subsp. vesca]
Length=364

 Score =   499 bits (1284),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 233/365 (64%), Positives = 298/365 (82%), Gaps = 9/365 (2%)
 Frame = -3

Query  1244  MAPA---ALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAAN-AIVADDS  1077
             MAP+    +++   + DFV+N+G GVKGLS MG+K+LP QYIQP  ER++ N A ++++S
Sbjct  1     MAPSLSQTITDPSDLTDFVINKGNGVKGLSQMGLKSLPKQYIQPVAERMSMNIAKMSEES  60

Query  1076  IPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             IP ID+SNW+DP V+ ++C AAE+WGFFQI+NHGVP+E+LE +K AT++FF+LP EEK K
Sbjct  61    IPIIDMSNWEDPKVTESICNAAEKWGFFQILNHGVPIEVLEHVKEATHKFFELPAEEKCK  120

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             +SK  SPS NVR+GTSFSPE+EK LEWKD+LSLFYVS+DEA+A WPPAC+ E +EYM + 
Sbjct  121   FSKEYSPSNNVRFGTSFSPEAEKALEWKDWLSLFYVSEDEASAHWPPACKAEVLEYMKRT  180

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
             + +IK LL++LM  LN+ E +DK+ E L MG+KRIN NYYP CPNPEL VGVGRHSD+ST
Sbjct  181   DILIKRLLDILMKRLNVTE-IDKTNEALLMGSKRINLNYYPVCPNPELTVGVGRHSDVST  239

Query  536   ITVLLQDHIGGLHVR---KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSA  366
             +TVLLQD+IGGL+VR     + D+WVHVPP++G+LVINIGDALQI+SNG+YKS EHRV A
Sbjct  240   LTVLLQDYIGGLYVRAGTTTDEDSWVHVPPLEGSLVINIGDALQIMSNGKYKSVEHRVVA  299

Query  365   NGGSDRISVPIFVTPDPECRVGPLPEVL-AGGEKPLYKELVYSDYLRHFFGKAHDGKETI  189
             NG   RISVPIFV P P   +GPLPEVL + GEK LYK+++YSDY++HFF KAHDGK T+
Sbjct  300   NGSKTRISVPIFVNPRPSDVIGPLPEVLGSSGEKALYKQVLYSDYVKHFFRKAHDGKSTV  359

Query  188   EFAKI  174
             +FAK 
Sbjct  360   DFAKF  364



>ref|XP_008359473.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Malus domestica]
Length=363

 Score =   498 bits (1283),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 232/356 (65%), Positives = 289/356 (81%), Gaps = 5/356 (1%)
 Frame = -3

Query  1232  ALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDS----IPTI  1065
              +++  SV DFV+++  GVKGLS+MG+KALP QYIQP +ERI    +VA  +    IP I
Sbjct  8     TITDPSSVTDFVISKSHGVKGLSEMGLKALPKQYIQPLEERITTMNVVATTNPGEYIPII  67

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D+SN DDP V+ A+C AAE+WGFFQ++NHGVP+E LE++  AT+RFF+LP E+K KYS  
Sbjct  68    DMSNSDDPKVAEAICNAAEKWGFFQLVNHGVPIEELENVXEATHRFFELPAEKKTKYSVE  127

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             +S S+NVR+GTSFSP +EK LEWKD+LSLFYVS+DEA+A WPPAC+ E +EYM + + + 
Sbjct  128   HSASKNVRFGTSFSPXAEKALEWKDWLSLFYVSEDEASAFWPPACKAEVLEYMKKTDILT  187

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             K +LEMLM  LN+EE LD+ KE L MG+KRIN NYYP CPNPEL VGVGRHSD+ST+T+L
Sbjct  188   KQILEMLMKRLNVEE-LDQEKEHLLMGSKRINLNYYPVCPNPELTVGVGRHSDVSTLTIL  246

Query  524   LQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             LQDHIGGL+VR  + ++WVHVPPV G+LVINIGDALQI+SNGRYKS EHRV+ANG  +RI
Sbjct  247   LQDHIGGLYVRGTDKESWVHVPPVKGSLVINIGDALQIMSNGRYKSIEHRVAANGCKNRI  306

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             SVPIFV P P   + PLPEVLA GEK +YK+++YSDY+RHFF KAHDGK TI+FAK
Sbjct  307   SVPIFVNPRPSDLIAPLPEVLASGEKAVYKQVLYSDYVRHFFRKAHDGKGTIDFAK  362



>ref|XP_006355251.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Solanum tuberosum]
Length=354

 Score =   498 bits (1282),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 222/357 (62%), Positives = 287/357 (80%), Gaps = 3/357 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M    LS SE + DFVVNEG GVKGL D+GI+ALP QYIQP KERI  + ++ DDSIP I
Sbjct  1     MISKILSNSEKLFDFVVNEGHGVKGLCDIGIQALPKQYIQPLKERITTSIVITDDSIPLI  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D SNWDDP V+  +C+AA+ WGFFQ+INHG+P+E+L+++K  ++RFF LP  EK+KY+  
Sbjct  61    DASNWDDPKVADQICKAAQNWGFFQVINHGIPIEVLDNIKETSHRFFNLPTNEKKKYT--  118

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             NS S NVRY TSF+PE+EKTL W+DYLSL ++SDDEA + WP +CR EA+EY+  C+ +I
Sbjct  119   NSLSSNVRYVTSFNPEAEKTLSWRDYLSLVHISDDEAISFWPTSCREEALEYLKSCDTVI  178

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             + +L++LM GLN+ E +D+ KE L MG KRINFNYYPKCPNPEL++GVGRHSDISTITVL
Sbjct  179   RKILKLLMGGLNVRE-IDEEKEELLMGLKRINFNYYPKCPNPELSIGVGRHSDISTITVL  237

Query  524   LQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             LQD IGGL+V+K +++ W+H+PP++GALVINIGDALQI+SN +YKS EH V ANG ++R+
Sbjct  238   LQDDIGGLYVKKHDTNVWIHIPPINGALVINIGDALQIMSNDKYKSVEHCVIANGNNNRV  297

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             SVPIF+ P     +GPL EVL  GEKP+YK+++Y+DY   FF K HDGK+T++FAKI
Sbjct  298   SVPIFLHPKATSVIGPLKEVLQNGEKPIYKQILYADYTNIFFSKGHDGKDTVKFAKI  354



>dbj|BAL22347.1| oxidoreductase [Ipomoea batatas]
Length=358

 Score =   498 bits (1281),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 224/344 (65%), Positives = 284/344 (83%), Gaps = 1/344 (0%)
 Frame = -3

Query  1205  DFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRA  1026
             +FVV +G GVKGLS++G++ LP+QY+ PP+ER+++  +V+DDSIP ID+SNW+DP V++ 
Sbjct  15    EFVVKQGHGVKGLSELGLQTLPNQYVHPPEERLSSMDVVSDDSIPVIDVSNWEDPKVAKL  74

Query  1025  VCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSF  846
             +C+AAE+ GFFQI+NHG+P+E+LE  K ATYRFF+ P EEK+KYSK N P+ +VRY TSF
Sbjct  75    ICDAAEKRGFFQIVNHGIPLEMLEKAKAATYRFFREPAEEKKKYSKENCPTSHVRYSTSF  134

Query  845   SPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNI  666
              P+ EK LEWKD+LS+FYVSD+EAA  WPP+CR +A+EY+  C  + + LLE LM GLN+
Sbjct  135   LPQIEKALEWKDHLSMFYVSDEEAAQYWPPSCRDDALEYLKSCEMVSRKLLEALMQGLNV  194

Query  665   EERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKL  486
              E +D +KE L MG++RIN NYYPKCPNP+L VGVGRHSDIST+T+LLQD IGGL+VRKL
Sbjct  195   NE-IDDAKESLLMGSRRININYYPKCPNPDLTVGVGRHSDISTLTLLLQDDIGGLYVRKL  253

Query  485   NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECR  306
               + W HVPPV GALVINIGDALQI+SNGRYKS EHRV AN  +DRISVP+FV P P   
Sbjct  254   EHEAWSHVPPVKGALVINIGDALQIMSNGRYKSIEHRVLANETNDRISVPVFVNPKPNDI  313

Query  305   VGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             VGPLPEVLA GEKP+YK ++YSDY +HF+ KAH+GK+TI FA+I
Sbjct  314   VGPLPEVLASGEKPVYKPVLYSDYAKHFYRKAHNGKDTIAFARI  357



>ref|XP_009345720.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Pyrus x bretschneideri]
Length=363

 Score =   498 bits (1281),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 232/363 (64%), Positives = 294/363 (81%), Gaps = 8/363 (2%)
 Frame = -3

Query  1244  MAP---AALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDS-  1077
             MAP     +++  SV DFV+++  GV+GLS+MG+KALP QYIQP +ERI    +VA  + 
Sbjct  1     MAPPVAQTINDPSSVTDFVISKSHGVRGLSEMGLKALPKQYIQPLEERITTMNVVATTNP  60

Query  1076  ---IPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEE  906
                IP ID+SN DDP V+ A+C AAE+WGFFQ++NHGVP+E+LE++K AT+RFF+LP ++
Sbjct  61    GEYIPIIDMSNSDDPKVAEAICNAAEKWGFFQLVNHGVPIEVLENVKEATHRFFELPAKK  120

Query  905   KRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYM  726
             K KYS  +S S+NVR+GTSFSP +EK LEWKD+LSLFYVS+DEA+A WPPAC+ E +EYM
Sbjct  121   KTKYSVEHSASKNVRFGTSFSPHAEKALEWKDWLSLFYVSEDEASAFWPPACKAEVLEYM  180

Query  725   TQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSD  546
             T+ + + K +LEMLM  LN++E LD+ KE L MG+KRIN NYYP CPNPEL VGVGRHSD
Sbjct  181   TKTDILTKQILEMLMKRLNVKE-LDQEKEHLLMGSKRINLNYYPVCPNPELTVGVGRHSD  239

Query  545   ISTITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSA  366
             +ST+T+LLQDHIGGL++R  +  +WVHVPPV G+LVINIGDALQI+SNGRYKS EHRV+A
Sbjct  240   VSTLTILLQDHIGGLYIRGTDKKSWVHVPPVKGSLVINIGDALQIMSNGRYKSIEHRVAA  299

Query  365   NGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIE  186
             NG  +RISVPIFV P P   + PLPEVLA GEK +YK+++YSDY++HFF KAHDGK TI+
Sbjct  300   NGCKNRISVPIFVNPRPSDLIVPLPEVLASGEKAVYKQVLYSDYVKHFFRKAHDGKGTID  359

Query  185   FAK  177
             FAK
Sbjct  360   FAK  362



>ref|XP_002285698.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Vitis vinifera]
Length=358

 Score =   497 bits (1280),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 229/360 (64%), Positives = 295/360 (82%), Gaps = 5/360 (1%)
 Frame = -3

Query  1244  MAPAAL---SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSI  1074
             MAP  +   + S  + DFVVN+G GVKGLS+M + +LP Q+IQPP+ERI A+ +V +  I
Sbjct  1     MAPTMVVSATNSWDITDFVVNQGHGVKGLSEMKLPSLPKQFIQPPEERIDASKVVCEKCI  60

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID++  DDP V+  +C+AAE+WGFFQ++NHGVP+ +LE +K AT+RFF LP EEK+KY
Sbjct  61    PVIDMAGLDDPKVAELICDAAEKWGFFQVVNHGVPIGVLEDVKEATHRFFALPGEEKKKY  120

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             SK NS S +VR+GTSF+P++EK+LEWKDYLSLFYVS+DEA+ALWP  C+ +A+EYM +  
Sbjct  121   SKENSNSNSVRFGTSFTPQAEKSLEWKDYLSLFYVSEDEASALWPSVCKDQALEYMKRSE  180

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              +I+ LL++LM  LN++E +D+ KE L MG+ RIN NYYP CPNPEL VGVGRHSD+ST+
Sbjct  181   LVIRQLLDVLMRRLNVKE-IDEKKESLLMGSMRINLNYYPICPNPELTVGVGRHSDVSTL  239

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             TVLLQD IGGL+V+ ++ DTWVHVPP+ G+LVINIGDALQI+SNGRYKS EHRV ANG S
Sbjct  240   TVLLQDDIGGLYVKGVH-DTWVHVPPIRGSLVINIGDALQIMSNGRYKSVEHRVIANGSS  298

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +R+SVPIFV P P   +GPLPE+L GGE+PLYK+++YSDY++HFF KAHDGK T+EFAKI
Sbjct  299   NRVSVPIFVNPRPSEVIGPLPELLEGGEEPLYKQVLYSDYVKHFFRKAHDGKNTVEFAKI  358



>ref|NP_175925.1| feruloyl CoA ortho-hydroxylase 2 [Arabidopsis thaliana]
 sp|Q9C899.1|F6H2_ARATH RecName: Full=Feruloyl CoA ortho-hydroxylase 2 [Arabidopsis thaliana]
 gb|AAG51560.1|AC027034_6 leucoanthocyanidin dioxygenase 2, putative; 51024-52213 [Arabidopsis 
thaliana]
 gb|AAR92264.1| At1g55290 [Arabidopsis thaliana]
 gb|AAS76251.1| At1g55290 [Arabidopsis thaliana]
 gb|AEE33219.1| feruloyl CoA ortho-hydroxylase 2 [Arabidopsis thaliana]
Length=361

 Score =   497 bits (1280),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 231/361 (64%), Positives = 291/361 (81%), Gaps = 4/361 (1%)
 Frame = -3

Query  1250  KTMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDS  1077
             +T+A   L+  + V +FVV+EG GVKGLS+ GIK LP QYIQP +ER+    +   +D+S
Sbjct  3     QTLAAQFLTRDQ-VTNFVVHEGNGVKGLSETGIKVLPDQYIQPFEERLINFHVKEDSDES  61

Query  1076  IPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             IP IDISN D+ +VS+AVC+AAEEWGFFQ+INHGV +E+LE++KTAT+RFF LPVEEKRK
Sbjct  62    IPVIDISNLDEKSVSKAVCDAAEEWGFFQVINHGVSMEVLENMKTATHRFFGLPVEEKRK  121

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             +S+  S S NVR+GTSFSP +EK LEWKDYLSLF+VS+ EA+ LWP +CR E +EYM + 
Sbjct  122   FSREKSLSTNVRFGTSFSPHAEKALEWKDYLSLFFVSEAEASQLWPDSCRSETLEYMNET  181

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               ++K LL  L   LN++E LDK+KE  FMG+ RIN NYYP CPNPEL VGVGRHSD+S+
Sbjct  182   KPLVKKLLRFLGENLNVKE-LDKTKESFFMGSTRINLNYYPICPNPELTVGVGRHSDVSS  240

Query  536   ITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGG  357
             +T+LLQD IGGLHVR L +  WVHVPP+ G+LVINIGDA+QI+SNGRYKS EHRV ANG 
Sbjct  241   LTILLQDEIGGLHVRSLTTGRWVHVPPISGSLVINIGDAMQIMSNGRYKSVEHRVLANGS  300

Query  356   SDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
              +RISVPIFV+P PE  +GPL EV+  GEKP+YK+++Y+DY++HFF KAHDGK+TI+FA 
Sbjct  301   YNRISVPIFVSPKPESVIGPLLEVIENGEKPVYKDILYTDYVKHFFRKAHDGKKTIDFAN  360

Query  176   I  174
             I
Sbjct  361   I  361



>gb|KFK38706.1| hypothetical protein AALP_AA3G149300 [Arabis alpina]
Length=361

 Score =   497 bits (1279),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 231/360 (64%), Positives = 292/360 (81%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++ A LS    V +FVVN+G GVKGLS+ G+KALP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTAQLSNPAEVTEFVVNKGNGVKGLSETGLKALPDQYIQPFEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+SN D+  V+ A+C+AAE+WGFFQ+INHGVP+E+L+++K AT+RFF LPVEEK K+
Sbjct  63    PVIDMSNPDESKVAEAICDAAEKWGFFQVINHGVPLEVLDNVKAATHRFFNLPVEEKSKF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             +K NS S NVR+GTSFSP +EK LEWKDYLSLF+VSD EA   WP  CR+EA+EYM +  
Sbjct  123   TKENSLSTNVRFGTSFSPRAEKALEWKDYLSLFFVSDAEAEQYWPDVCRNEALEYMNKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ R+N NYYP CP+P+L VGVGRHSD+S++
Sbjct  183   TMVRKLLEYLGKNLNVKE-LDETKESLFMGSIRVNLNYYPVCPSPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L+S  WVHVPPV G+ VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLSSGNWVHVPPVPGSFVINIGDAMQILSNGRYKSVEHRVLANGNN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV A GE+P+Y+++VYSDY+R+FF KAHDGK+T++FAKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVTANGEEPIYRDIVYSDYVRYFFKKAHDGKKTVDFAKI  361



>dbj|BAL22348.1| oxidoreductase [Ipomoea batatas]
Length=359

 Score =   496 bits (1278),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 223/344 (65%), Positives = 282/344 (82%), Gaps = 1/344 (0%)
 Frame = -3

Query  1205  DFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRA  1026
             +FVV +G GVKGLS++G++ LP+QY+ PP+ER+++  +V+DDSIP ID+SNW+DP V++ 
Sbjct  16    EFVVKQGHGVKGLSELGLQTLPNQYVHPPEERLSSMDVVSDDSIPVIDVSNWEDPKVAKL  75

Query  1025  VCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSF  846
             +C AAE+ GFFQI+NHG+P+E+LE  K ATYRFF+ P +EK+KYSK N P+ +VRY TSF
Sbjct  76    ICNAAEKRGFFQIVNHGIPLEMLEKAKAATYRFFREPAQEKKKYSKENCPTSHVRYSTSF  135

Query  845   SPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNI  666
              P+ EK LEWKD+LS+FYVSD EAA  WPP+CR +A+EY+  C  + + LLE LM GLN+
Sbjct  136   LPQIEKALEWKDHLSMFYVSDQEAAQYWPPSCRDDALEYLKSCELVSRKLLEALMQGLNV  195

Query  665   EERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKL  486
              + +D SKE L MG++RIN NYYPKCPNP+L VGVGRHSDIST+T+LLQD IGGL+VRKL
Sbjct  196   NQ-IDDSKESLLMGSRRININYYPKCPNPDLTVGVGRHSDISTLTLLLQDDIGGLYVRKL  254

Query  485   NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECR  306
               + W HVPPV GALVINIGDALQI+SNGRYKS EHRV AN  +DRISVP+FV P P   
Sbjct  255   EHEAWSHVPPVKGALVINIGDALQIMSNGRYKSIEHRVMANESNDRISVPVFVNPKPNDI  314

Query  305   VGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             VGPLPEVLA GEKP+YK ++YSDY +HF+ KAH+GK+TI FA+I
Sbjct  315   VGPLPEVLASGEKPVYKPVLYSDYAKHFYRKAHNGKDTIAFARI  358



>ref|XP_003530089.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Glycine max]
Length=355

 Score =   496 bits (1276),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 232/358 (65%), Positives = 290/358 (81%), Gaps = 9/358 (3%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPT  1068
             T+ P+ L+E      FV+ +G GVKGLS+MG+K+LPSQY+QP +ER+    +V  +SIP 
Sbjct  4     TLIPSDLTE------FVMLQGNGVKGLSEMGLKSLPSQYVQPLEERVIN--VVPQESIPI  55

Query  1067  IDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSK  888
             ID+SNWDDP V  A+C+AAE+WGFFQIINHGVP+E+L+S+K ATYRF+ LP +EK KY+K
Sbjct  56    IDMSNWDDPKVQDAICDAAEKWGFFQIINHGVPLEVLDSVKDATYRFYGLPPKEKVKYTK  115

Query  887   ANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAM  708
              NS +++VRYG+SFSPE+EK LEWKDYLSLFYVS+DEAAA WPPACR+EA+EYM +   +
Sbjct  116   ENSSTKHVRYGSSFSPEAEKALEWKDYLSLFYVSEDEAAATWPPACRNEALEYMKRSEIL  175

Query  707   IKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITV  528
             IK LL +LM  LN+ E +D++ E LFMG+KRIN NYYP CPN +L V +GRHSD+ST+TV
Sbjct  176   IKQLLNVLMKRLNVSE-IDETNESLFMGSKRINLNYYPVCPNHDLTVAIGRHSDVSTLTV  234

Query  527   LLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDR  348
             LLQD  GGL+VR  N   W+HVPPV GA+VINIGDALQ++SNGRYKS EHRVSANG   R
Sbjct  235   LLQDETGGLYVRAPNHHGWIHVPPVSGAIVINIGDALQVMSNGRYKSIEHRVSANGSKTR  294

Query  347   ISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +SVPIFV P P   +GPLP+VLA GEK LYK ++YSDY++HFF KAHDGK T+E+AKI
Sbjct  295   VSVPIFVNPRPSDVIGPLPQVLASGEKALYKNVLYSDYVKHFFRKAHDGKLTVEYAKI  352



>emb|CDY60812.1| BnaA01g37310D [Brassica napus]
Length=361

 Score =   496 bits (1277),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 229/360 (64%), Positives = 293/360 (81%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++    S+   V +FVVN+G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TVSTTQFSDPAEVTEFVVNQGNGVKGLSETGIKALPDQYIQPFEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+SN D+  V++A+C+AAE+WGFFQ+INHGVP+E+L+++K AT+RFF LPVEEK KY
Sbjct  63    PVIDMSNPDESNVAKAICDAAEKWGFFQVINHGVPLEVLDNVKAATHRFFNLPVEEKSKY  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             +K NS S NVR+GTSFSP +EK LEWKDYLSLF+VS+ EA+  WP  C++EA++YM +  
Sbjct  123   TKENSLSTNVRFGTSFSPRAEKALEWKDYLSLFFVSETEASQFWPDVCKNEALDYMNKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ R+N NYYP CPNP+L VGVGRHSDIS++
Sbjct  183   TMVRKLLEYLGKNLNVKE-LDETKESLFMGSIRVNLNYYPICPNPDLTVGVGRHSDISSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T++LQD IGGLHVR L S  WVHVPPV G+ VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TIVLQDQIGGLHVRSLVSGNWVHVPPVPGSFVINIGDAMQILSNGRYKSVEHRVLANGSN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV+A GE+P+Y+++VYSDY+R+FF KAHDGK+T++FAKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVIANGEEPIYRDVVYSDYVRYFFKKAHDGKKTVDFAKI  361



>ref|XP_006488907.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Citrus sinensis]
 gb|KDO63055.1| hypothetical protein CISIN_1g018077mg [Citrus sinensis]
Length=361

 Score =   494 bits (1273),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 225/359 (63%), Positives = 287/359 (80%), Gaps = 3/359 (1%)
 Frame = -3

Query  1244  MAPAA--LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIP  1071
             MAP    LS+   V DFVVN+G GVKGLS+MG+KALP QYIQP +ER +   IV  +SIP
Sbjct  1     MAPTTVLLSDFSDVTDFVVNQGNGVKGLSEMGLKALPKQYIQPLEERFSEKKIVPHESIP  60

Query  1070  TIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
              ID+S WDDP V++++C+AAE WGFFQ++NH VP+++L+ +K AT+RFF L   EK KYS
Sbjct  61    IIDMSKWDDPEVAKSICDAAEMWGFFQVVNHRVPLQVLDRVKAATHRFFGLSAAEKNKYS  120

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             K  SPS NVR+GTSF+ ++EK LEWKDYLSLFYVSDDEA+ALWPPAC+ E +EY      
Sbjct  121   KELSPSNNVRFGTSFNTQAEKALEWKDYLSLFYVSDDEASALWPPACKDEVLEYTKSSEV  180

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             +IK LL++LM GL +E   D++KE L MG+ R N NYYP CPNPEL VGVGRHSD+ST+T
Sbjct  181   LIKQLLKVLMKGLKVEGT-DEAKEALLMGSVRTNLNYYPICPNPELTVGVGRHSDVSTLT  239

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +LLQD IGGL+VR  + ++W+HVPP+ G+LVINIGDALQI+SNG+Y+S EH V ANG S+
Sbjct  240   ILLQDDIGGLYVRGNDGESWIHVPPISGSLVINIGDALQIMSNGKYRSVEHCVIANGSSN  299

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             RISVPIF+ P P+  +GP PEVLA GEKP+YK+++Y DY++HFF KAHDGK+T++FAK+
Sbjct  300   RISVPIFINPRPQDTIGPFPEVLASGEKPVYKQVLYKDYVKHFFRKAHDGKKTVDFAKL  358



>emb|CDX75720.1| BnaC03g38030D [Brassica napus]
Length=361

 Score =   494 bits (1272),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 230/360 (64%), Positives = 292/360 (81%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++    ++   V +FVVN+G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTVQFADPAEVTEFVVNKGNGVKGLSETGIKALPDQYIQPFEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+SN ++  V+ AVC+AAE WGFFQ+INHGVP+E+L+++K AT+RFF LPVEEK ++
Sbjct  63    PVIDMSNPEEDKVAEAVCDAAERWGFFQVINHGVPLEVLDNVKAATHRFFNLPVEEKSRF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             ++ NS S NVR+GTSFSP +EK LEWKDYLSLF+VS+ EA   WP AC++EA+EYM +  
Sbjct  123   TRENSLSTNVRFGTSFSPRAEKALEWKDYLSLFFVSETEAEQYWPDACKNEALEYMNKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LDK+KE LFMG+ RIN NYYP CPNP+L VGVGRHSD+S++
Sbjct  183   TMVRKLLEYLGKNLNVKE-LDKTKESLFMGSIRINLNYYPICPNPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L+S  WVHVPPV G+ VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLSSGNWVHVPPVPGSFVINIGDAMQILSNGRYKSVEHRVLANGSN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV+A GE+P+Y+++VYSDY+R+FF KAHDGK+TI+FAKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVVANGEEPVYRDVVYSDYVRYFFKKAHDGKKTIDFAKI  361



>ref|XP_006407193.1| hypothetical protein EUTSA_v10021003mg [Eutrema salsugineum]
 gb|ESQ48646.1| hypothetical protein EUTSA_v10021003mg [Eutrema salsugineum]
Length=361

 Score =   493 bits (1270),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 229/360 (64%), Positives = 288/360 (80%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++ A   +   V +FVVN+G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTAQFGDPAQVTEFVVNKGNGVKGLSETGIKALPDQYIQPFEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+SN D+  V+ A+C+AAE+WGFFQ+INHGVP+E+L+++K AT+RFF LPVEEK K+
Sbjct  63    PVIDMSNPDESRVAEAICDAAEKWGFFQVINHGVPLEVLDNVKAATHRFFNLPVEEKSKF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             +K NS S NVR+GTSFSP +EK LEWKDYLSLF+VS+ EA   WP  CR+EA+EYM +  
Sbjct  123   TKENSLSTNVRFGTSFSPRAEKALEWKDYLSLFFVSEAEATQFWPDVCRNEALEYMNKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ R+N NYYP CPNP+L VGVGRHSD+S +
Sbjct  183   KMVRKLLEYLGKNLNVKE-LDETKESLFMGSIRVNLNYYPICPNPDLTVGVGRHSDVSAL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L S  WVHVPPV G+ VINIGDA+QI+SNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLASGNWVHVPPVPGSFVINIGDAMQIMSNGRYKSVEHRVLANGSN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV A GE+P+Y+ +VYSDY+R+FF KAHDGK+T++FAKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVTANGEEPIYRNVVYSDYVRYFFKKAHDGKKTVDFAKI  361



>ref|XP_007014695.1| Leucoanthocyanidin dioxygenase, putative [Theobroma cacao]
 gb|EOY32314.1| Leucoanthocyanidin dioxygenase, putative [Theobroma cacao]
Length=363

 Score =   491 bits (1265),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 292/353 (83%), Gaps = 3/353 (1%)
 Frame = -3

Query  1226  SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANA--IVADDSIPTIDISN  1053
             ++S ++ DFV+N+G GVKGLS+MG+KALP  YIQP +ER+ A+A  ++ ++SIP ID++N
Sbjct  12    TDSSALTDFVINQGNGVKGLSEMGLKALPKAYIQPLEERMWASATQVIPEESIPIIDMTN  71

Query  1052  WDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPS  873
             W+DP V++AVC+AAE+WGFFQI+NH VP+++LE+++ AT+RFF LP EEK+KYSK +S S
Sbjct  72    WEDPKVAKAVCDAAEKWGFFQIVNHAVPIQVLENVQDATHRFFGLPAEEKKKYSKEHSAS  131

Query  872   ENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLL  693
              NVR+GTSFSP++EK LEWKD+LSLF+VS++EA A WPP CR + +EYM     +IK L 
Sbjct  132   SNVRFGTSFSPKAEKALEWKDFLSLFFVSEEEACAFWPPVCREQVLEYMRSSEVVIKQLF  191

Query  692   EMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDH  513
             ++LM+GLN++E +D++ + L MG+ R N NYYP CPNPEL VGVGRHSD+S++T+LLQD 
Sbjct  192   QILMNGLNVKE-IDETTKSLLMGSVRTNLNYYPICPNPELTVGVGRHSDVSSLTILLQDE  250

Query  512   IGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPI  333
             IGGL+V+      W+HVPP+ G+LVIN+GDALQILSNGRY+S EHRV ANG  +RISVPI
Sbjct  251   IGGLYVKGNQGGNWIHVPPIKGSLVINVGDALQILSNGRYRSVEHRVIANGSKNRISVPI  310

Query  332   FVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             FV P P   +GPLP+VL  G+KP+YK+++YSDY+RHFF KAHDGK+T+EFA+I
Sbjct  311   FVNPRPGDIIGPLPQVLENGQKPIYKQVLYSDYVRHFFHKAHDGKKTVEFAEI  363



>ref|XP_002285699.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Vitis vinifera]
Length=358

 Score =   491 bits (1264),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 227/360 (63%), Positives = 294/360 (82%), Gaps = 5/360 (1%)
 Frame = -3

Query  1244  MAPAAL---SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSI  1074
             MAP  +   + S  + DFVVN+G GVKGLS+M + ++P Q+IQPP+ERI A+ +V ++ I
Sbjct  1     MAPKMVQSATNSWDITDFVVNQGHGVKGLSEMKLLSIPKQFIQPPEERIDASKVVCEECI  60

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID++  D P V++ +C+AAE+WGFFQ++NHGVP+ +LE +K AT+RFF LP EEKRKY
Sbjct  61    PVIDMACLDGPKVAQMICDAAEKWGFFQVVNHGVPLGVLEDVKEATHRFFALPGEEKRKY  120

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             SK NS S NVR+GTSF+P++EK+LEWKDYLSLFYVS++EA+ALWP  C+ +A+EYM +  
Sbjct  121   SKENSRSNNVRFGTSFTPQAEKSLEWKDYLSLFYVSENEASALWPSVCKDQALEYMKRSE  180

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              +I+ LLE+L   LN++E +D+ KE L MG+ RIN NYYP CPNPEL VGVGRHSD+S +
Sbjct  181   LVIRQLLEVLTRRLNVKE-IDEKKESLLMGSMRINLNYYPICPNPELTVGVGRHSDVSIL  239

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             TVLLQD IGGL+VR ++ DTWVHVPP+ G+LVINIGDALQI+SNGRYKS EHRV A+G S
Sbjct  240   TVLLQDDIGGLYVRGVH-DTWVHVPPIRGSLVINIGDALQIMSNGRYKSVEHRVIASGSS  298

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +R+SVPIFV P P   +GPLPEVL GGE+PLYK+++YSDY++HFF KAHDGK ++EFAKI
Sbjct  299   NRVSVPIFVNPRPSEVIGPLPEVLEGGEEPLYKQVLYSDYVKHFFRKAHDGKNSVEFAKI  358



>ref|XP_009146469.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Brassica rapa]
 emb|CDX97501.1| BnaA05g25780D [Brassica napus]
Length=361

 Score =   491 bits (1264),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 226/360 (63%), Positives = 293/360 (81%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++ A  ++   V +FVVN+G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTANFADPAEVTEFVVNKGNGVKGLSETGIKALPDQYIQPFEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+S+ D+  V+ A+C+AAE+WGFFQ+INHGVP+++L+++K AT+RFF LPVEEK ++
Sbjct  63    PVIDMSDPDENKVAEAICDAAEKWGFFQVINHGVPLDVLDNVKAATHRFFNLPVEEKSRF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             +K NS + NVR+GTSFSP +EK LEWKDYLSLF+VS+ EA   WP  C++EA+EYM +  
Sbjct  123   TKENSLTTNVRFGTSFSPRAEKALEWKDYLSLFFVSEAEAEQFWPDVCKNEALEYMNKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ R+N NYYP CPNP+L VGVGRHSD+S++
Sbjct  183   TMVRKLLEYLGKNLNVKE-LDETKESLFMGSIRVNLNYYPICPNPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L+S  WVHVPPV G+ VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLSSGNWVHVPPVPGSFVINIGDAMQILSNGRYKSVEHRVLANGSN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV+A GE+P+YK++VYSDY+R+FF KAHDGK+T++FAKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVVANGEEPIYKDVVYSDYVRYFFKKAHDGKKTVDFAKI  361



>ref|XP_006445642.1| hypothetical protein CICLE_v10015715mg [Citrus clementina]
 gb|ESR58882.1| hypothetical protein CICLE_v10015715mg [Citrus clementina]
Length=361

 Score =   491 bits (1263),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 224/359 (62%), Positives = 285/359 (79%), Gaps = 3/359 (1%)
 Frame = -3

Query  1244  MAPAA--LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIP  1071
             MAP    LS+     DFVVN+G GVKGLS+MG+KALP QYIQP +ER +   IV  +SIP
Sbjct  1     MAPTTVLLSDFSDFTDFVVNQGNGVKGLSEMGLKALPKQYIQPLEERFSEKKIVPHESIP  60

Query  1070  TIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
              ID+S WDDP V++++C+AAE WGFFQ +NH VP+++L+ +K AT+RFF L   EK KYS
Sbjct  61    IIDMSKWDDPEVAKSICDAAEMWGFFQAVNHRVPLQVLDRVKAATHRFFGLSAAEKNKYS  120

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             K  SPS NVR+GTSF+ ++EK LEWKDYLSLFYVSDDEA+ALWPPAC+ E +EY      
Sbjct  121   KELSPSNNVRFGTSFNTQAEKALEWKDYLSLFYVSDDEASALWPPACKDEVLEYTKSSEV  180

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             +IK LL++LM GL +E   D++KE L MG+ R N NYYP CPNPEL VGVGRHSD+ST+T
Sbjct  181   LIKQLLKVLMKGLKVEGT-DEAKEALLMGSVRTNLNYYPICPNPELTVGVGRHSDVSTLT  239

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +LLQD IGGL+VR  + ++W+HVPP+ G+LVINIGDALQI+SNG+Y+S EH V ANG S+
Sbjct  240   ILLQDDIGGLYVRGNDGESWIHVPPISGSLVINIGDALQIMSNGKYRSVEHCVIANGSSN  299

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             RISVPIF+ P P+  +GP PEVLA GEKP+YK+++Y DY++HFF KAHDGK+T++FAK+
Sbjct  300   RISVPIFINPRPQDTIGPFPEVLASGEKPVYKQVLYKDYVKHFFRKAHDGKKTVDFAKL  358



>emb|CDY23625.1| BnaC05g39690D [Brassica napus]
Length=361

 Score =   489 bits (1260),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 225/360 (63%), Positives = 293/360 (81%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++ A  ++   V +FVVN+G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTANFADPAEVTEFVVNKGNGVKGLSETGIKALPDQYIQPFEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+S+ ++  V+ A+C+AAE+WGFFQ+INHGVP+++L+++K AT+RFF LPVEEK ++
Sbjct  63    PVIDMSDPNENKVAEAICDAAEKWGFFQVINHGVPLDVLDNVKAATHRFFNLPVEEKSRF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             +K NS + NVR+GTSFSP +EK LEWKDYLSLF+VS+ EA   WP  C++EA+EYM +  
Sbjct  123   TKENSLTTNVRFGTSFSPRAEKALEWKDYLSLFFVSEAEAEQFWPDVCKNEALEYMNKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ R+N NYYP CPNP+L VGVGRHSD+S++
Sbjct  183   TMVRKLLEYLGKNLNVKE-LDETKESLFMGSIRVNLNYYPICPNPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L+S  WVHVPPV G+ VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLSSGNWVHVPPVPGSFVINIGDAMQILSNGRYKSVEHRVLANGSN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV+A GE+P+YK++VYSDY+R+FF KAHDGK+T++FAKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVIANGEEPIYKDVVYSDYVRYFFKKAHDGKKTVDFAKI  361



>emb|CDY37479.1| BnaC01g37530D [Brassica napus]
Length=361

 Score =   489 bits (1259),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 225/360 (63%), Positives = 289/360 (80%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++    S+   V +FVVN+G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TVSTTQFSDPAEVTEFVVNQGNGVKGLSETGIKALPDQYIQPFEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+SN D+  V++A+C+AAE+WGFFQ+INHGV + +L+++K AT+RFF LPVEEK KY
Sbjct  63    PVIDMSNPDESKVAKAICDAAEKWGFFQVINHGVSLAVLDNVKAATHRFFNLPVEEKSKY  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             +K  S S NVR+GTSFSP +EK LEWKDYLSLF+VS+ EA+  WP  C++EA++YM +  
Sbjct  123   TKEKSLSTNVRFGTSFSPRAEKALEWKDYLSLFFVSETEASQFWPDVCKNEALDYMNKST  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ R+N NYYP CPNP+L VGVGRHSD+S++
Sbjct  183   TMVRKLLEYLGKNLNVKE-LDETKESLFMGSMRVNLNYYPICPNPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L S  WVHVPPV G+ VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLASGNWVHVPPVPGSFVINIGDAMQILSNGRYKSVEHRVLANGSN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV+  GE+P+Y+++VYSDY+R+FF KAHDGK+T++FAKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVIENGEEPIYRDVVYSDYVRYFFKKAHDGKKTVDFAKI  361



>gb|KHN27813.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=341

 Score =   486 bits (1252),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 224/339 (66%), Positives = 279/339 (82%), Gaps = 3/339 (1%)
 Frame = -3

Query  1190  EGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRAVCEAA  1011
             +G GVKGLS+MG+K+LPSQY+QP +ER+    +V  +SIP ID+SNWDDP V  A+C+AA
Sbjct  3     QGNGVKGLSEMGLKSLPSQYVQPLEERVIN--VVPQESIPIIDMSNWDDPKVQDAICDAA  60

Query  1010  EEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESE  831
             E+WGFFQIINHGVP+E+L+S+K ATYRF+ LP +EK KY+K NS +++VRYG+SFSPE+E
Sbjct  61    EKWGFFQIINHGVPLEVLDSVKDATYRFYGLPPKEKVKYTKENSSTKHVRYGSSFSPEAE  120

Query  830   KTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLD  651
             K LEWKDYLSLFYVS+DEAAA WPPACR+EA+EYM +   +IK LL +LM  LN+ E +D
Sbjct  121   KALEWKDYLSLFYVSEDEAAATWPPACRNEALEYMKRSEILIKQLLNVLMKRLNVSE-ID  179

Query  650   KSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSDTW  471
             ++ E LFMG+KRIN NYYP CPN +L V +GRHSD+ST+TVLLQD  GGL+VR  N   W
Sbjct  180   ETNESLFMGSKRINLNYYPVCPNHDLTVAIGRHSDVSTLTVLLQDETGGLYVRAPNHHGW  239

Query  470   VHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGPLP  291
             +HVPPV GA+VINIGDALQ++SNGRYKS EHRVS NG   R+SVPIFV P P   +GPLP
Sbjct  240   IHVPPVSGAIVINIGDALQVMSNGRYKSIEHRVSVNGSKTRVSVPIFVNPRPSDVIGPLP  299

Query  290   EVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +VLA GEK +YK ++YSDY++HFF KAHDGK T+E+AKI
Sbjct  300   QVLASGEKAMYKNVLYSDYVKHFFRKAHDGKLTVEYAKI  338



>ref|XP_010277719.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Nelumbo nucifera]
Length=355

 Score =   487 bits (1253),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 225/356 (63%), Positives = 283/356 (79%), Gaps = 2/356 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP  L+E   V +FVVN+G GVKGL++M I  +P QYIQP +ER+  + +V  DSIP I
Sbjct  1     MAPV-LAEPWDVTEFVVNKGNGVKGLAEMEIPCVPKQYIQPIEERLDMDTVVTQDSIPII  59

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D+S  +DP V+ ++C+AAE WGFFQ+INHGVP+++L+ +K AT+RFF LP  +K KYSK 
Sbjct  60    DMSMLEDPQVADSICDAAENWGFFQVINHGVPLDILDDVKQATHRFFGLPASDKLKYSKE  119

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             NS   NVRYGTSF P +E+ LEWKD+LSLFY SD +A+A WPP C+  A++YM     +I
Sbjct  120   NSSXNNVRYGTSFIPGAERALEWKDFLSLFYXSDQDASAFWPPECKDAALKYMNTSEPLI  179

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             K LLE LM+ LN++E +D+SK  L MG+KRIN NYYP CPNPEL +GVGRHSD+ST+T+L
Sbjct  180   KRLLEALMTRLNVKE-IDESKASLLMGSKRINLNYYPICPNPELTIGVGRHSDVSTLTIL  238

Query  524   LQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             LQD IGGL+VR++  D W+HVPP+ GALVINIGDALQILSNGRYKS EHRV ANG S+RI
Sbjct  239   LQDDIGGLYVRRIKGDGWIHVPPISGALVINIGDALQILSNGRYKSVEHRVVANGRSNRI  298

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             SVPIFV P P+  +GPLPEVL  GEKP+YK+++YSDY +HFF KAHDGKET++FAK
Sbjct  299   SVPIFVNPRPKDMIGPLPEVLESGEKPVYKQVLYSDYTKHFFRKAHDGKETLDFAK  354



>ref|XP_010487121.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Camelina sativa]
Length=361

 Score =   487 bits (1253),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 227/360 (63%), Positives = 286/360 (79%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++ +  S    V DFVV++G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTSQFSNPAEVTDFVVHKGNGVKGLSETGIKALPDQYIQPLEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+SN D+  V+ AVC+AAE WGFFQ++NHGVP+E+L+ +K AT+RFF LPVEEK K+
Sbjct  63    PVIDMSNPDESKVAEAVCDAAENWGFFQVVNHGVPLEVLDEVKAATHRFFNLPVEEKSKF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             +K NS S  VR+GTSFSP +EK LEWKDYLSLFYVS+ EA   WP  CR+E +EYM +  
Sbjct  123   TKENSLSSTVRFGTSFSPLAEKALEWKDYLSLFYVSEAEAEQFWPDVCRNETLEYMNKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ RIN NYYP CPNP+L VGVGRHSD+S++
Sbjct  183   KMVRKLLEYLGKNLNVKE-LDETKESLFMGSVRINLNYYPICPNPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L S  WVHVPPV  + VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLASGNWVHVPPVPNSFVINIGDAMQILSNGRYKSVEHRVLANGNN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV+A GE+P+Y+++VYSDY+++FF KAHDGK+T+++AKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVIANGEEPIYRDVVYSDYVKYFFRKAHDGKKTVDYAKI  361



>ref|XP_006299806.1| hypothetical protein CARUB_v10016002mg [Capsella rubella]
 gb|EOA32704.1| hypothetical protein CARUB_v10016002mg [Capsella rubella]
Length=361

 Score =   487 bits (1253),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 228/360 (63%), Positives = 288/360 (80%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++ A  S    V DFVV+ G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTAQFSTPAEVTDFVVHRGNGVKGLSETGIKALPDQYIQPLEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+SN D+  V+ AVC+AAE+WGFFQ++NHGVP+E+L+++K AT+RFF LPVEEK K+
Sbjct  63    PVIDMSNPDEKKVAEAVCDAAEKWGFFQVVNHGVPLEVLDNVKAATHRFFNLPVEEKSKF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             +K NS S  VR+GTSFSP +EK LEWKDYLSLF+VSD EA   WP ACR+E +EY+ +  
Sbjct  123   TKENSLSATVRFGTSFSPLAEKALEWKDYLSLFFVSDAEAEQFWPDACRNETLEYIDKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ R+N NYYP CPNP+L VGVGRHSD+S++
Sbjct  183   KMVRKLLEYLGKNLNVKE-LDETKESLFMGSIRVNLNYYPICPNPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L S  WVHVPPV G+ VINIGDA+QILSNG YKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLASGNWVHVPPVPGSFVINIGDAMQILSNGLYKSVEHRVLANGSN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV+A GE+P+Y+++VYSDY+++FF KAHDGK+T++FAKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVIAKGEEPIYRDVVYSDYVKYFFRKAHDGKKTVDFAKI  361



>ref|XP_002885061.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61320.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   486 bits (1250),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 227/360 (63%), Positives = 289/360 (80%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++    S    V DFVV++G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTTQFSNPAEVTDFVVHKGNGVKGLSETGIKALPDQYIQPLEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+S+ D+  V+ AVC+AAE+WGFFQ+INHGVP+E+L+ +K AT+RFF LPVEEK K+
Sbjct  63    PVIDMSSPDENRVAEAVCDAAEKWGFFQVINHGVPLEVLDDVKAATHRFFNLPVEEKCKF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             +K NS S NVR+GTSFSP +EK+LEWKDYLSLF+VS+ EA   WP  CR+E +EYM +  
Sbjct  123   TKENSLSTNVRFGTSFSPLAEKSLEWKDYLSLFFVSEAEAEQFWPDICRNETLEYMNKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ R+N NYYP CPNP+L VGVGRHSD+S++
Sbjct  183   KMVRKLLEYLGKNLNVKE-LDETKESLFMGSIRVNLNYYPICPNPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L S  WVHVPPV G+ VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLASGNWVHVPPVPGSFVINIGDAMQILSNGRYKSVEHRVLANGNN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV+A GE+P+Y++++YSDY+R+FF KAHDGK+T+++AKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVIANGEEPIYRDVLYSDYVRYFFRKAHDGKKTVDYAKI  361



>ref|XP_010465206.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Camelina sativa]
Length=361

 Score =   485 bits (1249),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 227/360 (63%), Positives = 286/360 (79%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++ +  S    V DFVV++G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTSQFSNPAEVTDFVVHKGNGVKGLSETGIKALPDQYIQPLEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+SN D+  V+ AVC+AAE WGFFQ++NHGVP+E+L+ +K AT+RFF LPVEEK K+
Sbjct  63    PVIDMSNPDESKVAEAVCDAAENWGFFQVVNHGVPLEVLDDVKAATHRFFNLPVEEKSKF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             +K NS S  VR+GTSFSP +EK LEWKDYLSLFYVS+ EA   WP  CR+E +EYM +  
Sbjct  123   TKENSLSSTVRFGTSFSPLAEKALEWKDYLSLFYVSEAEAEQFWPDVCRNETLEYMNKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ RIN NYYP CPNP+L VGVGRHSD+S++
Sbjct  183   KMVRKLLEYLGKNLNVKE-LDETKESLFMGSIRINLNYYPICPNPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L S  WVHVPPV  + VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLASGNWVHVPPVPNSFVINIGDAMQILSNGRYKSVEHRVLANGYN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV+A GE+P+Y+++VYSDY+++FF KAHDGK+T+++AKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVIANGEEPIYRDVVYSDYVKYFFRKAHDGKKTVDYAKI  361



>ref|XP_010500769.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Camelina sativa]
Length=361

 Score =   485 bits (1248),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 226/360 (63%), Positives = 286/360 (79%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++ +  S    V DFVV++G GVKGLS+ GIK+LP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTSQFSNPAEVTDFVVHKGNGVKGLSETGIKSLPDQYIQPLEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+SN D+  V+ AVC+AAE+WGFFQ++NHGVP+E+L+ +K AT+RFF LPVEEK K+
Sbjct  63    PVIDMSNPDESKVAEAVCDAAEKWGFFQVVNHGVPLEVLDEVKAATHRFFNLPVEEKSKF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             +K NS S  VR+GTSFSP +EK LEWKDYLSLFYVSD EA   WP  CR+E +EYM +  
Sbjct  123   TKENSLSSTVRFGTSFSPLAEKALEWKDYLSLFYVSDAEAEQFWPDVCRNETLEYMNKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ RIN NYYP CPNP+L VGVGRHSD+S++
Sbjct  183   KMVRKLLEYLGKNLNVKE-LDETKESLFMGSIRINLNYYPICPNPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L S  WVHVPPV  + VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLASGNWVHVPPVPNSFVINIGDAMQILSNGRYKSVEHRVLANGNN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPL EV+A GE+P+Y+++VYSDY+++FF KAHDGK+T+++AKI
Sbjct  302   NRISVPIFVNPKPESVIGPLSEVIANGEEPIYRDVVYSDYVKYFFRKAHDGKKTVDYAKI  361



>emb|CDX82531.1| BnaA03g32900D [Brassica napus]
Length=361

 Score =   484 bits (1246),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 225/360 (63%), Positives = 290/360 (81%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++    ++   V +FVVN+G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTLQFADPAEVTEFVVNKGNGVKGLSETGIKALPDQYIQPFEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+S  ++  V+ AVC+AAE WGFFQ+INHGVP+E+L+++K AT+RFF LPVEEK ++
Sbjct  63    PVIDMSYPEEDKVAEAVCDAAERWGFFQVINHGVPLEVLDNVKAATHRFFNLPVEEKSRF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             ++ NS S NVR+GTSFSP +EK LEWKDYLSLF+VS+ EA   WP AC++EA+EYM +  
Sbjct  123   TRENSLSTNVRFGTSFSPRAEKALEWKDYLSLFFVSETEAEQYWPNACKNEALEYMNKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ RIN NYYP CP+P+L VGVGRHSD+S++
Sbjct  183   TMVRKLLEYLGKNLNVKE-LDETKESLFMGSIRINLNYYPICPSPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L S  WVHVPPV G+ VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLTSGNWVHVPPVPGSFVINIGDAMQILSNGRYKSVEHRVLANGSN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV++ GE+P+Y++++YSDY+R+FF KAHDGK+TI+FAKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVVSNGEEPVYRDIMYSDYVRYFFKKAHDGKKTIDFAKI  361



>ref|XP_010462374.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2 [Camelina sativa]
Length=363

 Score =   484 bits (1245),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 230/364 (63%), Positives = 288/364 (79%), Gaps = 8/364 (2%)
 Frame = -3

Query  1250  KTMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVAD---D  1080
             +T+A +  S  + V DFVV +G GVKGLS+ GI  LP QYIQP +ER+  N  V D   +
Sbjct  3     QTLA-SQFSTRDQVTDFVVYKGNGVKGLSETGINILPDQYIQPFEERLI-NFHVNDRTEE  60

Query  1079  SIPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKR  900
             SIP ID+SN D+ +VS+AVC+AAEEWGFFQ+INHGV +E++E++K AT+RFF LPVEEKR
Sbjct  61    SIPVIDMSNSDEKSVSKAVCDAAEEWGFFQVINHGVSMEVIENMKAATHRFFSLPVEEKR  120

Query  899   KYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQ  720
             K S+  S S NVRYGTSFSP +EK LEWKDYLSL YVS+ EA+ LWP ACRH  +EYM +
Sbjct  121   KLSREKSLSTNVRYGTSFSPHAEKALEWKDYLSLLYVSEAEASQLWPDACRHATLEYMNE  180

Query  719   CNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIS  540
                ++K LL+ L   LN++E LDK+KE LFMG+ RIN NYYP CPNP+L VGVGRHSD+S
Sbjct  181   SKPLVKKLLQFLGENLNVKE-LDKTKESLFMGSTRINLNYYPTCPNPDLTVGVGRHSDVS  239

Query  539   TITVLLQDHIGGLHVRKLN--SDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSA  366
             T+T+LLQD IGGLHVR L   +D WV+VPP+ G+LVINIGDA+QI+SNGRYKS EHRV A
Sbjct  240   TLTILLQDQIGGLHVRSLTTGTDRWVNVPPISGSLVINIGDAMQIMSNGRYKSVEHRVLA  299

Query  365   NGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIE  186
             NG ++RISVPIFV P PE  +GPL EV+A GEKP+Y++++Y+DY++HFF K HD K+TI+
Sbjct  300   NGTNNRISVPIFVNPKPESLIGPLLEVIANGEKPVYRDVLYTDYVKHFFRKGHDRKKTID  359

Query  185   FAKI  174
             FA I
Sbjct  360   FANI  363



>ref|XP_009135312.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Brassica rapa]
Length=361

 Score =   483 bits (1243),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 225/360 (63%), Positives = 289/360 (80%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++    ++   V +FVVN+G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTLQFADPAEVTEFVVNKGNGVKGLSETGIKALPDQYIQPFEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+S  ++  V+ AVC+AAE WGFFQ+INHGVP+E+L+++K AT+RFF LPVEEK ++
Sbjct  63    PVIDMSYPEEDKVAEAVCDAAERWGFFQVINHGVPLEVLDNVKAATHRFFNLPVEEKSRF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             ++ NS S NVR+GTSFSP +EK LEWKDYLSLF+VS+ EA   WP AC++EA+EYM +  
Sbjct  123   TRENSLSTNVRFGTSFSPRAEKALEWKDYLSLFFVSETEAEQYWPNACKNEALEYMNKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ RIN NYYP CP+P+L VGVGRHSD+S++
Sbjct  183   TMVRKLLEYLGKNLNVKE-LDETKESLFMGSIRINLNYYPICPSPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L S  WVHVPPV G+ VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLTSGNWVHVPPVPGSFVINIGDAMQILSNGRYKSVEHRVLANGSN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPL EV++ GE+P+Y+++VYSDY+R+FF KAHDGK+TI+FAKI
Sbjct  302   NRISVPIFVNPKPESVIGPLTEVVSNGEEPVYRDVVYSDYVRYFFKKAHDGKKTIDFAKI  361



>ref|XP_003520370.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Glycine max]
Length=353

 Score =   482 bits (1240),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 229/358 (64%), Positives = 285/358 (80%), Gaps = 9/358 (3%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPT  1068
             T+ P+ L+E      FV+ +G GVKGLS+MG+K+LPSQYIQP  E I  N ++  +SIP 
Sbjct  4     TLIPSDLTE------FVMLQGNGVKGLSEMGLKSLPSQYIQP-LEEIMIN-VLPQESIPI  55

Query  1067  IDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSK  888
             ID+SNWDDP V  ++C+AAE+WGFFQIINHGVP ++L+++K ATYRF+ LP EEK KY+K
Sbjct  56    IDMSNWDDPKVQDSICDAAEKWGFFQIINHGVPPQVLDNVKDATYRFYGLPPEEKVKYTK  115

Query  887   ANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAM  708
              NS +++VRYG+SFSPE+EK LEWKDYLSLFYVS+DEAA  WPPACR EA+EYM +    
Sbjct  116   ENSSTKHVRYGSSFSPEAEKALEWKDYLSLFYVSEDEAATTWPPACRDEALEYMKRSEIF  175

Query  707   IKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITV  528
             IK LL +LM  LN+ E +D++ E +FMG+KRIN NYYP CPN +L V +GRHSD+ST+TV
Sbjct  176   IKRLLNVLMKRLNVSE-IDETNESIFMGSKRINLNYYPVCPNHDLTVAIGRHSDVSTLTV  234

Query  527   LLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDR  348
             LLQD  GGL+VR  N   W+HVPPV GA+VINIGDALQILSNGRYKS EHRVSANG   R
Sbjct  235   LLQDETGGLYVRAPNHHDWIHVPPVFGAIVINIGDALQILSNGRYKSIEHRVSANGSKSR  294

Query  347   ISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +S+PIFV P P   +GPLP+VLA GEK +YK ++YSDY++HFF KAHDGK TI++AKI
Sbjct  295   VSMPIFVNPRPSDVIGPLPQVLASGEKAMYKNVLYSDYVKHFFRKAHDGKLTIDYAKI  352



>ref|XP_006445643.1| hypothetical protein CICLE_v10018343mg [Citrus clementina]
 ref|XP_006488903.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Citrus sinensis]
 gb|ESR58883.1| hypothetical protein CICLE_v10018343mg [Citrus clementina]
 gb|KDO63053.1| hypothetical protein CISIN_1g017949mg [Citrus sinensis]
Length=363

 Score =   480 bits (1236),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 277/351 (79%), Gaps = 1/351 (0%)
 Frame = -3

Query  1226  SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWD  1047
             ++S  + DFVVN+G GVKGLS+MG+K+LP Q+ QP +ER +   I+   SIP ID+S W+
Sbjct  11    TQSWDLTDFVVNKGHGVKGLSEMGLKSLPKQFHQPLEERFSEKKILDQVSIPLIDMSKWE  70

Query  1046  DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSEN  867
              P V++++C+ AE WGFFQI+NHGVP+E+LE +K AT+RFF LP EEKRKYSK NSP  N
Sbjct  71    SPEVAKSICDTAENWGFFQIVNHGVPLEVLERVKEATHRFFALPAEEKRKYSKENSPINN  130

Query  866   VRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEM  687
             VRYG+SF P  E+ LEWKD+LSLFYVS++E +A WPP C+ E +EYM     +I+ L+ +
Sbjct  131   VRYGSSFVPHVERALEWKDFLSLFYVSEEETSAFWPPVCKDEMLEYMRSSEVLIRRLMHV  190

Query  686   LMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIG  507
             L+ GLN++ R+D+ +EP+ +G++R+N NYYP CPNPEL VGVGRHSDIST T+LLQD IG
Sbjct  191   LVKGLNVK-RIDEIREPMLLGSRRVNLNYYPMCPNPELTVGVGRHSDISTFTILLQDDIG  249

Query  506   GLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFV  327
             GLHVRK N   W+HV P+ G+L+IN+GDALQI+SNGRYKS EH V ANG  +RISVP+FV
Sbjct  250   GLHVRKDNGTEWIHVAPISGSLIINVGDALQIMSNGRYKSVEHCVIANGSQNRISVPLFV  309

Query  326   TPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P PE  + P PEVLA GEKPLYK ++ +DY RHF+ KAHDGK+TI+FAKI
Sbjct  310   NPKPEAILCPFPEVLANGEKPLYKPVLCADYSRHFYTKAHDGKKTIDFAKI  360



>ref|XP_010327291.1| PREDICTED: LOW QUALITY PROTEIN: feruloyl CoA ortho-hydroxylase 
1-like [Solanum lycopersicum]
Length=354

 Score =   480 bits (1235),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 219/357 (61%), Positives = 275/357 (77%), Gaps = 3/357 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M    LS SE V DFVVNEG GVKGL D+GI+ALP QYIQP +ERI  + +  D+SIP I
Sbjct  1     MISKILSNSEKVFDFVVNEGHGVKGLCDIGIQALPKQYIQPLEERITTSIVRTDNSIPLI  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D SNWDDP V+  +C+A + WGFFQ+INHGVP+E+L+++K   +RFF LP  EK+KY   
Sbjct  61    DASNWDDPKVADQICKAPQSWGFFQVINHGVPIEILDNIKETIHRFFNLPTNEKKKY--I  118

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             NS S NVRY TSF+PE+EKTL W+DY SL +VSDDEA + WP +CR EA+EY+  C+ +I
Sbjct  119   NSLSSNVRYATSFNPEAEKTLSWRDYYSLVHVSDDEATSFWPTSCRKEALEYLKSCDTVI  178

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             + +L++LM GLN++E +DK  E L MG KRINFNYYPKCPNPEL++GVGRHSDISTIT+L
Sbjct  179   RKILKLLMGGLNVKE-IDKETEELLMGLKRINFNYYPKCPNPELSIGVGRHSDISTITLL  237

Query  524   LQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             LQD IGGL+V+K  ++ W+H+PPV GALVINIGDALQI+SN +YKS EH + ANG  +R+
Sbjct  238   LQDDIGGLYVKKHETNVWIHIPPVKGALVINIGDALQIMSNDKYKSVEHCMIANGSHNRV  297

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             SVPIF+ P     +GPL EVL  GE   YK+++Y DY   FF K HDGK+TI+FAKI
Sbjct  298   SVPIFLHPKATSVIGPLKEVLQNGENQXYKKILYGDYTNIFFSKGHDGKDTIKFAKI  354



>ref|XP_006445647.1| hypothetical protein CICLE_v10015700mg [Citrus clementina]
 ref|XP_006488901.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Citrus sinensis]
 gb|ESR58887.1| hypothetical protein CICLE_v10015700mg [Citrus clementina]
 gb|KDO63050.1| hypothetical protein CISIN_1g017979mg [Citrus sinensis]
Length=363

 Score =   480 bits (1236),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 217/358 (61%), Positives = 280/358 (78%), Gaps = 1/358 (0%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPT  1068
             T     ++ES  + DFV+++G GVKGLS+ G+K+LP Q+ QP +ER +   I+   SIP 
Sbjct  4     TNGSTVVTESWDIADFVIHKGHGVKGLSEKGLKSLPKQFHQPLEERFSEKRILDHVSIPL  63

Query  1067  IDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSK  888
             ID+S W+ P V++++C+AAE WGFFQI+NHGVP+E+LE +K AT+RFF LP EEKRKYSK
Sbjct  64    IDMSKWESPEVAKSICDAAENWGFFQIVNHGVPLEVLERVKEATHRFFALPAEEKRKYSK  123

Query  887   ANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAM  708
              NSP  NVRYG+SF P  E+ LEWKD+LSLFYVS++E +A WPP C+ E +EYM     +
Sbjct  124   ENSPINNVRYGSSFVPHVERALEWKDFLSLFYVSEEETSAFWPPVCKDEMLEYMRSSEVL  183

Query  707   IKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITV  528
             IK L+++L+ GLN+ +R+D+ +EP+ +G++R+N NYYP CPNPEL VGVGRHSDIST T+
Sbjct  184   IKRLMDVLVKGLNV-KRIDEIREPMLLGSRRVNLNYYPMCPNPELTVGVGRHSDISTFTI  242

Query  527   LLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDR  348
             LLQD IGGLHVRK N   W+HV P+ G+L+INIGDALQI+SNGRYKS EH V ANG  +R
Sbjct  243   LLQDDIGGLHVRKDNGTDWIHVAPISGSLIINIGDALQIMSNGRYKSIEHCVIANGSQNR  302

Query  347   ISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             ISVP+FV P PE  + P PEVLA GEKPLYK ++ +DY RHF+ KAHDGK+TI+FAKI
Sbjct  303   ISVPLFVNPKPEAILCPFPEVLANGEKPLYKPVLCADYSRHFYTKAHDGKKTIDFAKI  360



>ref|XP_002882832.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59091.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   480 bits (1235),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 224/360 (62%), Positives = 287/360 (80%), Gaps = 4/360 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--ADDSI  1074
             T++    S    V DFVV++G GVKGLS+ GIKALP QYIQP +ER+  N  V   D++I
Sbjct  4     TLSTTQFSNPAEVTDFVVHKGNGVKGLSETGIKALPDQYIQPFEERLI-NKFVNETDEAI  62

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+SN D+  V+ AVC+AAE+WGFFQ+INHGVP+E+L+ +K AT+RFF LPVEEK K+
Sbjct  63    PVIDMSNPDENRVAEAVCDAAEKWGFFQVINHGVPLEVLDDVKAATHRFFNLPVEEKCKF  122

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             +K NS S  VR+GTSFSP +E+ LEWKDYLSLF+VS+ EA   WP  CR+E +EY+ +  
Sbjct  123   TKENSLSTTVRFGTSFSPLAEQALEWKDYLSLFFVSEAEAEQFWPDICRNETLEYIDKSK  182

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L   LN++E LD++KE LFMG+ R+N NYYP CPNP+L VGVGRHSD+S++
Sbjct  183   KMVRKLLEYLGKNLNVKE-LDETKESLFMGSIRVNLNYYPICPNPDLTVGVGRHSDVSSL  241

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD IGGLHVR L S  WVHVPPV G+ VINIGDA+QILSNGRYKS EHRV ANG +
Sbjct  242   TILLQDQIGGLHVRSLASGNWVHVPPVPGSFVINIGDAMQILSNGRYKSVEHRVLANGNN  301

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIFV P PE  +GPLPEV+A GE+P+Y++++YSDY+++FF KAHDGK+T+++AKI
Sbjct  302   NRISVPIFVNPKPESVIGPLPEVIANGEEPIYRDVLYSDYVKYFFRKAHDGKKTVDYAKI  361



>ref|XP_010534882.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Tarenaya hassleriana]
Length=359

 Score =   480 bits (1235),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 223/361 (62%), Positives = 284/361 (79%), Gaps = 8/361 (2%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAI-VADDSIP  1071
             TMA    S+   V DFVV +G GVKGLS+ GIKALP QYIQP +ER+    + + D+SIP
Sbjct  4     TMA-TQFSDPAKVTDFVVKKGNGVKGLSETGIKALPDQYIQPLEERLINQFVKLTDESIP  62

Query  1070  TIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
              ID+S+ D   V++AVC+AAE+WGFFQ++NHGVP+E+LES+K AT+RFF LPVEEKRK+ 
Sbjct  63    VIDMSDSDQTNVAKAVCDAAEKWGFFQVVNHGVPLEVLESVKMATHRFFGLPVEEKRKFL  122

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
               NSPS  VR+GTSFSP +EK LEWKDYLSLF+VS+ EA+  WP  CR EA+EYM +   
Sbjct  123   AENSPSRTVRFGTSFSPHAEKALEWKDYLSLFFVSEAEASQFWPHVCRDEALEYMNETKN  182

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             +++ +LEML+  LN++E     +  +FMG+ R+N NYYP CPNP+L VGVGRHSD+S++T
Sbjct  183   LVRKILEMLVKKLNVKEM----ESSMFMGSIRVNLNYYPICPNPDLTVGVGRHSDVSSLT  238

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +LLQD IGGLHVR L +  WVHV P+ G+LVINIGDA+QI+SNGRYKS EHRV ANGG +
Sbjct  239   ILLQDDIGGLHVRSLATGNWVHVAPIPGSLVINIGDAMQIMSNGRYKSVEHRVLANGGKN  298

Query  350   RISVPIFVTPDPECRVGPLPEVLA--GGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             RISVPIFV P P   +GPL E+++  GGE+PLYK ++YSDY+RHFF KAHDGK+T++FAK
Sbjct  299   RISVPIFVNPKPSSMIGPLSELISGGGGEEPLYKNVLYSDYVRHFFKKAHDGKKTVDFAK  358

Query  176   I  174
             I
Sbjct  359   I  359



>ref|XP_009117633.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Brassica rapa]
Length=361

 Score =   479 bits (1234),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 221/359 (62%), Positives = 287/359 (80%), Gaps = 2/359 (1%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAI-VADDSIP  1071
             T++    S+   V +FVVN+G GVKGLS+ GIKALP QYIQP +ER+  N +   D++IP
Sbjct  4     TVSTTQFSDPAEVTEFVVNQGNGVKGLSETGIKALPDQYIQPFEERLINNFVNETDEAIP  63

Query  1070  TIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
              ID+S  D+  V++A+C+AAE+WGFFQ+INHGVP+E+L+++K AT+RFF LPVEEK KY+
Sbjct  64    VIDMSYPDESKVAKAICDAAEKWGFFQVINHGVPLEVLDNVKAATHRFFNLPVEEKSKYT  123

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             K NS S NVR+GTSFSP +EK LEWKDYLSLF+VS+ EA+  WP  C++EA++YM +   
Sbjct  124   KENSLSTNVRFGTSFSPRAEKALEWKDYLSLFFVSETEASQFWPDVCKNEALDYMNKSKT  183

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             M++ LLE L   LN++E LD++KE LFMG+ R+N NYYP CPNP+L VGVGRHSD+S++T
Sbjct  184   MVRKLLEYLGKNLNVKE-LDETKESLFMGSIRVNLNYYPICPNPDLTVGVGRHSDVSSLT  242

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             ++LQD I GLHVR L S  WVHVPPV G+ VINIGD +QILSNGRYKS E RV ANG ++
Sbjct  243   IVLQDQIDGLHVRSLVSGNWVHVPPVPGSFVINIGDTMQILSNGRYKSVEPRVLANGSNN  302

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             RISVPIFV P PE  +GPL EV+A GE+P+ +++VYSDY+R+FF KAHDGK+T++FAKI
Sbjct  303   RISVPIFVNPKPESVIGPLLEVIANGEEPIDRDVVYSDYVRYFFKKAHDGKKTVDFAKI  361



>ref|XP_002297642.1| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE82447.1| oxidoreductase family protein [Populus trichocarpa]
Length=361

 Score =   479 bits (1232),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 223/361 (62%), Positives = 282/361 (78%), Gaps = 6/361 (2%)
 Frame = -3

Query  1244  MAPAAL----SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDS  1077
             MAP A       S+++ DFV+ +G GVKGLS+MG+K LP QYIQP +E I+   I    S
Sbjct  1     MAPTAAVLINDSSDAITDFVLKQGNGVKGLSEMGLKNLPKQYIQPLEEIISDAKITPQAS  60

Query  1076  IPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             IP ID+S  D P V+ AVC AAE WGFFQIINHGVP+++LE++K +T+RFF LP EEKRK
Sbjct  61    IPIIDVSKLDGPTVAEAVCRAAERWGFFQIINHGVPIDVLENVKESTHRFFGLPAEEKRK  120

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS NVR+GTSFSPE+EK LEWKDYLSLFYVS+DEA+ALWP  C+ + ++YM + 
Sbjct  121   YLKELSPSNNVRFGTSFSPEAEKALEWKDYLSLFYVSEDEASALWPSVCKDQVLDYMRRS  180

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               +I+ LL++LM  L + E +D++KE L MG+KRIN NYYP CPNPEL VG+GRHSD+ST
Sbjct  181   EIVIRRLLDVLMKNLKVTE-IDETKESLLMGSKRINLNYYPICPNPELTVGIGRHSDVST  239

Query  536   ITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGG  357
             +TVLLQD +GGL+VR  + D W+HVPPV+G+LVIN+GDALQI+SNGRYKS EH V  +G 
Sbjct  240   LTVLLQDDVGGLYVRG-DDDYWIHVPPVNGSLVINVGDALQIMSNGRYKSVEHCVMTDGS  298

Query  356   SDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
              +RIS+PIF+ P P  ++ P  EVLA GEK  YKE++YSDY++HFF KAHDGK+TI+FAK
Sbjct  299   KNRISIPIFINPRPSNKISPFHEVLASGEKAAYKEVLYSDYVKHFFRKAHDGKKTIDFAK  358

Query  176   I  174
             I
Sbjct  359   I  359



>ref|XP_006488902.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Citrus sinensis]
Length=363

 Score =   478 bits (1231),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 216/351 (62%), Positives = 279/351 (79%), Gaps = 1/351 (0%)
 Frame = -3

Query  1226  SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWD  1047
             +ES  +VDFV+N+G GVKGLS+MG+K+LP Q+ QP +ER +   I+   SIP ID+SNW+
Sbjct  11    TESWDIVDFVINKGHGVKGLSEMGLKSLPKQFHQPLEERFSEKKILDQVSIPLIDMSNWE  70

Query  1046  DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSEN  867
              P V++++C+AAE WGFFQI+NHGVP+E+LE +K AT+RFF LP EEKRKYSK NSP+  
Sbjct  71    SPEVAKSICDAAENWGFFQIVNHGVPLEVLERVKEATHRFFALPAEEKRKYSKENSPTNK  130

Query  866   VRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEM  687
             VR G+SF P  EK LEWKD+LSLFY S++E +A WPP C+ E +EYM     +I+ L+ +
Sbjct  131   VRLGSSFVPLVEKALEWKDFLSLFYGSEEETSAFWPPVCKDETLEYMKSSEVLIRRLMHV  190

Query  686   LMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIG  507
             L+ GLN+ +R+D+ +EP+ +G++R+N NYYP CPNPEL VGVGRHSDIST T+LLQD IG
Sbjct  191   LVKGLNV-KRIDEIREPMLLGSRRVNLNYYPMCPNPELTVGVGRHSDISTFTILLQDDIG  249

Query  506   GLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFV  327
             GLHVRK + + W+HV P+ G+L+INIGDALQI+SNGRYKS EH V ANG  +RISVP+FV
Sbjct  250   GLHVRKDSGNDWIHVAPISGSLIINIGDALQIMSNGRYKSIEHCVIANGSQNRISVPLFV  309

Query  326   TPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P PE  + P PEVLA GEKPLYK ++ +DY RHF+ KAHDGK+TI+FAKI
Sbjct  310   NPKPEAILCPFPEVLANGEKPLYKPVLCADYSRHFYTKAHDGKKTIDFAKI  360



>ref|NP_187970.1| feruloyl CoA ortho-hydroxylase 1 [Arabidopsis thaliana]
 sp|Q9LHN8.1|F6H1_ARATH RecName: Full=Feruloyl CoA ortho-hydroxylase 1 [Arabidopsis thaliana]
 dbj|BAB02603.1| leucoanthocyanidin dioxygenase-like protein [Arabidopsis thaliana]
 gb|AAS49108.1| At3g13610 [Arabidopsis thaliana]
 dbj|BAD95049.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75382.1| feruloyl CoA ortho-hydroxylase 1 [Arabidopsis thaliana]
Length=361

 Score =   477 bits (1228),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 225/363 (62%), Positives = 288/363 (79%), Gaps = 8/363 (2%)
 Frame = -3

Query  1244  MAPAALSESES----VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIV--AD  1083
             MAP  L+   S    V DFVV +G GVKGLS+ GIKALP QYIQP +ER+  N  V   D
Sbjct  1     MAPTLLTTQFSNPAEVTDFVVYKGNGVKGLSETGIKALPEQYIQPLEERLI-NKFVNETD  59

Query  1082  DSIPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEK  903
             ++IP ID+SN D+  V+ AVC+AAE+WGFFQ+INHGVP+E+L+ +K AT++FF LPVEEK
Sbjct  60    EAIPVIDMSNPDEDRVAEAVCDAAEKWGFFQVINHGVPLEVLDDVKAATHKFFNLPVEEK  119

Query  902   RKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMT  723
             RK++K NS S  VR+GTSFSP +E+ LEWKDYLSLF+VS+ EA   WP  CR+E +EY+ 
Sbjct  120   RKFTKENSLSTTVRFGTSFSPLAEQALEWKDYLSLFFVSEAEAEQFWPDICRNETLEYIN  179

Query  722   QCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDI  543
             +   M++ LLE L   LN++E LD++KE LFMG+ R+N NYYP CPNP+L VGVGRHSD+
Sbjct  180   KSKKMVRRLLEYLGKNLNVKE-LDETKESLFMGSIRVNLNYYPICPNPDLTVGVGRHSDV  238

Query  542   STITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSAN  363
             S++T+LLQD IGGLHVR L S  WVHVPPV G+ VINIGDA+QI+SNG YKS EHRV AN
Sbjct  239   SSLTILLQDQIGGLHVRSLASGNWVHVPPVAGSFVINIGDAMQIMSNGLYKSVEHRVLAN  298

Query  362   GGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEF  183
             G ++RISVPIFV P PE  +GPLPEV+A GE+P+Y++++YSDY+++FF KAHDGK+T+++
Sbjct  299   GYNNRISVPIFVNPKPESVIGPLPEVIANGEEPIYRDVLYSDYVKYFFRKAHDGKKTVDY  358

Query  182   AKI  174
             AKI
Sbjct  359   AKI  361



>ref|XP_011048234.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Populus euphratica]
Length=361

 Score =   476 bits (1226),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 221/361 (61%), Positives = 282/361 (78%), Gaps = 6/361 (2%)
 Frame = -3

Query  1244  MAPAAL----SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDS  1077
             MAP         S+++ DFV+ +G GVKGLS+MG+K LP QYIQP +E I+   I+   S
Sbjct  1     MAPTTAVLINGSSDAITDFVLKQGNGVKGLSEMGLKNLPKQYIQPLEEIISDAKIMPQAS  60

Query  1076  IPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             IP ID+S  D P V+ AVC AAE WGFFQIINHGVPV +LE++K +T+RFF+LP EEKRK
Sbjct  61    IPIIDMSKLDGPTVAEAVCRAAERWGFFQIINHGVPVHVLENVKESTHRFFRLPAEEKRK  120

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS NVR+GTSFSPE+E+ LEWKDYLSLFYVS+DEA+ALWP  C+ + ++YM + 
Sbjct  121   YLKELSPSNNVRFGTSFSPEAERALEWKDYLSLFYVSEDEASALWPSVCKDQVLDYMRRS  180

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               +I+ LL++LM  L + E +D+ KE L MG+KRIN NYYP CPNPEL VG+GRHSD+ST
Sbjct  181   EIVIRRLLDVLMKNLKVTE-IDEKKESLLMGSKRINLNYYPICPNPELTVGIGRHSDVST  239

Query  536   ITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGG  357
             +T LLQD++GGL+VR  + D W+HVPPV+G+LVIN+GDALQI+SNGRYKS EH V  +G 
Sbjct  240   LTALLQDNVGGLYVRG-DDDYWIHVPPVNGSLVINVGDALQIMSNGRYKSVEHCVMTDGS  298

Query  356   SDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
              +RIS+PIF+ P P  ++ P  EVLA GEK +YKE++YSDY++HFF KAHDGK+TI+FAK
Sbjct  299   KNRISIPIFINPRPSDKISPFHEVLASGEKAVYKEVLYSDYVKHFFRKAHDGKKTIDFAK  358

Query  176   I  174
             I
Sbjct  359   I  359



>gb|KHN30847.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=339

 Score =   474 bits (1220),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 223/339 (66%), Positives = 275/339 (81%), Gaps = 3/339 (1%)
 Frame = -3

Query  1190  EGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRAVCEAA  1011
             +G GVKGLS+MG+K+LPSQYIQP  E I  N ++  +SIP ID+SNWDDP V  ++C+AA
Sbjct  3     QGNGVKGLSEMGLKSLPSQYIQP-LEEIMIN-VLPQESIPIIDMSNWDDPKVQDSICDAA  60

Query  1010  EEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESE  831
             E+WGFFQIINHGVP ++L+++K ATYRF+ LP EEK KY+K NS +++VRYG+SFSPE+E
Sbjct  61    EKWGFFQIINHGVPPQVLDNVKDATYRFYGLPPEEKVKYTKENSSTKHVRYGSSFSPEAE  120

Query  830   KTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLD  651
             K LEWKDYLSLFYVS+DEAA  WPPACR EA+EYM +    IK LL +LM  LN+ E +D
Sbjct  121   KALEWKDYLSLFYVSEDEAATTWPPACRDEALEYMKRSEIFIKRLLNVLMKRLNVSE-ID  179

Query  650   KSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSDTW  471
             ++ E +FMG+KRIN NYYP CPN +L V +GRHSD+ST+TVLLQD  GGL+VR  N   W
Sbjct  180   ETNESIFMGSKRINLNYYPVCPNHDLTVAIGRHSDVSTLTVLLQDETGGLYVRAPNHHDW  239

Query  470   VHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGPLP  291
             +HVPPV GA+VINIGDALQILSNGRYKS EHRVSANG   R+S+PIFV P P   +GPLP
Sbjct  240   IHVPPVFGAIVINIGDALQILSNGRYKSIEHRVSANGSKSRVSMPIFVNPRPSDVIGPLP  299

Query  290   EVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +VLA GEK +YK ++YSDY++HFF KAHDGK TI++AKI
Sbjct  300   QVLASGEKAMYKNVLYSDYVKHFFRKAHDGKLTIDYAKI  338



>gb|AER36089.1| citrus dioxygenase [Citrus limetta]
Length=363

 Score =   475 bits (1222),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 274/351 (78%), Gaps = 1/351 (0%)
 Frame = -3

Query  1226  SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWD  1047
             ++S  + DFVVN+G GVKGLS+MG+K+LP Q+ QP +ER +   I+   SIP ID+S W+
Sbjct  11    TQSWDLTDFVVNKGHGVKGLSEMGLKSLPKQFHQPLEERFSEKKILDQVSIPLIDMSKWE  70

Query  1046  DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSEN  867
              P V++++C+ AE WGFFQI+NHGVP+E+LE +K AT+RFF LP EEKRKYSK NSP  N
Sbjct  71    SPEVAKSICDTAENWGFFQIVNHGVPLEVLERVKEATHRFFALPAEEKRKYSKENSPINN  130

Query  866   VRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEM  687
             VRYG+SF P  E+ LEWKD+LSLFYVS++E +A WPP C+ E +EYM      IK L+ +
Sbjct  131   VRYGSSFVPHVERALEWKDFLSLFYVSEEETSAFWPPVCKDEMLEYMRSSEVFIKRLMHV  190

Query  686   LMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIG  507
             L+  LN++ R+D+ +EP+ +G++R+N NYYP CPNPEL VGVGRHSDIST T+LLQD IG
Sbjct  191   LVKVLNVK-RIDEIREPMLLGSRRVNLNYYPMCPNPELTVGVGRHSDISTFTILLQDDIG  249

Query  506   GLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFV  327
             GLHVRK N   W+H  P+ G+L+INIGDALQI+SNGR KS EH V ANG  +RISVP+FV
Sbjct  250   GLHVRKDNGTDWIHAAPISGSLIINIGDALQIMSNGRNKSIEHCVIANGSQNRISVPLFV  309

Query  326   TPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P PE  + P PEVLA GEKPLYK ++Y+DY RHF+ KAHDGK+TI+FAKI
Sbjct  310   NPKPEAILCPFPEVLANGEKPLYKPVLYADYSRHFYTKAHDGKKTIDFAKI  360



>ref|XP_002525827.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF36521.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=362

 Score =   474 bits (1219),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 221/363 (61%), Positives = 287/363 (79%), Gaps = 9/363 (2%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPT  1068
             T+A +    S  + DFV+N+G GVKGLSD+G+K+LP QYIQP +  I    I+  DSIP 
Sbjct  4     TLAGSTADSSFDLNDFVINKGNGVKGLSDLGLKSLPRQYIQPQEALIN---IIPQDSIPV  60

Query  1067  IDISNWD-DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
             ID+SN+D DP ++ ++C+AAE++GFFQ++NHGVP+E+L+ +K AT+RFF LP EEKRK+S
Sbjct  61    IDMSNFDNDPKIAESICDAAEQFGFFQLVNHGVPLEVLDGVKDATHRFFGLPAEEKRKFS  120

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             K  S + NVR+GTSFSP+SEK LEWKDYLSLFYVS+DEA+ALWP AC+ E +EYM +   
Sbjct  121   KELSSTNNVRFGTSFSPDSEKALEWKDYLSLFYVSEDEASALWPSACKDECLEYMKKSEV  180

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             + + L+  LM  LN++E +D++KE L MG+KRIN NYYP+CPNP+L +GVGRHSD+S++T
Sbjct  181   LCRKLMTSLMERLNVKE-IDETKESLLMGSKRINLNYYPRCPNPQLTIGVGRHSDVSSLT  239

Query  530   VLLQDHIGGLHVR----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSAN  363
              LLQD IGGL+VR    K   D WVHVPPV+G+LVIN+GDALQILSNGRYKS EH V A+
Sbjct  240   FLLQDEIGGLYVRVNEGKGEEDGWVHVPPVEGSLVINVGDALQILSNGRYKSVEHCVIAS  299

Query  362   GGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEF  183
             G  +RIS+PIFV P P   +GPLPE+LA GE+P YK  +YSDY++HFF KAHDGK+T+ F
Sbjct  300   GSKNRISIPIFVNPKPSDVIGPLPEILAAGEQPKYKNFLYSDYVKHFFRKAHDGKKTVAF  359

Query  182   AKI  174
             A+I
Sbjct  360   AEI  362



>ref|XP_006368541.1| hypothetical protein POPTR_0001s04390g [Populus trichocarpa]
 gb|ERP65110.1| hypothetical protein POPTR_0001s04390g [Populus trichocarpa]
Length=343

 Score =   473 bits (1217),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 219/360 (61%), Positives = 281/360 (78%), Gaps = 20/360 (6%)
 Frame = -3

Query  1244  MAPA---ALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSI  1074
             MAP    + ++S  + DF +N+G GVKGLS+MG+++LP QYIQP +ER+    I++ +SI
Sbjct  1     MAPTLAVSFNDSSDITDFFLNKGNGVKGLSEMGLESLPKQYIQPLEERMCGTKIMSHESI  60

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID+S WDDP V+ A+CEAAE+WGFFQIINHGVP+E+LE++K AT++FF+LP EEKRKY
Sbjct  61    PIIDMSKWDDPKVAEAICEAAEKWGFFQIINHGVPIEVLENVKEATHQFFRLPAEEKRKY  120

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS NVR+GTSFSPE+EK LEWKDYLSLFYVS+DEA+ALWP  C+ + +EYM +  
Sbjct  121   LKEFSPSNNVRFGTSFSPEAEKALEWKDYLSLFYVSEDEASALWPAVCKDQVLEYMKRSE  180

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              +I+ LL++LM  LN+ E +D++KE L MG+KR N NYYP CPNPEL VGVGRHSD+ST+
Sbjct  181   TVIRKLLDVLMKNLNVTE-IDETKESLLMGSKRTNLNYYPICPNPELTVGVGRHSDVSTL  239

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T LLQD IGGL+                 ++VIN+GDALQI+SNGRYKS EHRV ANG +
Sbjct  240   TFLLQDDIGGLY----------------RSIVINVGDALQIMSNGRYKSIEHRVIANGSN  283

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +RISVPIF+ P P  ++ P PEVLA GEK +YKE++YSDY++HFF KAHDGK+TI+ AKI
Sbjct  284   NRISVPIFINPMPSDKISPFPEVLASGEKAVYKEVLYSDYVKHFFRKAHDGKKTIDLAKI  343



>ref|XP_002525830.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF36524.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=363

 Score =   473 bits (1217),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 224/364 (62%), Positives = 289/364 (79%), Gaps = 10/364 (3%)
 Frame = -3

Query  1247  TMA-PAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIP  1071
             TMA  +A + S  + DFV+N+G GVKGLSD+G+K+LP QYIQP +  I    I+  DSIP
Sbjct  4     TMAVSSATNSSFDLNDFVINKGNGVKGLSDLGLKSLPRQYIQPQEALIN---IIPQDSIP  60

Query  1070  TIDISNWD-DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
              ID+SN+D DP ++ ++C+AAE++GFFQ++NH VPVE+L+ +K AT+RFF LP EEKRK+
Sbjct  61    VIDMSNFDSDPEIAESICDAAEKFGFFQLVNHDVPVEVLDGVKDATHRFFGLPAEEKRKF  120

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             SK +S + NVR+GTSFSP++EK LEWKDYLSLFYVS+DEA+ALWP AC+ E +EYM +  
Sbjct  121   SKEHSSTNNVRFGTSFSPDAEKALEWKDYLSLFYVSEDEASALWPSACKDECLEYMKRSE  180

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              + + L+  LM  LN++E +D++KE L MG+KRIN NYYPKCPNP+L +GVGRHSD+S++
Sbjct  181   VLCRKLMTALMERLNVKE-IDETKESLLMGSKRINLNYYPKCPNPQLTIGVGRHSDVSSL  239

Query  533   TVLLQDHIGGLHVR----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSA  366
             T LLQD IGGL+VR    K   D WVHVPPV+G+LVIN+GDALQILSNGRYKS EH V A
Sbjct  240   TFLLQDAIGGLYVRVNEGKGEEDGWVHVPPVEGSLVINVGDALQILSNGRYKSVEHCVIA  299

Query  365   NGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIE  186
             +G  +RIS+PIFV P P   +GPLPE+LA GEKP YK  +YSDY++HFF KAHDGK+T+ 
Sbjct  300   SGSKNRISIPIFVNPKPSDVIGPLPEILATGEKPKYKNFLYSDYVKHFFRKAHDGKKTVA  359

Query  185   FAKI  174
             FA+I
Sbjct  360   FAEI  363



>gb|KDP40921.1| hypothetical protein JCGZ_24920 [Jatropha curcas]
Length=358

 Score =   473 bits (1217),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 223/362 (62%), Positives = 285/362 (79%), Gaps = 9/362 (2%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP   ++S ++ DFV+N+G GVKGLSD+G+K+LP QYIQP +  I    I+  +SIP I
Sbjct  1     MAPTMSTDSFNLTDFVINKGNGVKGLSDLGLKSLPKQYIQPQEALIN---IIPHESIPVI  57

Query  1064  DISNWD-DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSK  888
             D+SNWD DP V+ ++C+AAE++GFFQ++NHGVP+E+L+ +K AT+RFF LP E KR YSK
Sbjct  58    DMSNWDSDPKVAESICDAAEKYGFFQLVNHGVPLEVLDGVKDATHRFFGLPAEVKRNYSK  117

Query  887   ANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAM  708
               S + NVR+GTSFSP++EK LEWKDYLSLFYVS+DEA+ALWP AC+ E +EYM +   +
Sbjct  118   ELSSTNNVRFGTSFSPDAEKALEWKDYLSLFYVSEDEASALWPSACKDECLEYMKRSEIL  177

Query  707   IKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITV  528
              K L+  LM  LN++E +D+ KE L MG+KRIN NYYP+CPNP L +GVGRHSD+S +T 
Sbjct  178   CKKLMGALMERLNVKE-IDEKKESLLMGSKRINLNYYPRCPNPNLTIGVGRHSDVSALTF  236

Query  527   LLQDHIGGLHVR----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANG  360
             LLQD IGGL+VR    K   D WVHVPP++G+LVIN+GDALQILSNGRYKS EH V A+G
Sbjct  237   LLQDEIGGLYVRVNEGKGEEDGWVHVPPIEGSLVINVGDALQILSNGRYKSIEHCVIASG  296

Query  359   GSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFA  180
               +RIS+PIFV P P   +GPLPEVLA GEKP YK ++YSDY++HFF KAHDGK+T+ FA
Sbjct  297   SKNRISIPIFVNPKPSDVIGPLPEVLASGEKPKYKNILYSDYVKHFFRKAHDGKKTVGFA  356

Query  179   KI  174
             +I
Sbjct  357   EI  358



>ref|XP_002525828.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF36522.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=362

 Score =   472 bits (1215),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 223/363 (61%), Positives = 287/363 (79%), Gaps = 9/363 (2%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPT  1068
             T+A +A   S  + DFV+N+G GVKGLSD+G+K+LP QYIQP +  I    I+  DSIP 
Sbjct  4     TLAESAPHSSFDLNDFVINKGNGVKGLSDLGLKSLPRQYIQPQEALIN---IIPQDSIPV  60

Query  1067  IDISNWD-DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
             ID+SN+D DP ++ ++C+AAE++GFFQ++NHGVP+E+L+ +K AT+ FF LP EEKRK+S
Sbjct  61    IDMSNFDNDPKIAESICDAAEQFGFFQLVNHGVPLEVLDGVKDATHCFFGLPAEEKRKFS  120

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             K  S + NVR+GTSFSP+SEK LEWKDYLSLFYVS+DEA+ALWP AC+ E +EYM +   
Sbjct  121   KELSSTNNVRFGTSFSPDSEKALEWKDYLSLFYVSEDEASALWPSACKDECLEYMKKSEV  180

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             + + L+  LM  LN++E +D++KE L MG+KRIN NYYP+CPNP+L +GVGRHSD+S++T
Sbjct  181   LCRKLMTSLMERLNVKE-IDETKESLLMGSKRINLNYYPRCPNPQLTIGVGRHSDVSSLT  239

Query  530   VLLQDHIGGLHVR----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSAN  363
              LLQD IGGL+VR    K   D WVHVPPV+G+LVIN+GDALQILSNGRYKS EH V A+
Sbjct  240   FLLQDEIGGLYVRVNEGKGEEDGWVHVPPVEGSLVINVGDALQILSNGRYKSVEHCVIAS  299

Query  362   GGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEF  183
             G  +RIS+PIFV P P   +GPLPEVLA GEKP YK  +YSDY++HFF KAHDGK+T+ F
Sbjct  300   GSKNRISIPIFVNPKPSDVIGPLPEVLATGEKPKYKNFLYSDYVKHFFRKAHDGKKTVAF  359

Query  182   AKI  174
             A+I
Sbjct  360   AEI  362



>ref|XP_007134307.1| hypothetical protein PHAVU_010G036100g [Phaseolus vulgaris]
 gb|ESW06301.1| hypothetical protein PHAVU_010G036100g [Phaseolus vulgaris]
Length=354

 Score =   467 bits (1201),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 215/355 (61%), Positives = 282/355 (79%), Gaps = 9/355 (3%)
 Frame = -3

Query  1238  PAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDI  1059
             P+ LSE      FV+ +G GVKGLS+MG+K++P +YIQP +ER+    +V+ + IP ID+
Sbjct  6     PSDLSE------FVMVKGNGVKGLSEMGLKSVPREYIQPLEERMMK--VVSGEFIPIIDM  57

Query  1058  SNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             +N D+P V  A+C+AA++WGFFQIINHGVP+ +LE++K AT+RF+++P +EK K++K NS
Sbjct  58    ANCDEPKVQDAICDAAQKWGFFQIINHGVPLHVLENVKDATHRFYQMPPQEKVKFTKENS  117

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKN  699
             PS +VRYG+SFSPE+EK LEWKDYLSLFYVSD EA   WP ACR EA+EYM +   +IK 
Sbjct  118   PSNHVRYGSSFSPEAEKALEWKDYLSLFYVSDHEAQTTWPSACRDEALEYMKRSEILIKQ  177

Query  698   LLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQ  519
             LL +L+  LN+  ++D++ E LFMG+KRIN NYYP CPN E  + +GRHSD+ST+T+LLQ
Sbjct  178   LLNVLVKRLNVS-KIDETNEALFMGSKRINLNYYPVCPNHEETIAIGRHSDVSTLTILLQ  236

Query  518   DHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISV  339
             D IGGLHVR  N   W+HVPP+ GALVINIGDALQ++SNGRYKS EHRVSANG   R+SV
Sbjct  237   DEIGGLHVRAPNHRDWIHVPPISGALVINIGDALQVMSNGRYKSIEHRVSANGSKIRVSV  296

Query  338   PIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             PIFV P P   +GPLP+VLA GEK +Y++++YSDY++HFF K+HDGK T+E+AKI
Sbjct  297   PIFVNPRPSDVIGPLPQVLASGEKAMYRDVLYSDYVKHFFRKSHDGKMTVEYAKI  351



>ref|XP_002525829.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF36523.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=362

 Score =   467 bits (1202),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 221/363 (61%), Positives = 285/363 (79%), Gaps = 9/363 (2%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPT  1068
             T+A      S  + DFV+N+G GVKGLS++G+K+LP QYIQP +  I    I+  DSIP 
Sbjct  4     TLAEPTPVSSFDLNDFVINKGNGVKGLSNLGLKSLPRQYIQPQEALIN---IIPQDSIPV  60

Query  1067  IDISNWD-DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
             ID+SN+D DP ++ ++C+AAE++GFFQ++NH VPVE+L+ +K AT+RFF LP EEKRK+S
Sbjct  61    IDMSNFDSDPEIAESICDAAEKFGFFQLVNHDVPVEVLDGIKDATHRFFGLPAEEKRKFS  120

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             K  S + NVR+GTSFSP++EK LEWKDYLSLFYVS+DEA+ALWP AC+ E +EYM +   
Sbjct  121   KELSSTNNVRFGTSFSPDAEKALEWKDYLSLFYVSEDEASALWPSACKDECLEYMKRSEV  180

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             + + L+  LM  LN++E +D++KE L MG+KRIN NYYP+CPNP+L +GVGRHSD+S++T
Sbjct  181   LCRKLMTALMERLNVKE-IDETKESLLMGSKRINLNYYPRCPNPQLTLGVGRHSDVSSLT  239

Query  530   VLLQDHIGGLHVR----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSAN  363
              LLQD IGGL+VR    K   D WVHVPPV+G+LVIN+GDALQILSNGRYKS EH V A+
Sbjct  240   FLLQDEIGGLYVRVNEGKGEEDGWVHVPPVEGSLVINVGDALQILSNGRYKSVEHCVIAS  299

Query  362   GGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEF  183
             G  +RIS+PIFV P P   +GPLPEVLA GEKP YK  +YSDY++HFF KAHDGK+T+ F
Sbjct  300   GSKNRISIPIFVNPKPSDVIGPLPEVLATGEKPKYKNFLYSDYVKHFFRKAHDGKKTVAF  359

Query  182   AKI  174
             A+I
Sbjct  360   AEI  362



>ref|XP_009375631.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Pyrus x bretschneideri]
Length=360

 Score =   466 bits (1198),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 217/359 (60%), Positives = 280/359 (78%), Gaps = 8/359 (2%)
 Frame = -3

Query  1232  ALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISN  1053
              +S+   + DFV+N+G GVKGLS++G+K++P+QYIQP +ERI    I++ DSIP ID+SN
Sbjct  4     TISDISDITDFVINKGNGVKGLSELGLKSIPNQYIQPLEERIGT-MIMSQDSIPIIDMSN  62

Query  1052  WDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPS  873
             W+DP V  ++C AAE+ GFFQ++NHGVPVE+LE++K AT+RFF LP E K KYSK  SPS
Sbjct  63    WNDPKVVESICSAAEKLGFFQLVNHGVPVEVLENVKEATHRFFLLPAEAKSKYSKERSPS  122

Query  872   ENVRYGTSFSPESEKTLEWKDYLSLFYVSDD-EAAALWPPACRHEAMEYMTQCNAMIKNL  696
              NV+YGTSF+P++EK LEWKD+L L+   D+ EA+A WPP CR E +EYM +   + K L
Sbjct  123   NNVQYGTSFNPQAEKALEWKDFLGLYAYGDEHEASAFWPPVCRDEVLEYMKKSEILTKRL  182

Query  695   LEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQD  516
             +E+LM  LN++E +DK+KE L MGAKRI  NYYP CPNPELAVG GRHSDIST+T+LLQD
Sbjct  183   VELLMRRLNVKE-IDKAKEYLLMGAKRIQLNYYPICPNPELAVGNGRHSDISTLTILLQD  241

Query  515   HIGGLHVRKLNSDT-----WVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
              IGGL+VR+  +       W+HVPPV G+LVINIGDALQI+SNGRYKS EHRV+ +   +
Sbjct  242   DIGGLYVRRNGNGNDKDGGWIHVPPVKGSLVINIGDALQIISNGRYKSVEHRVAVSSSKN  301

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             R+S+PIFV P P   + PLPEVL  GEKP+YK +++SDY++HFF K H+GK TIEFAKI
Sbjct  302   RVSIPIFVFPRPSEMISPLPEVLESGEKPVYKSVLFSDYVKHFFAKPHNGKTTIEFAKI  360



>gb|KDP40923.1| hypothetical protein JCGZ_24922 [Jatropha curcas]
Length=362

 Score =   465 bits (1196),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 220/361 (61%), Positives = 284/361 (79%), Gaps = 10/361 (3%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPT  1068
             T+A +A +++  + DFV+N+G GVKGLSD+G+K+LP QYIQP +  I    I+ ++SIP 
Sbjct  4     TLADSA-TDNFDLNDFVINQGNGVKGLSDLGLKSLPRQYIQPQEALIN---IIPNESIPV  59

Query  1067  IDISNWD-DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
             ID+ NWD DP ++ +VC+AAE++GFFQ++NHGVP+E+LE +K AT+RFF LP   KRKYS
Sbjct  60    IDMLNWDTDPKIAESVCDAAEKFGFFQLVNHGVPLEVLEGVKDATHRFFGLPAAVKRKYS  119

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             K +S + NVR+GTSFSP+ EK LEWKDYLSLFYVS++EA+ALWPP C+ E +EYM +   
Sbjct  120   KEHSSTNNVRFGTSFSPDCEKALEWKDYLSLFYVSEEEASALWPPECKDECLEYMKRSEV  179

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             + K L+  LM  LN++E +D  KE L MG+KRIN NYYP+CPNP L +GVGRHSD+S +T
Sbjct  180   LCKKLMGALMERLNVKE-IDDKKESLLMGSKRINLNYYPRCPNPNLTIGVGRHSDVSALT  238

Query  530   VLLQDHIGGLHVR----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSAN  363
              LLQD IGGL+VR    K   D WVHVPP++G+LVIN+GDALQILSNGRYKS EH V A+
Sbjct  239   FLLQDEIGGLYVRVNEGKGEEDGWVHVPPIEGSLVINVGDALQILSNGRYKSIEHCVIAS  298

Query  362   GGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEF  183
             G  +RIS+PIFV P P   +GPLPEVLA GEKP YK ++YSDY++HFF KAHDGK+T++F
Sbjct  299   GSKNRISIPIFVNPKPSDVIGPLPEVLASGEKPKYKNILYSDYVKHFFRKAHDGKKTVDF  358

Query  182   A  180
             A
Sbjct  359   A  359



>gb|ADV77970.1| putative oxoglutarate dependent dioxygenase [Ruta graveolens]
Length=367

 Score =   458 bits (1179),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 210/349 (60%), Positives = 269/349 (77%), Gaps = 4/349 (1%)
 Frame = -3

Query  1217  ESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPA  1038
             + + +FV  +G GVKGLS++GIK LP Q+ QP +ER +   I+   SIP ID+S WD P 
Sbjct  17    DEISEFVTKKGHGVKGLSELGIKTLPKQFHQPLEERFSEKKILERASIPLIDMSKWDSPE  76

Query  1037  VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRY  858
             V +++C+AAE WGFFQI+NHGVP+E L+ +K AT+RFF LP EEK KYSK NSP  NVR+
Sbjct  77    VVKSICDAAEHWGFFQIVNHGVPLETLQRVKEATHRFFALPAEEKNKYSKENSPINNVRF  136

Query  857   GTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEML-M  681
             G+SF P  EK LEWKD+LS+FYVS++E    WPP CR E +EYM     +IK L+E+L +
Sbjct  137   GSSFVPHVEKALEWKDFLSMFYVSEEETNTYWPPICRDEMLEYMRSSEVLIKRLMEVLVV  196

Query  680   SGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGL  501
              GL +++ +D+ +EP+ +G++RIN NYYPKCPNPEL +GVGRHSDIST T+LLQD IGGL
Sbjct  197   KGLKVKQ-IDEIREPMLVGSRRINLNYYPKCPNPELTLGVGRHSDISTFTILLQDEIGGL  255

Query  500   HVRKLN--SDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFV  327
             HVRKL+   +TWVHV P+ G+L+INIGDALQI+SNGRYKS EH V ANG  DRISVP+FV
Sbjct  256   HVRKLDDTGNTWVHVTPISGSLIINIGDALQIMSNGRYKSIEHMVVANGTQDRISVPLFV  315

Query  326   TPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFA  180
              P P+  + P PEVLA GEKP+YK ++ SDY RHF+ K HDGK+T++FA
Sbjct  316   NPKPQAILCPFPEVLANGEKPVYKPVLCSDYSRHFYTKPHDGKKTVDFA  364



>gb|ADV77968.1| putative dioxoglutarate dependent dioxygenase [Ruta graveolens]
Length=369

 Score =   454 bits (1167),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 214/367 (58%), Positives = 271/367 (74%), Gaps = 7/367 (2%)
 Frame = -3

Query  1256  PRKTMAPAALSESES---VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVA  1086
             P K  +    + +ES   V DFV  +G GVKGLS+ GIK LP  + QP +ER +   I+ 
Sbjct  3     PTKDFSTTTTNGAESWDDVADFVTKKGHGVKGLSERGIKTLPKPFHQPLEERFSEKKILE  62

Query  1085  DDSIPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEE  906
               SIP ID+S WD P V +++C+AAE WGFFQI+NHGVP+E LE +K AT+RFF LP EE
Sbjct  63    RASIPLIDMSQWDSPEVVKSICDAAENWGFFQIVNHGVPLETLERVKEATHRFFGLPAEE  122

Query  905   KRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYM  726
             K  YSK NSP  NVR+G+SF P  EK LEWKD+LS+FYVS++E    WPP CR E +EYM
Sbjct  123   KNNYSKENSPINNVRFGSSFVPHVEKALEWKDFLSMFYVSEEETNTYWPPICRDEMLEYM  182

Query  725   TQCNAMIKNLLEML-MSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHS  549
                  +I+ L+E+L + GL +++ +D+ +EP+ +G++RIN NYYPKCPNPEL +GVGRHS
Sbjct  183   RSSEVLIQRLMEVLVVKGLKVKQ-IDEIREPMLVGSRRINLNYYPKCPNPELTLGVGRHS  241

Query  548   DISTITVLLQDHIGGLHVRKLN--SDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             DIST T+LLQD IGGLHVRKL+   +TWVHV P+ G+L+INIGDALQI+SNGRYKS EH 
Sbjct  242   DISTFTILLQDQIGGLHVRKLDDTGNTWVHVTPIAGSLIINIGDALQIMSNGRYKSIEHM  301

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V ANG  DRISVP+FV P P+  + P PEVLA GEKP+YK +  SDY RHF+ K HDGK+
Sbjct  302   VVANGTQDRISVPLFVNPKPQAILCPFPEVLANGEKPVYKPVFCSDYSRHFYTKPHDGKK  361

Query  194   TIEFAKI  174
             T++ A I
Sbjct  362   TVDVAMI  368



>ref|XP_006423466.1| hypothetical protein CICLE_v10029948mg [Citrus clementina]
 gb|ESR36706.1| hypothetical protein CICLE_v10029948mg [Citrus clementina]
Length=351

 Score =   451 bits (1161),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 210/358 (59%), Positives = 271/358 (76%), Gaps = 13/358 (4%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPT  1068
             T     ++ES  +VDFV+++G GVKGLS+ G+K+LP Q+ QP +ER +   I+ D S   
Sbjct  4     TNGSTVVTESWDIVDFVIHKGHGVKGLSEKGLKSLPKQFHQPLEERFSEKRIL-DQS---  59

Query  1067  IDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSK  888
                     P V++ +C+AAE WGFFQI+NHGV +E+LE +K AT+RFF LP EEKRKYSK
Sbjct  60    --------PEVAKFICDAAENWGFFQIVNHGVALEVLERVKEATHRFFALPAEEKRKYSK  111

Query  887   ANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAM  708
              NSP++NVRYG+SF+P  E+ LEWKD+LSLFYVS++E +A WP  C+ E +EYM      
Sbjct  112   ENSPTKNVRYGSSFAPHVERALEWKDFLSLFYVSEEETSAFWPLVCKDEMLEYMRSSEVF  171

Query  707   IKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITV  528
             IK L+ +L+ GLN++ R+D+ +EP+ +G++R+N NYYP CPNPEL VGVGRHSDIST T+
Sbjct  172   IKRLMHVLVKGLNVK-RIDEIREPMLLGSRRVNLNYYPMCPNPELTVGVGRHSDISTFTI  230

Query  527   LLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDR  348
             LLQD IGGLHVRK N   W+H  P+ G+L+INIGDALQI+SNGR KS EH V ANG  +R
Sbjct  231   LLQDDIGGLHVRKDNGTGWIHAAPISGSLIINIGDALQIMSNGRNKSIEHCVIANGSQNR  290

Query  347   ISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             ISVP+FV P PE  + P PEVLA GEKPLYK ++Y+DY RHF+ KAHDGK+TI+FAKI
Sbjct  291   ISVPLFVNPKPEAILCPFPEVLANGEKPLYKPVLYADYSRHFYTKAHDGKKTIDFAKI  348



>ref|XP_004228966.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Solanum lycopersicum]
Length=359

 Score =   451 bits (1159),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 204/351 (58%), Positives = 269/351 (77%), Gaps = 1/351 (0%)
 Frame = -3

Query  1226  SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWD  1047
             S SE V DFVVN+G  VKGL D+GIKALP QYIQP +ERI  + +  DDSIP I+ SNWD
Sbjct  10    SNSEEVFDFVVNKGYEVKGLCDIGIKALPKQYIQPLEERITTSIVRTDDSIPIIEASNWD  69

Query  1046  DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSEN  867
             DP V   + EAA+ WG +Q+INHGVP+E+L+++K +T+RFF LP  EK+KY+K NS S N
Sbjct  70    DPKVGYQIREAAQNWGLYQVINHGVPIEVLDNIKESTHRFFNLPTNEKKKYTKENSISSN  129

Query  866   VRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEM  687
             VRYGTSF+PE+E+TL W+DY SL Y+SDDEA + WP +CR EA++Y+  C+ +I+N+L++
Sbjct  130   VRYGTSFTPEAERTLGWRDYHSLVYISDDEATSFWPSSCREEALKYLKSCDTIIRNILKL  189

Query  686   LMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIG  507
             LM  LN+ + +D+ KE L MG K INF+YYPKCPN E ++GVGRH D+STIT+LLQD+IG
Sbjct  190   LMGVLNVRD-IDEEKEELLMGLKIINFDYYPKCPNSERSIGVGRHFDVSTITLLLQDYIG  248

Query  506   GLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFV  327
             GL V+K  ++ W+H+P V GALVINIGD LQI+ N +YKS EH V ANG ++R+SVPIF+
Sbjct  249   GLDVKKYETNVWIHIPLVKGALVINIGDTLQIMRNDKYKSVEHCVIANGSNNRVSVPIFL  308

Query  326   TPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P+    +GPL +VL   EKP+YK+++Y+DY   FF K HD K+ IE A I
Sbjct  309   HPNTTRVIGPLKKVLRNREKPIYKQILYADYTSIFFNKGHDEKDIIELAMI  359



>ref|XP_006445646.1| hypothetical protein CICLE_v10017914mg [Citrus clementina]
 gb|ESR58886.1| hypothetical protein CICLE_v10017914mg [Citrus clementina]
 gb|KDO63051.1| hypothetical protein CISIN_1g039524mg [Citrus sinensis]
Length=331

 Score =   449 bits (1155),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 260/329 (79%), Gaps = 1/329 (0%)
 Frame = -3

Query  1160  MGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRAVCEAAEEWGFFQIIN  981
             MG+K+LP Q+ QP +ER +   I+   SIP ID+SNW+ P V++++C+AAE WGFFQI+N
Sbjct  1     MGLKSLPKQFHQPLEERFSEKKILDQVSIPLIDMSNWESPEVAKSICDAAENWGFFQIVN  60

Query  980   HGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLS  801
             HGVP+E+LE +K AT+RFF LP EEKRKYSK NSP+  VR G+SF P  EK LEWKD+LS
Sbjct  61    HGVPLEVLERVKEATHRFFALPAEEKRKYSKENSPTNKVRLGSSFVPLVEKALEWKDFLS  120

Query  800   LFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGA  621
             LFY S++E +A WPP C+ E +EYM     +I+ L+ +L+ GLN++ R+D+ +EP+ +G+
Sbjct  121   LFYGSEEETSAFWPPVCKDETLEYMKSSEVLIRRLMHVLVKGLNVK-RIDEIREPMLLGS  179

Query  620   KRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSDTWVHVPPVDGAL  441
             +R+N NYYP CPNPEL VGVGRHSDIST T+LLQD IGGLHVRK + + W+HV P+ G+L
Sbjct  180   RRVNLNYYPMCPNPELTVGVGRHSDISTFTILLQDDIGGLHVRKDSGNDWIHVAPISGSL  239

Query  440   VINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPL  261
             +INIGDALQI+SNGRYKS EH V ANG  +RISVP+FV P PE  + P PEVLA GEKPL
Sbjct  240   IINIGDALQIMSNGRYKSIEHCVIANGSQNRISVPLFVNPKPEAILCPFPEVLANGEKPL  299

Query  260   YKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             YK ++ +DY RHF+ KAHDGK+TI+FAKI
Sbjct  300   YKPVLCADYSRHFYTKAHDGKKTIDFAKI  328



>gb|KDP40922.1| hypothetical protein JCGZ_24921 [Jatropha curcas]
Length=542

 Score =   456 bits (1173),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 215/343 (63%), Positives = 272/343 (79%), Gaps = 9/343 (3%)
 Frame = -3

Query  1187  GRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWD-DPAVSRAVCEAA  1011
             G GVKGLSD+G+K+LP QYIQP +  I    I+  +SIP ID+SNWD DP V+ ++C+AA
Sbjct  204   GNGVKGLSDLGLKSLPKQYIQPQEALIN---IIPHESIPVIDMSNWDSDPKVAESICDAA  260

Query  1010  EEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESE  831
             E++GFFQ++NHGVP+E+L+ +K AT+RFF LP E KR YSK  S + NVR+GTSFSP++E
Sbjct  261   EKYGFFQLVNHGVPLEVLDGVKDATHRFFGLPAEVKRNYSKELSSTNNVRFGTSFSPDAE  320

Query  830   KTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLD  651
             K LEWKDYLSLFYVS+DEA+ALWP AC+ E +EYM +   + K L+ +LM  LN++E +D
Sbjct  321   KALEWKDYLSLFYVSEDEASALWPSACKDECLEYMKRSEILCKKLMGVLMERLNVKE-ID  379

Query  650   KSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVR----KLN  483
             + KE L MG+KRIN NYYP+CPNP L +GVGRHSD+S +T LLQD IGGL+VR    K  
Sbjct  380   EKKESLLMGSKRINLNYYPRCPNPNLTIGVGRHSDVSALTFLLQDEIGGLYVRVNEGKGE  439

Query  482   SDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRV  303
              D WVHVPP++G+LVIN+GDALQILSNGRYKS EH V A+G  +RIS+PIFV P P   +
Sbjct  440   EDGWVHVPPIEGSLVINVGDALQILSNGRYKSIEHCVIASGSKNRISIPIFVNPKPSDVI  499

Query  302   GPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             GPLPEVLA GEKP YK ++YSDY++HFF KAHDGK+T+ FA+I
Sbjct  500   GPLPEVLASGEKPKYKNILYSDYVKHFFRKAHDGKKTVGFAEI  542


 Score =   251 bits (641),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 160/208 (77%), Gaps = 5/208 (2%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP   ++S  + DFV+N+G GVKGLSD+G+K+LP QYIQP +  I    I+  +SIP I
Sbjct  1     MAPTMSTDSFDLTDFVINKGNGVKGLSDLGLKSLPKQYIQPQEALIN---IIPHESIPVI  57

Query  1064  DISNWD-DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSK  888
             D+SNWD DP V+ ++C+AAE++GFFQ++NHGVP+E+L+ +K AT+RFF LP E KR YSK
Sbjct  58    DMSNWDSDPKVAESICDAAEKYGFFQLVNHGVPLEVLDGVKDATHRFFGLPAEVKRNYSK  117

Query  887   ANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAM  708
               S + NVR+GTSFSP++EK LEWKDYLSLFYVS+DEA+ALWP AC+ E +EYM +   +
Sbjct  118   ELSSTNNVRFGTSFSPDAEKALEWKDYLSLFYVSEDEASALWPSACKDECLEYMKRSEIL  177

Query  707   IKNLLEMLMSGLNIEERLDKSKEPLFMG  624
              K L+ +LM  LN++E +D+ KE L MG
Sbjct  178   CKKLMGVLMERLNVKE-IDEKKESLLMG  204



>gb|ADV77969.1| putative oxoglutarate dependent dioxygenase [Ruta graveolens]
Length=369

 Score =   443 bits (1139),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 262/351 (75%), Gaps = 4/351 (1%)
 Frame = -3

Query  1217  ESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPA  1038
             + V DFV  +G GVKGLS+ GIK LP  + QP +ER +   I+   SIP ID+S WD P 
Sbjct  18    DDVADFVTKKGHGVKGLSERGIKTLPKPFHQPLEERFSEKKILERASIPLIDMSEWDSPE  77

Query  1037  VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRY  858
             V +++C+AAE WGFFQI+NHGVP+E LE +K AT+RFF LP EEK KYSK NSP  NVR+
Sbjct  78    VVKSICDAAENWGFFQIVNHGVPLETLERVKEATHRFFGLPAEEKNKYSKENSPINNVRF  137

Query  857   GTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEML-M  681
             G+SF P  EK LEWKD+LS+FYVS +E    WPP C  + +EYM     +IK L+E+L +
Sbjct  138   GSSFVPHVEKALEWKDFLSMFYVSXEETNTYWPPICXDQMLEYMRSSEVLIKRLMEVLVV  197

Query  680   SGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGL  501
              GL +++ +D+ +EP+ +G++R+N NYYPKCPN EL +GVGRHSDIST T+LLQD I  L
Sbjct  198   KGLKVKQ-IDEIREPMLVGSRRVNLNYYPKCPNRELTLGVGRHSDISTFTILLQDQIEVL  256

Query  500   HVRKLN--SDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFV  327
             HVRKL+   +TWVHV P+ G+L+INIGDALQI+SNGRYKS EH V ANG  DRISVP+FV
Sbjct  257   HVRKLDDTGNTWVHVTPIAGSLIINIGDALQIMSNGRYKSIEHMVVANGTQDRISVPLFV  316

Query  326   TPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P P+  + P PEVLA GEKPLYK +  SDY RHF+ K HDGK+T++FA I
Sbjct  317   NPKPQAILCPFPEVLANGEKPLYKPVFCSDYSRHFYTKPHDGKKTVDFALI  367



>ref|XP_010552260.1| PREDICTED: LOW QUALITY PROTEIN: feruloyl CoA ortho-hydroxylase 
1 [Tarenaya hassleriana]
Length=355

 Score =   441 bits (1134),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 208/352 (59%), Positives = 275/352 (78%), Gaps = 5/352 (1%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW  1050
              S+   V DFVV +G GVKGLS+ GIK++P +YIQP +E++     +  +SIP ID+S+ 
Sbjct  9     FSDPSKVYDFVVIKGNGVKGLSETGIKSIPDEYIQPFEEQL-----INXESIPVIDMSDP  63

Query  1049  DDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSE  870
             D+  +  AV +AAE+WGFFQ++NHGVP+E+LE++KTAT RFF LPVEEKRK+ K  SPS+
Sbjct  64    DEKKIGEAVSDAAEKWGFFQVVNHGVPLEVLENVKTATSRFFGLPVEEKRKFLKEYSPSK  123

Query  869   NVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLE  690
             NVR  TSF+P+++K LEWKDYLSLF+VS+ EA+  WP  CRHEA+EYM +   +++ LLE
Sbjct  124   NVRLVTSFNPQADKALEWKDYLSLFFVSESEASQFWPQVCRHEALEYMNKSKNLVRKLLE  183

Query  689   MLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHI  510
             ML+  LN+ +  ++ +E LFMG+ R+N NYYP CP+P LAVGVG HSD+S+ T+LLQD  
Sbjct  184   MLLKKLNVRKLDEEERESLFMGSFRVNLNYYPICPDPSLAVGVGPHSDVSSFTILLQDET  243

Query  509   GGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIF  330
             GGLHVR L +  WVHV P+ G+LVINIGDA+QI+SNG YKS EHRV ANG  +RISVPIF
Sbjct  244   GGLHVRSLTTGNWVHVQPIKGSLVINIGDAMQIMSNGLYKSVEHRVLANGSKNRISVPIF  303

Query  329   VTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             V P P   + PLPE++A G++PLYK ++YSDY++HFF KAHDGK+T++FAKI
Sbjct  304   VNPKPSSVISPLPEMVARGQEPLYKNVLYSDYVKHFFKKAHDGKKTLDFAKI  355



>emb|CDP17662.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   437 bits (1125),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 200/339 (59%), Positives = 261/339 (77%), Gaps = 2/339 (1%)
 Frame = -3

Query  1187  GRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRAVCEAAE  1008
             G GVKGLSDM +K LP Q+IQPP+ER   + ++ ++SIP IDISNW+DP V+  VC+AAE
Sbjct  9     GYGVKGLSDMNLKTLPQQFIQPPEERFTEHTLILEESIPVIDISNWNDPKVADIVCDAAE  68

Query  1007  EWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESEK  828
             +WGFFQ INHG+P E+L+S+  AT+RFF+LP +EK KY+K NSP+ NV   TSF PE E 
Sbjct  69    KWGFFQTINHGIPAEILQSVMDATHRFFELPPKEKMKYNKKNSPTTNVFLRTSFVPEIET  128

Query  827   TLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLDK  648
              +EW D L+  YVSD+EA + WPP CR++ ++Y+  C  + K LL MLM  LN+ E +DK
Sbjct  129   AMEWHDKLTFLYVSDEEAQSFWPPICRNQVLDYIKPCELLAKRLLGMLMKRLNVTE-IDK  187

Query  647   SKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSDTWV  468
             SKE + MG+K++N NYYPKCP PEL +G+GRHSD+STI++L QD IGGL+VRKL +D+W+
Sbjct  188   SKESMLMGSKKVNLNYYPKCPEPELTIGIGRHSDLSTISILPQDVIGGLYVRKLENDSWM  247

Query  467   HVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGPLPE  288
             +V P+DGALVINIGDAL+I+SNGRY+S EH V+ N   +RIS P F  P+P   +GPL E
Sbjct  248   YVSPIDGALVINIGDALEIISNGRYRSIEHCVTVNKHHNRISAPFFAGPEPSAIIGPLEE  307

Query  287   VL-AGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             VL + GEKPLYK+++YSDY  HFF KAH GK+ I+FA I
Sbjct  308   VLESSGEKPLYKKVLYSDYPAHFFTKAHGGKDKIQFAII  346



>ref|XP_009764115.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Nicotiana sylvestris]
Length=357

 Score =   434 bits (1117),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 198/358 (55%), Positives = 269/358 (75%), Gaps = 2/358 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M+ A ++ S  ++DF+VN+G GVKGLS +G+K +P ++IQP +ER+    IV+ +SIP I
Sbjct  1     MSTAEVTNSSDLIDFLVNKGNGVKGLSQIGLKNVPEKFIQPQEERLNFTQIVSSESIPII  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D SN DDP V+ ++C+AAE+WGFFQIINHG+PVE+LE++  A ++FF+LPVEE+RKY K 
Sbjct  61    DFSNCDDPKVAESICDAAEKWGFFQIINHGIPVEVLENVLEAGHKFFELPVEERRKYLKE  120

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAA-LWPPACRHEAMEYMTQCNAM  708
             NSP+  V+  TSFSP +EK LEWKDYL   Y S+DE++  LWP   + + +EYM     +
Sbjct  121   NSPTHTVQLKTSFSPLAEKVLEWKDYLFHIYDSEDESSTMLWPAVSKDQVLEYMKWAKPV  180

Query  707   IKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITV  528
             I  LLE+L+ GLN+++ +D++ + + MG   +N  +YP CPNPEL  G GRH+D+S+IT+
Sbjct  181   IVKLLEVLLKGLNVKQ-IDEAMKSVVMGTLIVNLIHYPTCPNPELTAGAGRHADVSSITM  239

Query  527   LLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDR  348
             LLQD +GGL+VR+   D W+HVPPV GALVINIGD LQI+SN RYKS EHRV  N   +R
Sbjct  240   LLQDDVGGLYVREPKGDGWIHVPPVKGALVINIGDVLQIMSNDRYKSVEHRVIVNANRNR  299

Query  347   ISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +SVPIFV P P+   GPLP+VL  GEKPLYK+++YSDY  +FF K H+GK+ IEFAK+
Sbjct  300   VSVPIFVNPAPDAVFGPLPQVLENGEKPLYKQVIYSDYFNYFFSKGHEGKQAIEFAKL  357



>ref|XP_006446357.1| hypothetical protein CICLE_v10015758mg [Citrus clementina]
 gb|ESR59597.1| hypothetical protein CICLE_v10015758mg [Citrus clementina]
Length=355

 Score =   434 bits (1116),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 261/349 (75%), Gaps = 5/349 (1%)
 Frame = -3

Query  1217  ESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPA  1038
             + V DFVVN G G+ GL D GI+ +P +YI PP++R     +V+ DSI  ID+SNWDDP 
Sbjct  11    DDVTDFVVNRGNGITGLVDSGIQKVPERYILPPQQRFDLTKVVSQDSILIIDVSNWDDPE  70

Query  1037  VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRY  858
             V +++CEA+ +WGFFQIINHG+P+++LE++  A + FF LP E++ KY K  SPSE V  
Sbjct  71    VIKSICEASGKWGFFQIINHGIPLQVLENITDAAHSFFGLPNEQRSKYYKGASPSETVFL  130

Query  857   GTSFSPESEKTLEWKDYLSLFYV-SDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLM  681
              TSFSP++E  LEW+DYL+  Y+  +D+A+ALWPP C+ E +EYM +   +IKNLL++L+
Sbjct  131   ATSFSPQAEVALEWRDYLNFQYIPGNDQASALWPPVCKDEVLEYMKKAEIVIKNLLQVLL  190

Query  680   SGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGL  501
              GLN+++  D+  +   MG+ RIN NYYPKCPNP+L  GVG HSDISTITVLLQD IGGL
Sbjct  191   KGLNVKD-FDRDTQHTLMGSPRINLNYYPKCPNPQLTAGVGPHSDISTITVLLQDDIGGL  249

Query  500   HVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTP  321
             +VR +  DTW+HVPP+ GALVINIGD LQI+SN +YKS EHRV AN   +R+SVPIFV P
Sbjct  250   YVRGIEDDTWIHVPPIKGALVINIGDVLQIISNDKYKSIEHRVVANKIKNRVSVPIFVNP  309

Query  320   DPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P+   GPLPE    GE P+YK+LV+SDY   +F K HDGK+TI++A+I
Sbjct  310   APDAVFGPLPE---SGEIPIYKQLVFSDYFNFYFSKPHDGKKTIDYARI  355



>gb|KDO66421.1| hypothetical protein CISIN_1g018488mg [Citrus sinensis]
 gb|KDO66422.1| hypothetical protein CISIN_1g018488mg [Citrus sinensis]
Length=355

 Score =   433 bits (1114),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 199/349 (57%), Positives = 260/349 (74%), Gaps = 5/349 (1%)
 Frame = -3

Query  1217  ESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPA  1038
             + V DFVVN G G+ GL D GI+ +P +YI PP++R     +V+ DSI  ID+SNWDDP 
Sbjct  11    DDVTDFVVNRGNGITGLVDSGIQKVPERYILPPQQRFDLTKVVSQDSILIIDVSNWDDPE  70

Query  1037  VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRY  858
             V +++CEA+ +WGFFQIINHG+P+++LE++  A + FF LP E++ KY K  SPSE V  
Sbjct  71    VIKSICEASGKWGFFQIINHGIPLQVLENITDAAHSFFGLPNEQRSKYYKGASPSETVFL  130

Query  857   GTSFSPESEKTLEWKDYLSLFYV-SDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLM  681
              TSFSP++E  LEW+DYLS  Y+  +D+A+ALWPP C+ E +EYM +   +IKNLL++L+
Sbjct  131   ATSFSPQAEVALEWRDYLSFQYIPGNDQASALWPPVCKDEVLEYMKKAEIVIKNLLQVLL  190

Query  680   SGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGL  501
              GLN+++  D+  +   MG+ RI  NYYPKCPNPEL  GVG HSDISTITVLLQD IGGL
Sbjct  191   QGLNVKD-FDRDTQHTLMGSPRIYLNYYPKCPNPELTAGVGPHSDISTITVLLQDDIGGL  249

Query  500   HVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTP  321
             +VR +  DTW+HVPP+ GALVINIGD LQI+SN +YKS EHRV AN   +R+SVPIFV P
Sbjct  250   YVRGIEDDTWIHVPPIKGALVINIGDVLQIISNDKYKSIEHRVVANKIKNRVSVPIFVNP  309

Query  320   DPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P+   GPLPE    GE P+YK+LV+SDY   +F K HDGK+TI++A+I
Sbjct  310   APDAVFGPLPE---SGEIPIYKQLVFSDYFNFYFSKPHDGKKTIDYARI  355



>gb|KDP34560.1| hypothetical protein JCGZ_11110 [Jatropha curcas]
Length=358

 Score =   432 bits (1112),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 203/359 (57%), Positives = 271/359 (75%), Gaps = 3/359 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAI-VADDSIPT  1068
             M+P   S S +++DFVV++  G+KGL D G++++P QYIQP  ER+  + I ++ +SIP 
Sbjct  1     MSPTTASSSTNILDFVVHKANGLKGLVDTGLESIPHQYIQPQDERLNTSQILISQESIPI  60

Query  1067  IDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSK  888
             ID+SNWDDP V+ ++ +AA +WGFFQIINHG+P+E++++LK + + FF LP EE++KY K
Sbjct  61    IDVSNWDDPQVAESISQAASKWGFFQIINHGIPLEIVDNLKDSGHGFFSLPNEERKKYWK  120

Query  887   ANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAA-ALWPPACRHEAMEYMTQCNA  711
              NS ++ V   TSFSP +EK LEWKDYLS  Y+  DE + +LWPP C+ + ++YM +   
Sbjct  121   GNSSTDTVFLATSFSPLTEKVLEWKDYLSFHYIPGDEKSPSLWPPICKDQVLDYMKRAEL  180

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             +IK LLE+L+  LN++E +DK +E   MG+ RIN NYYP CPNPELA G+GRHSD+S+IT
Sbjct  181   VIKRLLELLLKKLNVKE-IDKEREYALMGSLRINMNYYPHCPNPELAAGIGRHSDVSSIT  239

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             VLLQD IGGL+VR +  ++W+H+PPV GALVINIGD LQI+SN RYKS EHRV  NG  +
Sbjct  240   VLLQDDIGGLYVRGIEENSWIHIPPVTGALVINIGDVLQIMSNDRYKSIEHRVIVNGSKN  299

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             R+SVPIFV P P   +GPLPEVL  GE P YK ++YSDY  +FF K HDGK TI+FAKI
Sbjct  300   RVSVPIFVNPGPHALIGPLPEVLGSGEAPKYKSVLYSDYFTYFFSKGHDGKNTIDFAKI  358



>ref|XP_006470506.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Citrus sinensis]
Length=355

 Score =   431 bits (1109),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 199/349 (57%), Positives = 259/349 (74%), Gaps = 5/349 (1%)
 Frame = -3

Query  1217  ESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPA  1038
             + V DFVVN G GV GL D GI+ +P +YI PP++R     +V+ D I  ID+SNWDDP 
Sbjct  11    DDVTDFVVNRGNGVTGLVDSGIQKVPERYILPPQQRFDLTKVVSQDPILIIDVSNWDDPE  70

Query  1037  VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRY  858
             V +++CEA+ +WGFFQIINHG+P+++LE++  A + FF LP E++ KY K  SPSE V  
Sbjct  71    VIKSICEASGKWGFFQIINHGIPLQVLENITDAAHSFFGLPNEQRSKYYKGASPSETVFL  130

Query  857   GTSFSPESEKTLEWKDYLSLFYV-SDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLM  681
              TSFSP++E  LEW+DYLS  Y+  +D+A+ALWPP C+ E +EYM +   +IKNLL++L+
Sbjct  131   ATSFSPQAEVALEWRDYLSFQYIPGNDQASALWPPVCKDEVLEYMKKAEIVIKNLLQVLL  190

Query  680   SGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGL  501
              GLN+++  D+  +   MG+ RI  NYYPKCPNPEL  GVG HSDISTITVLLQD IGGL
Sbjct  191   QGLNVKD-FDRDTQHTLMGSPRIYLNYYPKCPNPELTAGVGPHSDISTITVLLQDDIGGL  249

Query  500   HVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTP  321
             +VR +  DTW+HVPP+ GALVINIGD LQI+SN +YKS EHRV AN   +R+SVPIFV P
Sbjct  250   YVRGIEDDTWIHVPPIKGALVINIGDVLQIISNDKYKSIEHRVVANKIKNRVSVPIFVNP  309

Query  320   DPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P+   GPLPE    GE P+YK+LV+SDY   +F K HDGK+TI++A+I
Sbjct  310   APDAVFGPLPE---SGEIPIYKQLVFSDYFNFYFSKPHDGKKTIDYARI  355



>ref|XP_007015337.1| Leucoanthocyanidin dioxygenase, putative [Theobroma cacao]
 gb|EOY32956.1| Leucoanthocyanidin dioxygenase, putative [Theobroma cacao]
Length=356

 Score =   429 bits (1104),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 197/356 (55%), Positives = 267/356 (75%), Gaps = 2/356 (1%)
 Frame = -3

Query  1238  PAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDI  1059
             P    +S+ + DFVVN+G G+KGL D GI+++P  YI P +ER+ A+ +V ++ IP ID+
Sbjct  2     PPRNPDSDKIFDFVVNKGNGIKGLVDTGIESVPELYILPIEERLEASKVVPEEPIPVIDV  61

Query  1058  SNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             S+W DP V+ ++C+AA +WGFFQIINHGVP+ +L +++ A + FF LP EE+ KY   NS
Sbjct  62    SDWGDPQVTESICQAASKWGFFQIINHGVPLAVLYAVREAAHGFFGLPNEERNKYWIGNS  121

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVS-DDEAAALWPPACRHEAMEYMTQCNAMIK  702
             P++ V   TSF P++E  LEWKDYL+  YV+ D + +ALWPP C+ + +EYM +   +I+
Sbjct  122   PTDTVTLKTSFVPQAEGALEWKDYLTFRYVAGDQDPSALWPPVCKDQVVEYMKRAEPVIR  181

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              LLE+L+ GL ++E +DK++E   M +  +N NYYP+CPNP+L  GV  HSDISTITVLL
Sbjct  182   KLLEVLLKGLKVKE-IDKAREYTLMASPIVNLNYYPRCPNPDLTAGVRPHSDISTITVLL  240

Query  521   QDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRIS  342
             QD  GGL+VR  + D W+HVPPVDGALVINIGD LQI+SN RYKS EHRV ANG  +R+S
Sbjct  241   QDDNGGLYVRATDDDGWIHVPPVDGALVINIGDILQIMSNDRYKSIEHRVVANGSKNRVS  300

Query  341   VPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             VPIFV P P+   GPLPEVL  GE+PLYKE+++SDY ++FF K H+GK+T++FAKI
Sbjct  301   VPIFVNPGPDAVFGPLPEVLESGERPLYKEVLFSDYFKYFFSKKHEGKKTMDFAKI  356



>emb|CDP05588.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   423 bits (1088),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 194/357 (54%), Positives = 262/357 (73%), Gaps = 1/357 (0%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M+ ++L +   + DFVV +G GVKGLS++ +K +P QYIQPP+ER+  N +V  +SIP I
Sbjct  1     MSSSSLFDPNDLTDFVVKQGNGVKGLSEIDLKTVPRQYIQPPEERLDKNQVVDGESIPVI  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D+SNWDDP V  ++CEAA +WGFFQI+NHG+P+E+L+++K A ++FF+LP E++RKY K 
Sbjct  61    DVSNWDDPKVGASICEAASKWGFFQIVNHGIPLEVLDNVKEAAHKFFELPTEDRRKYLKE  120

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             NSP+  V+  TS SP  EK LEWKD L  FYV  DE+  LWPP  + + +E++     +I
Sbjct  121   NSPTPTVQLSTSHSPSVEKVLEWKDVLIHFYVPGDESTNLWPPVSKDQVLEHIKWAKPVI  180

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             + L+E+L+ GLN++E  D+ KE L  GA  ++ N+Y   PNPEL+ GVG HSDIS+ITVL
Sbjct  181   RKLMEVLLKGLNVKE-FDEEKESLLTGACTLSLNHYSISPNPELSYGVGPHSDISSITVL  239

Query  524   LQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             LQD +GGL+VR   +  W+HV P+ GALV+NIGD LQI SN RYKS EH V  N   +R+
Sbjct  240   LQDDVGGLYVRATRAGQWIHVTPIQGALVVNIGDTLQIASNDRYKSIEHCVIPNAAENRV  299

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             SVPIF +P     VGPLPEVL  GEKP+YK++ +SDY++HF+ K HDGK+TIEFAKI
Sbjct  300   SVPIFASPKAGGIVGPLPEVLKTGEKPIYKDVPWSDYMKHFYSKGHDGKKTIEFAKI  356



>gb|KHG00946.1| hypothetical protein F383_06437 [Gossypium arboreum]
 gb|KHG25965.1| hypothetical protein F383_10223 [Gossypium arboreum]
Length=356

 Score =   420 bits (1080),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 259/351 (74%), Gaps = 4/351 (1%)
 Frame = -3

Query  1220  SESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDP  1041
             SE ++DFVVN+G G+KGL D GI+ +P  YI P +ER+  N I+  DSIP ID+SNWDDP
Sbjct  8     SEKILDFVVNKGNGIKGLVDTGIETVPDLYILPIEERLLPNNILTYDSIPVIDVSNWDDP  67

Query  1040  AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVR  861
              V  ++ +AA +WGFFQIINHGVP+ +L+++K A +RFF LP EE+ KY   NSP++ V 
Sbjct  68    KVKESISDAAGKWGFFQIINHGVPLHVLDAVKEAAHRFFGLPYEERNKYWAGNSPTDTVT  127

Query  860   YGTSFSPESEKTLEWKDYLSLFYVS--DDEAAALWPPACRHEAMEYMTQCNAMIKNLLEM  687
               TSF P++E  LEWKDYLS F  S  D E+  LWPP CR E ++Y+    ++I+ LLE+
Sbjct  128   LKTSFVPQAEAALEWKDYLS-FRCSPRDLESFPLWPPVCRDEVVDYVESAKSVIRKLLEV  186

Query  686   LMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIG  507
             L+ GL +++ +DK++E   MG+  +N  YYP CPNP+   GV  HSDIS +TVLLQD  G
Sbjct  187   LLEGLKVKQ-IDKAREYTLMGSPIVNLMYYPHCPNPDFTAGVRPHSDISALTVLLQDDNG  245

Query  506   GLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFV  327
             GL+VR   +D+W+HV P++GALVINIGD LQI+SN RYKS EHRV ANG  DR+SVPIFV
Sbjct  246   GLYVRATQNDSWIHVLPINGALVINIGDILQIMSNDRYKSIEHRVVANGSKDRVSVPIFV  305

Query  326   TPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P P+    PLPEVL  GE+PLYKE+V+SDY ++FF K HDGK+T++FA+I
Sbjct  306   NPGPDAVFSPLPEVLESGEQPLYKEVVFSDYFKYFFSKKHDGKKTMDFARI  356



>ref|XP_011090260.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Sesamum indicum]
Length=356

 Score =   419 bits (1076),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 260/354 (73%), Gaps = 4/354 (1%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW  1050
             LSE ++++DF++N+G GVKGLS + +K +P ++IQPP+ER+    I   +S+P ID+S W
Sbjct  5     LSEPDNLIDFMLNKGNGVKGLSQINLKQIPDRFIQPPEERLDHIQIATQESVPVIDVSRW  64

Query  1049  DDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSE  870
             DDP ++ ++CEAA +WGFFQIINHG+P E+LE++K A + FF+LPVEE+R+Y K NSP+ 
Sbjct  65    DDPGIAESICEAAAKWGFFQIINHGIPDEVLENVKRAAHDFFELPVEERRRYLKENSPTH  124

Query  869   NVRYGTSFSPESEKTLEWKDYLSLFYV--SDDEAAALWPPACRHEAMEYMTQCNAMIKNL  696
              V   TSFSP +EK LEWKDYL + Y    ++E +  WPP  R + ++Y+     +I+ L
Sbjct  125   TVMLKTSFSPLAEKILEWKDYL-MHYCDGQENEHSKFWPPLSRDQVLDYVNWIKPIIRKL  183

Query  695   LEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQD  516
             L +L++G+ +E+ +DK KE   MG+  +   YYPKCPNP +A G GRHSD+S+IT+LLQD
Sbjct  184   LTVLLNGIKVEQ-IDKVKESALMGSPVVTLLYYPKCPNPNVAAGAGRHSDVSSITILLQD  242

Query  515   HIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVP  336
              +GGL+VR    D W+H+ P  GALV+NIGD LQI+SN RYKS EHRV  NG  +R+SVP
Sbjct  243   DVGGLYVRATEGDQWIHIAPTKGALVVNIGDVLQIMSNDRYKSIEHRVFVNGSKNRVSVP  302

Query  335   IFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +FV P  +  +GPLPEVL  GEKP+YK +V+SDY  +FF K HDGK ++++AKI
Sbjct  303   VFVNPSSDAIIGPLPEVLKAGEKPIYKHVVFSDYFNYFFSKGHDGKRSLDYAKI  356



>ref|XP_010673493.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=356

 Score =   418 bits (1075),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 264/350 (75%), Gaps = 4/350 (1%)
 Frame = -3

Query  1214  SVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADD-SIPTIDISNWDDPA  1038
             +++++++  G GVKGLS+  +  LP QYIQP  ER     I+ +  SIP ID+S W+DP+
Sbjct  8     NLIEYLMKTGHGVKGLSETEMGELPEQYIQPESERPGNMKIMEESCSIPIIDVSKWEDPS  67

Query  1037  VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRY  858
             V  +VC+AA++WGFFQIINHGVP+E+LE++K AT  FF+L  EEK++Y K NSPS +VR 
Sbjct  68    VVTSVCDAAQKWGFFQIINHGVPLEVLENVKQATLMFFRLTPEEKKRYLKENSPSNHVRL  127

Query  857   GTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN-AMIKNLLEMLM  681
              TSF P++E +LEWKDYLSLFYVS+ EA ++WP  CR + ++Y+ +C   +IK L ++LM
Sbjct  128   STSFIPDAENSLEWKDYLSLFYVSEHEALSIWPTVCRDQLLDYIRKCQQVLIKPLAQILM  187

Query  680   SGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGL  501
              GL+I + +++ +  L  G+KRIN NYYPKC  PEL VGVGRHSD+ST T+LLQD +GGL
Sbjct  188   KGLHITD-MNEKRWSLLTGSKRINLNYYPKCSQPELTVGVGRHSDVSTFTILLQDDVGGL  246

Query  500   HVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTP  321
             +VR  + + WVHVPP+ GALVINIGDALQI+SNG+YKS EHRV AN   DRIS+P+FV P
Sbjct  247   YVRAPDGERWVHVPPIPGALVINIGDALQIMSNGKYKSIEHRVIANESKDRISIPLFVNP  306

Query  320   DPECRVGPLPEVL-AGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P   +GP  EVL   GEKP YK+++YSDY   F+ K HDGK+T++FAKI
Sbjct  307   KPTDLIGPFEEVLEESGEKPKYKKVLYSDYTLCFYRKPHDGKDTLQFAKI  356



>ref|XP_006340349.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Solanum tuberosum]
Length=357

 Score =   412 bits (1059),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 195/358 (54%), Positives = 265/358 (74%), Gaps = 2/358 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M+ A +SE+  ++DF+VN+G GVKGLS MG++ +P ++IQP +ER+    I++ +SIP I
Sbjct  1     MSIAEVSEASDLIDFLVNKGNGVKGLSQMGLEIVPQKFIQPHEERLDFTQILSSESIPII  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D SN+DDP V+ ++C+AAE WGFFQI+NHG+P+E+LE++  A ++FF+L VEE+RKY K 
Sbjct  61    DFSNFDDPKVAESICDAAENWGFFQIVNHGIPIEVLENVIEAGHKFFELSVEERRKYLKE  120

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFY-VSDDEAAALWPPACRHEAMEYMTQCNAM  708
             NSP+  V+  TSFSP +EK LEWKDYL   Y   DDE++ LWP   + + +EYM     +
Sbjct  121   NSPTPTVQLKTSFSPLAEKVLEWKDYLFHIYDCDDDESSNLWPAVSKDQVLEYMKWAKPI  180

Query  707   IKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITV  528
             I  LLE+L+  LN++ ++D+S + + MG   +N  +YP CP+PEL  G GRH+D+S+IT+
Sbjct  181   IVKLLEVLLEKLNVK-KIDESMKSVVMGTLIVNLIHYPMCPSPELTAGAGRHADVSSITM  239

Query  527   LLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDR  348
             LLQD +GGL+VR    D W+HVPPV GALVINIGD LQI+SN RYKS EHRV  N   +R
Sbjct  240   LLQDDVGGLYVRDPKGDGWIHVPPVKGALVINIGDVLQIMSNDRYKSVEHRVIVNASRNR  299

Query  347   ISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +SVPIFV P P+   GPL +VL  GEKPLYK +VYSDY  +FF K H+GK+TIEFAK+
Sbjct  300   VSVPIFVNPAPDAVFGPLTQVLQNGEKPLYKHVVYSDYFNYFFSKGHEGKQTIEFAKL  357



>ref|XP_004251238.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Solanum lycopersicum]
Length=359

 Score =   407 bits (1046),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 192/360 (53%), Positives = 263/360 (73%), Gaps = 4/360 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M+ A +SE+  ++DF+VN+G GVKGLS MG++ +P ++IQP +ER+    I + +SIP +
Sbjct  1     MSIAEVSEASDLIDFLVNKGNGVKGLSQMGLQIVPQKFIQPHEERLDFTQITSSESIPIL  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D SN+DDP V+ ++C+AAE+WGFFQI+NHG+P+E+LE++  A ++FF L V+E+RKY K 
Sbjct  61    DFSNFDDPKVAESICDAAEKWGFFQIVNHGIPIEVLENVIEAGHKFFGLSVDERRKYLKE  120

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYV---SDDEAAALWPPACRHEAMEYMTQCN  714
             NSP+  V   TSFSP +EK LEWKDYL   Y     DDE++ LWP   + + +EYM    
Sbjct  121   NSPTHTVELKTSFSPFAEKVLEWKDYLFHIYDCGDDDDESSKLWPAVSKDQVLEYMKWAK  180

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              +I  LL++L+  LN+++ +D+  + + MG   +N  +YP CPNPEL  G GRH+D+S+I
Sbjct  181   PIIVKLLKVLLEKLNVKQ-IDEPMKSVVMGTLIVNLIHYPVCPNPELTAGAGRHADVSSI  239

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             T+LLQD +GGL+VR+   D W+HVPPV GALVINIGD LQI+SN RYKS EHRV  N   
Sbjct  240   TMLLQDDVGGLYVREPKGDGWIHVPPVKGALVINIGDVLQIMSNDRYKSVEHRVFVNASR  299

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +R+SVPIFV P P+   GPL +VL  GEKPLYK +VYSDY  +FF K H+GK+TIEFAK+
Sbjct  300   NRVSVPIFVNPAPDAVFGPLTQVLENGEKPLYKHVVYSDYFNYFFSKGHEGKQTIEFAKL  359



>emb|CDP09714.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   405 bits (1042),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/357 (55%), Positives = 261/357 (73%), Gaps = 2/357 (1%)
 Frame = -3

Query  1244  MAPAALS-ESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPT  1068
             M+ A++  E   ++DF VN+G GVKGLS++GIK +P +YI PP++R+  N I  D+SI  
Sbjct  1     MSAASVEFELTDLIDFAVNQGNGVKGLSNLGIKTIPQKYILPPEDRLNQNQIAQDESIAV  60

Query  1067  IDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSK  888
             ID+SNWDDP ++ ++CEAA + G FQIINHG+P+E+LE++K A ++FF+LP EE+RKY K
Sbjct  61    IDVSNWDDPKIAASICEAAAKRGCFQIINHGIPLEVLENVKEARHKFFELPDEERRKYLK  120

Query  887   ANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAM  708
              NSP+  V+  TSFSP +EK LEWKDYL+  Y+ DDE++ LWP   + + +EY+     +
Sbjct  121   ENSPTPTVQLKTSFSPLAEKVLEWKDYLTHLYIPDDESSKLWPSVSKDQVLEYIKWAKPI  180

Query  707   IKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITV  528
             I+ LLE+L+ GLN+ +++D++ E   MG+  +N  YYP CPNPELA G GRHSDIS IT+
Sbjct  181   IRKLLELLLKGLNV-KKIDETIESQLMGSLYVNLVYYPVCPNPELASGAGRHSDISAITI  239

Query  527   LLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDR  348
             LLQD +GGL V+   +D W+HV PV GALVINIGD LQI+SN RYKS EH+V+ NG  +R
Sbjct  240   LLQDDVGGLFVQGTKADQWIHVTPVKGALVINIGDVLQIVSNDRYKSVEHQVTVNGRRNR  299

Query  347   ISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             +SVPIFV P  +  VGP PE L  GEKP+YK  VYSDY  +FF K    K+TIE AK
Sbjct  300   VSVPIFVDPAADTVVGPFPEALESGEKPIYKHFVYSDYFNYFFSKGLGRKQTIELAK  356



>gb|AFK44895.1| unknown [Medicago truncatula]
Length=354

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 199/356 (56%), Positives = 262/356 (74%), Gaps = 6/356 (2%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDS----IPTID  1062
             +S   +++DF+VN+  GVKGL+D+ +  +P QYIQP + R+ +  I+  DS    IP ID
Sbjct  1     MSTPNNLIDFLVNQANGVKGLADLNLPNIPHQYIQPIQARLDSCKIIPHDSEEQSIPIID  60

Query  1061  ISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKAN  882
              +NWDDP V  ++  AA + GFFQI+NHG+P+ +L+ LK + ++FF+LPVEEK+   K N
Sbjct  61    FTNWDDPDVQDSIFSAATKLGFFQIVNHGIPINVLDDLKASVHKFFELPVEEKKSV-KEN  119

Query  881   SPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIK  702
             SP E VR  TSFSP +E  LEWKDYL L Y S+++  A WP  C+++A+EYM   +A I+
Sbjct  120   SPPEVVRLATSFSPHAESVLEWKDYLQLVYTSEEKIHAYWPVVCKNQALEYMKYADAFIR  179

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              LL++L+  LN++E LDK +E   MGA  + FNYYP CP PEL  GVG HSDIS+ITVLL
Sbjct  180   KLLKVLLKKLNVKE-LDKEREYALMGAMILGFNYYPACPEPELVSGVGPHSDISSITVLL  238

Query  521   QDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRIS  342
             QD IGGL+VR  + D+W++VPPV+GALVINIGD LQI+SNGRYKS EHRV  +G   RIS
Sbjct  239   QDDIGGLYVRGKDGDSWINVPPVNGALVINIGDVLQIMSNGRYKSIEHRVVVDGNKTRIS  298

Query  341   VPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +PIFV P P+  +G LPEVL  GE+P YK++V+SDY  +FF KAHDGK+TIEFAKI
Sbjct  299   MPIFVNPAPDAVIGTLPEVLENGEEPHYKQVVFSDYFNYFFSKAHDGKKTIEFAKI  354



>ref|NP_001240180.1| 1-aminocyclopropane-1-carboxylate oxidase homolog 6-like [Glycine 
max]
 gb|ACU18616.1| unknown [Glycine max]
 gb|AHY03267.1| putative Fe(II)- and 2-oxoglutaratedependent dioxygenase [Glycine 
max]
 gb|KHN45182.1| 1-aminocyclopropane-1-carboxylate oxidase like 6 [Glycine soja]
Length=351

 Score =   404 bits (1039),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 260/351 (74%), Gaps = 2/351 (1%)
 Frame = -3

Query  1226  SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWD  1047
             S   +++DF+VN+  GVKGL+D+ + ++P QYIQP + R+    IV   SIP ID + W+
Sbjct  3     STPTNLIDFLVNQANGVKGLADLNLASVPHQYIQPLQARLDHTKIVTQKSIPIIDFTKWE  62

Query  1046  DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSEN  867
             DP V  ++ +AA +WGFFQI+NHG+P E+L+ LK A +RFF+LP EEK+   K NSP E 
Sbjct  63    DPDVQDSIFDAATKWGFFQIVNHGIPSEVLDDLKDAVHRFFELPAEEKQCL-KDNSPPEV  121

Query  866   VRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEM  687
             VR  +SFSP +E  LEWKDYL L Y S+++  A WPP C+ +A+EYM    A+I+ LL++
Sbjct  122   VRLASSFSPYAESVLEWKDYLQLVYASEEKIHAYWPPICKDQALEYMKHAEALIRKLLKV  181

Query  686   LMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIG  507
             L+  LN++E LDK++E   MGA  + FNYYP CP+PE+  GVG HSD+S+ITVLLQD IG
Sbjct  182   LLKKLNVKE-LDKAREHTLMGAMILGFNYYPACPDPEVVAGVGPHSDVSSITVLLQDDIG  240

Query  506   GLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFV  327
             GL+VR  + D+W++VPPV+GALVINIGD LQI+SN R KS EHRV AN    RIS+PIFV
Sbjct  241   GLYVRGSDGDSWIYVPPVEGALVINIGDVLQIMSNERCKSIEHRVVANRSKTRISIPIFV  300

Query  326   TPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P P+  +GPL EVL  G++P YK+L+YSDY ++FF KAHDGK+TIEFA I
Sbjct  301   NPAPDAVIGPLSEVLDDGDEPKYKQLLYSDYFKYFFSKAHDGKKTIEFAMI  351



>gb|KEH33527.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=354

 Score =   404 bits (1039),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 199/356 (56%), Positives = 260/356 (73%), Gaps = 6/356 (2%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDS----IPTID  1062
             +S   +++DF+VN+  GVKGL+D+ +   P QYIQP + R+ +  I+  DS    IP ID
Sbjct  1     MSTPNNLIDFLVNQANGVKGLADLNLPIFPHQYIQPIQARLDSCKIIPHDSEEQSIPIID  60

Query  1061  ISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKAN  882
              +NWDDP V  ++  AA   GFFQI+NHG+P+ +L+ LK + ++FF+LPVEEK+   K N
Sbjct  61    FTNWDDPDVQDSIFSAATNLGFFQIVNHGIPINVLDDLKASVHKFFELPVEEKKSV-KEN  119

Query  881   SPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIK  702
             SP E VR  TSFSP +E  LEWKDYL L Y S+++  A WP  C+++A+EYM   +A I+
Sbjct  120   SPPEVVRLATSFSPHAESVLEWKDYLQLVYTSEEKIHAYWPVVCKNQALEYMKYADAFIR  179

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              LL++L+  LN++E LDK +E   MGA  + FNYYP CP PEL  GVG HSDIS+ITVLL
Sbjct  180   KLLKVLLKKLNVKE-LDKEREYALMGAMILGFNYYPACPEPELVSGVGPHSDISSITVLL  238

Query  521   QDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRIS  342
             QD IGGL+VR  + D+W++VPPV+GALVINIGD LQI+SNGRYKS EHRV  +G   RIS
Sbjct  239   QDDIGGLYVRGKDGDSWINVPPVNGALVINIGDVLQIMSNGRYKSIEHRVVVDGNKTRIS  298

Query  341   VPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +PIFV P P+  +G LPEVL  GE+P YK++V+SDY  +FF KAHDGK+TIEFAKI
Sbjct  299   MPIFVNPAPDAVIGTLPEVLENGEEPHYKQVVFSDYFNYFFSKAHDGKKTIEFAKI  354



>ref|XP_003599720.1| Flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=353

 Score =   402 bits (1032),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 196/356 (55%), Positives = 261/356 (73%), Gaps = 7/356 (2%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDS----IPTID  1062
             +S   +++DF+VN+  GVKGL+++ +  +P QYIQP + R+ +  I+  DS    IP ID
Sbjct  1     MSTPINLIDFLVNQANGVKGLAELNLPTVPHQYIQPIQARLDSCKIIPHDSEEQSIPIID  60

Query  1061  ISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKAN  882
              +NWDDP V  ++  AA + GFFQI+NHG+P+ +L+ LK + ++FF+LPVEEK+  S  +
Sbjct  61    FTNWDDPDVQDSIFSAATKLGFFQIVNHGIPINVLDDLKASVHKFFELPVEEKK--SVKD  118

Query  881   SPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIK  702
             SP E VR  TSFSP +E  LEWKDYL L Y S+++  A WP  C+++A+EYM   +A I+
Sbjct  119   SPPEVVRLSTSFSPLAESVLEWKDYLRLVYTSEEKIHAYWPAVCKNQALEYMKYADAFIR  178

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              LL++L+  LN+ E LDK +E   MGA  + FNYYP CP PEL  GVG HSDIS+ITVLL
Sbjct  179   KLLQVLLKKLNVNE-LDKEREHALMGAMILGFNYYPACPEPELVSGVGPHSDISSITVLL  237

Query  521   QDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRIS  342
             QD IGGL+VR  + D+W++VPPV+GALVINIGD LQI+SNGRYKS EHRV  +G   RIS
Sbjct  238   QDDIGGLYVRGKDGDSWINVPPVNGALVINIGDVLQIMSNGRYKSIEHRVVVDGNKTRIS  297

Query  341   VPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +PIFV P P+  +G LPEVL  GE+P YK++V+S+Y  +FF KAHDGK+TIEFAKI
Sbjct  298   MPIFVNPAPDAVIGTLPEVLENGEEPHYKQVVFSEYFNYFFSKAHDGKKTIEFAKI  353



>ref|XP_007146231.1| hypothetical protein PHAVU_006G023200g [Phaseolus vulgaris]
 gb|ESW18225.1| hypothetical protein PHAVU_006G023200g [Phaseolus vulgaris]
Length=352

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/352 (56%), Positives = 259/352 (74%), Gaps = 3/352 (1%)
 Frame = -3

Query  1226  SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWD  1047
             S + ++  F+VN+  GVKGL+D+ +  +P QYIQP + R+    IV  +SIP ID +NW+
Sbjct  3     STTSNLTHFLVNQANGVKGLADLNLPTVPPQYIQPLQARLDHTKIVPRESIPIIDFTNWE  62

Query  1046  DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSEN  867
             DP V   + EAA EWGFFQIINHG+P ++++ LK + +RFF+LP +EK+   K NSP+E 
Sbjct  63    DPHVQNFIFEAAVEWGFFQIINHGIPFKVIDDLKASVHRFFELPAQEKKSI-KENSPTEV  121

Query  866   VRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEM  687
             VR  TSFSP +E  LEWKDYL L Y S+++  A WP  C+ +A+EYM  C  +++ LL++
Sbjct  122   VRLATSFSPHAELVLEWKDYLQLVYASEEKIHAHWPAICKDQAVEYMKYCEVLVRKLLKV  181

Query  686   LMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIG  507
             L+  +N+EE LDK++E   MGA  + FNYYP CP PE+  GV  HSDIS+ITVLLQD IG
Sbjct  182   LLKKVNVEE-LDKAREDTLMGAMILGFNYYPACPEPEVVSGVAPHSDISSITVLLQDDIG  240

Query  506   GLHVRKLNS-DTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIF  330
             GL+VR  +  D+W++VPPV+GALVINIGD LQI+SN RYKS EHRV AN    RIS+PIF
Sbjct  241   GLYVRGSDGGDSWIYVPPVEGALVINIGDVLQIMSNERYKSIEHRVVANKRKTRISIPIF  300

Query  329   VTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             V P P+  +GPLPEVL  G+KP YK+L+YSDY ++FF KAHDGK+TIEFA I
Sbjct  301   VNPAPDAVIGPLPEVLENGDKPKYKQLLYSDYFKYFFSKAHDGKKTIEFAMI  352



>ref|XP_011010706.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like, partial [Populus 
euphratica]
Length=278

 Score =   396 bits (1018),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 179/277 (65%), Positives = 228/277 (82%), Gaps = 2/277 (1%)
 Frame = -3

Query  1004  WGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESEKT  825
             WGFFQIINHGVPV +LE++K +T+RFF+LP EEKRKY K  SPS NVR+GTSFSPE+E+ 
Sbjct  2     WGFFQIINHGVPVHVLENVKESTHRFFRLPAEEKRKYLKELSPSNNVRFGTSFSPEAERA  61

Query  824   LEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKS  645
             LEWKDYLSLFYVS+DEA+ALWP  C+ + ++YM +   +I+ LL++LM  L + E +D+ 
Sbjct  62    LEWKDYLSLFYVSEDEASALWPSVCKDQVLDYMRRSEIVIRRLLDVLMKNLKVTE-IDEK  120

Query  644   KEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSDTWVH  465
             KE L MG+KRIN NYYP CPNPEL VG+GRHSD+ST+T LLQD++GGL+VR  + D W+H
Sbjct  121   KESLLMGSKRINLNYYPICPNPELTVGIGRHSDVSTLTALLQDNVGGLYVRG-DDDYWIH  179

Query  464   VPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGPLPEV  285
             VPPV+G+LVIN+GDALQI+SNGRYKS EH V  +G  +RIS+PIF+ P P  ++ P  EV
Sbjct  180   VPPVNGSLVINVGDALQIMSNGRYKSVEHCVMTDGSKNRISIPIFINPRPSDKISPFHEV  239

Query  284   LAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             LA GEK +YKE++YSDY++HFF KAHDGK+TI+FAKI
Sbjct  240   LASGEKAVYKEVLYSDYVKHFFRKAHDGKKTIDFAKI  276



>gb|AES69971.2| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=353

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/356 (54%), Positives = 258/356 (72%), Gaps = 7/356 (2%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDS----IPTID  1062
             +S   +++DF+VN+  GVKGL+++ +  +P QYIQP + R+ +  I+  DS    IP ID
Sbjct  1     MSTPINLIDFLVNQANGVKGLAELNLPTVPHQYIQPIQARLDSCKIIPHDSEEQSIPIID  60

Query  1061  ISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKAN  882
              +NWDDP V  ++  AA + GFFQI+NHG+P+ +L+ LK + ++FF+LPVEEK+  S  +
Sbjct  61    FTNWDDPDVQDSIFSAATKLGFFQIVNHGIPINVLDDLKASVHKFFELPVEEKK--SVKD  118

Query  881   SPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIK  702
             SP E VR  TSFSP +E  LEWKDYL L Y S+++  A WP  C+++A+EYM   +A I+
Sbjct  119   SPPEVVRLSTSFSPLAESVLEWKDYLRLVYTSEEKIHAYWPAVCKNQALEYMKYADAFIR  178

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              LL++L+  LN+ E LDK +E   MGA  + FNYYP CP PEL  GVG HSDIS+ITVLL
Sbjct  179   KLLQVLLKKLNVNE-LDKEREHALMGAMILGFNYYPACPEPELVSGVGPHSDISSITVLL  237

Query  521   QDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRIS  342
             QD   GL++R    D+W++VPPV+GALVINIGD LQI+SNGRYKS EHRV  +G   RIS
Sbjct  238   QDDKRGLYIRGKEGDSWINVPPVNGALVINIGDVLQIMSNGRYKSIEHRVVVDGNKTRIS  297

Query  341   VPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +PIFV P P+  +G LPEVL  GE+P YK++V+S+Y  +FF KAHDGK+TIEFAKI
Sbjct  298   MPIFVNPAPDAVIGTLPEVLENGEEPHYKQVVFSEYFNYFFSKAHDGKKTIEFAKI  353



>ref|XP_010093053.1| 1-aminocyclopropane-1-carboxylate oxidase-3-like protein [Morus 
notabilis]
 gb|EXB53381.1| 1-aminocyclopropane-1-carboxylate oxidase-3-like protein [Morus 
notabilis]
Length=363

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 180/366 (49%), Positives = 252/366 (69%), Gaps = 12/366 (3%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+   +  S+ +FVV +G GVKGL D+G+  +P +Y+QPPKERI  ++  + ++ P +
Sbjct  1     MAPSTFDDGNSLFNFVVRDGYGVKGLVDLGVSNVPERYVQPPKERIEKSSAKSLEASP-V  59

Query  1064  DISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  D P    V+  +  AAE  GFFQ++NHGVP+ELL SLK A +RFF+   E K  +
Sbjct  60    DLSKLDGPDHDNVAAEIVRAAESLGFFQVVNHGVPLELLASLKAAAFRFFEQKPENKALF  119

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS NV+YGTSF+PE EK LEWKDY+S+ Y +DD+A   WP  C+  ++EY+    
Sbjct  120   RKGASPSPNVKYGTSFAPEKEKALEWKDYISMVYTTDDDALKFWPEICKEVSLEYLKTSL  179

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M+K LL++L+S  N++  ++ S+    +G K +N N+YP CPNP+L VGVGRHSD+ T+
Sbjct  180   DMVKRLLKVLIS--NLKMTVEDSEIEALIGLKMVNMNFYPACPNPDLTVGVGRHSDMGTL  237

Query  533   TVLLQDHIGGLHVR------KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRV  372
             TVLLQD IGGL+V+       +    W+ +PP+ GALVIN+GD LQILSNGRYKSAEHRV
Sbjct  238   TVLLQDGIGGLYVKVEEDMDAVKKGEWIEIPPISGALVINVGDTLQILSNGRYKSAEHRV  297

Query  371   SANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKET  192
                    R+S+PIF  P P  ++GPLP+V+       Y+E+V+ DY+ +FFG AHDGK++
Sbjct  298   RTTSTQSRVSIPIFTIPKPIQKIGPLPQVVQSDGVAHYREVVFGDYMNNFFGNAHDGKKS  357

Query  191   IEFAKI  174
             ++FAKI
Sbjct  358   LDFAKI  363



>ref|XP_006489000.1| PREDICTED: LOW QUALITY PROTEIN: feruloyl CoA ortho-hydroxylase 
2-like [Citrus sinensis]
Length=343

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 190/370 (51%), Positives = 253/370 (68%), Gaps = 31/370 (8%)
 Frame = -3

Query  1244  MAPAALS--ESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIP  1071
             MAP  +S  +  S   FV+N+G G KGLS+M +KALP QYI P +ERI    ++   SI 
Sbjct  1     MAPTIVSFTDESSTXHFVINQGNGAKGLSEMRLKALPKQYIHPLEERIDEAKVLPQASIA  60

Query  1070  TIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
               D+S  +D  V++++C+A E WG+FQ+                    F L   EK++YS
Sbjct  61    VNDMSKCNDAEVAKSICDATENWGYFQV--------------------FGLSAYEKKRYS  100

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             K  SPS NVR+ TSF+ + EK LEWKD+LS FYVS +EA+AL PPACR E +EYM   +A
Sbjct  101   KEPSPSNNVRFVTSFNTQVEKALEWKDFLSQFYVSXEEASALRPPACRDEVLEYMKSSDA  160

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             +IK LL++LM GLN+ +        L  G+ R N N+ P C NPEL +GVGRHSD+ST+T
Sbjct  161   LIKQLLQVLMKGLNVNK--------LEXGSVRTNLNFCPICLNPELTIGVGRHSDVSTLT  212

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             VLLQD IGG +VR  + ++W+ V P+DG+L+INIGDALQILSNGRYKS EH V A+G  +
Sbjct  213   VLLQDSIGGFYVRGNDGESWIDVHPIDGSLLINIGDALQILSNGRYKSVEHCVVASGSKN  272

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI*  171
              ISVPIF+ P P+  + PLPEVLA GEKP+YK ++YSDY++H F KAHDGK+T+ FAK+ 
Sbjct  273   SISVPIFINPRPQDTICPLPEVLASGEKPIYKPVLYSDYVKHVFRKAHDGKKTVGFAKMS  332

Query  170   A-MHIVSSCF  144
               + +V++CF
Sbjct  333   KFLTVVANCF  342



>ref|XP_010536147.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Tarenaya hassleriana]
Length=359

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/355 (52%), Positives = 246/355 (69%), Gaps = 7/355 (2%)
 Frame = -3

Query  1220  SESVVDFVVNEGRGVKGLS-DMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDD  1044
             S  V+DFVV++  GV GLS D  ++ LP  YI PP+ER+    I+  D IP  D+ +W D
Sbjct  5     SMDVIDFVVSKQNGVTGLSNDFPLQTLPPPYILPPEERLLPGKILCTDQIPIFDVGDWSD  64

Query  1043  PAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENV  864
               V+  +C+AA  +GFFQ++NHG+P+E ++++  A   F+ LP EE+R++ K N  +E V
Sbjct  65    ARVASQICDAASRFGFFQVVNHGIPMETMDAVTAAARAFYALPSEERRRFWKGNPAAETV  124

Query  863   RYGTSFSPESEKTLEWKDYLSLFY-VSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEM  687
                TSFSP +E  LEWKDYL   Y   +DEA++LWP  C+ + MEYM     +IKNLL +
Sbjct  125   FLQTSFSPMAEAVLEWKDYLMFSYDPENDEASSLWPSVCKDQVMEYMKSAQPVIKNLLAI  184

Query  686   LMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIG  507
             LM  LN+ E +D+S     MG+ +I+FN+YPKCPNP+LA GVGRHSDIS ITVLLQD +G
Sbjct  185   LMKNLNVNE-IDESLSNSLMGSFKISFNHYPKCPNPDLAAGVGRHSDISAITVLLQDDVG  243

Query  506   GLHVR---KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVP  336
             GL+VR   +   D W+HV P  GALVIN+GD LQ++SN  YKS EHRV A+G  +R+SVP
Sbjct  244   GLYVRANEQEEDDRWIHVAPTRGALVINVGDVLQMMSNDLYKSIEHRVVASGARNRVSVP  303

Query  335   IFVTPDPECRVGPLPEVLA-GGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             IFV P  +  + PLPE +A  GE  +Y+E+V+SDY  +FF K HDGK+TI+FAKI
Sbjct  304   IFVNPREDAAIKPLPEAVAMTGEAAVYREIVFSDYFSYFFSKGHDGKKTIDFAKI  358



>ref|XP_006364250.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Solanum tuberosum]
Length=369

 Score =   380 bits (977),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/367 (51%), Positives = 248/367 (68%), Gaps = 14/367 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVA------D  1083
             MAP+ + ES ++ DFVV +G GVKGL D GIK +P +YIQPPKERI  +  +       D
Sbjct  1     MAPS-IDESNALFDFVVQKGNGVKGLVDNGIKMVPERYIQPPKERILIDKKIMNSNDDID  59

Query  1082  DSIPTIDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPV  912
               +  ID+S    P    V   + +AAE  GFFQ++NHGV +ELLESLK A + FF  P 
Sbjct  60    QLLVAIDLSKLHGPEHDQVVGTITKAAETLGFFQVVNHGVTLELLESLKGAAHNFFAQPP  119

Query  911   EEKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAME  732
              EK  Y K  SPS  V+YGTSF PE E  LEWKDY+S+ Y +DDEA A WPP C+  A+E
Sbjct  120   MEKAVYLKEVSPSPLVKYGTSFVPEKEMALEWKDYVSMMYTNDDEAHAQWPPQCKDVALE  179

Query  731   YMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRH  552
             Y+     M++ LLE+L   L +   LD+ K     G K +N N+YP CPNPEL VGVGRH
Sbjct  180   YLKSSTKMVRILLEILFENLGV--TLDEEKFESLTGLKMVNMNFYPSCPNPELTVGVGRH  237

Query  551   SDISTITVLLQDHIGGLHVR--KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEH  378
             SD+ T+TVLLQD IGGL+V+  +   D W+ +PP+ GALVIN+GD +QILSNGRYKSAEH
Sbjct  238   SDMGTLTVLLQDGIGGLYVKLEQDVEDEWIEIPPIPGALVINVGDTMQILSNGRYKSAEH  297

Query  377   RVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGK  198
             RV       R+S+P+F TP P  ++GPLP+++       YK++++ DY+++FFGKAH+GK
Sbjct  298   RVRTTSSESRVSIPLFATPKPSEKIGPLPQLVESDGVAHYKQVLFGDYMKNFFGKAHEGK  357

Query  197   ETIEFAK  177
             ++++FA+
Sbjct  358   KSLDFAQ  364



>gb|KDP25105.1| hypothetical protein JCGZ_22640 [Jatropha curcas]
Length=363

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 187/366 (51%), Positives = 248/366 (68%), Gaps = 13/366 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+  S+ +S+ +FVV +G GVKG+ D+G+  +P QY+QP +ERI       +D+ P I
Sbjct  1     MAPS-FSDRDSLFNFVVRDGNGVKGMVDLGLTKVPQQYVQPQEERIDKRNATLNDNSP-I  58

Query  1064  DISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  D P    V   +  AAE  GFFQ+INHGVP+ELLESLK A + FF    E+K  Y
Sbjct  59    DLSKLDGPDHNHVVEEISRAAETLGFFQVINHGVPLELLESLKVAAHSFFSQTPEKKAAY  118

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS  V+YGTSF PE EK LEWKDY+S+ Y +DDEA  +WP  C+  A+EY+    
Sbjct  119   RKGVSPSPLVKYGTSFVPEKEKALEWKDYISMIYTNDDEALQVWPKECKEVALEYLRTSI  178

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE+L+  L +  +LD SK    +G K +N N+YP CPNPEL VGVGRHSD+ T+
Sbjct  179   KMVRKLLEVLIEKLGV--KLDDSKIDALIGMKMVNMNFYPTCPNPELTVGVGRHSDMGTL  236

Query  533   TVLLQDHIGGLHVR-KLNSD-----TWVHVPPVDGALVINIGDALQILSNGRYKSAEHRV  372
             TVLLQD IGGL+V+ + N D      W+ +PPV GALVIN+GD LQILSNGRYKSAEHRV
Sbjct  237   TVLLQDEIGGLYVKLEDNVDGKDKGEWIEIPPVTGALVINVGDTLQILSNGRYKSAEHRV  296

Query  371   SANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKET  192
                    R+SVPIF  P P  ++ P  E++      LY+E+V+ DY+ +FFG AH+GK++
Sbjct  297   RTTSLQSRVSVPIFTIPKPTEKIAPFAELVERDGVALYREVVFGDYMNNFFGNAHEGKKS  356

Query  191   IEFAKI  174
             ++FA+I
Sbjct  357   LDFARI  362



>ref|XP_004250780.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Solanum lycopersicum]
Length=369

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 187/367 (51%), Positives = 247/367 (67%), Gaps = 14/367 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVA------D  1083
             MAP+ + ES ++ DFVV +G GVKGL D GIK +P +YIQPPKERI  +  +       D
Sbjct  1     MAPS-IDESNALFDFVVQKGNGVKGLVDNGIKVVPERYIQPPKERILIDKKIINSNDDID  59

Query  1082  DSIPTIDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPV  912
               +  ID+S    P    V   + +AAE  GFFQ+INHGV +ELLESLK A + FF    
Sbjct  60    QVLVAIDLSKVHGPEHDQVVGTITKAAETLGFFQVINHGVTLELLESLKGAAHNFFAQTP  119

Query  911   EEKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAME  732
              EK  Y K  SPS  V+YGTSF PE E  LEWKDY+S+ Y +DDEA A WPP C+  A+E
Sbjct  120   MEKAVYLKQVSPSPLVKYGTSFVPEKEMALEWKDYVSMMYTNDDEAHAQWPPQCKDVALE  179

Query  731   YMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRH  552
             Y+     M++ LLE+L    N+   LD+ K     G K +N N+YP CPNPEL VGVGRH
Sbjct  180   YLKSSTKMVRILLEILFE--NLGATLDEEKLESLTGLKMVNMNFYPSCPNPELTVGVGRH  237

Query  551   SDISTITVLLQDHIGGLHVR--KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEH  378
             SD+ T+TVLLQD IGGL+V+  +   D W+ +PP+ GALVIN+GD +QILSNGRYKSAEH
Sbjct  238   SDMGTLTVLLQDGIGGLYVKLEQGVEDEWIEIPPIPGALVINVGDTMQILSNGRYKSAEH  297

Query  377   RVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGK  198
             RV       R+SVP+F TP P  ++GPLP+++       YK++++ DY+++FFGKAH+GK
Sbjct  298   RVRTTSSESRVSVPLFATPKPSEKIGPLPQLVESDGVAHYKQVLFGDYMKNFFGKAHEGK  357

Query  197   ETIEFAK  177
             ++++FA+
Sbjct  358   KSLDFAQ  364



>emb|CDP17396.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   374 bits (961),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 186/367 (51%), Positives = 247/367 (67%), Gaps = 14/367 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+    S S+ DFVV +G GVKGL D GI+ +P +Y+QP  ERI    + + ++   I
Sbjct  1     MAPS-FDTSNSLFDFVVKKGNGVKGLVDSGIQKVPDRYVQPSFERIGKLVVGSYENSSPI  59

Query  1064  DISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  D P    V  A+  A+E  GFFQ++NHGVPV+LL+SLK A ++FF  P E K  +
Sbjct  60    DLSKLDGPDHDQVVEAIVRASETLGFFQVVNHGVPVDLLDSLKDAAHQFFAQPPESKAVF  119

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS  V+YGTSF+P+ EK LEWKDY+S+ Y +D EA   WP  C+  A++YM    
Sbjct  120   LKGISPSPLVKYGTSFAPDKEKALEWKDYVSMVYTNDSEALEHWPKDCKEMALDYMKSSI  179

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE+L   L +E  +D S+    +G K +N N+YP CPNPEL VGVGRHSD+ T 
Sbjct  180   KMVRRLLEILFGYLGVE--VDDSRVESLLGLKMVNMNFYPACPNPELTVGVGRHSDMGTF  237

Query  533   TVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             TVLLQD IGGLHV K+ +DT       W+ +PP  GALVIN+GDALQILSNGRYKSAEHR
Sbjct  238   TVLLQDGIGGLHV-KVENDTVEGQKEDWLEIPPCPGALVINVGDALQILSNGRYKSAEHR  296

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V       R+S+PIF  P P  ++GPLP+++       YKE+++ DY+ +FFGKAH GK+
Sbjct  297   VRTTNKQSRVSIPIFTVPRPTEKIGPLPQLVERDGVAHYKEVIFEDYMNNFFGKAHQGKK  356

Query  194   TIEFAKI  174
             +++FAKI
Sbjct  357   SLDFAKI  363



>ref|XP_010534761.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Tarenaya hassleriana]
Length=361

 Score =   374 bits (960),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 189/359 (53%), Positives = 244/359 (68%), Gaps = 12/359 (3%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADDSIPTIDISN  1053
             L +  S+ +FVV EG GVKGL D G+  +P  Y+QPP ERI   NA + + + P ID+S 
Sbjct  5     LEDRNSLFNFVVEEGYGVKGLMDSGLSTVPQPYVQPPHERIPIKNAHICEAARP-IDLSL  63

Query  1052  WDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKAN  882
              D P    V+  +  AAE  GFFQ++NHGVPVELLESLK A + FFK P E+K  Y K  
Sbjct  64    LDGPDHDRVAHQIARAAETLGFFQVVNHGVPVELLESLKAAAHEFFKQPPEKKAMYRKEV  123

Query  881   SPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIK  702
             SPS  V+YGTSF PE E+ LEWKDY+S+ Y +DDEA   WP  CR  A+EY+     M+K
Sbjct  124   SPSRLVKYGTSFVPEKEEALEWKDYVSMVYTNDDEALQHWPHPCRDVALEYLKTSMKMVK  183

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              ++ +LM  L +   LD+ +    +G   +N NYYP CP PEL VGVGRHSD+ T+TVLL
Sbjct  184   TIVGVLMGRLGVT--LDEERTEALVGMTMVNMNYYPPCPKPELTVGVGRHSDMGTLTVLL  241

Query  521   QDHIGGLHVRKLNSDT----WVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             QD IGGL+V KL+  T    WV +PPV GALVIN+GDALQI+SNGRYKSAEHRV     S
Sbjct  242   QDGIGGLYV-KLDEGTDNGEWVEIPPVHGALVINVGDALQIVSNGRYKSAEHRVRTTETS  300

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
              R+SVPIF  P P  ++GP PE++       YKE+++ DY+ +FFG+AHDGK++++FA+
Sbjct  301   ARVSVPIFTVPKPWEKIGPFPEIVKRDGVARYKEVLFQDYMNNFFGQAHDGKKSLDFAR  359



>gb|KHG03924.1| 1-aminocyclopropane-1-carboxylate oxidase [Gossypium arboreum]
Length=365

 Score =   374 bits (959),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 188/365 (52%), Positives = 243/365 (67%), Gaps = 13/365 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+  +E+ S+ +FVV +G GVKG+ D+GI  +P  YIQPP E+I      +   IP I
Sbjct  1     MAPSFDNET-SLFNFVVRDGNGVKGIVDLGISKVPQAYIQPPAEQINKKN-ASKCEIPPI  58

Query  1064  DISNWDDPAVSRAVCE---AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  D P     V +   AAE  GFFQ++NHGVP ELL+SLK   + FF LP E K  Y
Sbjct  59    DLSKLDGPDHDEEVNQIVRAAETLGFFQVVNHGVPTELLDSLKQTAHNFFGLPPERKAVY  118

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              +  SPS  V+YGTSF PE EK LEWKDY+S+ Y +DDEA   WP  CR  A++Y+   +
Sbjct  119   RREVSPSPLVKYGTSFVPEKEKALEWKDYISMAYTNDDEALQQWPVECRDVALQYLKTSH  178

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE L+  L  E  LD SK   F+G K +N N+YP CPNPEL +GVGRHSD+ T+
Sbjct  179   EMVRKLLEALLGNLGAE--LDDSKIDAFIGKKMVNMNFYPTCPNPELTIGVGRHSDMGTL  236

Query  533   TVLLQDHIGGLHVR---KLNSDT---WVHVPPVDGALVINIGDALQILSNGRYKSAEHRV  372
             T+LLQD IGGL V+    +N +    WV +PP+ GALVINIGD LQI SNGRYKSAEHRV
Sbjct  237   TILLQDGIGGLFVKVPQDVNMEKKGEWVEIPPIPGALVINIGDMLQIWSNGRYKSAEHRV  296

Query  371   SANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKET  192
                    R+S+PIF +P P  ++ PLP+V+       YKE ++SDY+ +FFG AHDGK++
Sbjct  297   RTTSTKSRVSIPIFTSPQPTQKIAPLPQVVEKDGVARYKEFLFSDYMNNFFGNAHDGKKS  356

Query  191   IEFAK  177
             +EFAK
Sbjct  357   LEFAK  361



>ref|XP_009628264.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/365 (50%), Positives = 247/365 (68%), Gaps = 12/365 (3%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVAD-DSIPT  1068
             MAP+   +   + DFVV +G GVKGL D GIK +P +YIQPPKERI    I +    +  
Sbjct  1     MAPS-FDDGNFLFDFVVQKGNGVKGLVDNGIKIVPERYIQPPKERIDKKIINSRIQELVA  59

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S  + P    V R +  AAE  GFFQ+INHG+ +ELLESLK A ++FF  P E+K  
Sbjct  60    IDLSKLNGPENDQVVRDISIAAETLGFFQVINHGINLELLESLKNAAHKFFSQPPEKKAI  119

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS  V+YGTSF PE E  LEWKDY+S+ Y +D+EA + WP  C+  A+EY+   
Sbjct  120   YLKGVSPSPLVKYGTSFVPEKEMALEWKDYVSMMYTNDNEALSQWPHECKEVALEYLKSS  179

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M++ LLE+L    N+  +LD ++     G K +N N+YP CPNPEL VGVGRHSD+ T
Sbjct  180   TKMVRKLLEILFG--NLGAKLDDTRFESLTGLKMVNMNFYPTCPNPELTVGVGRHSDMGT  237

Query  536   ITVLLQDHIGGLHVR-----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRV  372
             +TVLLQD IGGL+V+     +   D W+ +PP+ GALVIN+GD +QILSNGRYKSAEHRV
Sbjct  238   LTVLLQDGIGGLYVKLEEDVEEGKDEWIEIPPIPGALVINVGDTMQILSNGRYKSAEHRV  297

Query  371   SANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKET  192
                    R+SVP+F TP P  ++GPLP+++       YK++++ DY+++FFGKAH+GK++
Sbjct  298   RTTSSESRVSVPLFTTPKPSEKIGPLPQLVEIDGFAHYKQVLFGDYMQNFFGKAHEGKKS  357

Query  191   IEFAK  177
             ++FA+
Sbjct  358   LDFAQ  362



>ref|XP_008226098.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Prunus mume]
Length=369

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 186/367 (51%), Positives = 246/367 (67%), Gaps = 14/367 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+   +  S+ +FVV +G GVKG+ D+G+  +P QYIQPP ERI     ++ D +  I
Sbjct  1     MAPS-FEDGNSLFNFVVRDGNGVKGMVDLGLSKVPEQYIQPPHERIVKLNAISTDELSPI  59

Query  1064  DISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  D P    V+ A+  AAE  GFFQ++NHG+PVELLESLK A + FF    E+K  Y
Sbjct  60    DLSKLDGPDHDQVADAIVNAAEVLGFFQVVNHGMPVELLESLKNAAHDFFWQAPEKKAAY  119

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS  V+YGTSF PE EK LEWKDY+S+ Y SD +A   WP  C+  A+EY+    
Sbjct  120   RKGVSPSPYVKYGTSFVPEKEKALEWKDYVSMVYSSDVDALTYWPNECKEVALEYLKFSM  179

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M+K +L++L++ L +   L+ SK    +G + +N N+YP CP+PEL VGVGRHSD+ T+
Sbjct  180   DMVKKILKVLIAKLGV--TLEDSKIDALIGLRMVNMNFYPTCPDPELTVGVGRHSDMGTL  237

Query  533   TVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             TVLLQD IGGL+V K+  D        W+ + PV GALVINIGD LQILSNGRYKSAEHR
Sbjct  238   TVLLQDGIGGLYV-KVEEDMDAGRKGEWIEISPVPGALVINIGDTLQILSNGRYKSAEHR  296

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V       R+SVPIF  P P  R+GPLPEV+       Y+E+V+ DY+ +FFG AH+GK+
Sbjct  297   VRTTSTKSRVSVPIFTIPKPTERIGPLPEVVKNDGVARYREVVFEDYMSNFFGNAHEGKK  356

Query  194   TIEFAKI  174
             ++E+A+I
Sbjct  357   SLEYAQI  363



>emb|CDY70527.1| BnaCnng68740D [Brassica napus]
Length=357

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 243/352 (69%), Gaps = 6/352 (2%)
 Frame = -3

Query  1223  ESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDD  1044
             +  ++ +FVV +G GVKGL D G+  +P  ++QP  ERIA       ++   ID+S  D 
Sbjct  7     DQATLFNFVVKQGNGVKGLIDSGMSRVPQPFVQPLSERIATPHARTCEAAQPIDLSQLDG  66

Query  1043  P---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPS  873
             P    V++ + EAAE  GFFQ++NHGV VELLE LKT+ ++FF  P E+K  Y K  SPS
Sbjct  67    PRHKEVAKQITEAAETLGFFQVVNHGVSVELLELLKTSAHKFFAQPPEKKAIYLKEVSPS  126

Query  872   ENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLL  693
             + V+YGTSF PE EK +EWKDY+S+ Y +D E    WPP CR  A++++    AM+K ++
Sbjct  127   KLVKYGTSFVPEKEKAIEWKDYVSMLYTNDHEVLQHWPPQCREVALDFLKSSMAMVKRVV  186

Query  692   EMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDH  513
             E+LM  + +  RL++ +    MG K +N NYYP CP+PEL +GVGRHSD+  +TVLLQD 
Sbjct  187   EVLMEDVGV--RLEEERMNRLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGMLTVLLQDG  244

Query  512   IGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPI  333
             IGGL+V KL++  W  +PP+DGALVIN+GD LQILSNG+YKSAEHRV       R+SVPI
Sbjct  245   IGGLYV-KLDNGDWAEIPPLDGALVINVGDTLQILSNGKYKSAEHRVRTTNIGSRVSVPI  303

Query  332   FVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             F  P+P  ++GPLPEV+       YKEL++ DY+ +FFG+ HDGK++++FA+
Sbjct  304   FTAPNPSEKIGPLPEVVRRDGVARYKELLFQDYMNNFFGQPHDGKKSLDFAR  355



>ref|XP_007213898.1| hypothetical protein PRUPE_ppa007382mg [Prunus persica]
 gb|EMJ15097.1| hypothetical protein PRUPE_ppa007382mg [Prunus persica]
Length=370

 Score =   372 bits (955),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 193/377 (51%), Positives = 252/377 (67%), Gaps = 20/377 (5%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAA-NAIVADDSIPT  1068
             MAP+   +  S+ +FVV +G GVKG+ D+G+  +P QYIQPP ERI   NAI AD+  P 
Sbjct  1     MAPS-FEDGNSLFNFVVRDGNGVKGMVDLGLSKVPEQYIQPPHERIVKLNAISADELSP-  58

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S  D P    V+ A+  AAE  GFFQ++NHG+PVELLESLK A + FF    E+K  
Sbjct  59    IDLSKLDGPDHDQVADAIVNAAEVLGFFQVVNHGMPVELLESLKNAAHDFFGQAPEKKAA  118

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS  V+YGTSF PE EK LEWKDY+S+ Y SD +A   WP  C+  A+EY+   
Sbjct  119   YRKGVSPSPYVKYGTSFVPEKEKALEWKDYVSMVYSSDVDALTYWPNECKEVALEYLKFS  178

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M+K +L++L++ L +   L+ SK    +G + +N N+YP CP+PEL VGVGRHSD+ T
Sbjct  179   MDMVKKILKVLIAKLGV--TLEDSKIDALIGLRMVNMNFYPTCPDPELTVGVGRHSDMGT  236

Query  536   ITVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEH  378
             +TVLLQD IGGL+V K+  D        W+ + PV GALVINIGD LQILSNGRYKSAEH
Sbjct  237   LTVLLQDGIGGLYV-KVEEDMDAGRKGEWIEISPVPGALVINIGDTLQILSNGRYKSAEH  295

Query  377   RVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGK  198
             RV       R+SVPIF  P    R+GPLPEV+       Y+E+V+ DY+ +FFG AH+GK
Sbjct  296   RVRTTSTKSRVSVPIFTIPKQTERIGPLPEVVKNDGVARYREVVFEDYMSNFFGNAHEGK  355

Query  197   ETIEFAKI*AMHIVSSC  147
             +++E+A+I    I+SS 
Sbjct  356   KSLEYAQI----IISST  368



>ref|XP_010499635.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Camelina sativa]
Length=358

 Score =   371 bits (952),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 181/360 (50%), Positives = 246/360 (68%), Gaps = 8/360 (2%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADDSIPT  1068
             MA     +  ++ +FVV +G GVKG+ D G+ ++P  ++QP  ERI   NA+  + S P 
Sbjct  1     MAIINFEDQTTLYNFVVKQGNGVKGMIDSGLSSVPQPFVQPISERIPTQNALTCEASQP-  59

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+SN + P    V++ + EAAE  GFFQ++NHGV VELLE LKT+ + FF    EEK  
Sbjct  60    IDLSNLNGPHHKEVAKQIVEAAETLGFFQVVNHGVSVELLELLKTSAHEFFAQAPEEKAI  119

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS+ V+YGTSF P+ EK +EWKDY+S+ Y SD EA   WP  CR  A+++M   
Sbjct  120   YLKEVSPSKLVKYGTSFVPDKEKAIEWKDYVSMMYTSDHEALQHWPQPCREVALKFMKSS  179

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M+KN++ +LM   N+  +L++ +    MG K +N NYYP CP+PEL +GVGRHSD+  
Sbjct  180   MEMVKNVVNILME--NVGVKLEEERMNGLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGM  237

Query  536   ITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGG  357
             +TVLLQD IGGL+V KL++  W  +PPV GALVINIGD LQILSNG+YKSAEHRV     
Sbjct  238   LTVLLQDGIGGLYV-KLDNGEWAEIPPVHGALVINIGDTLQILSNGKYKSAEHRVRTTNI  296

Query  356   SDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
               R+SVPIF  P+P  ++GPLPEV+       YKEL++ DY+ +FFG+ HDGK++++FA+
Sbjct  297   GSRVSVPIFTAPNPSEKIGPLPEVVKRDGVARYKELLFQDYMNNFFGQPHDGKKSLDFAR  356



>gb|AFK49211.1| unknown [Lotus japonicus]
Length=367

 Score =   370 bits (950),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/365 (52%), Positives = 244/365 (67%), Gaps = 12/365 (3%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP++ S S S+ +FVV +G GVKGL D G+  +P +YIQPP+E+I        D  P I
Sbjct  1     MAPSSNS-SNSLYEFVVRDGNGVKGLVDSGLSEVPERYIQPPEEQINKLESSPCDMQP-I  58

Query  1064  DISNWDDPAVSRAVCE---AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  + P   + V E   AAE  GFFQ++NH VPVELLESLK A + FF LP E+K  Y
Sbjct  59    DLSKLNGPEHDKVVDEIVGAAETLGFFQVVNHVVPVELLESLKEAAHTFFNLPPEKKAVY  118

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
                 SPS  V+YGTSF PE EK LEWKDY+S+ Y  D++A   WP  C+  A+EY+   +
Sbjct  119   RAGVSPSPKVKYGTSFVPEKEKALEWKDYISMVYSCDEDALQYWPNQCKEAALEYLKLSS  178

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              ++K L+E+L+  L +E  LD SK    +G K +N NYYP+CPNPEL VGVGRHSD+ TI
Sbjct  179   KLVKQLVEILVGKLGVE--LDDSKIESLLGMKMVNMNYYPECPNPELTVGVGRHSDMGTI  236

Query  533   TVLLQDHIGGLHVR-----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVS  369
             TVLLQD IGGL+V+        +  W+ +PP+ GALVINIGD LQILSNGRYKSAEHRV 
Sbjct  237   TVLLQDGIGGLYVKVEEDNDAENGEWLEIPPIPGALVINIGDTLQILSNGRYKSAEHRVR  296

Query  368   ANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETI  189
                   R+SVP+F  P    R+GPLPEV+       YKE+V+ DY+ +FFG AH GK+++
Sbjct  297   TTSTQSRVSVPVFTVPLASERIGPLPEVVKKDGLARYKEVVWQDYMNNFFGNAHAGKKSL  356

Query  188   EFAKI  174
             +F KI
Sbjct  357   DFVKI  361



>ref|XP_010465070.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Camelina sativa]
Length=358

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/360 (50%), Positives = 246/360 (68%), Gaps = 8/360 (2%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADDSIPT  1068
             MA     +  ++ +FVV EG GVKG+ D G+  +P  ++QP  ERI   NA+  + S P 
Sbjct  1     MAIINFEDQTTLYNFVVKEGNGVKGMIDSGLSIVPKPFVQPISERIPTQNALTCEASQP-  59

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S+ + P    V++ + EAAE  GFFQ++NHGV VELLESLKT+ + FF    EEK  
Sbjct  60    IDLSHLNGPHHKEVAKQIVEAAETLGFFQVVNHGVSVELLESLKTSAHEFFAQAPEEKAI  119

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS+ V+YGTSF P+ EK +EWKDY+S+ Y SD EA   WP  CR  A+++M   
Sbjct  120   YLKEVSPSKLVKYGTSFVPDKEKAIEWKDYVSMMYTSDHEALQHWPQPCRDVALKFMKSS  179

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M+KN++ +LM   N+  +L++ +    MG K +N NYYP CP+PEL +GVGRHSD+  
Sbjct  180   MEMVKNVVNILME--NVGVKLEEERMNGLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGM  237

Query  536   ITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGG  357
             +TVLLQD IGGL+V KL++  W  +PPV GALVINIGD +QILSNG+YKSAEHRV     
Sbjct  238   LTVLLQDGIGGLYV-KLDNGEWAEIPPVHGALVINIGDTMQILSNGKYKSAEHRVRTTNI  296

Query  356   SDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
               R+SVPIF  P+P  ++GPLPEV+       YKEL++ DY+ +FFG+ HDGK++++FA+
Sbjct  297   GSRVSVPIFTAPNPSEKIGPLPEVVKRDGVARYKELLFQDYMNNFFGQPHDGKKSLDFAR  356



>ref|NP_187896.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAF34829.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAB01419.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE65937.1| oxidoreductase 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AEE75258.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=357

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 239/354 (68%), Gaps = 6/354 (2%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW  1050
               +  ++ +FVV EG GVKG+ D G+ ++P  ++QP  ERI     +  ++   ID+SN 
Sbjct  5     FEDQTTLFNFVVREGNGVKGMIDSGLSSVPRPFVQPLSERIPTQKALTCEATQPIDLSNL  64

Query  1049  DDPA---VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             D P    V++ + EAAE  GFFQ++NHGV VELLE LK++ + FF    EEK  Y K  S
Sbjct  65    DGPQHKEVAKQIVEAAETLGFFQVVNHGVSVELLELLKSSAHEFFAQAPEEKSMYLKEVS  124

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKN  699
             PS+ V+YGTSF P+ EK +EWKDY+S+ Y +D EA   WP  CR  A+E++     M+KN
Sbjct  125   PSKLVKYGTSFVPDKEKAIEWKDYVSMLYTNDSEALQHWPQPCREVALEFLNSSMEMVKN  184

Query  698   LLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQ  519
             ++ +LM   N+   L++ K    MG K +N NYYP CP+PEL VGVGRHSD+  +TVLLQ
Sbjct  185   VVNILME--NVGVTLEEEKMNGLMGTKMVNMNYYPTCPSPELTVGVGRHSDMGMLTVLLQ  242

Query  518   DHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISV  339
             D IGGL+V KL++  W  +PPV GALVINIGD LQILSNG+YKSAEHRV       R+SV
Sbjct  243   DGIGGLYV-KLDNGEWAEIPPVHGALVINIGDTLQILSNGKYKSAEHRVRTTNIGSRVSV  301

Query  338   PIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             PIF  P+P  +VGPLPEV+       YKE ++ DY+ +FFG+ HDGK++++FA+
Sbjct  302   PIFTAPNPSQKVGPLPEVVKRDGVARYKEFLFQDYMNNFFGQPHDGKKSLDFAR  355



>gb|ABK28555.1| unknown [Arabidopsis thaliana]
Length=358

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 239/354 (68%), Gaps = 6/354 (2%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW  1050
               +  ++ +FVV EG GVKG+ D G+ ++P  ++QP  ERI     +  ++   ID+SN 
Sbjct  5     FEDQTTLFNFVVREGNGVKGMIDSGLSSVPRPFVQPLSERIPTQKALTCEATQPIDLSNL  64

Query  1049  DDPA---VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             D P    V++ + EAAE  GFFQ++NHGV VELLE LK++ + FF    EEK  Y K  S
Sbjct  65    DGPQHKEVAKQIVEAAETLGFFQVVNHGVSVELLELLKSSAHEFFAQAPEEKSMYLKEVS  124

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKN  699
             PS+ V+YGTSF P+ EK +EWKDY+S+ Y +D EA   WP  CR  A+E++     M+KN
Sbjct  125   PSKLVKYGTSFVPDKEKAIEWKDYVSMLYTNDSEALQHWPQPCREVALEFLNSSMEMVKN  184

Query  698   LLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQ  519
             ++ +LM   N+   L++ K    MG K +N NYYP CP+PEL VGVGRHSD+  +TVLLQ
Sbjct  185   VVNILME--NVGVTLEEEKMNGLMGTKMVNMNYYPTCPSPELTVGVGRHSDMGMLTVLLQ  242

Query  518   DHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISV  339
             D IGGL+V KL++  W  +PPV GALVINIGD LQILSNG+YKSAEHRV       R+SV
Sbjct  243   DGIGGLYV-KLDNGEWAEIPPVHGALVINIGDTLQILSNGKYKSAEHRVRTTNIGSRVSV  301

Query  338   PIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             PIF  P+P  +VGPLPEV+       YKE ++ DY+ +FFG+ HDGK++++FA+
Sbjct  302   PIFTAPNPSQKVGPLPEVVKRDGVARYKEFLFQDYMNNFFGQPHDGKKSLDFAR  355



>emb|CDY08394.1| BnaA05g26300D [Brassica napus]
Length=357

 Score =   368 bits (944),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/352 (49%), Positives = 242/352 (69%), Gaps = 6/352 (2%)
 Frame = -3

Query  1223  ESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDD  1044
             +  ++ +FVV +G GVKGL D G+  +P  ++QP  ERIA       ++   ID+   D 
Sbjct  7     DQATLFNFVVKQGNGVKGLIDSGMSCVPQPFVQPLSERIATPHARTCEAAQPIDLFQLDG  66

Query  1043  P---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPS  873
             P    VS+ + EAA   GFFQ++NHGV VELLE LKT+ ++FF  P E+K  Y K  SPS
Sbjct  67    PRHKEVSKQITEAAATLGFFQVVNHGVSVELLELLKTSAHKFFAQPPEKKAIYLKEVSPS  126

Query  872   ENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLL  693
             + V+YGTSF PE EK +EWKDY+S+ Y +D E    WPP CR  A++++    AM++ ++
Sbjct  127   KLVKYGTSFVPEKEKAIEWKDYVSMLYTNDHEVLQHWPPQCREVALDFLKSSMAMVERVV  186

Query  692   EMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDH  513
             E+LM  + +  RL++ +    MG K +N NYYP CP+PEL++GVGRHSD+  +TVLLQD 
Sbjct  187   EVLMEDVGV--RLEEERMNRLMGTKMVNMNYYPTCPSPELSIGVGRHSDMGMLTVLLQDG  244

Query  512   IGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPI  333
             IGGL+V KL++  W  +PP+DGALVIN+GD LQILSNG+YKSAEHRV       R+SVPI
Sbjct  245   IGGLYV-KLDNGDWAEIPPLDGALVINVGDTLQILSNGKYKSAEHRVRTTNFGSRVSVPI  303

Query  332   FVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             F  P+P  ++GPLPEV+       YKEL++ DY+ +FFG+ HDGK++++FA+
Sbjct  304   FTAPNPSEKIGPLPEVVKHDGVARYKELLFQDYMNNFFGQPHDGKKSLDFAR  355



>ref|XP_002306414.1| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE93410.1| oxidoreductase family protein [Populus trichocarpa]
Length=366

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 186/366 (51%), Positives = 242/366 (66%), Gaps = 15/366 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+ L +  S+ +FVV +G GVKG+ D G+  +P QY+QPP+ERI      A D+ P I
Sbjct  1     MAPSFL-DGNSMFNFVVRDGNGVKGMVDFGLSEVPEQYVQPPEERIDKLNATAHDN-PPI  58

Query  1064  DISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  D P    +   +  AAE  GFFQ++NHGVPVELLESLK A   FF  P E+K  Y
Sbjct  59    DLSKLDGPDHDQIVEEIATAAETLGFFQVMNHGVPVELLESLKDAANNFFGQPPEKKAVY  118

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS +VRYGTSF P+ EK LEWKDY+S+ Y +D EA   WP  C+  A+EY+    
Sbjct  119   RKGVSPSPSVRYGTSFVPDKEKALEWKDYISMRYTTDAEALEYWPQECKDVALEYLRTSI  178

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ +LE+L+  L +   LD SK    +G K +N N+YP CPNPEL VGVGRHSD+  +
Sbjct  179   KMVRKVLEILIGKLGVT--LDDSKIDGLIGLKLVNMNFYPTCPNPELTVGVGRHSDMGIL  236

Query  533   TVLLQDHIGGLHVR-------KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             TVLLQD IGGL+V+       K   D W+ +PPV GALVIN+GD LQILSNGRYKSAEHR
Sbjct  237   TVLLQDDIGGLYVKMEEEMDGKRKGD-WLEIPPVPGALVINVGDTLQILSNGRYKSAEHR  295

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V       R+S+PIF  P P  R+GPLP+V+       Y+E ++ +Y+ +FF  AHDGK+
Sbjct  296   VRTTRTKSRVSIPIFTIPKPTERIGPLPQVVERDGVARYREFIFEEYMNNFFSNAHDGKK  355

Query  194   TIEFAK  177
             +++FAK
Sbjct  356   SLDFAK  361



>ref|XP_010487018.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Camelina sativa]
Length=358

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/360 (50%), Positives = 246/360 (68%), Gaps = 8/360 (2%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADDSIPT  1068
             MA     +  ++ +FVV EG GVKG+ D G+ ++P  ++QP  ERI   NA+  + S P 
Sbjct  1     MAIINFEDQTTLYNFVVKEGNGVKGMIDSGLSSVPQPFVQPISERIPTQNALKCEASQP-  59

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S+ + P    V++ + EAAE  GFFQ++NHGV VELLE LKT+ + FF    EEK  
Sbjct  60    IDLSHLNGPHHKEVAKQIVEAAETLGFFQVVNHGVSVELLELLKTSAHEFFAQAPEEKAI  119

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS+ V+YGTSF P+ EK +EWKDY+S+ Y SD EA   WP  CR  A+++M   
Sbjct  120   YLKEVSPSKLVKYGTSFVPDKEKAIEWKDYVSMMYTSDHEALQHWPQPCREVALKFMKSS  179

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M+KN++ +LM   N+  +L++ +    MG K +N NYYP CP+PEL +GVGRHSD+  
Sbjct  180   MEMVKNVVNILME--NVGVKLEEERMNGLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGM  237

Query  536   ITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGG  357
             +TVLLQD IGGL+V KL++  W  +PPV GALVINIGD +QILSNG+YKSAEHRV     
Sbjct  238   LTVLLQDGIGGLYV-KLDNGEWAEIPPVHGALVINIGDTMQILSNGKYKSAEHRVRTTNI  296

Query  356   SDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
               R+SVPIF  P+P  ++GPLPEV+       YKEL++ DY+ +FFG+ HDGK++++FA+
Sbjct  297   GSRVSVPIFTAPNPSEKIGPLPEVVKRDGVARYKELLFQDYMNNFFGQPHDGKKSLDFAR  356



>gb|AFK39991.1| unknown [Lotus japonicus]
Length=367

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 188/365 (52%), Positives = 244/365 (67%), Gaps = 12/365 (3%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP++ S S S+ +FVV +G GVKGL D G+  +P +YIQPP+E+I        D  P I
Sbjct  1     MAPSSNS-SNSLYEFVVRDGNGVKGLVDSGLSEVPERYIQPPEEQINKLESSPCDMQP-I  58

Query  1064  DISNWDDPAVSRAVCE---AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  + P   + V E   AAE  GFFQ++NH VPVELLESLK A + FF LP  +K  Y
Sbjct  59    DLSKLNGPEHDKVVDEIVGAAETLGFFQVVNHVVPVELLESLKEAAHTFFNLPPGKKAVY  118

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
                 SPS  V+YGTSF PE EK LEWKDY+S+ Y+ D++A   WP  C+  A+EY+   +
Sbjct  119   RAGVSPSPKVKYGTSFVPEKEKALEWKDYISMVYICDEDALQYWPNQCKEAALEYLKLSS  178

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              ++K L+E+L+  L +E  LD SK    +G K +N NYYP+CPNPEL VGVGRHSD+ TI
Sbjct  179   KLVKQLVEILVGKLGVE--LDDSKIESLLGMKMVNMNYYPECPNPELTVGVGRHSDMGTI  236

Query  533   TVLLQDHIGGLHVR-----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVS  369
             TVLLQD IGGL+V+        +  W+ +PP+ GALVINIGD LQILSNG+YKSAEHRV 
Sbjct  237   TVLLQDGIGGLYVKVEEDNDAENGEWLEIPPIPGALVINIGDTLQILSNGKYKSAEHRVR  296

Query  368   ANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETI  189
                   R+SVP+F  P    R+GPLPEV+       YKE+V+ DY+ +FFG AH GK+++
Sbjct  297   TTSTQSRVSVPVFTVPLASERIGPLPEVVKKDGLARYKEVVWQDYMNNFFGNAHAGKKSL  356

Query  188   EFAKI  174
             +F KI
Sbjct  357   DFVKI  361



>ref|XP_009135260.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Brassica rapa]
Length=357

 Score =   367 bits (942),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 239/349 (68%), Gaps = 8/349 (2%)
 Frame = -3

Query  1211  VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAA-NAIVADDSIPTIDISNWDDP--  1041
             + DFVV +G GVKGL D G+  +P  ++QPP ERIA  N    + + P ID+S  D P  
Sbjct  11    LFDFVVKQGNGVKGLIDSGMSCVPQPFVQPPSERIATLNGQTCEAAQP-IDLSQLDGPHH  69

Query  1040  -AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENV  864
               V++ + EAAE  GFFQ++NHGV +ELLE LKT+ + FF  P E+K  Y K  SPS+ V
Sbjct  70    KEVAKQIVEAAETLGFFQVVNHGVSIELLELLKTSAHEFFAQPPEKKAIYLKEVSPSKLV  129

Query  863   RYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEML  684
             +YGTSF PE EK +EWKDY+S+ Y +D EA   WP  CR  A+ ++     M+K ++E+L
Sbjct  130   KYGTSFVPEKEKAIEWKDYVSMLYTNDHEALQHWPQPCREVALAFLKSSMQMVKRVVEVL  189

Query  683   MSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGG  504
             M  + +  RL++ +    MG K +N NYYP CP+PEL +GVGRHSD+  +TVLLQD IGG
Sbjct  190   MEDVGV--RLEEERMNSLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGMLTVLLQDGIGG  247

Query  503   LHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVT  324
             L+VR  N D W  +PP++GALVIN+GD LQILSNG+YKSAEHRV       R+SVPIF  
Sbjct  248   LYVRLDNGD-WAEIPPLNGALVINVGDTLQILSNGKYKSAEHRVRTTNIGSRVSVPIFTA  306

Query  323   PDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             P+P  ++GPLP+V+       YKEL++ DY+ +FF + HDGK++++FA+
Sbjct  307   PNPSEKIGPLPQVVKRDGVARYKELLFQDYMNNFFSQPHDGKKSLDFAR  355



>ref|NP_001242438.1| uncharacterized protein LOC100803722 [Glycine max]
 gb|ACU23105.1| unknown [Glycine max]
Length=362

 Score =   367 bits (942),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 186/365 (51%), Positives = 242/365 (66%), Gaps = 12/365 (3%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M+P+  + S S+ DFVV EG GVKGL D+G+  +P +Y Q P+ERI        D+ P I
Sbjct  1     MSPS-FNSSNSLYDFVVREGNGVKGLVDLGVSEVPERYKQHPQERINKQDSRTCDA-PPI  58

Query  1064  DISNWDDPAVSRAVCE---AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  + P   + V E   AAE  GFFQ++NHGVP+ELLESLK A + FF LP E+K  Y
Sbjct  59    DLSKLNGPDHEKVVDEIARAAETLGFFQVVNHGVPLELLESLKDAAHTFFSLPPEKKAVY  118

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
                 SPS  V+YGTSF PE EK LEWKDY+S+ Y SD+EA   WP  C+  A+EY+   +
Sbjct  119   CTGVSPSPRVKYGTSFVPEKEKALEWKDYISMVYSSDEEALQHWPDRCKEVALEYLKLSS  178

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M+++++E L+S L +   LD SK    +G K +N NYYP CPNPEL VGVGRHSD+  I
Sbjct  179   KMVRDIVEALISKLGVA--LDDSKIEGLLGLKMVNMNYYPACPNPELTVGVGRHSDMGAI  236

Query  533   TVLLQDHIGGLHVR-----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVS  369
             TVLLQD IGGL+V+           W+ +PP+ GALVINIGD +QILSNG+YKSAEHRV 
Sbjct  237   TVLLQDGIGGLYVKVEEDEDAGKGEWLEIPPIPGALVINIGDTIQILSNGKYKSAEHRVR  296

Query  368   ANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETI  189
                   R+SVP+F  P    R+GPLPEV+       Y+E+V  DY+ +FFG AH GK+++
Sbjct  297   TTSTQSRVSVPVFTMPIATDRIGPLPEVVKKDGLARYREVVLQDYMNNFFGNAHAGKKSL  356

Query  188   EFAKI  174
             +FA+I
Sbjct  357   DFARI  361



>ref|XP_002882794.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59053.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=357

 Score =   367 bits (941),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 239/354 (68%), Gaps = 6/354 (2%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW  1050
               +  ++ +FVV EG GVKG+ D G+ ++P  ++QP  ERI     +  ++   ID+S  
Sbjct  5     FEDQTTLFNFVVTEGNGVKGMIDSGLSSVPQPFVQPLSERIPTQKALTCEATQPIDLSKL  64

Query  1049  DDPA---VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             D P    V++ + EAAE  GFFQ++NHGV VELLE LK++ + FF    EEK  Y K  S
Sbjct  65    DGPQHKEVAKQIVEAAETLGFFQVVNHGVSVELLELLKSSAHEFFAQAPEEKAMYLKEVS  124

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKN  699
             PS+ V+YGTSF P+ EK +EWKDY+S+ Y +D EA   WP  CR  A+E++     M+KN
Sbjct  125   PSKLVKYGTSFVPDKEKAIEWKDYVSMLYTNDSEALQHWPQPCREMALEFLKSSMEMVKN  184

Query  698   LLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQ  519
             ++ +LM   N+   L++ K    MG K +N NYYP CP+PEL +GVGRHSD+  +TVLLQ
Sbjct  185   VVNILME--NVGVTLEEEKMNGLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGMLTVLLQ  242

Query  518   DHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISV  339
             D IGGL+V KL++  W  +PPV GALVINIGD LQILSNG+YKSAEHRV       R+SV
Sbjct  243   DGIGGLYV-KLDNGEWAEIPPVHGALVINIGDTLQILSNGKYKSAEHRVRTTNIGSRVSV  301

Query  338   PIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             PIF  P+P  ++GPLPEV+       YKE+++ DY+ +FFG+ HDGK++++FA+
Sbjct  302   PIFTAPNPSEKIGPLPEVVKRDGVARYKEILFQDYMNNFFGQPHDGKKSLDFAR  355



>ref|XP_010647291.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Vitis vinifera]
 emb|CBI23495.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   367 bits (941),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/367 (50%), Positives = 247/367 (67%), Gaps = 14/367 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP    + +SV +FVV +G GVKG+ D+G++ +P QYIQP  ERI      + D  P I
Sbjct  1     MAPN-FDDGDSVYNFVVRDGNGVKGMVDLGLEKVPEQYIQPHHERIDKLKASSYDR-PPI  58

Query  1064  DISNWDDPAVSRAV---CEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  D P  S+ V    EAAE  GFFQ++NH VP+E+LES+K+A + FF    E+K  Y
Sbjct  59    DLSMLDGPQHSQVVGLIAEAAERVGFFQVVNHRVPIEVLESVKSAAHEFFGQAPEKKAVY  118

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS  V+YGTSF PE EK LEWKDY+S+ Y SD EA   WP  C+  A+EY+   N
Sbjct  119   RKGVSPSPYVKYGTSFVPEKEKALEWKDYVSMVYTSDGEALEFWPNECKEVALEYLKASN  178

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
             +M++ +LE+LM  L +   L++S+   F+G K +N N+YP CPNP+L VGV RHSD+  +
Sbjct  179   SMVRRILEVLMEKLGV--TLEESRMDGFIGLKIVNMNFYPICPNPDLTVGVARHSDMGML  236

Query  533   TVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             TVLLQD IGGL+V+     T       WV +PP+ GAL+IN+GD LQILSNG+YKSAEHR
Sbjct  237   TVLLQDGIGGLYVKMEEDITDAGKKGEWVEIPPIPGALIINVGDTLQILSNGKYKSAEHR  296

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V       R+S+PIF TP P  ++GPLP+V+       Y+E V+ +Y+ +FFGKAH+GK+
Sbjct  297   VRTTSTQSRVSIPIFTTPRPNEKIGPLPQVVERDGVAHYREFVFEEYMNNFFGKAHEGKK  356

Query  194   TIEFAKI  174
             +++FA+I
Sbjct  357   SLDFAQI  363



>ref|XP_008372034.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Malus domestica]
Length=362

 Score =   366 bits (940),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 184/366 (50%), Positives = 247/366 (67%), Gaps = 17/366 (5%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAA-NAIVADDSIPT  1068
             MAP+   + +S+ +FVV +G GVKG+ D+G+  +P QYIQPP ERI   NA V +  +P 
Sbjct  1     MAPS-FEDGKSLFNFVVRDGNGVKGMVDLGLSKVPEQYIQPPHERIVKLNASVHE--LPP  57

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S  D P    V+  +  AAE  GFFQ++NHG+P+ELLESLK++   FF    E+K  
Sbjct  58    IDLSKLDGPDHDQVANDIANAAEVLGFFQVLNHGIPLELLESLKSSANDFFGQAPEKKAA  117

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
               K  SPS +V+YGTSF PE EK LEWKDY+S+ Y SD +A + WP  C++ A+EY+   
Sbjct  118   XXKGLSPSPHVKYGTSFVPEKEKALEWKDYVSMVYTSDADALSYWPNECKNVALEYLKTS  177

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M+K ++++L++ L +   L+ SK    +G + +N NYYP CP+PEL VGVGRHSD+ T
Sbjct  178   TDMVKKIVKVLIAKLGV--TLEDSKXEALIGLRMVNMNYYPTCPDPELTVGVGRHSDMGT  235

Query  536   ITVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEH  378
             +TVLLQD IGGL+V KL  D        W+ + PV GALVINIGD LQILSNGRYKSAEH
Sbjct  236   LTVLLQDGIGGLYV-KLEEDMDGEKKGEWIEITPVPGALVINIGDTLQILSNGRYKSAEH  294

Query  377   RVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGK  198
             RV       R+SVPIF  P P  R+GPLPEV+       Y+E+V+ DY+ +FF  AHDGK
Sbjct  295   RVRTTSSQSRVSVPIFXIPKPTERIGPLPEVVESDGVARYREVVFEDYMNNFFSNAHDGK  354

Query  197   ETIEFA  180
             +++++A
Sbjct  355   KSLDYA  360



>emb|CDP09718.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/392 (47%), Positives = 249/392 (64%), Gaps = 43/392 (11%)
 Frame = -3

Query  1223  ESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDD  1044
             E   ++DF V +G GV GLS +G+K++P +YI PP+ER+  N +V +DSIP ID+SNW D
Sbjct  9     EHMDLIDFAVKQGNGVNGLSKLGLKSIPHRYILPPEERLNQNQVVLEDSIPIIDVSNWGD  68

Query  1043  PAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENV  864
             P  +  +CEAA +WGFFQIINHGVP+E+LE +  A ++FF+LP EE+RKY K NSP+  V
Sbjct  69    PEAAALICEAAAKWGFFQIINHGVPLEVLEDVLEAGHKFFELPNEERRKYLKENSPTPTV  128

Query  863   RYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPA-----------------------  753
             +  T FSP +EK  EWKDYL   YV  + ++ LWP                         
Sbjct  129   QLKTGFSPLAEKVFEWKDYLVHHYVPHNVSSDLWPSVSKCMMYLDWPSLNGITFLSIRNL  188

Query  752   -------------------CRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLF  630
                                 R + +EY+     +IK L+E+L+ GLN++E  D+S+E   
Sbjct  189   ISVMTVAFTPGNDLTSEVYIRDQVLEYLKWAKPVIKKLVEVLLQGLNVKE-FDESQESQL  247

Query  629   MGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSDTWVHVPPVD  450
             +    I+  +YP CP+PELA G  RHSDIS+IT+LLQD +GGL+V+   +D W+HV PV 
Sbjct  248   IDRTTISLIHYPMCPSPELACGARRHSDISSITILLQDDVGGLYVKGTTADQWIHVSPVK  307

Query  449   GALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGE  270
             GAL +NIGD LQI+SN RYKS EH+V  NG  +R+SVPIFV+P  +  VGP P+ L  G+
Sbjct  308   GALAVNIGDILQIVSNDRYKSIEHQVIVNGRRNRVSVPIFVSPAADTVVGPFPQSLENGK  367

Query  269   KPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             KP+YK ++YSDYL +F  K  D  +TIEFAKI
Sbjct  368   KPIYKHVIYSDYLNYFLSKRDDRNQTIEFAKI  399



>ref|XP_007022206.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
[Theobroma cacao]
 gb|EOY13731.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
[Theobroma cacao]
Length=434

 Score =   367 bits (943),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/367 (50%), Positives = 239/367 (65%), Gaps = 14/367 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+ L +   + +FVV EG GVKG+ D+G+  +P  YIQPPKERI        +  P I
Sbjct  69    MAPS-LDDGSCLFNFVVREGNGVKGMVDLGLSKVPEPYIQPPKERIDKKKATRHEQAP-I  126

Query  1064  DISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D S  + P    V + +  A E  GFFQ++NHGVPV+LLESLK A + FF  P  +K  Y
Sbjct  127   DFSRLNGPDHDQVVKEIVTADETLGFFQLVNHGVPVDLLESLKDAAHNFFGQPSVKKAVY  186

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS  V+YGTSF PE EK LEWKDY+S+ Y +D EA A WP  CR  A+EY+    
Sbjct  187   RKEVSPSPLVKYGTSFVPEKEKALEWKDYISMIYTNDAEALAQWPEECREVALEYLKTSM  246

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M++ LLE+L   L ++  LD SK    +G K +N N+YP CPNP+L VGVGRHSD+ T+
Sbjct  247   NMVRKLLEVLTENLGVQ--LDDSKIDALVGMKMVNMNFYPICPNPDLTVGVGRHSDMGTL  304

Query  533   TVLLQDHIGGLHVRKL-------NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             T+LLQD IGGL+V+             WV +PP+ GALVINIGD LQI SNG+YKSAEHR
Sbjct  305   TILLQDGIGGLYVKVTEEIDDIEKKAEWVEIPPLPGALVINIGDTLQISSNGKYKSAEHR  364

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V       R+S+PIF TP P  ++ PLP+++       Y+ELV+ DY+++FF  AHDGK+
Sbjct  365   VRTTSTKSRVSIPIFTTPKPSAKIAPLPQLVEKERVARYRELVFGDYMKNFFANAHDGKK  424

Query  194   TIEFAKI  174
             +++FA+I
Sbjct  425   SLDFAQI  431



>ref|XP_007146232.1| hypothetical protein PHAVU_006G023300g [Phaseolus vulgaris]
 gb|ESW18226.1| hypothetical protein PHAVU_006G023300g [Phaseolus vulgaris]
Length=338

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 184/352 (52%), Positives = 246/352 (70%), Gaps = 17/352 (5%)
 Frame = -3

Query  1226  SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWD  1047
             S   +++ F+VN+  GVKGL+D+ +  +P QYIQP + R+              D +  +
Sbjct  3     STPSNLIHFLVNQANGVKGLADLNLPTVPPQYIQPLQARL--------------DHTKIE  48

Query  1046  DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSEN  867
             DP V  ++ +AA EWGFFQIINHG+P ++++ LK + +RFF+LP +EK+   K NSP E 
Sbjct  49    DPHVQNSIFDAAVEWGFFQIINHGIPFKVIDDLKASVHRFFELPAQEKKSI-KENSPPEV  107

Query  866   VRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEM  687
             VR  TSF P +E  LEWKDYL L Y S+++  A WP  C+ +A+EYM  C  +++ LL++
Sbjct  108   VRLATSFCPHAELVLEWKDYLQLVYASEEKIHAHWPAICKDQAVEYMKYCEVLVRKLLKV  167

Query  686   LMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIG  507
             L+  +N+ E LDK+ E   MGA  + FNYYP CP PE+  GV  HSDIS ITVLLQD IG
Sbjct  168   LLKKVNVRE-LDKAGEDTLMGAMTLGFNYYPACPEPEVVSGVAPHSDISLITVLLQDDIG  226

Query  506   GLHVRKLNS-DTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIF  330
             GL+VR  +  D+W++VPPV+GALVINIGD LQI+SN RYKS EHRV AN    RIS+PIF
Sbjct  227   GLYVRGSDGGDSWIYVPPVEGALVINIGDVLQIMSNERYKSIEHRVVANKRRTRISIPIF  286

Query  329   VTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             V+P P+  +GPL EVL  G+KP YK+++YSDY ++FF KAHDGK+TIEFA I
Sbjct  287   VSPAPDAVIGPLSEVLENGDKPKYKQILYSDYFKYFFSKAHDGKKTIEFAMI  338



>emb|CDY24239.1| BnaC01g38190D [Brassica napus]
Length=360

 Score =   364 bits (934),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/364 (49%), Positives = 247/364 (68%), Gaps = 13/364 (4%)
 Frame = -3

Query  1250  KTMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIP  1071
             +TM+ A   + +++ +FVV EG GVKGL D GI  +P  ++QP  ERIA       +++ 
Sbjct  2     ETMS-ANYEDRDTLFNFVVKEGNGVKGLIDSGISCVPQPFVQPLSERIATPNGQTCEAVQ  60

Query  1070  TIDISNWDDPA---VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKR  900
              IDIS  D P    V++ + EAAE  GFFQ++NHGV VELLE LK + + FF+ P E K 
Sbjct  61    PIDISQLDGPCHTEVAKQIVEAAETLGFFQVVNHGVSVELLELLKMSAHEFFEQPPENKA  120

Query  899   KYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQ  720
              Y K  SPS+ V+YGTSF PE EK +EWKDY+S+ Y +DDEA   WP  CR  A++++  
Sbjct  121   VYLKEVSPSKLVKYGTSFVPEKEKAIEWKDYVSMLYTNDDEALQHWPLQCREVALDFLKS  180

Query  719   CNAMIKNLLEMLMSGLNI---EERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHS  549
               AM+K ++E+L+  + +   EER++       MG K +N NYYP CP+PEL +GVGRHS
Sbjct  181   SMAMVKRIVEVLVEDVGVILEEERMNS-----LMGTKMVNMNYYPTCPSPELTIGVGRHS  235

Query  548   DISTITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVS  369
             D+  +TVLLQD IGGL+V+  N D W+ +PP++GALVIN+GD LQILSNG+YKSAEHRV 
Sbjct  236   DMGMLTVLLQDGIGGLYVKVDNGD-WLEIPPLNGALVINVGDTLQILSNGKYKSAEHRVR  294

Query  368   ANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETI  189
                   R+SVPIF  P+   ++GPLPEV+       YKE+++ DY+ +FF + HDGK+++
Sbjct  295   TTNIGSRVSVPIFTAPNLSEKIGPLPEVVERDGVARYKEVLFQDYMNNFFSQPHDGKKSL  354

Query  188   EFAK  177
             +FA+
Sbjct  355   DFAR  358



>gb|KFK38632.1| hypothetical protein AALP_AA3G139200 [Arabis alpina]
Length=357

 Score =   363 bits (933),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 241/355 (68%), Gaps = 8/355 (2%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAA-NAIVADDSIPTIDISN  1053
               +  ++ +FVV +G GVKGL D G+  +P  ++QP  ERIA  NA   + S P ID+  
Sbjct  5     FEDKTTLFNFVVKQGNGVKGLIDSGLSCVPQPFVQPLAERIATPNAPTREASEP-IDLFK  63

Query  1052  WDDPA---VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKAN  882
              D P    V + + EA+E  GFFQ++NHGV VELLE LKT+ + FF    EEK  Y K  
Sbjct  64    LDGPHHKDVVKQIVEASETLGFFQVVNHGVSVELLEMLKTSAHEFFAKAPEEKAMYLKEV  123

Query  881   SPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIK  702
             SPS+ V+YGTSF PE EK +EWKDY+S+ Y +D EA   WP  CR  A+E++     M+K
Sbjct  124   SPSKLVKYGTSFVPEKEKAIEWKDYVSMLYTNDHEALQHWPQPCRDVALEFLKSSMEMVK  183

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              ++E+LM   N+  RL++      MG K +N NYYP CP+PEL +GVGRHSD+  +TVLL
Sbjct  184   RVVEILME--NVGVRLEEETMNGLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGMLTVLL  241

Query  521   QDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRIS  342
             QD IGGL+V KL++  W  +PP++GALVIN+GD LQILSNG+YKSAEHRV     S R+S
Sbjct  242   QDGIGGLYV-KLDNGEWAEIPPINGALVINVGDTLQILSNGKYKSAEHRVRTTNISSRVS  300

Query  341   VPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             VPIF  P+P  ++GPLPEV+       YKEL++ DY+ +FFG+ HDGK++++FA+
Sbjct  301   VPIFTAPNPSEKIGPLPEVVKRDGVARYKELLFQDYMNNFFGQPHDGKKSLDFAR  355



>ref|XP_009124685.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Brassica rapa]
Length=357

 Score =   363 bits (933),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 175/359 (49%), Positives = 242/359 (67%), Gaps = 12/359 (3%)
 Frame = -3

Query  1235  AALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDIS  1056
             A   + +++ +FVV EG GVKGL D G+  +P  ++QP  ERIA       +++  ID+S
Sbjct  3     ANYEDRDTLFNFVVKEGNGVKGLIDSGMSCVPQPFVQPLSERIATPNGQTCEAVQPIDLS  62

Query  1055  NWDDPA---VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
               D P    V++ + EAAE  GFFQ++NHGV VELLE LK + + FF+ P E K  Y K 
Sbjct  63    QIDGPCHTEVAKQIVEAAETLGFFQVVNHGVSVELLELLKMSAHEFFEQPPENKAVYLKE  122

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
              SPS+ V+YGTSF PE EK +EWKDY+S+ Y +DDEA   WP  CR  A++++    AM+
Sbjct  123   VSPSKLVKYGTSFVPEKEKAIEWKDYVSMLYTNDDEALQHWPLQCREVALDFLKSSMAMV  182

Query  704   KNLLEMLMSGLNI---EERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
             K ++E+LM  + +   EER++       +G K +N NYYP CP+PEL +GVGRHSD+  +
Sbjct  183   KRIVEVLMEDVGVILEEERMNS-----LVGTKMVNMNYYPTCPSPELTIGVGRHSDMGML  237

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGS  354
             TVLLQD IGGL+V+  N D W  +PP++GALVIN+GD LQILSNG+YKSAEHRV      
Sbjct  238   TVLLQDGIGGLYVKPDNGD-WAEIPPLNGALVINVGDTLQILSNGKYKSAEHRVRTTNIG  296

Query  353   DRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
              R+SVPIF  P P  ++GPLPEV+       YKE+++ DY+ +FF + HDGK++++FA+
Sbjct  297   SRVSVPIFTAPTPSEKIGPLPEVVERDGVARYKEVLFQDYMNNFFSQPHDGKKSLDFAR  355



>emb|CDP20007.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   364 bits (934),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 180/366 (49%), Positives = 242/366 (66%), Gaps = 17/366 (5%)
 Frame = -3

Query  1235  AALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADD---SIPTI  1065
             ++  +  ++ DFVV +G GVKGL D GI  +P +YIQPP ERI      + D   SIP I
Sbjct  3     SSFDDGNTLFDFVVKDGNGVKGLVDSGIAKVPERYIQPPYERIGKLVENSRDHFSSIP-I  61

Query  1064  DISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  D P    V  A+  AAE  GFFQ+INHG+ ++LLESLK A +RFFK P + K  Y
Sbjct  62    DLSKLDGPDHDQVVEAIIRAAETLGFFQVINHGMSLDLLESLKDAAHRFFKQPADAKAVY  121

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS  V+YGTSF+PE EK LEWKDYLS+ Y +D +A   WP  C+  A++Y+    
Sbjct  122   LKGVSPSPFVKYGTSFAPEQEKALEWKDYLSMVYTNDSDARKHWPKECKEVALDYLKSST  181

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M+K LL +L+  L +   LD SK    +G K +N N+YP CPNPEL +GVGRHSD+ T+
Sbjct  182   NMVKMLLGILIGNLGVT--LDDSKLESLIGTKLVNMNFYPTCPNPELTIGVGRHSDMGTL  239

Query  533   TVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             TVLLQD IGGL+V KL  D        W+ +PP+ GALVIN+GD+LQILSNGRY SAEHR
Sbjct  240   TVLLQDGIGGLYV-KLEEDALVGKKEEWIEIPPIPGALVINVGDSLQILSNGRYTSAEHR  298

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V       R+S+P+F  P P  ++GPLP +       LY+++++ +Y+ +FFG +H+GK+
Sbjct  299   VRTTSKQSRVSIPVFTAPRPTEKIGPLPHLAKLDGGALYRDVIFQEYMNNFFGHSHEGKK  358

Query  194   TIEFAK  177
             +++FAK
Sbjct  359   SLDFAK  364



>ref|XP_009146572.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Brassica rapa]
Length=365

 Score =   363 bits (933),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 175/360 (49%), Positives = 243/360 (68%), Gaps = 14/360 (4%)
 Frame = -3

Query  1223  ESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDD  1044
             +  ++ +FVV +G GVKGL D G+  +P  ++QP  ERIA       ++   ID+S  D 
Sbjct  7     DQATLFNFVVKQGNGVKGLIDSGMSCVPQPFVQPLSERIATPHARTCEAAQPIDLSQLDG  66

Query  1043  P---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPS  873
             P    VS+ + EAA   GFFQ++NHGV VELLE LKT+ ++FF  P E+K  Y K  SPS
Sbjct  67    PRHKEVSKQITEAAATLGFFQVVNHGVSVELLELLKTSAHKFFAQPPEKKAIYLKEVSPS  126

Query  872   ENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRH--------EAMEYMTQC  717
             + V+YGTSF PE EK +EWKDY+S+ Y +D E    WPP CR+         A++++   
Sbjct  127   KLVKYGTSFVPEKEKAIEWKDYVSMLYTNDHEVLQHWPPQCRYILYMCDREVALDFLKSS  186

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
              AM++ ++E+LM  + +  RL++ +    MG K +N NYYP CP+PEL +GVGRHSD+  
Sbjct  187   MAMVERVVEVLMEDVGV--RLEEERMNRLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGM  244

Query  536   ITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGG  357
             +TVLLQD IGGL+V KL++  W  +PP+DGALVIN+GD LQILSNG+YKSAEHRV     
Sbjct  245   LTVLLQDGIGGLYV-KLDNGDWAEIPPLDGALVINVGDTLQILSNGKYKSAEHRVRTTNF  303

Query  356   SDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
               R+SVPIF  P+P  ++GPLPEV+       YKEL++ DY+ +FFG+ HDGK++++FA+
Sbjct  304   GSRVSVPIFTAPNPSEKIGPLPEVVKHDGVARYKELLFQDYMNNFFGQPHDGKKSLDFAR  363



>ref|XP_006407284.1| hypothetical protein EUTSA_v10020841mg [Eutrema salsugineum]
 gb|ESQ48737.1| hypothetical protein EUTSA_v10020841mg [Eutrema salsugineum]
Length=408

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 243/355 (68%), Gaps = 8/355 (2%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAA-NAIVADDSIPTIDISN  1053
               +  ++ +FVV +G GVKGL D G+  +P  +IQP  ERIA  NA   + + P ID+S 
Sbjct  56    FEDQTTLFNFVVKQGNGVKGLIDSGMSCVPKPFIQPLSERIATPNARTCEAAQP-IDLSQ  114

Query  1052  WDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKAN  882
              D P    V++ + +A+E  G FQ++NHGV +ELLE LKT+ + FF  P E+K  Y K  
Sbjct  115   LDGPHHKEVTKQIVKASETLGVFQVVNHGVSLELLELLKTSAHEFFAQPPEKKAIYLKEV  174

Query  881   SPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIK  702
             SPS+ V+YGTSF PE EK +EWKDY+S+ Y +D EA   WP  CR  A+E++     M+K
Sbjct  175   SPSKLVKYGTSFVPEKEKAIEWKDYVSMLYTNDREALQHWPRPCRDVALEFLKSSMEMVK  234

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              ++E+LM   NI  RL++ +    MG K +N NYYP CP+PEL +GVGRHSD+  +TVLL
Sbjct  235   RVVEVLME--NIGVRLEEGRMNGLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGMLTVLL  292

Query  521   QDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRIS  342
             QD IGGL+V KL++  W  +PP+DGALV+N+GD LQILSNGRYKSAEHRV       R+S
Sbjct  293   QDGIGGLYV-KLDNGEWAEIPPLDGALVVNVGDTLQILSNGRYKSAEHRVRTTNMGSRVS  351

Query  341   VPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             +PIF  P+P  ++GPLPEV+       YKEL++ DY+ +FFG+ HDGK++++FA+
Sbjct  352   IPIFTAPNPSEKIGPLPEVVKRDGVARYKELLFQDYMYNFFGQPHDGKKSLDFAR  406



>ref|XP_011022120.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Populus euphratica]
Length=363

 Score =   362 bits (930),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/367 (50%), Positives = 240/367 (65%), Gaps = 17/367 (5%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADDSIPT  1068
             MAP+ L +  S+ +FVV +G GVKG+ D G+  +P QY+Q P+ERI   NAI  D+  P 
Sbjct  1     MAPSFL-DGNSLFNFVVRDGNGVKGMVDSGLSEVPEQYVQQPEERIDKLNAIAHDN--PP  57

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S    P    +   +  AAE  GFFQ+ NHGVPVELLESLK A   FF  P E+K  
Sbjct  58    IDLSKLGGPDHDQIVEEIARAAETLGFFQVTNHGVPVELLESLKDAANNFFCQPPEKKAV  117

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y +  SPS +VRYGTSF P+ E  LEWKDY+S+ Y +D EA   WP  C+  A+EY+   
Sbjct  118   YRQGVSPSPSVRYGTSFVPDKETALEWKDYISMRYTTDAEALQYWPQECKDVALEYLRTS  177

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M++ LLE+L+  L +   LD SK    +G K +N N+YP CPNPEL +GVGRHSD+  
Sbjct  178   IKMVRKLLEILIGKLGVT--LDDSKIDGLIGLKLVNMNFYPTCPNPELTIGVGRHSDMGV  235

Query  536   ITVLLQDHIGGLHVR-------KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEH  378
             +TVLLQD IGGLHV+       K   D W+ +PPV GALVIN+GD LQILSNGRYKSAEH
Sbjct  236   LTVLLQDDIGGLHVKMEEEMDGKRKGD-WLEIPPVPGALVINVGDTLQILSNGRYKSAEH  294

Query  377   RVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGK  198
             RV       R+S+PIF  P P  R+GPLP+V+       Y+E ++ +Y+ +FF  AHDGK
Sbjct  295   RVRTARTKSRVSIPIFTIPKPTERIGPLPQVVERDGVARYREFIFEEYMNNFFSNAHDGK  354

Query  197   ETIEFAK  177
             ++++FAK
Sbjct  355   KSLDFAK  361



>ref|XP_007022209.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
[Theobroma cacao]
 gb|EOY13734.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
[Theobroma cacao]
Length=373

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 184/367 (50%), Positives = 238/367 (65%), Gaps = 15/367 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+   +S S+ +FVV +G GVKG+ D+G+  +P  Y+QPPKERI        +  P I
Sbjct  9     MAPS-FDDSSSLFNFVVRDGNGVKGIVDLGLSKVPQAYMQPPKERIDKQNASKHEQ-PPI  66

Query  1064  DISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S    P    V + +  AAE  GFFQ++NHGVPVELLESLK   + FF LP E K  Y
Sbjct  67    DLSRLGGPDHDEVVKEIVRAAETLGFFQVVNHGVPVELLESLKDTAHNFFCLPPERKAIY  126

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
                 SP+  V+YGTSF PE E+ LEWKDY+S+ Y SD EA   WP  CR  A+EY+    
Sbjct  127   RTEVSPTPLVKYGTSFVPEKERALEWKDYISMQYTSDAEALEHWPIECREVALEYLRTSI  186

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M+  LLE+LM  L +  + + SK       K IN N+YP CPNP+L VGVGRHSD+ T+
Sbjct  187   GMVSKLLEVLMGNLGV--KPEDSKIDALFDKKMINMNFYPTCPNPDLTVGVGRHSDMGTL  244

Query  533   TVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             TVLLQD IGGL+V K+  D        W+ +PP+ GALVIN+GD LQILSNG+YKSAEHR
Sbjct  245   TVLLQDGIGGLYV-KIEDDIDFGKKGEWMEIPPIPGALVINVGDMLQILSNGKYKSAEHR  303

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V       R+S+PIF  P P  ++ PLP+V+      LY+E V +DY+ +FFG AHDGK+
Sbjct  304   VRTTSTKSRVSIPIFTIPKPTEKIAPLPQVVEKDGIALYREFVLADYMNNFFGNAHDGKK  363

Query  194   TIEFAKI  174
             +++FAKI
Sbjct  364   SLDFAKI  370



>ref|XP_007022212.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
[Theobroma cacao]
 gb|EOY13737.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
[Theobroma cacao]
Length=365

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/368 (50%), Positives = 239/368 (65%), Gaps = 17/368 (5%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADDSIPT  1068
             MAP+     +S+ DFVV +G GVKG+ D+G+  +P  YIQPP+E+I   NA  +    P 
Sbjct  1     MAPS-FDNGKSLFDFVVRDGNGVKGIVDLGLSKVPQAYIQPPEEQIDKENA--SKHGQPP  57

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S  D P    V + +  A+E  GFFQ++NHGVPV+LLESLK A + FF  P E K  
Sbjct  58    IDLSRLDGPDHDEVVKEIVRASETLGFFQVVNHGVPVDLLESLKDAAHTFFGQPPERKSV  117

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SP+  VRYGTSF PE EK LEWKDY+S+ Y +D EA   WP  CR  A+EY+   
Sbjct  118   YRKEVSPTPLVRYGTSFVPEKEKALEWKDYISMVYTNDAEALEHWPVECREVALEYLKTS  177

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M+K LL +L   L +  +LD SK    +G K +N N+YP CPNP+L VGVGRHSD  T
Sbjct  178   LEMVKKLLHVLTENLGV--KLDDSKIDALIGRKTVNMNFYPTCPNPDLTVGVGRHSDFGT  235

Query  536   ITVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEH  378
             +TVLLQD IGGL+V  +  DT       WV +PP+ GALVINIGD LQILSNGRYKSAEH
Sbjct  236   LTVLLQDGIGGLYV-NIPEDTDIGKRGDWVEIPPIHGALVINIGDMLQILSNGRYKSAEH  294

Query  377   RVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGK  198
             RV       R+S+PIF  P P  ++ PLP+V+       Y+E V  DY+ ++FG  H+GK
Sbjct  295   RVRTTSTKSRVSIPIFTIPKPTEKIAPLPQVVEKDGVARYREFVLGDYMNNYFGNPHEGK  354

Query  197   ETIEFAKI  174
             ++++FA+I
Sbjct  355   KSLDFARI  362



>ref|XP_010647147.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Vitis vinifera]
 emb|CBI23485.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   362 bits (929),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/367 (49%), Positives = 246/367 (67%), Gaps = 14/367 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP    + +SV +FVV +G GVKG+ D+G++ +P QYIQP  ERI      + D  P I
Sbjct  1     MAPN-FDDGDSVYNFVVRDGNGVKGMVDLGLEKVPEQYIQPHHERIDKLKASSYDR-PPI  58

Query  1064  DISNWDDPAVSRAV---CEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  D P  S+ V    EAAE  GFFQ++NH VP+E+LES+K+A + FF    E+K  Y
Sbjct  59    DLSMLDGPQHSQVVGLIAEAAERVGFFQVVNHRVPIEVLESVKSAAHEFFGQAPEKKAVY  118

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS  V+YGTSF PE EK LEWKDY+S+ Y SD EA   WP  C+  A+EY+   +
Sbjct  119   RKGVSPSPYVKYGTSFVPEKEKALEWKDYVSMVYTSDGEALEFWPNECQEVALEYLKASS  178

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
             +M++ +LE+LM  L +   L++S+   F+G K +N N+YP CPNP+L VGV RHSD+  +
Sbjct  179   SMVRRILEVLMEKLGV--TLEESRMDGFIGLKIVNMNFYPICPNPDLTVGVARHSDMGML  236

Query  533   TVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             TVLLQD IGGL+V+     T       WV +PP+ GAL+IN+GD LQILSNG+YKSAEHR
Sbjct  237   TVLLQDGIGGLYVKMEEDITDAGKKGEWVEIPPIPGALIINVGDTLQILSNGKYKSAEHR  296

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V       R+S+PIF  P P  ++GPLP+V+       Y+E V+ +Y+ +FFGKAH+GK+
Sbjct  297   VRTTSTQSRVSIPIFTMPRPNEKIGPLPQVVERDGVAHYREFVFEEYMNNFFGKAHEGKK  356

Query  194   TIEFAKI  174
             +++FA+I
Sbjct  357   SLDFAQI  363



>ref|XP_007149304.1| hypothetical protein PHAVU_005G059100g [Phaseolus vulgaris]
 gb|ESW21298.1| hypothetical protein PHAVU_005G059100g [Phaseolus vulgaris]
Length=362

 Score =   362 bits (928),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 182/366 (50%), Positives = 243/366 (66%), Gaps = 14/366 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAA-NAIVADDSIPT  1068
             MAP+  + S S+ DFVV +G GVKGL D G+  +P +YIQPP+ERI   ++ V DD  P 
Sbjct  1     MAPS-FNSSNSLYDFVVRDGNGVKGLVDSGVSEVPERYIQPPRERIRKHDSGVCDD--PP  57

Query  1067  IDISNWDDPAVSRAVCE---AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S  +     + V E   AAE  GFFQ++NHGVP+ELLESLK A + FF LP E+K  
Sbjct  58    IDLSKLNGAEHEKVVDEIARAAETLGFFQVVNHGVPLELLESLKDAAHTFFSLPPEKKAV  117

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y    SPS  V+YGTSF PE EK LEWKDY+S+ + S++EA   WP  C+  A+EY+   
Sbjct  118   YCSGVSPSPRVKYGTSFVPEKEKALEWKDYISMTFSSEEEALQYWPNQCKEVALEYLKLS  177

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M+++++E L+  L +   L  S+    +G K +N NYYP CPNP+L VGVGRHSD+  
Sbjct  178   TKMVRDIVEALIGKLGV--TLKDSEMESLLGMKMVNMNYYPACPNPDLTVGVGRHSDMGA  235

Query  536   ITVLLQDHIGGLHVR-----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRV  372
             ITVLLQD IGGL+V+       + + W+ +PP+ GALVINIGD LQILSNG+YKSAEHRV
Sbjct  236   ITVLLQDGIGGLYVKVDQQNDADKEEWLEIPPIPGALVINIGDTLQILSNGKYKSAEHRV  295

Query  371   SANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKET  192
                    R+SVP+F  P    R+GPL EV+       Y+++V  DY+ +FFG AH GK++
Sbjct  296   RTTSSESRVSVPVFTMPKATERIGPLAEVVEKDGLARYRQVVLQDYMNNFFGNAHAGKKS  355

Query  191   IEFAKI  174
             ++FA+I
Sbjct  356   LDFARI  361



>emb|CDY57297.1| BnaC03g73320D [Brassica napus]
Length=357

 Score =   360 bits (925),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 174/349 (50%), Positives = 238/349 (68%), Gaps = 8/349 (2%)
 Frame = -3

Query  1211  VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAA-NAIVADDSIPTIDISNWDDP--  1041
             + DFVV +G GVKGL D G+  +P  ++QPP ERIA  N    + + P ID+S  D P  
Sbjct  11    LFDFVVKQGNGVKGLIDSGMSCVPQPFVQPPSERIATLNGQTCEAAQP-IDLSQLDGPHH  69

Query  1040  -AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENV  864
               V++ + EAAE  GFFQ++NHGV VELLE LKT+ + FF  P E+K  Y K  SP++ V
Sbjct  70    KEVAKQIVEAAETLGFFQVVNHGVSVELLELLKTSAHEFFAQPPEKKAIYLKEVSPNKLV  129

Query  863   RYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEML  684
             +YGTSF PE EK +EWKDY+S+ Y +D EA   WP  CR  A+ ++     M++ ++E+L
Sbjct  130   KYGTSFVPEKEKAIEWKDYVSMLYTNDHEALQHWPQPCREVALAFLKSSMQMVERVVEVL  189

Query  683   MSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGG  504
             M  + +  RL++ +    MG K +N NYYP CP+PEL +GVGRHSD+  +TVLLQD IGG
Sbjct  190   MEDVGV--RLEEERMNSLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGMLTVLLQDGIGG  247

Query  503   LHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVT  324
             L+VR  N D W  +PP++ ALVIN+GD LQILSNG+YKSAEHRV       R+SVPIF  
Sbjct  248   LYVRLDNGD-WAEIPPLNEALVINVGDTLQILSNGKYKSAEHRVRTTNIGSRVSVPIFTA  306

Query  323   PDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             P+P  ++GPLP+V+       YKEL++ DY+ +FF + HDGK++++FA+
Sbjct  307   PNPSEKIGPLPQVVKRDGVARYKELLFQDYMNNFFSQPHDGKKSLDFAR  355



>emb|CDY57296.1| BnaC03g73310D [Brassica napus]
Length=357

 Score =   360 bits (925),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 174/349 (50%), Positives = 237/349 (68%), Gaps = 8/349 (2%)
 Frame = -3

Query  1211  VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAA-NAIVADDSIPTIDISNWDDP--  1041
             + DFVV +G GVKGL D G+  +P  ++QPP ERIA  N    + + P ID+S  D P  
Sbjct  11    LFDFVVKQGNGVKGLIDSGMSCVPQPFVQPPSERIATLNGQTCEAAQP-IDLSQLDGPHH  69

Query  1040  -AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENV  864
               V++ + EAAE  GFFQ++NHGV VELLE LK + + FF+ P E K  Y K  SPS+ V
Sbjct  70    KEVAKQIVEAAETLGFFQVVNHGVSVELLELLKMSAHEFFEQPPENKAVYLKEVSPSKLV  129

Query  863   RYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEML  684
             +YGTSF PE EK +EWKDY+S+ Y +D EA   WP  CR  A+ ++     M+K ++++L
Sbjct  130   KYGTSFVPEKEKAIEWKDYVSMLYTNDHEALQHWPQPCREVALAFLKSSMQMVKRVVKVL  189

Query  683   MSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGG  504
             M  + +  RL++ +    MG K +N NYYP CP+PEL +GVGRHSD+  +TVLLQD IGG
Sbjct  190   MEDVGV--RLEEERMNSLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGMLTVLLQDGIGG  247

Query  503   LHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVT  324
             L+VR  N D W  +PP++ ALVIN+GD LQILSNG+YKSAEHRV       R+SVPIF  
Sbjct  248   LYVRLDNGD-WAEIPPLNEALVINVGDTLQILSNGKYKSAEHRVRTTNIGSRVSVPIFTA  306

Query  323   PDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             P+P  ++GPLP+V+       YKEL++ DY+ +FF + HDGK++++FA+
Sbjct  307   PNPSEKIGPLPQVVKRDGVARYKELLFQDYMNNFFSQPHDGKKSLDFAR  355



>ref|XP_009764116.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Nicotiana sylvestris]
Length=360

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/350 (49%), Positives = 235/350 (67%), Gaps = 5/350 (1%)
 Frame = -3

Query  1211  VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANA--IVADDSIPTIDISNWDDPA  1038
             + DFV+ +  G+KGL D G++ +P Q IQP  +R+  N   I   +SIPTID+SNWDD  
Sbjct  12    IFDFVIKKANGIKGLVDTGLENVPKQCIQPENQRLDKNQLQINIQESIPTIDLSNWDDVN  71

Query  1037  VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS-PSENVR  861
              ++++ EAA +WGFFQIINHG+P+E+LE+LK A +RFF+LP EEK KY K N+ P E+V 
Sbjct  72    AAKSIQEAASKWGFFQIINHGIPIEILENLKEAGHRFFELPAEEKIKYYKENAGPDESVL  131

Query  860   -YGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEML  684
              + ++   + EK LEW+D +       D++  LWPP  R + +EY      + K LLE+L
Sbjct  132   LFWSAIGEKDEKVLEWRDSIKHGCNPGDDSN-LWPPQTRDQVLEYQKWAIPLAKKLLEIL  190

Query  683   MSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGG  504
             + GLN+ E +D + EPL MG   IN NYYP CPNP L +G  RH D+S IT+LLQD  GG
Sbjct  191   LKGLNVNENIDGTLEPLLMGTMAINMNYYPPCPNPSLTIGCRRHCDVSCITILLQDDTGG  250

Query  503   LHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVT  324
             L VR    + W+HV PV GAL +NIGD+LQI+SN RYKS EH  + +    RIS+P FV 
Sbjct  251   LFVRGTKDNNWIHVTPVKGALAVNIGDSLQIMSNDRYKSVEHCAAVDSSKARISIPFFVN  310

Query  323   PDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             P  +  +GP P+VL  GEKP+YK++++SDY  +FF K   GK +++FAKI
Sbjct  311   PRLDTVIGPFPQVLENGEKPVYKQVLFSDYWEYFFSKRPSGKASLDFAKI  360



>ref|XP_009361814.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Pyrus x bretschneideri]
Length=362

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/366 (49%), Positives = 244/366 (67%), Gaps = 17/366 (5%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAA-NAIVADDSIPT  1068
             MAP+   + +S+ +FVV +G GVKG+ D+G+  +P QYIQPP ERI   N  V +  +P 
Sbjct  1     MAPS-FEDGKSLFNFVVRDGNGVKGMVDLGLSKVPEQYIQPPHERIVKLNTSVHE--LPP  57

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S  D P    V+  +  AAE  GFFQ++NH +P+ELLESLK++   FF    E+K  
Sbjct  58    IDLSKLDGPDHDQVANDIANAAEVLGFFQVLNHAIPLELLESLKSSANDFFGQAPEKKAA  117

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS +V+YGTSF PE EK LEWKDY+S+ Y SD +A + WP  C+  A+EY+   
Sbjct  118   YRKGVSPSPHVKYGTSFVPEKEKALEWKDYVSMVYTSDADALSYWPNECKDVALEYLKTS  177

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M+K ++++L++ L +   L+ SK    +G + +N NYYP CP+P+L VGVGRHSD+ T
Sbjct  178   TDMVKKIVKVLIAKLGV--TLEDSKLEALIGLRMVNMNYYPTCPDPDLTVGVGRHSDMGT  235

Query  536   ITVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEH  378
             +TVLLQD IGGL+V KL  D        W+ + PV GALVINIGD LQILSNGRYKSAEH
Sbjct  236   LTVLLQDGIGGLYV-KLEEDMDGGKKGEWIEITPVPGALVINIGDTLQILSNGRYKSAEH  294

Query  377   RVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGK  198
             RV       R+SVPIF  P    R+GPLPEV+       Y+E+V+ DY+ +FF  AHDGK
Sbjct  295   RVRTTSSQSRVSVPIFTIPKATERIGPLPEVVESDGVARYREVVFEDYMNNFFSNAHDGK  354

Query  197   ETIEFA  180
             +++++A
Sbjct  355   KSLDYA  360



>ref|XP_006828760.1| hypothetical protein AMTR_s00001p00076430 [Amborella trichopoda]
 gb|ERM96176.1| hypothetical protein AMTR_s00001p00076430 [Amborella trichopoda]
Length=372

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/363 (50%), Positives = 247/363 (68%), Gaps = 14/363 (4%)
 Frame = -3

Query  1241  APAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSI----  1074
              P   S+   +++ VV EG GVKG+ D GI  LP +YI PP ERI     +  D++    
Sbjct  17    GPTKFSDDGKLLELVVKEGYGVKGMVDSGIAELPQRYIHPPHERIVRKEAI--DALCYLA  74

Query  1073  PTIDISNWDDPA---VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEK  903
               ID+S         V+RA+CE+AE+ GFFQ++NHGVP ELLES+K AT RFF++PVE+K
Sbjct  75    KPIDLSKLGREGGEEVARALCESAEKLGFFQVVNHGVPFELLESMKCATKRFFEMPVEKK  134

Query  902   RKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMT  723
               Y +  +P  NV YGTSF+P+ E  LEWKDYLS+ Y++D+EA   WP  CR  ++EY+ 
Sbjct  135   AMYLRGKTPCPNVFYGTSFAPDKEVCLEWKDYLSMIYMNDEEALKYWPEQCRDVSLEYLK  194

Query  722   QCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDI  543
             +C AMI  +L+ L+ GL +       +   +M AK +N NYYP CPNPEL VGVGRHSD+
Sbjct  195   KCKAMISGILKGLLEGLGVGLEEGALEA--YMEAKAVNLNYYPPCPNPELTVGVGRHSDL  252

Query  542   STITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSAN  363
             + +TVLLQD IGGL+V+      W+ + PV GALVIN+GD L+ILSNGRYKSAEHRV A+
Sbjct  253   AALTVLLQDEIGGLYVKV--DKGWIEISPVPGALVINVGDTLEILSNGRYKSAEHRVMAS  310

Query  362   GGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEF  183
             G  +R+S+PIFV+P P   +GPLP ++  G K +Y  L++ +Y+ ++FG  H GK +++F
Sbjct  311   GSKERVSIPIFVSPRPHTMIGPLPGLVEDG-KAVYGRLLFGEYMANYFGAGHQGKSSLDF  369

Query  182   AKI  174
             A+I
Sbjct  370   ARI  372



>ref|XP_010468586.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Camelina sativa]
Length=375

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/363 (49%), Positives = 246/363 (68%), Gaps = 9/363 (2%)
 Frame = -3

Query  1250  KTMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADDSI  1074
             +T+A     +  ++ +FVV +G GVKG+ D G+ ++P  ++QP  ERI   NA+  + S 
Sbjct  15    ETIAIINFEDQTTLFNFVVKQGNGVKGMIDSGLSSVPQPFVQPQAERIPTQNALTCEASQ  74

Query  1073  PTIDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEK  903
             P ID+S+ D P    V++ + EAAE  GFFQ++NHGV VELLE LKT+ + FF    EEK
Sbjct  75    P-IDLSHLDGPHHKEVAKQIVEAAETLGFFQVVNHGVSVELLELLKTSAHEFFAKAPEEK  133

Query  902   RKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLF-YVSDDEAAALWPPACRHEAMEYM  726
               Y K  +PS+ V+YGTSF P+ EK +EWKDY+S+  Y +D EA   WP  CR  A++++
Sbjct  134   AIYLKEVNPSKLVKYGTSFVPDKEKAIEWKDYVSMIVYTNDHEALQQWPEPCREVALKFL  193

Query  725   TQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSD  546
                  M+KN++ +LM   N+  RL++ +    MG K +N NYYP CP+PEL +GVGRHSD
Sbjct  194   KSSMEMVKNIVNILME--NVGVRLEEERMNGLMGTKMVNMNYYPTCPSPELTIGVGRHSD  251

Query  545   ISTITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSA  366
             +  +TVLLQD IGGL+V KL++  W  +PPV GALVINIGD  QILS G+YKSAEHRV  
Sbjct  252   MGMLTVLLQDGIGGLYV-KLDNGEWAEIPPVHGALVINIGDTFQILSYGKYKSAEHRVRT  310

Query  365   NGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIE  186
                  R+SVPIF  P+P  ++GPLPEV+       YKEL++ DY+ +FFG+ HDGK++++
Sbjct  311   TNMGSRVSVPIFTAPNPSEKIGPLPEVVKRDGVARYKELLFKDYMSNFFGQPHDGKKSLD  370

Query  185   FAK  177
             FA+
Sbjct  371   FAR  373



>ref|XP_009613782.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Nicotiana tomentosiformis]
Length=360

 Score =   359 bits (921),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/355 (49%), Positives = 240/355 (68%), Gaps = 6/355 (2%)
 Frame = -3

Query  1223  ESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADD--SIPTIDISNW  1050
             E+  + DFV+ +  G+KGL D G++ +P Q IQP  +R+  N +  D+  SIPTID+SNW
Sbjct  7     EAVDIFDFVIKKANGIKGLVDTGLENVPKQCIQPKDQRLDKNQLHIDNQESIPTIDLSNW  66

Query  1049  DDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS-PS  873
             DD  V +++ EAA +WGFFQIINHG+P+E+LE+LK A +RFF+LP EEK KY K N+ P 
Sbjct  67    DDVNVVKSIQEAASKWGFFQIINHGIPIEVLENLKEAGHRFFELPAEEKIKYYKENAGPD  126

Query  872   ENVR-YGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNL  696
             E+V  + ++   + EK LEW+D +       D++  LWPP  R + +EY      + K L
Sbjct  127   ESVLLFWSAIGEKDEKVLEWRDSIKHGCNPGDDSD-LWPPQTREQVLEYEKWAIPLAKKL  185

Query  695   LEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQD  516
             LE+L+ GLN+ E +D++ EPL MG   IN NYYP CPNP L +G  RH D+S IT+LLQD
Sbjct  186   LEILLKGLNVNENIDETLEPLLMGTMAININYYPPCPNPSLTIGCRRHCDVSCITILLQD  245

Query  515   HIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVP  336
               GGL V+    + W+HV PV GAL +NIGD+LQI+SN RYKS EH  + +    RIS+P
Sbjct  246   DTGGLFVQGTKDNNWIHVTPVKGALAVNIGDSLQIMSNDRYKSVEHCAAVDSSKARISIP  305

Query  335   IFVTPDPECRVGPLPEVL-AGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +FV P  +  +GP P+VL   GEKP+YK+L++SDY  +FF K   GK +++FAKI
Sbjct  306   LFVNPRLDTVIGPFPQVLETDGEKPVYKQLLFSDYWEYFFSKRPSGKASLDFAKI  360



>ref|XP_006340353.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Solanum tuberosum]
Length=357

 Score =   357 bits (915),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/358 (46%), Positives = 243/358 (68%), Gaps = 4/358 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M  +    ++ + DFV+ +  G+KG++D  ++ +P+Q IQP ++R+  + I   +SIPTI
Sbjct  1     MPSSKFEPNDDIFDFVIKKANGLKGIADTSLEIIPNQCIQPKEQRLDKSQIDNQESIPTI  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D+SN+DD  V +++ EAA +WGFFQIINHG+P+E+LE LK A ++FF+LP EEK KY K 
Sbjct  61    DLSNFDDLNVEKSIQEAANKWGFFQIINHGIPIEVLEDLKEAGHKFFELPAEEKVKYYKE  120

Query  884   NSPSEN--VRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             N+ ++   + Y ++   + EK LEW+D +     + +  + LWPP  R++ +EY      
Sbjct  121   NAGADESVLLYWSAIGVKDEKVLEWRDSIK-HGCNLENDSNLWPPQTRNQVLEYQKWAKP  179

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             + K LLE+L+ GLN+ E +D+S EPL MG   IN NYYP CPNP + +G  RH D+S IT
Sbjct  180   LAKKLLEVLLKGLNVNE-IDESLEPLLMGTMAININYYPPCPNPSITIGCRRHCDVSCIT  238

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +LLQD  GGL+VR    D W+HV P+ GAL +NIGD+LQI+SN RYKS EH V+ +    
Sbjct  239   LLLQDDTGGLYVRGTKGDNWIHVNPIKGALAVNIGDSLQIMSNDRYKSIEHCVAVDSSRA  298

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
             RISVP+FV P  +  +GP P++L  GEKP+YK++++SDY  +FF K   GK +++FAK
Sbjct  299   RISVPLFVNPSLDTVIGPFPQMLKDGEKPVYKQVLFSDYWDYFFSKRPSGKASLDFAK  356



>emb|CAN80862.1| hypothetical protein VITISV_011327 [Vitis vinifera]
Length=366

 Score =   357 bits (915),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 178/367 (49%), Positives = 244/367 (66%), Gaps = 14/367 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+   + +S+ +FVV +G GVKG+ D+G++ +P QYIQP  ERI      + D  P I
Sbjct  1     MAPS-FDDGDSLYNFVVRDGNGVKGMVDLGLEKVPEQYIQPQHERIDKLKASSYDR-PPI  58

Query  1064  DISNWDDPAVSRA---VCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S    P  S+    + EAAE  GFFQ++NHGVP E+LES+K+A + FF    E+K  Y
Sbjct  59    DLSMLGGPQHSQVMELIAEAAESVGFFQVVNHGVPNEVLESVKSAAHEFFGQAPEKKAVY  118

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS  V+YGTSF PE EK LEWKDY+S+ Y SD +A   WP  C+  A+E++    
Sbjct  119   RKGVSPSPYVKYGTSFVPEKEKALEWKDYVSMVYTSDADAFEFWPNECKEVALEFLKASI  178

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
             +M++ +LE+LM  L +   LD+S+    +G K +N N+YP CPNP+L VGVGRHSD+  +
Sbjct  179   SMVRRILEVLMEKLGV--TLDESRIDGLIGLKMVNMNFYPTCPNPDLTVGVGRHSDMGML  236

Query  533   TVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             TVLLQD IGGL+V+     T       WV +PP  GALVIN+GD LQILSNG+YKSAEHR
Sbjct  237   TVLLQDGIGGLYVKMEEDITGAGKKGEWVEIPPTPGALVINVGDTLQILSNGKYKSAEHR  296

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V       R+S+PIF  P P  ++GPLP+V+       Y+E+V  +Y+ +FFGKAH+GK+
Sbjct  297   VRTTSTQSRVSIPIFTIPRPNEKIGPLPQVVERDGVAHYREVVXEEYMNNFFGKAHEGKK  356

Query  194   TIEFAKI  174
             +++FA+I
Sbjct  357   SLDFAQI  363



>ref|XP_010644912.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Vitis vinifera]
Length=366

 Score =   357 bits (915),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 178/367 (49%), Positives = 244/367 (66%), Gaps = 14/367 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+   + +S+ +FVV +G GVKG+ D+G++ +P QYIQP  ERI      + D  P I
Sbjct  1     MAPS-FDDGDSLYNFVVRDGNGVKGMVDLGLEKVPEQYIQPQHERIDKLKASSYDR-PPI  58

Query  1064  DISNWDDPAVSRA---VCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S    P  S+    + EAAE  GFFQ++NHGVP E+LES+K+A + FF    E+K  Y
Sbjct  59    DLSMLGGPQHSQVMELIAEAAESVGFFQVVNHGVPNEVLESVKSAAHEFFGQAPEKKAVY  118

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS  V+YGTSF PE EK LEWKDY+S+ Y SD +A   WP  C+  A+E++    
Sbjct  119   RKGVSPSPYVKYGTSFVPEKEKALEWKDYVSMVYTSDADAFEFWPNECKEVALEFLKASI  178

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
             +M++ +LE+LM  L +   LD+S+    +G K +N N+YP CPNP+L VGVGRHSD+  +
Sbjct  179   SMVRRILEVLMEKLGV--TLDESRIDGLIGLKMVNMNFYPTCPNPDLTVGVGRHSDMGML  236

Query  533   TVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             TVLLQD IGGL+V+     T       WV +PP  GALVIN+GD LQILSNG+YKSAEHR
Sbjct  237   TVLLQDGIGGLYVKMEEDITGAGKKGEWVEIPPTPGALVINVGDTLQILSNGKYKSAEHR  296

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V       R+S+PIF  P P  ++GPLP+V+       Y+E+V  +Y+ +FFGKAH+GK+
Sbjct  297   VRTTSTQSRVSIPIFTIPRPNEKIGPLPQVVERDGVAHYREVVVEEYMNNFFGKAHEGKK  356

Query  194   TIEFAKI  174
             +++FA+I
Sbjct  357   SLDFAQI  363



>ref|XP_009776994.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1 [Nicotiana sylvestris]
Length=370

 Score =   357 bits (915),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 182/369 (49%), Positives = 244/369 (66%), Gaps = 16/369 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVAD-----D  1080
             MAP+   +   + DFVV +G GVKGL D GIK +P +YIQPP ERI    I +       
Sbjct  1     MAPS-FDDGNFLFDFVVQKGNGVKGLVDNGIKIVPERYIQPPNERIDKKIINSRIQQKYQ  59

Query  1079  SIPTIDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVE  909
              +  ID+S  + P    V R +  AAE  GFFQ+INHG+ +ELLE LK A ++FF  P E
Sbjct  60    ELVAIDLSKLNGPENDQVVRDISIAAETLGFFQVINHGINLELLELLKNAAHKFFSQPPE  119

Query  908   EKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEY  729
             +K  Y K  SPS  V+YGTSF PE E  LEWKDY+S+ Y +D+EA + WP  C+  A+EY
Sbjct  120   KKALYLKGVSPSPLVKYGTSFVPEMEMALEWKDYVSMMYTNDNEALSQWPNECKEVALEY  179

Query  728   MTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHS  549
             +     M++ LLE+L    N+   LD +K     G K +N N+YP CP+PEL VGVGRHS
Sbjct  180   LKSSTKMVRKLLEILFG--NLGATLDDTKFESLTGLKMVNMNFYPTCPSPELTVGVGRHS  237

Query  548   DISTITVLLQDHIGGLHVR-----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSA  384
             D+ T+TVLLQD IGGL+V+     +   D W+ +PP+ GALVIN+GD +QILSNGRYKSA
Sbjct  238   DMGTLTVLLQDGIGGLYVKLEEAVEEGKDEWIEIPPIPGALVINVGDTMQILSNGRYKSA  297

Query  383   EHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHD  204
             EHRV       R+SVP+F TP P  ++GPLP+++       YKE+++ DY+++FFGKAH+
Sbjct  298   EHRVRTTSSESRVSVPLFTTPKPSEKIGPLPQLVEIDGVAHYKEVLFGDYMQNFFGKAHE  357

Query  203   GKETIEFAK  177
             GK++++FAK
Sbjct  358   GKKSLDFAK  366



>ref|XP_006340355.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Solanum tuberosum]
Length=357

 Score =   355 bits (912),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 165/359 (46%), Positives = 243/359 (68%), Gaps = 4/359 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M  +    ++ +++FV+ +  G+KGL D G++ +P+Q IQP  +R+  + I   +SIPTI
Sbjct  1     MPSSKFEPNDDILNFVIKKANGLKGLVDTGLENIPNQCIQPKDQRLEKSQIDNQESIPTI  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             DISN+DD +V +++ +AA +WGFFQIINHG+P+E+L+ LK A ++FF+LP EEK KY+K 
Sbjct  61    DISNFDDLSVEKSIQDAASKWGFFQIINHGIPIEVLDDLKEAGHKFFELPSEEKVKYNKE  120

Query  884   --NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
               N+    + + ++   + EK LEW+D +     +    + LWPP  R++ +EY      
Sbjct  121   SYNASESVLMFWSAIGEKDEKVLEWRDGIR-HSCNPQNDSNLWPPQTRNQVLEYQKWATP  179

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             + K LLE+L+ GLN+ E +D+S EPL MG   IN NYYP CPNP +A+G  RH D+S IT
Sbjct  180   LAKKLLEVLLKGLNVNE-IDESLEPLLMGTMAININYYPPCPNPSIAIGFRRHCDMSCIT  238

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +LLQD  GGL+V+    D W+HV P+ GAL +NIG++LQI+SN RYKS EH V+ +    
Sbjct  239   LLLQDDTGGLYVQGTKGDNWIHVNPIKGALAVNIGNSLQIMSNDRYKSIEHCVAVDSSRA  298

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             RISVP+FV P P+  +GP P++L  GEK +YK +++SDY  H+F K   GK +++FAKI
Sbjct  299   RISVPLFVNPSPDSVIGPFPQILKDGEKSMYKHVLFSDYWDHYFSKRPSGKASLDFAKI  357



>emb|CDP13111.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/369 (49%), Positives = 239/369 (65%), Gaps = 16/369 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADD--SIP  1071
             MAP    +  S+ DFVV +G GVKGL D GI  +P ++IQPP ERI      + D  S  
Sbjct  1     MAPT-FDDGNSLFDFVVKDGNGVKGLVDSGITKVPERFIQPPSERIVKVVQSSKDHFSAV  59

Query  1070  TIDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKR  900
              ID+S  D P    V  A+  AAE  GFFQ+INHGV  +LLESLK A +RFF  P + K 
Sbjct  60    PIDLSKLDGPDHDQVVEAIVRAAETLGFFQVINHGVSFDLLESLKNAAHRFFAQPADAKA  119

Query  899   KYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQ  720
              Y K  SPS  V+YGTSF+PE EK LEWKD++S+ Y +D +A   WP  C+ EA+EY+  
Sbjct  120   VYLKRVSPSPLVKYGTSFAPEQEKALEWKDFVSMVYTNDGDAQQHWPKVCKEEALEYLKL  179

Query  719   CNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIS  540
              + M++ LLE+L+  L +   LD S+     G K +N N+YP CPNPEL VGVGRHSD+S
Sbjct  180   SSKMVRRLLEILIGNLGVA--LDDSRLESLTGNKIVNMNFYPICPNPELTVGVGRHSDMS  237

Query  539   TITVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAE  381
              +TVLLQD++GGL+V KL  D        W+ +PP+ GALVIN GD+LQILSNGRY+SAE
Sbjct  238   ILTVLLQDNVGGLYV-KLEEDILDGRKEEWIEIPPIPGALVINAGDSLQILSNGRYRSAE  296

Query  380   HRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDG  201
             H V       R+S+P+F  P P  ++GPLP V       +Y+E+++ +Y+ +  G AHDG
Sbjct  297   HGVRTTSKQSRVSIPVFNLPRPSEKIGPLPHVAEVDGGAVYREVMFEEYMSNHVGHAHDG  356

Query  200   KETIEFAKI  174
             K++++F KI
Sbjct  357   KKSLDFVKI  365



>ref|XP_004488807.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Cicer arietinum]
Length=364

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/359 (49%), Positives = 239/359 (67%), Gaps = 11/359 (3%)
 Frame = -3

Query  1226  SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWD  1047
             + S S+ +FVV +G GVKGL D G+  +P  YIQP  ERI        D +P ID+S  +
Sbjct  6     NSSNSLYNFVVKDGNGVKGLVDSGLSQVPKLYIQPLNERINKVDSKPCD-MPPIDLSKLN  64

Query  1046  DPAVSRAVCE---AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSP  876
              P   + V E   AAE  GFFQ++NH VP+ELLESLK + + FF LP +EK  Y K+ SP
Sbjct  65    GPEHEKVVDEIVRAAETLGFFQVVNHCVPLELLESLKDSAHTFFNLPPKEKVVYRKSVSP  124

Query  875   SENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNL  696
             S  +RY TSF+PE+E  LEWKDY+++ Y +DD+A   WP  C+  A+EY+   + +++ +
Sbjct  125   SLKMRYETSFAPETENVLEWKDYINMVYSNDDDALQYWPSQCKEVALEYLKLSSKIVREM  184

Query  695   LEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQD  516
             LE+L+  L +E  +D+SK     G K +N NYYP CPNPEL VGVGRHSD+ T+TVLLQD
Sbjct  185   LEILIGKLGVE--VDESKIEDIFGLKMVNMNYYPACPNPELTVGVGRHSDMGTLTVLLQD  242

Query  515   HIGGLHVRKLNSDT-----WVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
              IGGL+V+    +      W+ + P+ GALVIN+GDALQILSNG+YKS+EHRV       
Sbjct  243   GIGGLYVKTEEDNAHGNGEWLQILPIHGALVINVGDALQILSNGKYKSSEHRVMTPSTQS  302

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             R+SVP+F  P P  R+GP PE++       Y+EL++ DY+ HFFG  H+GK+ ++FAKI
Sbjct  303   RVSVPLFTLPIPTLRIGPFPELVKKDGFAFYRELLWQDYMDHFFGNPHEGKKNLDFAKI  361



>ref|XP_006422215.1| hypothetical protein CICLE_v10006882mg [Citrus clementina]
 ref|XP_006475536.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Citrus sinensis]
 gb|ESR35455.1| hypothetical protein CICLE_v10006882mg [Citrus clementina]
Length=363

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 240/368 (65%), Gaps = 19/368 (5%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADDSIPT  1068
             MAP+ L + +S+ +FVV +G GVKG+ D+G+  +P  YIQP +ERI   NA +   +   
Sbjct  1     MAPS-LEDGDSLFNFVVQDGNGVKGMVDLGLSKVPQPYIQPQEERIDKKNASICAQA--P  57

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S  D P    V+R +  A+E  GFFQ++NHGVPVELLESLK A + FF     +K  
Sbjct  58    IDLSKLDGPNHEEVARQIARASETLGFFQVVNHGVPVELLESLKDAAHAFFNQTPGKKAV  117

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS  V+YGTSF PE EK LEWKDY+S+ Y +D EA   WP  C   A+EY+   
Sbjct  118   YRKGVSPSPLVKYGTSFVPEKEKALEWKDYISMVYTNDAEALQQWPKECNIVALEYLRTS  177

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M++ LLE+L   L +   LD+ +    +G K +N N+YP CPNPEL VGVGRHSD+  
Sbjct  178   MKMVRKLLEVLFKNLGV--TLDEPELDAIIGFKMVNMNFYPTCPNPELTVGVGRHSDMGA  235

Query  536   ITVLLQDHIGGLHVRKLNSDT--------WVHVPPVDGALVINIGDALQILSNGRYKSAE  381
             +T+LLQD IGGL+V K+  D         W+ +PPV GALVIN+GD LQILSNGRYKSAE
Sbjct  236   LTILLQDGIGGLYV-KVEEDIPDVGKKGEWMEIPPVPGALVINVGDTLQILSNGRYKSAE  294

Query  380   HRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDG  201
             HRV       R+S+PIF  P P  ++GPLP+ L   E   ++E ++ DY+ +FF  AHDG
Sbjct  295   HRVRTTSSKSRVSIPIFTMPKPTVKIGPLPQ-LVEKEGSRFREFLFQDYMNNFFSNAHDG  353

Query  200   KETIEFAK  177
             K++++FA+
Sbjct  354   KKSLDFAR  361



>ref|XP_006422213.1| hypothetical protein CICLE_v10007156mg [Citrus clementina]
 ref|XP_006475535.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Citrus sinensis]
 gb|ESR35453.1| hypothetical protein CICLE_v10007156mg [Citrus clementina]
Length=363

 Score =   353 bits (907),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/364 (48%), Positives = 235/364 (65%), Gaps = 16/364 (4%)
 Frame = -3

Query  1235  AALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDIS  1056
             ++L + +S+  FVV +G GVKG+ D+G+  +P  YIQP +ERI           P ID+S
Sbjct  3     SSLEDRDSLFKFVVQDGNGVKGIVDLGLSKVPQPYIQPQEERIDKKNASTCAQAP-IDLS  61

Query  1055  NWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
               D P    V++ +  A E  GFFQ++NHGVPVELLESLK A + FF+ P E+K  Y + 
Sbjct  62    KLDGPNHEQVAQQIARACETLGFFQVVNHGVPVELLESLKDAAHTFFRQPSEKKAVYREG  121

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
              SPS  V Y TSF+PE EK LEWKDY+++ Y +D EA   WP  C   A+EY+     M+
Sbjct  122   VSPSPLVNYRTSFAPEKEKALEWKDYINMVYTNDAEALEQWPKECNEVALEYLRTSMKMV  181

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             + LLE+L   L +   LD+S+    +G K +N N+YP CPNPEL VGVGRHSD+  +T+L
Sbjct  182   RKLLEVLFKNLGVT--LDESELDAIIGFKMVNMNFYPTCPNPELTVGVGRHSDVGALTIL  239

Query  524   LQDHIGGLHVRKLNSDT--------WVHVPPVDGALVINIGDALQILSNGRYKSAEHRVS  369
             LQD IGGL+VR +  D         W+ +PPV GALVIN+GD LQILSNGRYKSAEHRV 
Sbjct  240   LQDGIGGLYVR-VEEDIPDVGKKGEWMEIPPVPGALVINVGDTLQILSNGRYKSAEHRVR  298

Query  368   ANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETI  189
                   R+S+P F  P P  ++GPLP+ L   E   ++EL++ DY  +FF  AHDGK+++
Sbjct  299   TTSSKSRVSIPFFTMPKPTVKIGPLPQ-LVEKEGSRFRELLFQDYRNNFFSNAHDGKKSL  357

Query  188   EFAK  177
             +FA+
Sbjct  358   DFAR  361



>ref|XP_006340351.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Solanum tuberosum]
Length=357

 Score =   353 bits (906),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 240/359 (67%), Gaps = 4/359 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M+ +    ++ + DFV+ +  G+KGL D  ++ +P+Q IQP ++R+  + I   +SIP I
Sbjct  1     MSSSKFEPNDDIFDFVIKKANGIKGLVDTNLEIIPNQCIQPKEQRLDKSQIDNQESIPII  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D+SN+DD  V +++ EAA +WGFFQIINHG+P E+LE LK A ++FF+LP EEK KY K 
Sbjct  61    DLSNFDDLNVEKSIQEAASKWGFFQIINHGIPTEVLEDLKDAAHKFFELPAEEKVKYRKE  120

Query  884   N-SPSENV-RYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
               SP E+V  + ++   + EK LEW+D +     +    + LWPP  R++ +EY      
Sbjct  121   KLSPGESVFMFWSAIGEKDEKVLEWRDGIK-HGCNPQNDSNLWPPQTRNQVLEYQKWAKP  179

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             + K LLE+L+ GLN+ E +D+S EPLFMG   IN NYYP CPNP +A+G  RH D+  I 
Sbjct  180   LAKKLLEVLLKGLNVNE-IDESLEPLFMGTMSININYYPPCPNPNIAMGFRRHCDMGCII  238

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +LLQD  GGL+VR    D W+H+ P+ GAL +NIGD+LQI+SN RYKS EH V+ +    
Sbjct  239   LLLQDDTGGLYVRGTKGDNWIHINPIKGALAVNIGDSLQIMSNDRYKSIEHCVAVDSSKA  298

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             RISVP+FV P  +  +GP P++L  GEKP+YK +++SDY  +FF K   GK +++FAKI
Sbjct  299   RISVPLFVNPSLDSIIGPFPQMLKDGEKPVYKHVLFSDYWDYFFSKRPSGKASLDFAKI  357



>gb|KDO61641.1| hypothetical protein CISIN_1g017959mg [Citrus sinensis]
Length=363

 Score =   353 bits (906),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 239/368 (65%), Gaps = 19/368 (5%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADDSIPT  1068
             MAP+ L + +S+ +FVV +G GVKG+ D+G+  +P  YIQP +ERI   NA +   +   
Sbjct  1     MAPS-LEDGDSLFNFVVQDGNGVKGMVDLGLSKVPQPYIQPQEERIDKKNASICAQA--P  57

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S  D P    V+R +  A+E  GFFQ++NHGVPVELLESLK A + FF     +K  
Sbjct  58    IDLSKLDGPNHEEVARQIARASETLGFFQVVNHGVPVELLESLKDAAHAFFNQTPGKKAV  117

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS  V+YGTSF PE EK LEWKDY+S+ Y +D EA   WP  C   A+EY+   
Sbjct  118   YRKGVSPSPLVKYGTSFVPEKEKALEWKDYISMVYTNDAEALQQWPKECNIVALEYLRTS  177

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M++ LLE+L   L +   LD+ +    +G K +N N+YP CPNPEL VGVGRHSD+  
Sbjct  178   MKMVRKLLEVLFKNLGVT--LDEPELDAIIGFKMVNMNFYPTCPNPELTVGVGRHSDMGA  235

Query  536   ITVLLQDHIGGLHVRKLNSDT--------WVHVPPVDGALVINIGDALQILSNGRYKSAE  381
             +T+LLQD IGGL+V K+  D         W+ +PPV GALVIN+GD LQILSNGRYKSAE
Sbjct  236   LTILLQDGIGGLYV-KVEEDIPDVGKKGEWMEIPPVPGALVINVGDTLQILSNGRYKSAE  294

Query  380   HRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDG  201
             HRV       R+S+PIF  P P  ++GPLP+ L   E   ++E ++ DY  +FF  AHDG
Sbjct  295   HRVRTTSSKSRVSIPIFTMPKPTVKIGPLPQ-LVEKEGSRFREFLFQDYRNNFFSNAHDG  353

Query  200   KETIEFAK  177
             K++++FA+
Sbjct  354   KKSLDFAR  361



>ref|XP_003625733.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|AES81951.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=335

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 237/347 (68%), Gaps = 18/347 (5%)
 Frame = -3

Query  1214  SVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAV  1035
             +++DF+VN+  GVK   D   K +P                 ++ SIP ID +NW+D  V
Sbjct  7     NLIDFLVNQANGVKARLD-KCKIIPQD---------------SEQSIPIIDFTNWEDIQV  50

Query  1034  SRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYG  855
               ++  AA +WGFFQI+NHG+P+  ++ LK + ++FF+LPVEEK+   K NSP + VR  
Sbjct  51    QDSIFSAATKWGFFQIVNHGIPINAVDDLKASVHKFFELPVEEKKSL-KENSPPDVVRLA  109

Query  854   TSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSG  675
             TSFSP +E  LEWKD+L L Y S+++  A WPP C+ +A+EYM    A I+ LL++L+  
Sbjct  110   TSFSPHAESVLEWKDHLHLVYTSEEKIHAYWPPVCKDQALEYMKYAEAFIRKLLKVLLKK  169

Query  674   LNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHV  495
             LN++E L + +E   M    + F YYP CP PEL  GV  HSDI++ITVLLQD IGGL+V
Sbjct  170   LNVKE-LGREREHALMDTMSLGFVYYPACPAPELVSGVSPHSDITSITVLLQDDIGGLYV  228

Query  494   RKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDP  315
             R  +SD W++VPPV+GALV+NIGD LQI+SN  YKS EHRV AN    RIS+PIFV P P
Sbjct  229   RGKDSDGWINVPPVNGALVVNIGDVLQIMSNECYKSIEHRVVANRNKTRISMPIFVNPAP  288

Query  314   ECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +  +GPL + L  G++PLYK++VYSDY  HFF KAHDGK+TIEFAKI
Sbjct  289   DAIIGPLSKTLKNGDEPLYKQVVYSDYFNHFFSKAHDGKKTIEFAKI  335



>gb|KDO61642.1| hypothetical protein CISIN_1g046101mg [Citrus sinensis]
Length=363

 Score =   352 bits (902),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 175/364 (48%), Positives = 234/364 (64%), Gaps = 16/364 (4%)
 Frame = -3

Query  1235  AALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDIS  1056
             ++L + +S+  FVV +G GVKG+ D+G+  +P  YIQP +ERI           P ID+S
Sbjct  3     SSLEDRDSLFKFVVQDGNGVKGIVDLGLSKVPQPYIQPQEERIDKKNASTCAQAP-IDLS  61

Query  1055  NWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
               D P    V++ +  A E  GFFQ++NHGVPVELLESLK A + FF  P E+K  Y + 
Sbjct  62    KLDGPNHEQVAQQIARACETLGFFQVVNHGVPVELLESLKDAAHTFFCQPSEKKAVYREG  121

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
              SPS  V Y TSF+PE EK LEWKDY+++ Y +D EA   WP  C   A+EY+     M+
Sbjct  122   VSPSPLVNYRTSFAPEKEKALEWKDYINMVYTNDAEALEQWPKECNEVALEYLRTSMKMV  181

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             + LLE+L   L +   LD+S+    +G K +N N+YP CPNPEL VGVGRHSD+  +T+L
Sbjct  182   RKLLEVLFKNLGV--TLDESELDAIIGFKMVNMNFYPTCPNPELTVGVGRHSDVGALTIL  239

Query  524   LQDHIGGLHVRKLNSDT--------WVHVPPVDGALVINIGDALQILSNGRYKSAEHRVS  369
             LQD IGGL+VR +  D         W+ +PPV GALVIN+GD LQILSNGRYKSAEHRV 
Sbjct  240   LQDGIGGLYVR-VEEDIPDVGKKGEWMEIPPVPGALVINVGDTLQILSNGRYKSAEHRVR  298

Query  368   ANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETI  189
                   R+S+P F  P P  ++GPLP+ L   E   ++EL++ DY  +FF  AHDGK+++
Sbjct  299   TTSSKSRVSIPFFTMPKPTVKIGPLPQ-LVEKEGSRFRELLFQDYRNNFFSNAHDGKKSL  357

Query  188   EFAK  177
             +FA+
Sbjct  358   DFAR  361



>ref|XP_010519828.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2 [Tarenaya hassleriana]
Length=359

 Score =   351 bits (900),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 238/351 (68%), Gaps = 8/351 (2%)
 Frame = -3

Query  1211  VVDFVVNEGRGVKGLSDM-GIKALPSQYIQPPKERIAANAIVADDSIPT--IDISNWDDP  1041
             V +FVVN+  GVKGL D+   K+LP QY+QPP+E ++A  I+A  S P   ID+S+W DP
Sbjct  10    VTEFVVNQRNGVKGLVDVVSPKSLPPQYVQPPEELLSAGNILAPGSSPVNVIDVSDWTDP  69

Query  1040  AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVR  861
              V+  +CEAA   GFFQI+ HG+P E L +L+ A   FF L  EE+++Y + +S SE + 
Sbjct  70    RVAEEICEAASTRGFFQIVGHGIPAEELHALRAAARGFFGLAAEERKRYWRGDSVSETMW  129

Query  860   YGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLM  681
               TSF+P  E+ LEW+D++   Y   +++AA WP  C+ + +E+  +   + K +L +LM
Sbjct  130   MTTSFNPYEEQVLEWRDFVKFEYPETEDSAATWPSVCKEQVIEHFKRIRPIAKKMLSILM  189

Query  680   SGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDH-IGG  504
               LN    +D  +E   MG  R+NFNYYP+CPNPELA GVGRHSDI+T+T+LLQD  +GG
Sbjct  190   IKLN--SNMDDDQERTLMGTLRMNFNYYPECPNPELAAGVGRHSDINTLTILLQDDVVGG  247

Query  503   LHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFV  327
             L+ R   + D W+ VPPV+ AL++NIGD LQILSN RY+S EHRV+ N  S R+S+P+F 
Sbjct  248   LYARATEHGDKWIQVPPVEDALLVNIGDVLQILSNDRYRSVEHRVTPNRVS-RVSIPVFC  306

Query  326   TPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P  +  + PL E L  GE P YK++VYSDYL+ FFGK HDGK T+E  +I
Sbjct  307   GPVNDSVIEPLREALEKGEMPRYKKIVYSDYLKSFFGKPHDGKRTMESIRI  357



>ref|XP_004251440.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Solanum lycopersicum]
Length=357

 Score =   350 bits (899),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 167/359 (47%), Positives = 246/359 (69%), Gaps = 4/359 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M+ +    ++ ++DFV+ +  G+KGL D  ++ +PSQ IQP ++R+  +     +SIPTI
Sbjct  1     MSLSKFEPNDDILDFVIKKANGLKGLVDTNLEVIPSQCIQPKEQRLDKSQTDNQESIPTI  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS-K  888
             D+SN+DD +V +++ EAA +WGFFQIINHG+P+E+L+ LK A ++FF+LP EEK KYS +
Sbjct  61    DLSNFDDLSVEKSIQEAASKWGFFQIINHGIPIEVLDDLKEAGHKFFELPAEEKVKYSTE  120

Query  887   ANSPSENV-RYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             + S  E+V  + ++   + EK LEW+D +       +++  LWP   R++ +EY      
Sbjct  121   SYSAGESVLMFWSAIGEKDEKVLEWRDTIRQGCNPQNDSN-LWPSQTRNQVLEYQKWATP  179

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             + K LLE+L+ GL++ E +D+S EPL MG K IN NYYP CPNP +A+G+ RH D+S IT
Sbjct  180   LAKKLLEVLLKGLDVNE-IDESLEPLLMGTKAININYYPPCPNPSIAIGIRRHCDVSCIT  238

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +LLQD  GGL+VR    D W+HV P+ GAL +NIG++LQI+SN RYKS EH VS +    
Sbjct  239   LLLQDDTGGLYVRGTKGDNWIHVNPIKGALEVNIGNSLQIMSNDRYKSIEHCVSVDSNRG  298

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             RISVP+F+ P  +  +GP P++L  GEK +YK ++YSDY  H+F K   GK +++FAKI
Sbjct  299   RISVPLFLNPSLDSVIGPFPQMLKDGEKLVYKHVLYSDYWDHYFTKRPSGKASLDFAKI  357



>ref|XP_004251239.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Solanum lycopersicum]
Length=357

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/359 (45%), Positives = 240/359 (67%), Gaps = 4/359 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M  +    ++ + DFV+ +  G+KG++D  ++ +P+Q IQP ++R+  + I   +SIPTI
Sbjct  1     MPSSKFEPNDDIFDFVIKKANGLKGIADTSLEIIPNQCIQPEEQRLDKSQIDNQESIPTI  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D+SN+DD  + +++ EAA +WGFFQIINHG+P+E+LE LK A ++FF+LP EEK KY + 
Sbjct  61    DLSNFDDLNIEKSIQEAASKWGFFQIINHGIPIEVLEDLKEAGHKFFELPAEEKAKYYRE  120

Query  884   NSPSEN--VRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             N+ ++   + Y ++   + EK +EW+D +     +    + LWPP  R++ +EY      
Sbjct  121   NAGADESVLLYWSAIGDKDEKVIEWRDSIK-HGCNPQNDSNLWPPQTRNQVLEYQKWATP  179

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             + K LLE+L+ GLN+ E +D+S EPL MG   IN NYYP CPNP + +G  RH D+S IT
Sbjct  180   LAKKLLEVLLKGLNVNE-IDESLEPLLMGTMAININYYPPCPNPSITIGCRRHCDVSCIT  238

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +LLQD  GGL+VR    D W+HV P+  AL +NIGD+LQI+SN RYKS EH V+ +    
Sbjct  239   LLLQDDTGGLYVRGTKGDNWIHVNPIKDALAVNIGDSLQIMSNDRYKSIEHCVAVDSSRA  298

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             RISVP+FV P  +  +GP  ++L  GEKP+YK +++SDY  +FF K   GK +++FAKI
Sbjct  299   RISVPLFVNPSLDSVIGPFSQMLKDGEKPVYKHVLFSDYWDYFFSKRPSGKASLDFAKI  357



>ref|XP_007022207.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
[Theobroma cacao]
 gb|EOY13732.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
[Theobroma cacao]
Length=351

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 229/355 (65%), Gaps = 15/355 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+   +S S+ +FVV +G GVKG+ D+G+  +P  Y+QPPKERI        +  P I
Sbjct  1     MAPS-FDDSSSLFNFVVRDGNGVKGMVDLGLSKVPQAYMQPPKERIDKQNASKHEQ-PPI  58

Query  1064  DISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  D P    V++ +  AAE  GFFQ++NHGVPV+LLESLK   ++FF LP E K  Y
Sbjct  59    DLSRLDGPYHDEVAKEIVRAAETLGFFQVVNHGVPVDLLESLKDTAHKFFGLPPERKAVY  118

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
                 SP+  V+YGTSF PE EK LEWKDY+S+ Y +D E    WP  CR  A+EY+    
Sbjct  119   RTEVSPTSLVKYGTSFVPEKEKALEWKDYISMVYTNDAEVLEHWPIECREVAIEYLKTSL  178

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              M+K LL +LM  L +E  LD SK    +G K ++ NYYP CPNPEL VGVGRHSD+ T+
Sbjct  179   EMVKKLLHVLMRNLGVE--LDDSKIDSLIGRKTVHMNYYPTCPNPELTVGVGRHSDMGTL  236

Query  533   TVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             TVLL D IGGL+V  +  DT       WV +PP+ GALVIN+GD LQILSNGRYKSAEHR
Sbjct  237   TVLLHDGIGGLYV-NVPEDTDIGKKGEWVEIPPIPGALVINVGDMLQILSNGRYKSAEHR  295

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKA  210
             V       R+S+PIF  P P  ++ PLP+V+       Y+E + +DY+ +FF K+
Sbjct  296   VRTTSAKSRVSIPIFTIPKPTEKIAPLPQVVEKDGIAHYREFLLADYMNNFFWKS  350



>ref|XP_006340352.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Solanum tuberosum]
Length=356

 Score =   348 bits (893),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 167/359 (47%), Positives = 242/359 (67%), Gaps = 5/359 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M+ +    ++ ++DFV+ +  G+KGL D  ++ +P+Q IQP ++R+  + I   +SIPTI
Sbjct  1     MSSSKFEPNDDILDFVIKKANGLKGLVDTNLEIIPNQCIQPKEQRLNKSQIDNQESIPTI  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             ++SN+DD  V +++ EAA +WGFFQIINHG+P+E+LE+LK A ++FF+LP EEK KY K 
Sbjct  61    NLSNFDDLNVEKSIQEAASKWGFFQIINHGIPIEVLENLKDAAHKFFELPAEEKVKYHKE  120

Query  884   N-SPSENV-RYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
               SP E+V  + ++   + EK LEW+D +     +    + LWPP  R + +EY      
Sbjct  121   KVSPGESVLMFWSAIGEKDEKVLEWRDTIR-HGCNPQNDSNLWPPQTRDQVLEYKKWVKP  179

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             + K LLE+L+ GLN+ E +D+S EPL MG   IN NYYP CPNP +A+G  RH D+  IT
Sbjct  180   LAKKLLEVLLKGLNVNE-IDESLEPLLMGTMSININYYPPCPNPSIAIGFRRHCDMDCIT  238

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +LLQ+  GGL+VR    D W+HV P+ GAL +NIGD+LQI+SN RYKS EH V+ +    
Sbjct  239   LLLQNDTGGLYVRG-TKDNWIHVNPIKGALAVNIGDSLQIMSNDRYKSIEHCVAVDSSRA  297

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             RIS+P+FV P  +  +GP P++L  GEKP+YK +++SDY  H F K   GK +++FAKI
Sbjct  298   RISIPLFVNPSFDSVIGPFPQILKDGEKPVYKHILFSDYWDHCFIKRPSGKASLDFAKI  356



>ref|XP_002513396.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF48799.1| leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=677

 Score =   357 bits (915),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 179/361 (50%), Positives = 240/361 (66%), Gaps = 14/361 (4%)
 Frame = -3

Query  1244  MAPA-ALSESE-SVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIP  1071
             MAPA + S+++ S+ +FVV +G GVKG+ D G+  +P QY+QP +ERI   +   +D+ P
Sbjct  1     MAPAPSFSDADGSLFNFVVRDGNGVKGIVDSGLSKVPKQYVQPQQERIDKLSATLNDN-P  59

Query  1070  TIDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKR  900
              ID++  D P    V   +  AAE  GFFQ++NHGVP+ELLESLK A + FF  P E+K 
Sbjct  60    PIDLAKLDGPDHDQVVEEIARAAETLGFFQVVNHGVPIELLESLKDAAHSFFGQPPEKKA  119

Query  899   KYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQ  720
              Y K  SPS  V+YGTSF PE EK +EWKDY+S+ Y SD EA   WP  C+  A+EY+  
Sbjct  120   VYCKGVSPSPLVKYGTSFVPEKEKAMEWKDYVSMIYTSDAEALQFWPKECKDVALEYVRT  179

Query  719   CNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIS  540
                M++ LLE LM  L +   LD +K    +G K +N N+YP+CPNPEL VGVGRHSD+ 
Sbjct  180   SIKMVRKLLEALMVKLGV--NLDDAKMDELIGLKMVNMNFYPRCPNPELTVGVGRHSDLG  237

Query  539   TITVLLQDHIGGLHVR-KLNSD-----TWVHVPPVDGALVINIGDALQILSNGRYKSAEH  378
             T+T+LLQD IGGL+V+ + N D      W+ +PPV GALVIN+GD LQI+SNG+YKSAEH
Sbjct  238   TLTILLQDGIGGLYVKVEENVDGKKKGEWMEIPPVPGALVINVGDTLQIVSNGKYKSAEH  297

Query  377   RVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGK  198
             RV       R+S+PIF  P    ++GPL +V+       Y+E+V+ DY+ +FF  AHDGK
Sbjct  298   RVRTTSTQSRVSIPIFTIPRGSVKIGPLAQVVEKDGVARYREVVFEDYMNNFFSNAHDGK  357

Query  197   E  195
             +
Sbjct  358   K  358


 Score =   335 bits (860),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/310 (52%), Positives = 213/310 (69%), Gaps = 13/310 (4%)
 Frame = -3

Query  1073  PTIDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEK  903
             P ID+S  D P    V  A+ +AAE  GFFQ++NHGV +ELLESLK A +RFF  P E+K
Sbjct  370   PPIDLSKLDGPDHNQVVEALAKAAETLGFFQVVNHGVRIELLESLKAAAHRFFSQPPEKK  429

Query  902   RKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMT  723
               Y K  SPS  V+YGTSF+PE EK LEWKDY+S+ Y +D EA   WP  C+  A+EY+ 
Sbjct  430   AVYLKGVSPSPLVKYGTSFAPEKEKALEWKDYVSMVYSNDAEALEFWPKECKDVALEYLR  489

Query  722   QCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDI  543
                 M++ +LE+L+  L +  +LD ++    +G K +N N+YP CPNPEL VGVGRHSD+
Sbjct  490   TSVNMVRKVLEILIEKLGV--KLDDAEIEALIGLKMVNINFYPTCPNPELTVGVGRHSDM  547

Query  542   STITVLLQDHIGGLHVR-------KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSA  384
              T+TVLLQD IGGL+V+       K   D W+ +PPV GALVIN+GD LQILSNG+YKSA
Sbjct  548   GTLTVLLQDEIGGLYVKVEETIDGKKKGD-WMEIPPVPGALVINVGDTLQILSNGKYKSA  606

Query  383   EHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHD  204
             EHRV       R+S+PIF  P P  ++GPLP+ +      LY+E+V+ DY+ +FFG AH+
Sbjct  607   EHRVRTTSAKSRVSIPIFTIPKPTVKIGPLPQTVDKDGVALYREVVFGDYMNNFFGNAHE  666

Query  203   GKETIEFAKI  174
             GK+++EFA+I
Sbjct  667   GKKSLEFARI  676



>gb|KHN26841.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=366

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 179/363 (49%), Positives = 239/363 (66%), Gaps = 13/363 (4%)
 Frame = -3

Query  1232  ALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISN  1053
             + + S S+ DFVV EG GVKG+SD+G+  +P +YIQPP+ERI        D+ P ID+S 
Sbjct  4     SFNTSNSLYDFVVREGNGVKGVSDLGLPEVPDRYIQPPEERINKQESRTCDA-PPIDLSK  62

Query  1052  WDDPAVSRAVCE---AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKAN  882
              +     + V E   AAE  GFFQ++NHGVP+ELLESLK   ++FF LP+E+K  Y    
Sbjct  63    LNGLEHEKVVDEIVRAAETLGFFQVVNHGVPLELLESLKHTAHKFFSLPLEKKTLYRAGV  122

Query  881   SPSENV-RYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             SP+  V R  TSF PE EKT EWKDY+S+ Y SD+EA   WP  CR   +EY+   + M+
Sbjct  123   SPAGPVTRLATSFVPEKEKTWEWKDYISMIYRSDEEALQYWPNLCRELVLEYLKLSSKMV  182

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             + ++E+L+  L +   +D SK    MG K +NFNYYP CPNPEL VG+GRHSD+ TITVL
Sbjct  183   RGIVEILIRNLGV--TIDDSKTEQIMGDKVVNFNYYPPCPNPELTVGLGRHSDLGTITVL  240

Query  524   LQDHIGGLHVR-----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANG  360
             LQD IGGL+V+         + W+ +PP+ GALVINIGD LQILSNG+YKSAEHR +   
Sbjct  241   LQDEIGGLYVKMEEDNDAGKEEWLLIPPIPGALVINIGDILQILSNGKYKSAEHRTTTTS  300

Query  359   GSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDG-KETIEF  183
                R+SVP+F+ P    R+GP PE +       Y+E++  DY+  +FG AH+G K+ I+F
Sbjct  301   TRARVSVPLFILPIATERIGPFPEAVKNVGFARYREVLMQDYMNKYFGNAHEGKKKIIDF  360

Query  182   AKI  174
             A+I
Sbjct  361   ARI  363



>ref|XP_006585413.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Glycine max]
Length=366

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 179/363 (49%), Positives = 239/363 (66%), Gaps = 13/363 (4%)
 Frame = -3

Query  1232  ALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISN  1053
             + + S S+ DFVV EG GVKG+SD+G+  +P +YIQPP+ERI        D+ P ID+S 
Sbjct  4     SFNTSNSLYDFVVREGNGVKGVSDLGLPEVPDRYIQPPEERINKQESRTCDA-PPIDLSK  62

Query  1052  WDDPAVSRAVCE---AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKAN  882
              +     + V E   AAE  GFFQ++NHGVP+ELLESLK   ++FF LP+E+K  Y    
Sbjct  63    LNGLEHEKVVDEIVRAAETLGFFQVVNHGVPLELLESLKHTAHKFFSLPLEKKTLYRAGV  122

Query  881   SPSENV-RYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
             SP+  V R  TSF PE EKT EWKDY+S+ Y SD+EA   WP  CR   +EY+   + M+
Sbjct  123   SPAGPVTRLATSFVPEKEKTWEWKDYISMIYRSDEEALQYWPNLCRELVLEYLKLSSKMV  182

Query  704   KNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVL  525
             + ++E+L+  L +   +D SK    MG K +NFNYYP CPNPEL VG+GRHSD+ TITVL
Sbjct  183   RGIVEILIRNLGV--TIDDSKTEQIMGDKVVNFNYYPPCPNPELTVGLGRHSDLGTITVL  240

Query  524   LQDHIGGLHVR-----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANG  360
             LQD IGGL+V+         + W+ +PP+ GALVINIGD LQILSNG+YKSAEHR +   
Sbjct  241   LQDEIGGLYVKMEEDNDAGKEEWLLIPPIPGALVINIGDILQILSNGKYKSAEHRTTTTS  300

Query  359   GSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDG-KETIEF  183
                R+SVP+F+ P    R+GP PE +       Y+E++  DY+  +FG AH+G K+ I+F
Sbjct  301   TRARVSVPLFILPIATERIGPFPEAVKNVGFARYREVLMQDYMSKYFGNAHEGKKKIIDF  360

Query  182   AKI  174
             A+I
Sbjct  361   ARI  363



>gb|KFK24987.1| hypothetical protein AALP_AA8G051800 [Arabis alpina]
Length=367

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 177/371 (48%), Positives = 242/371 (65%), Gaps = 19/371 (5%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDS---  1077
             M+P  L++  +V DFVVN+  GVKGL D M  K LPS+YIQ P++R+    ++ D++   
Sbjct  1     MSPFVLTDV-AVTDFVVNQRNGVKGLVDVMSPKTLPSRYIQLPEKRVTTEKLIVDNTKTG  59

Query  1076  --------IPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFK  921
                     IP ID+S+W++P V+  +CEAA   GFFQI+NHGV V+ L  L+ A   FF 
Sbjct  60    KGCLPSPAIPVIDVSDWENPNVAEEICEAATTLGFFQIVNHGVSVDQLSDLRAAGRGFFG  119

Query  920   LPVEEKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDD-EAAALWPPACRH  744
             LP EEK++Y K +S S+   Y TSF+P  E  LEW+D++   Y  +  ++ A+WP  CR 
Sbjct  120   LPAEEKKRYWKGSSVSDTAWYMTSFNPYEEAKLEWRDFIKFEYRPNQVDSTAMWPTVCRD  179

Query  743   EAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVG  564
             E + +  +   + K +LE+LM+ LN    +D   E   MG  R+N N+YP+CP+P+LAVG
Sbjct  180   EVLNHSHRMKPIGKKILEILMNNLNAS--MDHYLEQTLMGTLRMNLNFYPECPDPKLAVG  237

Query  563   VGRHSDISTITVLLQDHI-GGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKS  387
              GRHSDI+T+T+LLQD I G L+ R    D W+HVPPV GA+V+NIGD LQILSN RYKS
Sbjct  238   TGRHSDINTLTLLLQDDIIGSLYARY--GDKWLHVPPVMGAIVVNIGDILQILSNDRYKS  295

Query  386   AEHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAH  207
              EH V AN    RIS   +  P+ +  V PLPEVL  G+K LYK  VYSDY+++FF + H
Sbjct  296   VEHVVMANRFLSRISFAFYCGPNNDSIVEPLPEVLENGDKALYKSTVYSDYMKYFFERPH  355

Query  206   DGKETIEFAKI  174
              GK+TIE+ K+
Sbjct  356   TGKKTIEWIKL  366



>gb|ACU16692.1| unknown [Glycine max]
Length=250

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 205/255 (80%), Gaps = 9/255 (4%)
 Frame = -3

Query  1247  TMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPT  1068
             T+ P+ L+E      FV+ +G GVKGLS+MG+K+LPSQY+QP +ER+    +V  +SIP 
Sbjct  4     TLIPSDLTE------FVMLQGNGVKGLSEMGLKSLPSQYVQPLEERVIN--VVPQESIPI  55

Query  1067  IDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSK  888
             ID+SNWDDP V  A+C+AAE+WGFFQIINHGVP+E+L+S+K ATYRF+ LP +EK KY+K
Sbjct  56    IDMSNWDDPKVQDAICDAAEKWGFFQIINHGVPLEVLDSVKDATYRFYGLPPKEKVKYTK  115

Query  887   ANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAM  708
              NS +++VRYG+SFSPE+EK LEWKDYLSLFYVS+DEAAA WPPACR+EA+EYM +   +
Sbjct  116   ENSSTKHVRYGSSFSPEAEKALEWKDYLSLFYVSEDEAAATWPPACRNEALEYMKRSEIL  175

Query  707   IKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITV  528
             IK LL +LM  LN+ E +D++ E LFMG+KRIN NYYP CPN +L V +GRHSD+ST+TV
Sbjct  176   IKQLLNVLMKRLNVSE-IDETNESLFMGSKRINLNYYPVCPNHDLTVAIGRHSDVSTLTV  234

Query  527   LLQDHIGGLHVRKLN  483
             LLQD  GGL+VR  N
Sbjct  235   LLQDETGGLYVRAPN  249



>emb|CBI21735.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   347 bits (891),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 175/359 (49%), Positives = 236/359 (66%), Gaps = 14/359 (4%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+   + +S+ +FVV +G GVKG+ D+G++ +P QYIQP  ERI      + D  P I
Sbjct  1     MAPS-FDDGDSLYNFVVRDGNGVKGMVDLGLEKVPEQYIQPQHERIDKLKASSYDR-PPI  58

Query  1064  DISNWDDPAVSRA---VCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S    P  S+    + EAAE  GFFQ++NHGVP E+LES+K+A + FF    E+K  Y
Sbjct  59    DLSMLGGPQHSQVMELIAEAAESVGFFQVVNHGVPNEVLESVKSAAHEFFGQAPEKKAVY  118

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
              K  SPS  V+YGTSF PE EK LEWKDY+S+ Y SD +A   WP  C+  A+E++    
Sbjct  119   RKGVSPSPYVKYGTSFVPEKEKALEWKDYVSMVYTSDADAFEFWPNECKEVALEFLKASI  178

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
             +M++ +LE+LM  L +   LD+S+    +G K +N N+YP CPNP+L VGVGRHSD+  +
Sbjct  179   SMVRRILEVLMEKLGV--TLDESRIDGLIGLKMVNMNFYPTCPNPDLTVGVGRHSDMGML  236

Query  533   TVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             TVLLQD IGGL+V+     T       WV +PP  GALVIN+GD LQILSNG+YKSAEHR
Sbjct  237   TVLLQDGIGGLYVKMEEDITGAGKKGEWVEIPPTPGALVINVGDTLQILSNGKYKSAEHR  296

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGK  198
             V       R+S+PIF  P P  ++GPLP+V+       Y+E+V  +Y+ +FFGKAH+GK
Sbjct  297   VRTTSTQSRVSIPIFTIPRPNEKIGPLPQVVERDGVAHYREVVVEEYMNNFFGKAHEGK  355


 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 74/112 (66%), Gaps = 3/112 (3%)
 Frame = -3

Query  1073  PTIDISNWDDPAVSRAV---CEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEK  903
             P ID+S  D P  S+ V    EAAE  GFFQ++NH VP+E+LES+K+A + FF    E+K
Sbjct  374   PPIDLSMLDGPQHSQVVGLIAEAAERVGFFQVVNHRVPIEVLESVKSAAHEFFGQAPEKK  433

Query  902   RKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACR  747
               Y K  SPS  V+YGTSF PE EK L+WKDY+S+ Y SD EA   WP  C+
Sbjct  434   AVYRKGVSPSPYVKYGTSFVPEKEKALKWKDYVSMVYTSDGEALEFWPNECK  485



>ref|XP_006409269.1| hypothetical protein EUTSA_v10023159mg [Eutrema salsugineum]
 gb|ESQ50722.1| hypothetical protein EUTSA_v10023159mg [Eutrema salsugineum]
Length=366

 Score =   343 bits (880),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 180/370 (49%), Positives = 239/370 (65%), Gaps = 18/370 (5%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDS---  1077
             M P  L++  +V DFVVN+  GVKGL + +  K LPS+YIQ P+ R+    ++ +     
Sbjct  1     MPPNRLNDV-AVTDFVVNQRNGVKGLVNVISPKTLPSRYIQLPENRVTTEKLIIETGKGK  59

Query  1076  -------IPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKL  918
                    IP ID+S+W +P V+  +CEAA   GFFQI+NHGV V+ L  L+ A   FF L
Sbjct  60    DGLLSPVIPVIDVSDWKNPNVAEEICEAAATLGFFQIVNHGVSVDELNELRAAGRGFFDL  119

Query  917   PVEEKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSL-FYVSDDEAAALWPPACRHE  741
             P EEK++Y K +S SE   Y TSF+P  E  LEW+D++   F     + AA WP  CR E
Sbjct  120   PAEEKKRYWKGSSVSETAWYMTSFNPYEEAKLEWRDFIKFEFRPHLVDFAATWPSVCRDE  179

Query  740   AMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGV  561
              +++  +   + KN+LE+LM+ LN    +D SKE + MG  R+N N+YP+CP P+LAVG 
Sbjct  180   VVKHSHRMKPIGKNILEILMNNLNAS--IDHSKEQILMGTLRMNINFYPECPEPKLAVGT  237

Query  560   GRHSDISTITVLLQDHI-GGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSA  384
             GRHSDI+T+T+LLQD I G L+ R    D W+HVPPV GA+V+NIGD LQILSN RYKS 
Sbjct  238   GRHSDINTLTLLLQDDIIGSLYARY--GDKWLHVPPVRGAIVVNIGDILQILSNDRYKSV  295

Query  383   EHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHD  204
             EH V AN    RIS   +  P+ +  + PL EVL  GEKPLYK  VYSDY++HFF + H 
Sbjct  296   EHVVMANQFLSRISFAFYCGPNNDSAIEPLAEVLENGEKPLYKSTVYSDYMKHFFERPHT  355

Query  203   GKETIEFAKI  174
             GK+TIE+ K+
Sbjct  356   GKKTIEWIKL  365



>gb|KDP25104.1| hypothetical protein JCGZ_22639 [Jatropha curcas]
Length=366

 Score =   343 bits (880),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 175/367 (48%), Positives = 244/367 (66%), Gaps = 12/367 (3%)
 Frame = -3

Query  1244  MAPA-ALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPT  1068
             MAP+ + S+S S+ +FVV EG GVKG+ D G+  +P QY+QP +ERI      ++++ P 
Sbjct  1     MAPSHSFSDSNSLFNFVVREGNGVKGMVDSGLSKVPQQYVQPQQERIDKLNATSNNN-PP  59

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S  D P    V+  +  AAE  GFFQ++NHGVP++LLE+LK + + FF  P E K  
Sbjct  60    IDMSKLDGPDRDRVAEEIARAAETVGFFQVVNHGVPLDLLEALKDSAHSFFGQPPERKAI  119

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  +P+  V+YGTSF PE EK LEWKDY+S+ Y +D EA   WP  C+  A+EY+   
Sbjct  120   YRKGVTPTPLVKYGTSFVPEKEKALEWKDYISMIYTNDAEALQFWPKECKEAALEYLRTS  179

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M++ LL++LM  L +   +D   + L  G K +N N+YP CPNPEL VGVGRHSD+ T
Sbjct  180   MTMVRKLLQVLMEKLGVSADIDAKIDAL-TGLKTVNMNFYPTCPNPELTVGVGRHSDLGT  238

Query  536   ITVLLQDHIGGLHVR---KLNSDT---WVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             +TVLLQD IGGL+V+    ++ D    W+ +PP+ GALVIN+GD LQI+SNGRYKSAEHR
Sbjct  239   LTVLLQDGIGGLYVKVEENMDGDVKGEWMEIPPIPGALVINVGDTLQIVSNGRYKSAEHR  298

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V       R+S+PIF  P    ++GP  EV+       Y+E+V+ +Y  +FFG AH+GK+
Sbjct  299   VRTTSSQSRVSIPIFTIPKGTEKIGPWAEVVEKDGVARYREIVFEEYYNNFFGNAHEGKK  358

Query  194   TIEFAKI  174
             +++FA+I
Sbjct  359   SLDFARI  365



>gb|KGN59447.1| hypothetical protein Csa_3G821020 [Cucumis sativus]
Length=364

 Score =   342 bits (878),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 233/348 (67%), Gaps = 16/348 (5%)
 Frame = -3

Query  1196  VNEGRGVKGLSDMGIKALPSQYIQPPKER----IAANAIVADDSIPTIDISNWDDPAVSR  1029
             +N+G G  GLS M ++ALP  +IQPP++R    I A++  + D+IP ID+S  +    + 
Sbjct  26    INKGYGTTGLSKMRLRALPKAFIQPPEKRSSSMIRASSQASGDTIPIIDMSKAE---AAE  82

Query  1028  AVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTS  849
              +CEAAE+WGFFQ+INHGVP  L+  +  A  RF     EEKR++ K N+   NV Y TS
Sbjct  83    LICEAAEKWGFFQVINHGVPAVLMSDVMHAARRFLGQAAEEKRRFLKENTSCSNVVYMTS  142

Query  848   FSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLN  669
             F  E+EK LEW DYLS+ +VS++EA A WP   +   +EY+   N +IK +L++LM+ LN
Sbjct  143   FFAEAEKGLEWSDYLSMNFVSEEEAYAFWPAISKDATIEYLKSSNTLIKRVLKILMNKLN  202

Query  668   IEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRK  489
               E LD++ +      +RI FNYYP  P P+L+VGV  HSD+S +TVLLQD +GGLHVR+
Sbjct  203   ANE-LDETNQ-----TRRIQFNYYPISPTPDLSVGVRSHSDVSLLTVLLQDDVGGLHVRR  256

Query  488   ---LNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPD  318
                   D WV V PV  +LVINIGD L+I+SNG YKS EH V +NG  DR+S+PIFV   
Sbjct  257   EIDSKGDEWVQVKPVAESLVINIGDFLEIMSNGIYKSVEHCVVSNGNIDRMSIPIFVGLQ  316

Query  317   PECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
                 +GPLPEVLA G+K  YKE+V+SDY+++F  K  DGK T++ AKI
Sbjct  317   NSPTIGPLPEVLATGKKAEYKEVVFSDYIKYFLNKPLDGKSTLKLAKI  364



>gb|KHG29594.1| hypothetical protein F383_14046 [Gossypium arboreum]
Length=367

 Score =   342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/369 (47%), Positives = 232/369 (63%), Gaps = 17/369 (5%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP+   +  SV +FVV  G GVKGL D G+  +P  Y+QPPKERI     V    +P I
Sbjct  1     MAPS-FEDGNSVFEFVVRRGNGVKGLVDSGLSKVPEAYVQPPKERIDKENAVKH-GLPPI  58

Query  1064  DISNWD-----DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKR  900
             D+S  D        V+  + +AAE  GFFQ++NHGVP+ LLESLK   + FF LP + K 
Sbjct  59    DLSKLDGFGPDHDEVADQIVKAAETLGFFQVVNHGVPLHLLESLKDTAHYFFSLPPQRKA  118

Query  899   KYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQ  720
              Y    SPS  V+YG+SF PE EK LEWKDY+ + Y +DDEA   WP   +   +EY+  
Sbjct  119   VYRSDVSPSPLVKYGSSFMPEKEKALEWKDYILMQYTNDDEALQHWPQEIKGVLLEYLRS  178

Query  719   CNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIS  540
                M+K LL++L+    I+   D     + +G K ++ N+YP CPNP+L VGVGRHSD+ 
Sbjct  179   SIGMVKKLLQVLLGNFGIKP--DDPMIDVLIGKKMLSMNFYPACPNPDLTVGVGRHSDMG  236

Query  539   TITVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSAE  381
             T+TVLLQD IGGL+V K+  D        W+ +PP   ALVIN+GD LQILSNG+YKSAE
Sbjct  237   TLTVLLQDGIGGLYV-KMEQDMDYGKKGDWIEIPPTPNALVINVGDMLQILSNGKYKSAE  295

Query  380   HRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDG  201
             HRV     S R+S+PIF  P    ++ PL +V+      LY+E V  DY+++FFG AH+G
Sbjct  296   HRVRTTSTSSRVSIPIFTMPKETTKIVPLSQVVKKDGTALYREFVLIDYMKNFFGNAHEG  355

Query  200   KETIEFAKI  174
             K++++FAKI
Sbjct  356   KKSLDFAKI  364



>emb|CDX82570.1| BnaA03g32510D [Brassica napus]
Length=376

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 166/331 (50%), Positives = 221/331 (67%), Gaps = 8/331 (2%)
 Frame = -3

Query  1211  VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAA-NAIVADDSIPTIDISNWDDP--  1041
             + DFVV +G GVKGL D G+  +P  ++QPP ERIA  N    + + P ID+S  D P  
Sbjct  11    LFDFVVKQGNGVKGLIDSGMSCVPQPFVQPPSERIATLNGQTCEAAQP-IDLSQLDGPHH  69

Query  1040  -AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENV  864
               V++ + EAAE  GFFQ++NHGV +ELLE LKT+ + FF  P E+K  Y K  SPS+ V
Sbjct  70    KEVAKQIVEAAETLGFFQVVNHGVSIELLELLKTSAHEFFAQPPEKKAIYLKEVSPSKLV  129

Query  863   RYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEML  684
             +YGTSF PE EK +EWKDY+S+ Y +D EA   WP  CR  A+ ++     M+K ++++L
Sbjct  130   KYGTSFVPEKEKAIEWKDYVSMLYTNDHEALQHWPQPCREVALAFLKSSMQMVKRVVKVL  189

Query  683   MSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGG  504
             M  + +  RL++ +    MG K +N NYYP CP+PEL +GVGRHSD+  +TVLLQD IGG
Sbjct  190   MEDVGV--RLEEERMNSLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGMLTVLLQDGIGG  247

Query  503   LHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVT  324
             L+VR  N D W  +PP++GALVIN+GD LQILSNG+YKSAEHRV       R+SVPIF  
Sbjct  248   LYVRLDNGD-WAEIPPLNGALVINVGDTLQILSNGKYKSAEHRVRTTNIGSRVSVPIFTA  306

Query  323   PDPECRVGPLPEVLAGGEKPLYKELVYSDYL  231
             P+P  ++GPLP+V+       YKEL +   L
Sbjct  307   PNPSEKIGPLPQVVKRDGVARYKELYFVSRL  337



>ref|XP_003596148.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
Length=404

 Score =   337 bits (864),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 169/357 (47%), Positives = 236/357 (66%), Gaps = 11/357 (3%)
 Frame = -3

Query  1220  SESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDP  1041
             S S+ +F+V +G G+KGL D G+  +P  YIQP  ERI        D +P ID+S  +  
Sbjct  8     SNSLYNFIVRDGNGIKGLVDSGLLEVPKIYIQPINERINKLETKPCD-MPPIDLSKLNGK  66

Query  1040  AVSRAVCE---AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSE  870
                + V E   AAE  GFFQ++NH VP+ELLES+K + + FF +P E+K  Y +  S S 
Sbjct  67    EHEKVVNEIVRAAETLGFFQVVNHCVPLELLESVKDSAHAFFNMPPEKKVVYRQNVSTSL  126

Query  869   NVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLE  690
              +RY T+F+PE E  LEWKDY+++ Y SD++A   WP  C+  A+EY+   + ++K +LE
Sbjct  127   KMRYQTTFAPEIENVLEWKDYINMVYSSDEDALQYWPNECKDVALEYLKLSSKIVKVILE  186

Query  689   MLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHI  510
             +L+  L +E  LD SK    +G K +N NYYP CPNPEL VGVGRHSD  TITVLLQD I
Sbjct  187   ILIGKLGVE--LDDSKIESLIGLKMVNMNYYPACPNPELTVGVGRHSDAGTITVLLQDGI  244

Query  509   GGLHVRKLNSD-----TWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             GGL+V+  + +      W+ +PP+ GALVIN+GDAL+ILSNG+YKS+EHRV       R+
Sbjct  245   GGLYVKAEDENDVGKVEWLEIPPIPGALVINVGDALEILSNGKYKSSEHRVMTTSNQSRV  304

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             SVP+F  P    ++GPLPE++       Y+E+++ DY+ +F+G AH+GK+T+ FAKI
Sbjct  305   SVPLFTLPKFTEKIGPLPELVKKDGLAGYREVLWKDYMDNFYGVAHEGKKTLNFAKI  361



>ref|XP_006399742.1| hypothetical protein EUTSA_v10013937mg [Eutrema salsugineum]
 gb|ESQ41195.1| hypothetical protein EUTSA_v10013937mg [Eutrema salsugineum]
Length=357

 Score =   335 bits (858),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/359 (47%), Positives = 237/359 (66%), Gaps = 9/359 (3%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDSI--PTIDI  1059
             ++ +  V DFVVN+  GVKGL D + +  LPS YIQPP+ER+ ++ I++  S   P ID+
Sbjct  1     MTPTTDVRDFVVNQRNGVKGLVDSLTLTTLPSPYIQPPQERLTSDKIISSSSSKIPVIDV  60

Query  1058  SNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             SNW DP V+R +C+AA + G FQI+NHG+    L++L  A   FF+L  EE+R+Y + +S
Sbjct  61    SNWTDPRVAREICDAASKLGLFQIVNHGIAPAELKALIAAARGFFELTAEERRRYWRGSS  120

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEA-AALWPPACRHEAMEYMTQCNAMIK  702
              SE     TSF+P  E  LEW+D+L   ++      AA WPP C+ + +++  +   + K
Sbjct  121   VSETAWLTTSFNPVKESVLEWRDFLKFEFLPQRHGFAATWPPVCKEQVIDHFERIKPIAK  180

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              +L +L+S LN    +D+S + + MG  R+NFNYYP+CP P LAVG GRHSDI+T+T+LL
Sbjct  181   KILNILISNLN--SAIDESNKQILMGTMRMNFNYYPECPEPSLAVGTGRHSDINTLTLLL  238

Query  521   QDH--IGGLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             Q+   +  L+ R   + D W++VPP+ GA+V+NIGD LQILSN RYKS EH V  N    
Sbjct  239   QEDGVLSSLYARATEDGDKWINVPPIPGAIVVNIGDVLQILSNDRYKSIEHCVVVNKSCS  298

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             R+S+P+F  P  +  + PLPEVL   EK  Y+E+VY DYL+ FFG+ HDGK+TIE  K+
Sbjct  299   RVSIPVFCGPVQDSVIQPLPEVLENSEKSRYREVVYLDYLKGFFGRPHDGKKTIESIKL  357



>gb|AES66399.2| leucoanthocyanidin dioxygenase-like protein [Medicago truncatula]
Length=364

 Score =   335 bits (858),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/357 (47%), Positives = 235/357 (66%), Gaps = 11/357 (3%)
 Frame = -3

Query  1220  SESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDP  1041
             S S+ +F+V +G G+KGL D G+  +P  YIQP  ERI        D +P ID+S  +  
Sbjct  8     SNSLYNFIVRDGNGIKGLVDSGLLEVPKIYIQPINERINKLETKPCD-MPPIDLSKLNGK  66

Query  1040  AVSRAVCE---AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSE  870
                + V E   AAE  GFFQ++NH VP+ELLES+K + + FF +P E+K  Y +  S S 
Sbjct  67    EHEKVVNEIVRAAETLGFFQVVNHCVPLELLESVKDSAHAFFNMPPEKKVVYRQNVSTSL  126

Query  869   NVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLE  690
              +RY T F+PE E  LEWKDY+++ Y SD++A   WP  C+  A+EY+   + ++K +LE
Sbjct  127   KMRYQTIFAPEIENVLEWKDYINMVYSSDEDALQYWPNECKDVALEYLKLSSKIVKVILE  186

Query  689   MLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHI  510
             +L+  L +E  LD SK    +G K +N NYYP CPNPEL VGVGRHSD  TITVLLQD I
Sbjct  187   ILIGKLGVE--LDDSKIESLIGLKMVNMNYYPACPNPELTVGVGRHSDAGTITVLLQDGI  244

Query  509   GGLHVRKLNSD-----TWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRI  345
             GGL+V+  + +      W+ +PP+ GALVIN+GDAL+ILSNG+YKS+EHRV       R+
Sbjct  245   GGLYVKAEDENDVGKVEWLEIPPIPGALVINVGDALEILSNGKYKSSEHRVMTTSNQSRV  304

Query  344   SVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             SVP+F  P    ++GPLPE++       Y+E+++ DY+ +F+G AH+GK+T+ FAKI
Sbjct  305   SVPLFTLPKFTEKIGPLPELVKKDGLAGYREVLWKDYMDNFYGVAHEGKKTLNFAKI  361



>ref|XP_006286652.1| hypothetical protein CARUB_v10002551mg [Capsella rubella]
 gb|EOA19550.1| hypothetical protein CARUB_v10002551mg [Capsella rubella]
Length=369

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/360 (46%), Positives = 234/360 (65%), Gaps = 8/360 (2%)
 Frame = -3

Query  1235  AALSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDSIPTIDI  1059
             +A S    V D+VVN+  GVKGL D + +  LP  YIQPP+ER  ++ I+    IP ID+
Sbjct  11    SASSADIEVRDYVVNQRNGVKGLVDFLTLTTLPPPYIQPPQERFTSDKILLGSPIPVIDV  70

Query  1058  SNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             S+W+DP V+R +C AA + G FQI+NHG+  E L+ +  A   FF+LP EE+R+Y + +S
Sbjct  71    SDWNDPQVAREICHAATKLGLFQIVNHGIAPEELKGIIAAARGFFELPTEERRRYWRGSS  130

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVSDD-EAAALWPPACRHEAMEYMTQCNAMIK  702
              SE     TSF+P  E  LEW+D+L   YVS   +  A WP  C+ + +++  +   + +
Sbjct  131   VSETAWLTTSFNPYKESVLEWRDFLKFEYVSQQHDFTATWPLVCKVQVIDHFKRIKPIAE  190

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              +L++LM+ LN    +D+S +   MG  R+NFNYYPKCP P LA+G GRHSDI+T+T+LL
Sbjct  191   KILKILMNNLN--SSIDESNKKTLMGTMRMNFNYYPKCPEPSLAMGTGRHSDINTLTLLL  248

Query  521   QDH--IGGLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             Q+   +G L+ R   + D W+HVPP  GA+V+NIGD LQILSN RY+S EH V  N    
Sbjct  249   QEDGVLGSLYARATEDGDKWIHVPPTPGAIVVNIGDVLQILSNDRYRSVEHCVVVNKCVS  308

Query  350   RISVPIFVTPDPECRVGPLPEV-LAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             R+S+P+F  P  E  + PLPEV L   E   Y+++VYSDYL+ FF + HDGK+TIE  ++
Sbjct  309   RVSIPVFCGPVNESVIEPLPEVLLENNEMARYRKIVYSDYLKGFFERPHDGKKTIESIRL  368



>ref|XP_006367566.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Solanum tuberosum]
Length=357

 Score =   333 bits (855),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/359 (45%), Positives = 235/359 (65%), Gaps = 4/359 (1%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             M  +    ++ ++DFV+ +  G+KGL D  ++ +P+Q IQP + R+  + I   +SIPTI
Sbjct  1     MTSSKFEPNDDILDFVIKKANGLKGLVDRSLEIIPNQCIQPKEHRLYKSQIDNQESIPTI  60

Query  1064  DISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
             D+SN+DD  V +++ EAA +WG FQIINHG+P+E+LE LK A ++FF+LP EEK KY K 
Sbjct  61    DLSNFDDLNVEKSIQEAASKWGCFQIINHGIPIEVLEDLKDAGHKFFELPPEEKVKYCKD  120

Query  884   N-SPSENV-RYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             N    E+V  + ++   ++EK LEW+D +     +    + LWPP  R++ +EY      
Sbjct  121   NYGAGESVLMFWSAIGEKNEKVLEWRDSIK-HGCNPQNDSNLWPPQTRNQVLEYQKWAKP  179

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             + K LLE+L+ GLN+   +D+S EPL MG   IN NYYP CPNP + +G  RH D S IT
Sbjct  180   LAKKLLEILLKGLNVN-VIDESLEPLLMGTMSININYYPPCPNPSITMGARRHCDGSCIT  238

Query  530   VLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             +L QD  GGL+V+    D W+HV P+ GAL +NIGD LQI+SN RYKS EH V+ +    
Sbjct  239   LLFQDDTGGLYVQGTEGDKWIHVNPIKGALAVNIGDLLQIMSNDRYKSIEHCVAVDSSRA  298

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             R+SVP+FV    +  +GP P++L  GEKP+YK +++SDY  +F+ K   GK +++FAKI
Sbjct  299   RVSVPLFVNASLDSVIGPFPQMLKDGEKPVYKHILHSDYWDNFYRKRPSGKASLDFAKI  357



>gb|KHG24468.1| hypothetical protein F383_30436 [Gossypium arboreum]
Length=367

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 173/370 (47%), Positives = 232/370 (63%), Gaps = 19/370 (5%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADDSIPT  1068
             MAP  L +  SV +FVV +G GVKGL D G+  +P  Y+QPP+ERI   NAI  D  +P 
Sbjct  1     MAPN-LEDRNSVFEFVVRQGNGVKGLVDSGLSTVPEAYVQPPEERIDKENAIKYD--LPP  57

Query  1067  IDISNWDDPA-----VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEK  903
             ID+S  D        V+  +  A E  GFFQ++NHGVP+ LLESLK + + FF LP + K
Sbjct  58    IDLSKLDGHGPDHDEVANQLVRAVETLGFFQVVNHGVPLHLLESLKVSAHEFFSLPPQRK  117

Query  902   RKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMT  723
               Y    SPS  V+YGTS+ PE EK L WKDY+ + Y +DDEA   WP   +   +EY+ 
Sbjct  118   AVYLADVSPSPLVKYGTSYIPEKEKALGWKDYILMQYTNDDEALQHWPQEIKEILLEYLR  177

Query  722   QCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDI  543
                 M+K LL++ +  L ++   D S   + +G K ++  +YP CPNP+L +GVGRHSDI
Sbjct  178   SSTGMVKKLLQVTLGNLGVKP--DDSMIDVLIGKKMLSMIFYPICPNPDLTLGVGRHSDI  235

Query  542   STITVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRYKSA  384
              T TVLLQD +GGL+V K+  DT       W+ +PP   ALVIN+GD LQILSNG+YKSA
Sbjct  236   GTFTVLLQDEVGGLYV-KIEQDTGYGKKGDWILIPPTPNALVINVGDMLQILSNGKYKSA  294

Query  383   EHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHD  204
             EH V  +  + R+SVPIF+ P    ++ PLP+V+      +YKE VY DY+   F  A D
Sbjct  295   EHIVCTSSTNSRVSVPIFIMPRETTKIAPLPQVVEKDGIAVYKEFVYVDYMNKVFANALD  354

Query  203   GKETIEFAKI  174
             GK++++FAKI
Sbjct  355   GKKSLDFAKI  364



>ref|XP_009125855.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Brassica rapa]
Length=356

 Score =   330 bits (846),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 162/358 (45%), Positives = 230/358 (64%), Gaps = 8/358 (2%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDS-IPTIDIS  1056
             ++ +  V +FVVN+  GVKGL D + + ALPS YIQP +ER+ ++ I++  S IP ID+S
Sbjct  1     MTPTNDVREFVVNQRNGVKGLVDSLKLTALPSPYIQPSQERLTSDKILSSPSQIPVIDVS  60

Query  1055  NWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSP  876
             NW+DP V+  +C AA + G FQI+NHG+    L++L  A   FF+LP EE+R+Y + +S 
Sbjct  61    NWNDPQVASEICHAAAKHGLFQIVNHGIVPGELKALIAAARGFFELPAEERRRYWRGSSV  120

Query  875   SENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAA-ALWPPACRHEAMEYMTQCNAMIKN  699
             SE     TSF+P  E  LEW+D+L   ++       A WPP CR +  ++  +   +   
Sbjct  121   SETAWLTTSFNPYKESILEWRDFLKFEFLPQRHGYDATWPPVCREQVTDHFKRMKPIANK  180

Query  698   LLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQ  519
             +L +LM+ LN    +D S     MG  R+NFNYYP+CP P LA+G GRHSDI+T+T+LLQ
Sbjct  181   ILTILMNNLN--STIDDSSNQTLMGTMRMNFNYYPECPEPTLAIGTGRHSDINTLTLLLQ  238

Query  518   DH--IGGLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDR  348
             +   +  L+ R   + D W+HVPP+ GA+V+NIGD LQI+SN RY+S EH V  N    R
Sbjct  239   EDGVLSSLYARATEDGDKWIHVPPIPGAIVVNIGDVLQIMSNDRYRSVEHCVLVNRSCSR  298

Query  347   ISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +S+P+F  P  +  + PLPEVL   E   Y+++VYSDYL+ FF + HDGK TIE  K+
Sbjct  299   VSIPVFCGPVNDSAIEPLPEVLENNEMARYRKVVYSDYLKDFFERPHDGKTTIESIKL  356



>emb|CDX85693.1| BnaA02g01200D [Brassica napus]
Length=356

 Score =   330 bits (846),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 162/358 (45%), Positives = 230/358 (64%), Gaps = 8/358 (2%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDS-IPTIDIS  1056
             ++ +  V +FVVN+  GVKGL D + + ALPS YIQP +ER+ ++ I++  S IP ID+S
Sbjct  1     MTPTNDVREFVVNQRNGVKGLVDSLKLTALPSPYIQPSQERLTSDKILSSPSQIPVIDVS  60

Query  1055  NWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSP  876
             NW+DP V+  +C AA + G FQI+NHG+    L++L  A   FF+LP EE+R+Y + +S 
Sbjct  61    NWNDPQVASEICHAAAKHGLFQIVNHGIVPGELKALIAAARGFFELPAEERRRYWRGSSV  120

Query  875   SENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAA-ALWPPACRHEAMEYMTQCNAMIKN  699
             SE     TSF+P  E  LEW+D+L   ++       A WPP CR +  ++  +   +   
Sbjct  121   SETAWLTTSFNPYKESILEWRDFLKFEFLPQRHGYDATWPPVCREQVTDHFKRMKPIANK  180

Query  698   LLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQ  519
             +L +LM+ LN    +D S     MG  R+NFNYYP+CP P LA+G GRHSDI+T+T+LLQ
Sbjct  181   ILTILMNNLN--STIDDSSNQTLMGTMRMNFNYYPECPEPTLAIGTGRHSDINTLTLLLQ  238

Query  518   DH--IGGLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDR  348
             +   +  L+ R   + D W+HVPP+ GA+V+NIGD LQI+SN RY+S EH V  N    R
Sbjct  239   EDGILSSLYARATEDGDKWIHVPPIPGAIVVNIGDVLQIMSNDRYRSVEHCVLVNRSCSR  298

Query  347   ISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +S+P+F  P  +  + PLPEVL   E   Y+++VYSDYL+ FF + HDGK TIE  K+
Sbjct  299   VSIPVFCGPVNDSAIEPLPEVLENNEMARYRKVVYSDYLKDFFERPHDGKTTIESIKL  356



>ref|XP_010274088.1| PREDICTED: LOW QUALITY PROTEIN: feruloyl CoA ortho-hydroxylase 
1 [Nelumbo nucifera]
Length=370

 Score =   328 bits (842),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 173/373 (46%), Positives = 234/373 (63%), Gaps = 24/373 (6%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPT-  1068
             MAP+  +    + +FVV EG GVKG+ D GI  +P QYIQ P+ERI    I  D S P  
Sbjct  1     MAPSFENIGNELFNFVVREGNGVKGMVDSGITTVPDQYIQSPQERIVKQGI--DPSYPPS  58

Query  1067  ----IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVE  909
                 ID+S  + P    V   + ++AE  GFFQ+INHGV VELLE LK A +RFF  P E
Sbjct  59    LVSPIDLSELEGPNHDQVVELLGQSAETLGFFQVINHGVQVELLEQLKDAAHRFFNQPPE  118

Query  908   EKR-KYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAME  732
              K   Y K  SPS  V+YGTSF PE+EK LEWKDY+S+ Y  D++A   WP  C+  A+E
Sbjct  119   RKAFVYLKGASPSPFVKYGTSFVPEAEKALEWKDYISMTYSGDEDALNFWPEECKEVALE  178

Query  731   YMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRH  552
             Y+     M+K +LE+L+  L +   +D ++   ++G + +N N   K    EL VGVGRH
Sbjct  179   YLKSSTKMVKRILEVLLRRLGV--TVDHTETEAYIGTRMVNMNLVSKS---ELTVGVGRH  233

Query  551   SDISTITVLLQDHIGGLHVRKLNSDT-------WVHVPPVDGALVINIGDALQILSNGRY  393
             SD+  +TVLLQD IGGL+V K+  D        WV +PP  GALV+N+GD L+ILSNGRY
Sbjct  234   SDMGILTVLLQDGIGGLYV-KVEDDRLGRKKGEWVEIPPTPGALVVNVGDTLEILSNGRY  292

Query  392   KSAEHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGK  213
             KSAEHRV       R+S+P+FV P P  ++ PLP+V+       Y E ++ +Y+++FFGK
Sbjct  293   KSAEHRVWTTNAESRVSIPVFVFPLPTKKIKPLPQVVEKDGVAHYGEFLFEEYMKNFFGK  352

Query  212   AHDGKETIEFAKI  174
              H+GK++++F KI
Sbjct  353   GHEGKKSLDFVKI  365



>emb|CDX91167.1| BnaC02g04300D [Brassica napus]
Length=356

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/358 (44%), Positives = 230/358 (64%), Gaps = 8/358 (2%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDS-IPTIDIS  1056
             ++ +  V +FVVN+  GVKGL D + + ALPS YIQPP+ER+ ++ I++  S IP ID+S
Sbjct  1     MTPTTDVREFVVNQRNGVKGLVDSLKLTALPSPYIQPPQERLTSDKILSSPSQIPVIDVS  60

Query  1055  NWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSP  876
             NW+DP V+  +C AA + G FQI+NHG+    L++L  A   FF+LP EE+R+Y + +S 
Sbjct  61    NWNDPHVASEICHAAAKLGLFQIVNHGITPAELKALIAAARGFFELPAEERRRYWRGSSV  120

Query  875   SENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEA-AALWPPACRHEAMEYMTQCNAMIKN  699
             SE     TSF+P  E  LEW+D+L   ++       A WPP C+ +  ++      +  N
Sbjct  121   SETAWLTTSFNPYKENVLEWRDFLKFEFLPQRHGFDATWPPVCKEQVTDHFKTMKPIANN  180

Query  698   LLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQ  519
             +L +LM+ LN    +++S +   MG  R+NFNYYP+CP P LA+G GRHSDI+T+T+LLQ
Sbjct  181   ILTILMNNLN--STINESSQRTLMGTMRMNFNYYPQCPEPSLAIGTGRHSDINTLTLLLQ  238

Query  518   DH--IGGLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDR  348
             +   +  L+ R   + + W HVPP+ GA+V+NIGD LQI+SN RY+S EH V  N    R
Sbjct  239   EDGVLSSLYARATEDGENWAHVPPIPGAIVVNIGDVLQIMSNDRYRSVEHCVLVNKSCSR  298

Query  347   ISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             +S+P+F  P  +  + PL EVL   E   Y+++VYSDYL+ FF + HDGK +IE  K 
Sbjct  299   VSIPVFCGPVHDSVIEPLQEVLENNEMARYRKVVYSDYLKDFFERPHDGKTSIESIKF  356



>ref|XP_010453293.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Camelina sativa]
Length=364

 Score =   326 bits (835),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/359 (45%), Positives = 236/359 (66%), Gaps = 7/359 (2%)
 Frame = -3

Query  1235  AALSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDSIPTIDI  1059
              A S+   V D+VVN+  GVKGL D + +  LP  YIQPP+ER  ++ I+    +P ID+
Sbjct  7     TASSDDIEVRDYVVNQRNGVKGLVDFLTLTTLPYPYIQPPQERFTSDKILVGSPVPVIDV  66

Query  1058  SNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             SNW+DP V+R +C AA+  G FQI+NHG+  E L+ + TA   FF+LP EE+R+Y + +S
Sbjct  67    SNWNDPNVAREICHAAKTLGMFQIVNHGIAPEELKGIITAARGFFELPAEERRRYWRGSS  126

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAAL-WPPACRHEAMEYMTQCNAMIK  702
              SE     TSF+P  E  LEW+D+L   Y+  +   A+ WP  C+ + +++  +   + +
Sbjct  127   VSETAWLTTSFNPYKESVLEWRDFLKFEYLPQEHDFAITWPLVCKEQVIDHFKKIKPITE  186

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              +L +L++  N+   +D+S + + MG  R+NFNYYPKCP P LA+G GRHSDI+T+T+LL
Sbjct  187   KILNILIN--NLNSIIDESNKDILMGTMRMNFNYYPKCPEPSLAIGTGRHSDINTLTLLL  244

Query  521   QDH--IGGLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             Q+   +G L+ R   + D W+HVPP+ GA+V+NIGD LQ+LSN RY+S EH V  N    
Sbjct  245   QEDGVLGSLYARATEDGDKWIHVPPIPGAIVVNIGDVLQVLSNDRYRSVEHCVVVNKCCS  304

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             R+S+P+F  P  +  + PLPEVL   E   Y+++VYSDYL+ FF + HDGK+TIE  K+
Sbjct  305   RVSIPVFCGPVHDSVIEPLPEVLENNETARYRKIVYSDYLKGFFERPHDGKKTIESIKL  363



>ref|XP_006828756.1| hypothetical protein AMTR_s00001p00072200 [Amborella trichopoda]
 gb|ERM96172.1| hypothetical protein AMTR_s00001p00072200 [Amborella trichopoda]
Length=364

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/366 (44%), Positives = 236/366 (64%), Gaps = 11/366 (3%)
 Frame = -3

Query  1256  PRKTMAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDS  1077
             P  ++A  A S+ + + +FVV  G GVKGL D GI  +P++YI PP++      I +  +
Sbjct  5     PDNSIAHIA-SDEDQLFEFVVRTGHGVKGLVDAGISHIPNRYIHPPEKLADFKRISSTIT  63

Query  1076  IPTIDISNWDDPAV----SRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVE  909
             +P ID+S   D ++    ++ +CEA +++GFF +IN+GVP +L++ L  +T  FF+LP E
Sbjct  64    LPIIDLSGLSDASIKNSIAQEICEATKKFGFFHVINYGVPQDLVKRLMDSTSEFFELPPE  123

Query  908   EKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEY  729
             +K  Y K  SP +NV  GTSF+PESEK LEWKDY+ +F+  +DEA A WPP  R   +EY
Sbjct  124   KKACYLKGVSPCKNVFLGTSFTPESEKCLEWKDYIIMFFFGEDEARAFWPPEYRDVLLEY  183

Query  728   MTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHS  549
             +     +I  + E L+ G+ +   +D      ++  K +N NYYP CPNPEL VGVG HS
Sbjct  184   LKLQQPLISFIFESLLKGIGV--TVDDELIKAYIEPKAVNLNYYPVCPNPELTVGVGPHS  241

Query  548   DISTITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVS  369
             D+  IT+L+QD +GGL  +    D WV + P+ GAL++N+G  L+ILSNG YKS EH   
Sbjct  242   DLGVITLLVQDDVGGLQAKI--EDEWVEIAPMPGALIVNVGATLEILSNGEYKSVEHMAR  299

Query  368   ANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKET-  192
             A+  ++RIS+PIFV P P  ++GPLP +L    KP+YK+L++ + + HFF   H GK+T 
Sbjct  300   AS-NTNRISIPIFVGPRPHTKIGPLPGLLQKDGKPIYKDLLFGELMEHFFSTPHKGKQTP  358

Query  191   IEFAKI  174
             ++FA+ 
Sbjct  359   LDFARF  364



>ref|XP_010491986.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like isoform X2 [Camelina 
sativa]
Length=368

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/359 (46%), Positives = 231/359 (64%), Gaps = 7/359 (2%)
 Frame = -3

Query  1235  AALSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDSIPTIDI  1059
              A S+   V D+VVN+  GVKGL D + + ALPS YIQ P+ER  ++ I+    +P ID+
Sbjct  11    TASSDDFEVRDYVVNQRNGVKGLVDFLTLTALPSVYIQAPQERFTSDKILVGSPVPVIDV  70

Query  1058  SNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             SNW+DP V+R +C AA   G FQI+NHG+  E L+ +  A   FF+LP EE+RKY + +S
Sbjct  71    SNWNDPNVAREICHAATTLGLFQIVNHGIAPEELKGIVAAARGFFELPAEERRKYWRGSS  130

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAAL-WPPACRHEAMEYMTQCNAMIK  702
              S+     TSF+P  E  LEW+D+L   Y+      A+ WPP C+ + +++  +   + +
Sbjct  131   VSKTAWLTTSFNPYKESVLEWRDFLKFEYLPQQHNFAITWPPVCKEQVIDHFKKIKPITE  190

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              +L +L++  N+   +D S +   MG  R+NFNYYPKCP P LA+G GRHSDI+T+T+LL
Sbjct  191   KILNILIN--NLNSVIDDSNKQTLMGTMRMNFNYYPKCPEPSLAIGTGRHSDINTLTLLL  248

Query  521   QDH--IGGLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             Q+   +G L  R   + D W+HVPP+ GA+V+NIGD LQILSN RY+S EH V  N    
Sbjct  249   QEDGVLGSLFARATEDGDKWIHVPPMPGAIVVNIGDVLQILSNDRYRSVEHCVVVNKCCS  308

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             R+S+P+F  P  +  + PLPEVL   E   Y++ VYSDYL+ FF + HDGK+TIE  K+
Sbjct  309   RVSIPVFCGPVHDSVIEPLPEVLEYNETARYRKTVYSDYLKGFFERPHDGKKTIESIKL  367



>emb|CDX68770.1| BnaC01g06830D [Brassica napus]
Length=364

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 232/371 (63%), Gaps = 22/371 (6%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDM-GIKALPSQYIQPPKERIAANAIVADDS---  1077
             MAP  L++  ++ DFVVN+  GVKGL D+   K LP  YIQ P++R+    ++ + +   
Sbjct  1     MAPIGLTDV-AITDFVVNQRHGVKGLVDIISPKTLPPCYIQLPEKRVTTEKLIMEAATTG  59

Query  1076  --------IPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFK  921
                     IP ID+S+W +P V+  +CEAA   GFFQI+NHGV V+    L+ A   FF 
Sbjct  60    KGALSAPVIPVIDVSDWKNPNVAEDICEAAATLGFFQIVNHGVSVDEQNELRAAGRGFFD  119

Query  920   LPVEEKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDD-EAAALWPPACRH  744
             LP EEK++Y + +S S+   Y TSF+P  E  LEW+DYL   Y+SD  + AA WP  CR 
Sbjct  120   LPTEEKKRYWEGSSVSDTAWYMTSFNPYKEAKLEWRDYLKFEYLSDQVDFAATWPTVCRD  179

Query  743   EAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVG  564
             E + +  +   + + +LE+LM+ LN      + +E   MG  R+N NYYP+CP+P+L VG
Sbjct  180   EVVNHSNRMKPIGRKILEILMNNLNA-----RMEEETLMGTLRMNVNYYPECPDPKLTVG  234

Query  563   VGRHSDISTITVLLQDHI-GGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKS  387
              G H DI+T+T+LLQD I G L+ R    D W+H+PPV GA+V+NIGD LQILSN RYKS
Sbjct  235   TGHHCDINTLTLLLQDDILGSLYARY--GDKWLHIPPVMGAIVVNIGDMLQILSNDRYKS  292

Query  386   AEHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAH  207
              EH V A+    RIS   +  P  +  + PL EVL  GEKPLYK  +YSDY++++F + H
Sbjct  293   VEHLVMASRFLSRISFAYYCGPSYDSVIEPLREVLENGEKPLYKPTMYSDYMKYYFARPH  352

Query  206   DGKETIEFAKI  174
              G +TIE  K+
Sbjct  353   TGSKTIESIKL  363



>ref|XP_010419817.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Camelina sativa]
Length=364

 Score =   321 bits (822),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/359 (45%), Positives = 233/359 (65%), Gaps = 7/359 (2%)
 Frame = -3

Query  1235  AALSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDSIPTIDI  1059
              A S+   V D+VVN+  GVKGL D + +  LPS YIQPP+ER  ++ I+    +P ID+
Sbjct  7     TASSDDIEVRDYVVNQRNGVKGLVDFLTLTTLPSPYIQPPQERFTSDKILLGSPVPVIDV  66

Query  1058  SNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             SNW+DP V+R +C AA   G FQI+NHG+  E L+ +  A   FF+LPVEE+R+Y + +S
Sbjct  67    SNWNDPNVAREICHAATTLGLFQIVNHGIAPEELKGIIAAARGFFELPVEERRRYWRGSS  126

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAAL-WPPACRHEAMEYMTQCNAMIK  702
              SE     TSF+P  E  LEW+D+L   Y+      A+ WP  C+ + +++  +   + +
Sbjct  127   VSETAWLTTSFNPYKESVLEWRDFLKFEYLPQQHNFAITWPLVCKEQVIDHFKKIKPITE  186

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              +L +L++  N+   +D+S +   MG  R+NFNYYPKCP P LA+G GRHSDI+T+T+LL
Sbjct  187   KILNILIN--NLNAIIDESNKETLMGTMRMNFNYYPKCPEPSLAIGTGRHSDINTLTLLL  244

Query  521   QDH--IGGLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             Q+   +G L+ R   + D W+HVPP+ GA+V+NIGD LQIL+N RY+S EH V  N    
Sbjct  245   QEDGVLGSLYARATEDGDKWIHVPPMPGAIVVNIGDVLQILTNDRYRSVEHCVVVNKCCS  304

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             R+S+P F  P  +  + PLPE+L   E   Y+++VYSDYL+ FF + HDGK+TIE  K+
Sbjct  305   RVSIPGFCGPVHDSVIEPLPEMLENNEMARYRKIVYSDYLKGFFERPHDGKKTIESIKL  363



>ref|XP_002873560.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49819.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=359

 Score =   320 bits (820),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 162/362 (45%), Positives = 233/362 (64%), Gaps = 9/362 (2%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDSIPT  1068
             M+P   ++   V DFVVN+  GVKGL D + +  LPS YIQPP+ER  ++ I+    +P 
Sbjct  1     MSPT--TDEIEVKDFVVNQKNGVKGLVDFLTLTTLPSPYIQPPQERFTSDKILFGSPVPV  58

Query  1067  IDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSK  888
             ID+SNW+DP ++R +C AA + G FQI+NHG+    L+ +  A   FF+LP EE+R+Y +
Sbjct  59    IDVSNWNDPHLAREICHAATKLGVFQIVNHGIAPAELKGVIAAARGFFELPAEERRRYWR  118

Query  887   ANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSD-DEAAALWPPACRHEAMEYMTQCNA  711
               S SE     TSF+P  E+ LEW+D+L   Y+    + AA WP  C+ + +++  +   
Sbjct  119   GTSVSETAWLTTSFNPYKERVLEWRDFLKFEYLPQRHDFAATWPSVCKEQVIDHFKKIKP  178

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTIT  531
             + + +L +L++  N+   +D+S +   MG  R+NFNYYPKCP P LA+G GRHSDI+TIT
Sbjct  179   ITEKILNILIN--NLNSVVDESNKETLMGTMRMNFNYYPKCPEPSLAIGTGRHSDINTIT  236

Query  530   VLLQDH--IGGLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANG  360
             +LLQ+H  +  L+ R   + D W++VPP+ GA+ +NIGD LQILSN RY+S EH V  N 
Sbjct  237   LLLQEHGVLSSLYARATEDGDKWINVPPIAGAIAVNIGDVLQILSNDRYRSVEHCVVVNK  296

Query  359   GSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFA  180
                R+S+P+F  P  +  + PLP VL   E   Y++ VYSDYL+ FFG+ HDGK+TIE  
Sbjct  297   CCSRVSIPVFCGPVHDSVIEPLPGVLENNEMARYRKTVYSDYLKGFFGRPHDGKKTIESI  356

Query  179   KI  174
             K 
Sbjct  357   KF  358



>ref|XP_009101685.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Brassica rapa]
 emb|CDX83116.1| BnaA01g21160D [Brassica napus]
Length=364

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/371 (45%), Positives = 230/371 (62%), Gaps = 22/371 (6%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDS---  1077
             MAP  L++  ++ DFVVN+  GVKGL + +  K LPS YIQ P++R+    ++ +     
Sbjct  1     MAPIGLTDV-AITDFVVNQRHGVKGLVEVISPKTLPSCYIQLPEKRVTTEKLIMEAPTTG  59

Query  1076  --------IPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFK  921
                     IP ID+S+W +P V+  +CEAA   GFFQI+NHGV V+    L+ A   FF 
Sbjct  60    KGALSAPVIPVIDVSDWKNPTVAEEICEAAATLGFFQIVNHGVSVDEQNELRAAGRGFFD  119

Query  920   LPVEEKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDD-EAAALWPPACRH  744
             LP EEK++Y + +S SE   Y TSF+P  E  LEW+DYL   Y+SD  + +A WP  CR 
Sbjct  120   LPTEEKKRYWEGSSVSETAWYMTSFNPYKEAKLEWRDYLKFEYLSDQVDFSATWPTVCRD  179

Query  743   EAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVG  564
             E + +  +   + + +LE+LM+ LN      + +E   MG  R+N NYYP+CP+P+L VG
Sbjct  180   EVVNHSNRMKPIGRKILEILMNNLNT-----RMEEQDLMGTLRMNVNYYPECPDPKLTVG  234

Query  563   VGRHSDISTITVLLQDHI-GGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKS  387
              G H DI+T+T+LLQD I G L+ R    D W+H+PPV GA+V+NIGD LQILSN RYKS
Sbjct  235   TGHHCDINTLTLLLQDDILGSLYARY--GDKWLHIPPVMGAIVVNIGDMLQILSNDRYKS  292

Query  386   AEHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAH  207
              EH V  +    RIS   +  P  +  + PL EVL  GEKPLYK  +Y DY++++F + H
Sbjct  293   VEHLVMTSRFLSRISFAYYCGPSYDSVIEPLREVLENGEKPLYKATMYKDYMKYYFARPH  352

Query  206   DGKETIEFAKI  174
              G +TIE  K+
Sbjct  353   TGSKTIESIKL  363



>ref|XP_010491985.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like isoform X1 [Camelina 
sativa]
Length=374

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 165/365 (45%), Positives = 231/365 (63%), Gaps = 13/365 (4%)
 Frame = -3

Query  1235  AALSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDSIPTIDI  1059
              A S+   V D+VVN+  GVKGL D + + ALPS YIQ P+ER  ++ I+    +P ID+
Sbjct  11    TASSDDFEVRDYVVNQRNGVKGLVDFLTLTALPSVYIQAPQERFTSDKILVGSPVPVIDV  70

Query  1058  SNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             SNW+DP V+R +C AA   G FQI+NHG+  E L+ +  A   FF+LP EE+RKY + +S
Sbjct  71    SNWNDPNVAREICHAATTLGLFQIVNHGIAPEELKGIVAAARGFFELPAEERRKYWRGSS  130

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAAL-WPPAC------RHEAMEYMTQ  720
              S+     TSF+P  E  LEW+D+L   Y+      A+ WPP C      R + +++  +
Sbjct  131   VSKTAWLTTSFNPYKESVLEWRDFLKFEYLPQQHNFAITWPPVCNLVTLYREQVIDHFKK  190

Query  719   CNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIS  540
                + + +L +L++  N+   +D S +   MG  R+NFNYYPKCP P LA+G GRHSDI+
Sbjct  191   IKPITEKILNILIN--NLNSVIDDSNKQTLMGTMRMNFNYYPKCPEPSLAIGTGRHSDIN  248

Query  539   TITVLLQDH--IGGLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVS  369
             T+T+LLQ+   +G L  R   + D W+HVPP+ GA+V+NIGD LQILSN RY+S EH V 
Sbjct  249   TLTLLLQEDGVLGSLFARATEDGDKWIHVPPMPGAIVVNIGDVLQILSNDRYRSVEHCVV  308

Query  368   ANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETI  189
              N    R+S+P+F  P  +  + PLPEVL   E   Y++ VYSDYL+ FF + HDGK+TI
Sbjct  309   VNKCCSRVSIPVFCGPVHDSVIEPLPEVLEYNETARYRKTVYSDYLKGFFERPHDGKKTI  368

Query  188   EFAKI  174
             E  K+
Sbjct  369   ESIKL  373



>emb|CDP17660.1| unnamed protein product [Coffea canephora]
Length=253

 Score =   314 bits (804),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 183/227 (81%), Gaps = 3/227 (1%)
 Frame = -3

Query  1244  MAPAALSESES--VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIP  1071
             MAPA   +S S  V+ F V++G GVKGL+D+G+  LP QYIQPP+E+I  + IV DDSIP
Sbjct  1     MAPALSMDSNSWDVISFAVDKGHGVKGLADLGLHTLPKQYIQPPEEQIINSTIVTDDSIP  60

Query  1070  TIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYS  891
              ID+SNW+DP V+  +C AAE+WGFFQI+NHG+P+E+LE++K AT RFF LP EEK K+S
Sbjct  61    VIDLSNWNDPNVAEQICNAAEKWGFFQIVNHGIPIEVLENVKEATRRFFALPAEEKNKHS  120

Query  890   KANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNA  711
             K +SPS NVRYGTSF+P++EK LEWKD+LSLFYVSDDEAAALWP ACR+E +++M +   
Sbjct  121   KDSSPSNNVRYGTSFTPKAEKALEWKDFLSLFYVSDDEAAALWPSACRNETLDFMKKSQF  180

Query  710   MIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELA  570
             +I+ LLE LM GLN++E +D++KE L MG+KRIN NYYPKCP PEL 
Sbjct  181   VIRKLLEALMKGLNVKE-IDETKESLLMGSKRININYYPKCPEPELT  226


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 16/62 (26%)
 Frame = -3

Query  359  GSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFA  180
            GS RI++  +    P+C   P PE+          +++YSDY++HFF KAHDGKET++FA
Sbjct  208  GSKRININYY----PKC---PEPEL---------TQVLYSDYVKHFFRKAHDGKETVDFA  251

Query  179  KI  174
            KI
Sbjct  252  KI  253



>ref|NP_568260.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 emb|CAC42888.1| 1-AMINOCYCLOPROPANE-1-CARBOXYLATE OXIDASE-like protein [Arabidopsis 
thaliana]
 gb|AED91785.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=360

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/352 (45%), Positives = 230/352 (65%), Gaps = 8/352 (2%)
 Frame = -3

Query  1211  VVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAV  1035
             V DFVVN+  GVKGL D + +  LPS YIQPP+ER  ++ I+    +P ID+SNW++P V
Sbjct  10    VRDFVVNQKNGVKGLVDFLTLTTLPSPYIQPPQERFTSDKILLGSPVPVIDVSNWNEPHV  69

Query  1034  SRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYG  855
             +R +C AA + G FQI+NHG+     + +  A   FF+LP EE+R+Y + +S SE     
Sbjct  70    AREICHAASKLGLFQIVNHGIAPAEFKGVIAAARGFFELPAEERRRYWRGSSVSETAWLT  129

Query  854   TSFSPESEKTLEWKDYLSLFYVSD-DEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMS  678
             TSF+P  E  LEW+D+L   Y+    + AA WP  C+ + +++  +   + + +L +L++
Sbjct  130   TSFNPCIESVLEWRDFLKFEYLPQRHDFAATWPSVCKEQVIDHFKRIKPITERILNILIN  189

Query  677   GLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDH--IGG  504
               N+   +D+S +   MG  R+NFNYYPKCP P LA+G GRHSDI+T+T+LLQ+   +  
Sbjct  190   --NLNTIIDESNKETLMGTMRMNFNYYPKCPEPSLAIGTGRHSDINTLTLLLQEDGVLSS  247

Query  503   LHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFV  327
             L+ R   + D W+HVPP+ GA+V+NIGD LQILSN RY+S EH V  N    R+S+P+F 
Sbjct  248   LYARATEDGDKWIHVPPIPGAIVVNIGDVLQILSNDRYRSVEHCVVVNKYCSRVSIPVFC  307

Query  326   TPDPECRVGPLPEVL-AGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P  +  + PLPEVL    E   Y+++VYSDYL+ FFG+ HDGK+TIE  K+
Sbjct  308   GPVHDSVIEPLPEVLDKNNEMARYRKIVYSDYLKFFFGRPHDGKKTIESIKL  359



>emb|CDX85696.1| BnaA02g01170D [Brassica napus]
Length=356

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/359 (44%), Positives = 234/359 (65%), Gaps = 10/359 (3%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDS-IPTIDIS  1056
             ++ +  V +FVVN+  GVKGL D + +  LPS YIQPP++R+ ++ I++  S IP ID+S
Sbjct  1     MTSTTDVREFVVNQRNGVKGLVDSLKLTTLPSPYIQPPQKRLTSDKILSSSSQIPVIDVS  60

Query  1055  NWDDPAVSRAVCEAAEEWGFFQIINHGV-PVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             NW+DP V+  +C+AA + G FQI+NHG+ PVEL ++L  A   F++ PVEE+ +Y K +S
Sbjct  61    NWNDPQVASEICDAAAKLGLFQIVNHGIAPVEL-KALVAAARGFYQFPVEERSRYWKGSS  119

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEA-AALWPPACRHEAMEYMTQCNAMIK  702
              SE     TSFSP  E  LEW+DY+   ++       A WPP C+ +  ++  +   +  
Sbjct  120   VSETAWLTTSFSPYKESVLEWRDYIKFEFLPQQHGFDAAWPPVCKEQVTDHFKRMKPIAN  179

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              +L +L++  N+   +++S +   MG  R+NFNYYP+CP P LA+G GRHSDI+T+T+LL
Sbjct  180   KILNILIN--NLNSTINESSQQTLMGTMRMNFNYYPECPEPSLAIGTGRHSDINTLTLLL  237

Query  521   QDH--IGGLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             Q+   +  L+ R   + D W+HVPP+ GA+V+NIGD LQI+SN  Y+S EH V  N    
Sbjct  238   QEDGVLSSLYARATEDGDKWIHVPPIPGAIVVNIGDVLQIMSNDGYRSVEHCVLVNKSCS  297

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             R+S+P+F  P  +  + PLPEVL   E   Y+++VYSDYL+ FF + HDGK TIE  K+
Sbjct  298   RVSIPVFCEPIRDSVIQPLPEVLENNEMARYRKVVYSDYLKTFFERPHDGKATIESVKL  356



>ref|XP_009125854.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Brassica rapa]
Length=361

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/359 (44%), Positives = 233/359 (65%), Gaps = 10/359 (3%)
 Frame = -3

Query  1229  LSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDS-IPTIDIS  1056
             ++ +  V +FVVN+  GVKGL D + +  LPS YIQPP++R+ ++ I++  S IP ID+S
Sbjct  1     MTSTTDVREFVVNQRNGVKGLVDSLKLTTLPSPYIQPPQKRLTSDKILSSSSQIPVIDVS  60

Query  1055  NWDDPAVSRAVCEAAEEWGFFQIINHGV-PVELLESLKTATYRFFKLPVEEKRKYSKANS  879
             NW+DP V+  +C+AA + G FQI+NHG+ PVEL ++L  A   F++LPVEE+ +Y K +S
Sbjct  61    NWNDPQVASEICDAAAKLGLFQIVNHGIAPVEL-KALVAAARGFYQLPVEERSRYWKGSS  119

Query  878   PSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEA-AALWPPACRHEAMEYMTQCNAMIK  702
              SE     TSFSP  +  LEW+DY+   ++         WPP C+ +  ++  +   +  
Sbjct  120   VSETAWLTTSFSPYKDSVLEWRDYIKFEFLPQRHGFDDTWPPVCKAQVTDHFKRMKPIAN  179

Query  701   NLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLL  522
              +L +L++  N+   +++S +   MG  R+NFNYYP+CP P LA+G GRHSDI+T+T+LL
Sbjct  180   KILNILIN--NLNSTINESNQQTLMGTMRMNFNYYPECPEPSLAIGTGRHSDINTLTLLL  237

Query  521   QDH--IGGLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD  351
             Q+      L+ R   + D W+HVPP+ GA+V+NIGD LQI+SN RY+S EH V  N    
Sbjct  238   QEDGVFSSLYARATEDGDKWIHVPPIPGAIVVNIGDVLQIMSNDRYRSVEHYVLVNKSCS  297

Query  350   RISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             R+SVP+F  P  +  + PLPEVL   E   Y+++VYSDYL+ FF + HDGK  IE  K+
Sbjct  298   RVSVPVFCEPIRDSVIQPLPEVLENNEMARYRKVVYSDYLKTFFERPHDGKANIESVKL  356



>gb|KFK25503.1| hypothetical protein AALP_AA8G123100 [Arabis alpina]
Length=354

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/353 (46%), Positives = 232/353 (66%), Gaps = 9/353 (3%)
 Frame = -3

Query  1211  VVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADDS-IPTIDISNWDDPA  1038
             V DFVV++  GVKGL D + +  LPS YIQPP+ER+ ++ I++  S IP ID+S W D  
Sbjct  4     VRDFVVSQENGVKGLVDYLTLTTLPSPYIQPPQERLTSDKILSSSSQIPVIDVSEWTDTD  63

Query  1037  VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRY  858
             V+R +C+AA + G FQI+NHG+  E L+++  A + FF+L  EE+R Y + +S SE    
Sbjct  64    VAREICDAAAKLGLFQIVNHGIAPEDLKAMIAAAHGFFELSREERRMYWRGSSVSETAWL  123

Query  857   GTSFSPESEKTLEWKDYLSLFYV-SDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLM  681
              TSFS   E  LEW+D+L   Y+ +  + AA+WP  C+ + +++  +   + KN   + +
Sbjct  124   TTSFSSLKESALEWRDFLKFEYLPTQHDFAAMWPLVCKKQVIDHFKRIKPIAKN--ILNI  181

Query  680   SGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDH--IG  507
                N+   +D+S E   MG  R+NFNYYP+CP P LAVG GRHSDI+T+T+LLQ+   + 
Sbjct  182   LINNLNSTIDESNEKNLMGTMRMNFNYYPECPEPNLAVGTGRHSDINTLTLLLQEDGVLN  241

Query  506   GLHVRKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIF  330
              L+ R   + D W+HVPP+ GA+V+NIGD LQILSN RY+S EH V+ N    R+S+P+F
Sbjct  242   SLYARATEDGDKWIHVPPIPGAIVVNIGDVLQILSNDRYRSVEHCVAVNKLCSRVSIPVF  301

Query  329   VTPDPECRVGPLPEVL-AGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
               P  +  + PLP+VL    E   Y+++VYSDYL+ FFG+ HDGK+TIE  K+
Sbjct  302   CGPVHDSVIEPLPKVLEKNDEMTRYRKIVYSDYLKGFFGRPHDGKKTIESLKL  354



>emb|CDY43392.1| BnaA01g30230D [Brassica napus]
Length=298

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/297 (50%), Positives = 201/297 (68%), Gaps = 12/297 (4%)
 Frame = -3

Query  1235  AALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDIS  1056
             A   + +++ +FVV EG GVKGL D G+  +P  ++QP  ERIA       +++  ID+S
Sbjct  3     ANYEDRDTLFNFVVKEGNGVKGLIDSGMSCVPQPFVQPLSERIATPNGQTCEAVQPIDLS  62

Query  1055  NWDDPA---VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKA  885
               D P    V++ + EAAE  GFFQ++NHGV VELLE LK + + FF+ P E K  Y K 
Sbjct  63    QIDGPCHTEVAKQIVEAAETLGFFQVVNHGVSVELLELLKMSAHEFFEQPPENKAVYLKE  122

Query  884   NSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMI  705
              SPS+ V+YGTSF PE EK +EWKDY+S+ Y +DDEA   WP  CR  A++++    AM+
Sbjct  123   VSPSKLVKYGTSFVPEKEKAIEWKDYVSMLYTNDDEALQHWPLQCREVALDFLKSSMAMV  182

Query  704   KNLLEMLMSGLNI---EERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
             K ++E+LM  + +   EER++       +G K +N NYYP CP+PEL +GVGRHSD+  +
Sbjct  183   KRIVEVLMEDVGVILEEERMNS-----LVGTKMVNMNYYPTCPSPELTIGVGRHSDMGML  237

Query  533   TVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSAN  363
             TVLLQD IGGL+V+  N D W  +PP++GALVIN+GD LQILSNG+YKSAEHR S +
Sbjct  238   TVLLQDSIGGLYVKPDNGD-WAEIPPLNGALVINVGDTLQILSNGKYKSAEHRKSLD  293



>emb|CDP09713.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 186/256 (73%), Gaps = 2/256 (1%)
 Frame = -3

Query  941  ATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALW  762
            A ++FF+LP EEKRKY K NSP+  V+  TSFS  +EK LEWKD+L  +Y  DDE+  LW
Sbjct  3    AGHKFFELPSEEKRKYLKENSPTPTVQLKTSFS-LAEKVLEWKDFLMHWYFPDDESVNLW  61

Query  761  PPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPN  582
            P   + + +EY+     +I+ LLE+L+ GLN++E  ++SKE   MGA  ++  +YP CPN
Sbjct  62   PAVSKDQVLEYINWAKPVIRKLLEVLLKGLNVKE-FNESKESQLMGALIVDLMHYPLCPN  120

Query  581  PELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSN  402
            PELA GVGRH+DISTIT+LLQD +GGL+V+   +D W+HV PV GALVINIGD LQI+SN
Sbjct  121  PELAAGVGRHADISTITILLQDDVGGLYVQGTRADQWIHVTPVKGALVINIGDILQIVSN  180

Query  401  GRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHF  222
             RYKS EHRV  N   +R+SVPIF+ P  +  VGP PE+L  GEKP+YK +V+SDY   F
Sbjct  181  DRYKSIEHRVIVNKSRNRVSVPIFLNPKDDAVVGPFPELLESGEKPIYKNVVFSDYFNFF  240

Query  221  FGKAHDGKETIEFAKI  174
            F K  +GK+T+EFAK+
Sbjct  241  FSKGPEGKKTLEFAKV  256



>gb|KFK42053.1| hypothetical protein AALP_AA2G205200 [Arabis alpina]
Length=400

 Score =   301 bits (771),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 215/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSD-MGIKALPSQYIQPPKERIAANAIVADD----  1080
             M+P AL++  +V DFVVN+  GVKGL D M  K LPS+YIQ P++R+    ++ D+    
Sbjct  1     MSPFALTDV-AVTDFVVNQRNGVKGLVDVMSPKTLPSRYIQLPEKRVTTEKLIVDNIKTG  59

Query  1079  -------SIPTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFK  921
                    +IP ID+S+W++P V+  +CEAA   GFFQI+NHGV V+ L  L+ A   FF 
Sbjct  60    KGGLPSPAIPVIDVSDWENPNVAEEICEAAATLGFFQIVNHGVSVDQLSDLRAAGRGFFG  119

Query  920   LPVEEKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDD-EAAALWPPACRH  744
             LP EEK++Y K +S S+   Y TSF+P  E  LEW+D++   Y  D  ++ A+WP  CR 
Sbjct  120   LPAEEKKRYWKGSSVSDTAWYMTSFNPYEEAKLEWRDFIKFEYRPDQVDSTAMWPTVCRD  179

Query  743   EAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVG  564
             E + +  +   + K +LE+LM+ LN    +D S E   MG  R+N N+YP+CP+P+LAVG
Sbjct  180   EVLNHSHRMKPIGKKILEILMNHLNAS--MDHSLEQTLMGTLRMNLNFYPECPDPKLAVG  237

Query  563   VGRHSDISTITVLLQDH-IGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKS  387
              GRHSDI+T+T+LLQD  IG L+ R    D W+HVPPV GA+V+NIGD LQI+SN RYKS
Sbjct  238   TGRHSDINTLTLLLQDDIIGSLYARY--GDKWLHVPPVMGAIVVNIGDILQIVSNDRYKS  295

Query  386   AEHRVSANGGSDRISVPIFVTPDPECRVGPLPE  288
              EH V AN    RIS   +  P+ +  V PLPE
Sbjct  296   VEHVVMANRFLSRISFAFYCGPNNDSVVEPLPE  328



>ref|XP_010266348.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Nelumbo nucifera]
Length=367

 Score =   297 bits (761),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 162/367 (44%), Positives = 227/367 (62%), Gaps = 29/367 (8%)
 Frame = -3

Query  1241  APAALSESES-VVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIP--  1071
             A  A S  ES V +FVV +G GVKGL+D GI ++P +YI PP ERI     +  D+ P  
Sbjct  19    AKMAASHHESDVFEFVVKKGFGVKGLADSGITSVPPRYIHPPDERIDRKKTI--DASPFL  76

Query  1070  --TIDISNWD----DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVE  909
                ID+S  +    D  ++ A+CEAA + GFFQ++NHGV ++++E  K   + FF L  E
Sbjct  77    GSPIDLSGLEGEKKDETIA-AICEAASKLGFFQVVNHGVSLQVMERAKQDAHTFFNLSPE  135

Query  908   EKRKYSKANSPSENVRYGTSFSPESEK-TLEW-KDYLSLFYVSDDEAAALWPPACRHEAM  735
             +K  Y K  +P  NV Y TSF     K +  W  D L+  Y             CR  A 
Sbjct  136   KKAVYLKGKTPCPNVFYSTSFGRRPRKNSFSWFIDLLTGIY------------GCRDAAH  183

Query  734   EYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGR  555
             +Y+   + MI+ +L  L+ GL +E   D+S    +M AK +N N+YP CPNPEL VGVGR
Sbjct  184   DYLKAASKMIQGILGALLRGLGVE--YDESLLSCYMEAKAVNMNFYPPCPNPELTVGVGR  241

Query  554   HSDISTITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             HSD++ +T+LLQD IGGL V K+    W+ +PPV+GA+V+N+GD L+ILSNGRYKSAEHR
Sbjct  242   HSDLAALTILLQDDIGGLFV-KVEDGGWIEIPPVEGAIVVNVGDTLEILSNGRYKSAEHR  300

Query  374   VSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKE  195
             V A+    R+SVPIFV+P P   +GPL  +     K +Y+ L++ +Y+ ++FG AH GK+
Sbjct  301   VIASSTRARVSVPIFVSPRPHTMIGPLLGLAEKDGKTVYRHLLFGEYMTNYFGAAHQGKK  360

Query  194   TIEFAKI  174
             T+ FA++
Sbjct  361   TLVFARL  367



>ref|XP_006445648.1| hypothetical protein CICLE_v10018321mg [Citrus clementina]
 gb|ESR58888.1| hypothetical protein CICLE_v10018321mg [Citrus clementina]
Length=308

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/354 (44%), Positives = 209/354 (59%), Gaps = 80/354 (23%)
 Frame = -3

Query  1202  FVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRAV  1023
             FV+N+G G KGLS+M +KALP QYI P +ERI    ++   SI   D+S  +D  V++++
Sbjct  33    FVINQGNGAKGLSEMRLKALPKQYIHPLEERIDEAKVLPQASIAVNDMSKCNDAEVAKSI  92

Query  1022  CEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFS  843
             C+A E WG+FQ                              +YSK  SPS NVR+ TSF+
Sbjct  93    CDATENWGYFQ------------------------------RYSKEPSPSNNVRFVTSFN  122

Query  842   PESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIE  663
              + EK LEWKD+LS                 + E +EYM                     
Sbjct  123   TQVEKALEWKDFLS-----------------QDEVLEYMK--------------------  145

Query  662   ERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLN  483
                        MG+ R N N+ P C NPEL +GVGRHSD+ST+TVL QD IGG +VR  +
Sbjct  146   -----------MGSVRTNLNFCPICLNPELTIGVGRHSDVSTLTVL-QDSIGGFYVRGND  193

Query  482   SDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRV  303
              ++W+ V P+DG+L+INIGDALQILSNGRYKS EH V A+G  + ISVPIF+ P P+  +
Sbjct  194   GESWIDVHPIDGSLLINIGDALQILSNGRYKSVEHCVVASGSKNSISVPIFINPRPQDTI  253

Query  302   GPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI*A-MHIVSSCF  144
              PLPEVLA GEKP+YK ++YSDY++H F KAHDGK+T+ FAK+   + +V++CF
Sbjct  254   CPLPEVLASGEKPIYKPVLYSDYVKHVFRKAHDGKKTVGFAKMSKFLTVVANCF  307



>gb|KHG22041.1| Deacetoxyvindoline 4-hydroxylase [Gossypium arboreum]
Length=322

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 195/299 (65%), Gaps = 15/299 (5%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADDSIPT  1068
             MAP+ L +  S+ +FVV +G GVKG+ D GI  +P  YIQPP E+I   NA  +   IP 
Sbjct  1     MAPS-LDDESSLFNFVVRDGNGVKGIVDSGISKVPRPYIQPPAEQINKKNA--SKCEIPP  57

Query  1067  IDISNWDDPA---VSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S  D P    V+  +  AAE  GFFQ++NHGVP++LL+SLK   + FF LP E K  
Sbjct  58    IDLSKLDGPEHDEVANQIVRAAETLGFFQVVNHGVPIQLLDSLKQTAHNFFGLPAERKAV  117

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS  V+YGTSF PE EK LEWKDY+S+ Y +++EA   WP  CR  A++Y+   
Sbjct  118   YRKEVSPSPLVKYGTSFVPEKEKALEWKDYISMGYTNENEALQQWPMECRDVALQYLKTS  177

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
             + M+K LL++LM+ L +E  LD S    F+G K +N N+YP CPNPEL VGVGRHSD+ T
Sbjct  178   HEMVKKLLDVLMANLGVE--LDDSNIDAFIGKKMVNMNFYPTCPNPELTVGVGRHSDMGT  235

Query  536   ITVLLQDHIGGLHVR------KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEH  378
             +T+LLQD IGGLHV+          + WV +P + GALVINIGD   ++ + + +S E+
Sbjct  236   LTILLQDGIGGLHVKVPEIIDMEKKEEWVEIPRIPGALVINIGDIYGVMEDIKVRSIEY  294



>ref|XP_009588068.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Nicotiana tomentosiformis]
Length=203

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 165/199 (83%), Gaps = 6/199 (3%)
 Frame = -3

Query  755  ACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPE  576
            +CR EA+E++     +IK LL+ LM GLNI E +D++KE L MG+KRIN NYYPKCPNPE
Sbjct  5    SCRDEALEFLRNSEIVIKKLLKALMKGLNINE-IDQTKESLLMGSKRINLNYYPKCPNPE  63

Query  575  LAVGVGRHSDISTITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGR  396
            L VGVGRHSD+ST+T+LLQD+IGGL+V+KL+S++WVH+PP+DGA+VINI DALQI++NG+
Sbjct  64   LTVGVGRHSDVSTLTILLQDNIGGLYVKKLDSNSWVHIPPIDGAIVINIRDALQIMNNGK  123

Query  395  YKSAEHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLY-----KELVYSDYL  231
            YKS EHRV ANG ++RISVPIFV P P   +GPLPEV+  GEK +Y     K+++YSDY+
Sbjct  124  YKSIEHRVMANGCNNRISVPIFVNPKPNDLIGPLPEVVKNGEKAIYKQVLXKQVLYSDYV  183

Query  230  RHFFGKAHDGKETIEFAKI  174
            +HFF KAHDGK T++F+KI
Sbjct  184  KHFFRKAHDGKVTVDFSKI  202



>emb|CDP22154.1| unnamed protein product, partial [Coffea canephora]
Length=288

 Score =   279 bits (713),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/301 (46%), Positives = 191/301 (63%), Gaps = 19/301 (6%)
 Frame = -3

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+S  D P    V  A+ +AAE  GFFQ+INHG+P++ LESLK A +RFF LP + K  
Sbjct  1     IDLSKLDGPDHDQVVEAIVKAAETLGFFQVINHGMPLDFLESLKNAAHRFFALPADAKSV  60

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS +V+YGTSF+PE EK LEWKD++S+ Y +D +A   WP  C+ EA +Y+   
Sbjct  61    YLKGVSPSPSVKYGTSFAPEQEKALEWKDFVSMVYTNDGDAQQHWPKECKEEAFDYLKSS  120

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M++ LL  L+  L +   LD S+    +G K +N N+YP CPNPEL VG         
Sbjct  121   IEMVRRLLTDLIGNLGV--TLDDSRLESLIGMKMVNMNFYPICPNPELTVG---------  169

Query  536   ITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGG  357
             + V L++    L  RK   + W+ +PP+ GALVIN+GD+LQILSNGRYKSAEHRV     
Sbjct  170   LYVKLEE--SKLDGRK---EEWIEIPPIPGALVINVGDSLQILSNGRYKSAEHRVRTTSK  224

Query  356   SDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
               R+SVP F  P P  ++GPL  +       +Y+E+ + +Y+ +FFG AHDGK++++F K
Sbjct  225   QSRVSVPFFAIPRPTTKIGPLRHLAELDGGAIYREVEFQEYMSNFFGHAHDGKKSLDFVK  284

Query  176   I  174
             I
Sbjct  285   I  285



>emb|CBI16506.3| unnamed protein product [Vitis vinifera]
Length=253

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 172/220 (78%), Gaps = 4/220 (2%)
 Frame = -3

Query  1244  MAPAAL---SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSI  1074
             MAP  +   + S  + DFVVN+G GVKGLS+M + +LP Q+IQPP+ERI A+ +V +  I
Sbjct  1     MAPTMVVSATNSWDITDFVVNQGHGVKGLSEMKLPSLPKQFIQPPEERIDASKVVCEKCI  60

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID++  DDP V+  +C+AAE+WGFFQ++NHGVP+ +LE +K AT+RFF LP EEK+KY
Sbjct  61    PVIDMAGLDDPKVAELICDAAEKWGFFQVVNHGVPIGVLEDVKEATHRFFALPGEEKKKY  120

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             SK NS S +VR+GTSF+P++EK+LEWKDYLSLFYVS+DEA+ALWP  C+ +A+EYM +  
Sbjct  121   SKENSNSNSVRFGTSFTPQAEKSLEWKDYLSLFYVSEDEASALWPSVCKDQALEYMKRSE  180

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYP  594
              +I+ LL++LM  LN++E +D+ KE L MG+ RIN NYYP
Sbjct  181   LVIRQLLDVLMRRLNVKE-IDEKKESLLMGSMRINLNYYP  219



>emb|CBI16504.3| unnamed protein product [Vitis vinifera]
Length=224

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 172/220 (78%), Gaps = 4/220 (2%)
 Frame = -3

Query  1244  MAPAAL---SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSI  1074
             MAP  +   + S  + DFVVN+G GVKGLS+M + ++P Q+IQPP+ERI A+ +V ++ I
Sbjct  1     MAPKMVQSATNSWDITDFVVNQGHGVKGLSEMKLLSIPKQFIQPPEERIDASKVVCEECI  60

Query  1073  PTIDISNWDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             P ID++  D P V++ +C+AAE+WGFFQ++NHGVP+ +LE +K AT+RFF LP EEKRKY
Sbjct  61    PVIDMACLDGPKVAQMICDAAEKWGFFQVVNHGVPLGVLEDVKEATHRFFALPGEEKRKY  120

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
             SK NS S NVR+GTSF+P++EK+LEWKDYLSLFYVS++EA+ALWP  C+ +A+EYM +  
Sbjct  121   SKENSRSNNVRFGTSFTPQAEKSLEWKDYLSLFYVSENEASALWPSVCKDQALEYMKRSE  180

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYP  594
              +I+ LLE+L   LN++E +D+ KE L MG+ RIN NYYP
Sbjct  181   LVIRQLLEVLTRRLNVKE-IDEKKESLLMGSMRINLNYYP  219



>ref|XP_006300271.1| hypothetical protein CARUB_v100140881mg, partial [Capsella rubella]
 gb|EOA33169.1| hypothetical protein CARUB_v100140881mg, partial [Capsella rubella]
Length=277

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/281 (48%), Positives = 186/281 (66%), Gaps = 8/281 (3%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERI-AANAIVADDSIPT  1068
             MA     +  ++ +FVV +G GVKG+ D G+ ++P  ++QP  ERI   NA   + S P 
Sbjct  1     MAIINFEDQPTLYNFVVKQGNGVKGMIDSGLSSVPQPFVQPISERIPTQNAYTCEASQP-  59

Query  1067  IDISNWDDP---AVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRK  897
             ID+ + + P    V++ + EAAE  GFFQ++NHGV VELL+ LKT+ + FF    EEK  
Sbjct  60    IDLFHLNGPHHKEVAKQIVEAAETLGFFQVVNHGVSVELLDLLKTSAHEFFAQSPEEKAI  119

Query  896   YSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQC  717
             Y K  SPS+ V+YGTSF P+ EK +EWKDY+S+ Y SD EA   WP  CR  A++++   
Sbjct  120   YLKEVSPSKLVKYGTSFVPDKEKAIEWKDYVSMMYTSDHEALQHWPQPCREVALKFLKSS  179

Query  716   NAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDIST  537
               M++N++ +LM   N+  +L++ +    MG K +N NYYP CP+PEL +GVGRHSD+  
Sbjct  180   MEMVENIVNILME--NVGVKLEEERMNGLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGM  237

Query  536   ITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQ  414
             +TVLLQD IGGL+V KL++  W  +PPV GALVINIGD LQ
Sbjct  238   LTVLLQDGIGGLYV-KLDNGEWAEIPPVHGALVINIGDTLQ  277



>ref|XP_008352041.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103415491 
[Malus domestica]
Length=604

 Score =   275 bits (702),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 169/217 (78%), Gaps = 2/217 (1%)
 Frame = -3

Query  1232  ALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISN  1053
              +S+   + DFV+N+G GVKGLS++G+K++P+QYIQP +ERI+   I++ DSIP ID+SN
Sbjct  4     TISDLSDITDFVINKGNGVKGLSELGLKSIPNQYIQPLEERIST-MIMSQDSIPIIDMSN  62

Query  1052  WDDPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPS  873
             W+DP V  ++C AAE+ GFF ++NHGVPVE+LE++K AT+RFF LP EEK KYSK +SPS
Sbjct  63    WNDPKVVESICSAAEKLGFFLLVNHGVPVEVLENVKEATHRFFVLPAEEKSKYSKEHSPS  122

Query  872   ENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLL  693
             +NV+YGTSF+P++EK LEWKD+L L+    DEA+A WPP CR E +EYM +   + K L+
Sbjct  123   KNVQYGTSFNPQAEKALEWKDFLGLYAYGQDEASAFWPPVCRDEVLEYMKKSEILTKRLV  182

Query  692   EMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPN  582
             E+LM  LN++E +DK+KE L MGAKRI  NYYP  PN
Sbjct  183   ELLMRRLNVKE-IDKAKEYLLMGAKRIQLNYYPIXPN  218



>gb|KHM99648.1| 1-aminocyclopropane-1-carboxylate oxidase like 6 [Glycine soja]
Length=268

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/267 (49%), Positives = 184/267 (69%), Gaps = 5/267 (2%)
 Frame = -3

Query  1226  SESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWD  1047
             S   +++DF+VN+  GVKGL+D+ +  +P QYIQ  + R+  + I+  +SIP ID + WD
Sbjct  3     STPSNLIDFLVNQANGVKGLADLNLPNVPHQYIQSLQARLDHSKIIPQESIPIIDFTKWD  62

Query  1046  DPAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSEN  867
                +   + +A  +WGFFQI+NHG+P ++L+ LK A ++FF LP EEK K  K NS  E 
Sbjct  63    ---IQDFIFDATTKWGFFQIVNHGIPSKVLDGLKDAVHKFFVLPAEEK-KCLKVNSSPEV  118

Query  866   VRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEM  687
             VR  TSFSP +E  LEWKDYL L Y S+++  A WP  C+ +A++YM     +I+ LL++
Sbjct  119   VRLATSFSPHAESILEWKDYLQLVYASEEKNHAHWPAICKDQALQYMKHAEVIIRKLLKV  178

Query  686   LMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIG  507
             L+  LN++E LDK +E   MGA  + FNYYP CP+PE+  GVG HSD+S+ITVLLQD IG
Sbjct  179   LLKKLNVKE-LDKPREKTLMGAMILGFNYYPACPDPEVVAGVGPHSDVSSITVLLQDDIG  237

Query  506   GLHVRKLNSDTWVHVPPVDGALVINIG  426
             GL+VR ++ D+W+ VPPV GALV  +G
Sbjct  238   GLYVRGIDDDSWIFVPPVQGALVSILG  264



>gb|AES66396.2| leucoanthocyanidin dioxygenase-like protein [Medicago truncatula]
Length=283

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/298 (45%), Positives = 184/298 (62%), Gaps = 31/298 (10%)
 Frame = -3

Query  1244  MAPAALSESESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTI  1065
             MAP   + S+S+ +FVV EG G+KGL D G+  +P  YIQP  +RI        D +P I
Sbjct  1     MAPV-FNSSKSMYNFVVREGNGIKGLVDSGLSEVPKIYIQPINKRINKLDTKPCD-MPPI  58

Query  1064  DISNWDDPAVSRAVCE---AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY  894
             D+S  +     + V E   AAE  GFFQ++NH VP+ELLESLK + + FF +        
Sbjct  59    DLSKLNGIEHEKVVDEIVRAAETLGFFQVVNHSVPLELLESLKDSAHTFFNI--------  110

Query  893   SKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCN  714
                        YGTSF+PE E  LEWKD + + Y SD++A   WP  C+  A+EY    +
Sbjct  111   -----------YGTSFAPEKENVLEWKDNIVMEYGSDEDALQYWPNVCKEVALEYFKLSS  159

Query  713   AMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTI  534
              +++++LE+L+  L  E ++D SK    +G K +N NYYP CPNP+L VG G+H+D  +I
Sbjct  160   KIVRDILEILIGKL--EVKVDDSKIESLIGLKTVNMNYYPACPNPDLTVGAGQHTDTGSI  217

Query  533   TVLLQDHIGGLHVR-----KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHR  375
             TVLLQD +GGLHV+      +    W+ +PP+ GALVIN+GDALQILSNG+YK+ EHR
Sbjct  218   TVLLQDGVGGLHVKVEDDNDVGQGEWLEIPPIPGALVINVGDALQILSNGKYKNCEHR  275



>ref|XP_002989580.1| 2-oxoglutarate-iron(II)-dependent oxygenase [Selaginella moellendorffii]
 gb|EFJ09456.1| 2-oxoglutarate-iron(II)-dependent oxygenase [Selaginella moellendorffii]
Length=365

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/346 (41%), Positives = 196/346 (57%), Gaps = 23/346 (7%)
 Frame = -3

Query  1184  RGVKGLSDMGIKALPSQYIQPPKERIAANAIVAD-DSIPTIDI----SNWDDPAVSRAVC  1020
             RGVK L D G+  +P  YIQP  +R+  + +  D   IP ID+    ++ + P    A+ 
Sbjct  18    RGVKVLVDGGMDIVPDIYIQPEHQRLCKSKVCPDTQDIPVIDLRELSNSGNRPKAIAAIG  77

Query  1019  EAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSP  840
             +A ++WGFFQ+ NHGVPV   E +K   Y FF+LPVEEK  Y   +  S+   YGTSF+P
Sbjct  78    QACQKWGFFQVTNHGVPVATTEKMKEVAYEFFELPVEEKMAYHATSMSSKMTMYGTSFNP  137

Query  839   ESEKTLEWKDYL--SLFYVSDDEAAALWP---PACRHEAMEYMTQCNAMIKNLLEMLMSG  675
               +KT +W+DYL  S   +S++  ++ WP   P+ R     Y     ++ K+LL  L   
Sbjct  138   YEDKTFDWRDYLRHSCNPLSEENVSS-WPANPPSYRQATHSYSEAVGSLCKSLLRALSES  196

Query  674   LNIE-ERLDKSKEPLFMGAKRINF---NYYPKCPNPELAVGVGRHSDISTITVLLQDHIG  507
             L +  E LD +      G     F   NYYP CP+P LA+G+  HSD+  IT+LLQD   
Sbjct  197   LGLSPEFLDAA-----FGTPNERFLLLNYYPPCPDPALALGLSSHSDVGGITILLQDATS  251

Query  506   GLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFV  327
             GL V  LN   W+ V P+ GA V+N+GD LQ+LSNG+YKS EHRV  N    R+S+ +F 
Sbjct  252   GLQV--LNDGQWIPVKPLPGAFVVNVGDQLQVLSNGKYKSVEHRVVLNSECPRLSIALFY  309

Query  326   TPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETI  189
              P     V P+ E+L     PLYKE  +SDY + F+ K  DGK  I
Sbjct  310   NPSFNTVVSPVEELLDESHPPLYKEFTFSDYKKRFYAKL-DGKACI  354



>dbj|BAB17023.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Arabidopsis 
thaliana]
Length=288

 Score =   251 bits (640),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 186/289 (64%), Gaps = 7/289 (2%)
 Frame = -3

Query  1025  VCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSF  846
             +C AA + G FQI+NHG+     + +  A   FF+LP EE+R+Y + +S SE     TSF
Sbjct  1     ICHAASKLGLFQIVNHGIAPAEFKGVIAAARGFFELPAEERRRYWRGSSVSETAWLTTSF  60

Query  845   SPESEKTLEWKDYLSLFYV-SDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLN  669
             +P  E  LEW+D+L   Y+    + AA WP  C+ + +++  +   + + +L +L++  N
Sbjct  61    NPCIESVLEWRDFLKFEYLPQRHDFAATWPSVCKEQVIDHFKRIKPITERILNILIN--N  118

Query  668   IEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDH--IGGLHV  495
             +   +D+S +   MG  R+NFNYYPKCP P LA+G GRHSDI+T+T+LLQ+   +  L+ 
Sbjct  119   LNTIIDESNKETLMGTMRMNFNYYPKCPEPSLAIGTGRHSDINTLTLLLQEDGVLSSLYA  178

Query  494   RKL-NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPD  318
             R   + D W+HVPP+ GA+V+NIGD LQILSN RY+S EH V  N    R+S+P+F  P 
Sbjct  179   RATEDGDKWIHVPPIPGAIVVNIGDVLQILSNDRYRSVEHCVVVNKYCSRVSIPVFCGPV  238

Query  317   PECRVGPLPEVL-AGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              +  + PLPEVL    E   Y+++VYSDYL+ FFG+ HDGK+TIE  K+
Sbjct  239   HDSVIEPLPEVLDKNNEMARYRKIVYSDYLKFFFGRPHDGKKTIESIKL  287



>ref|XP_002964234.1| oxidoreductase [Selaginella moellendorffii]
 gb|EFJ34567.1| oxidoreductase [Selaginella moellendorffii]
Length=363

 Score =   250 bits (638),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 195/344 (57%), Gaps = 22/344 (6%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPKERIAANAIVAD-DSIPTIDI----SNWDDPAVSRAVCE  1017
             GVK L D G+  +P  YIQP  +R+  + +  D   IP ID+    ++ + P    A+ +
Sbjct  18    GVKVLVDGGMGIVPDIYIQPEHQRLCKSKVCPDTQDIPVIDLRELSNSGNRPKAIAAIGQ  77

Query  1016  AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPE  837
             A ++WGFFQ+ NHGVPV   E +K   Y FF+LPVEEK  Y   +  S+   YGTSF+P 
Sbjct  78    ACQKWGFFQVTNHGVPVATTEKMKEVAYEFFELPVEEKMVYHATSMSSKMTMYGTSFNPY  137

Query  836   SEKTLEWKDYL--SLFYVSDDEAAALWP--PACRHEAMEYMTQCNAMIKNLLEMLMSGLN  669
              +KT +W+DYL  S   +S++  ++ WP  P     A+ Y     ++ K+LL  L   L 
Sbjct  138   EDKTFDWRDYLRHSCNPLSEENVSS-WPANPPSYETAVNYSEAVGSLCKSLLRALSESLG  196

Query  668   IE-ERLDKSKEPLFMGAKRINF---NYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGL  501
             +  E LD +      G     F   NYYP CP+P LA+G+  HSD+  IT+LLQD   GL
Sbjct  197   LSPEFLDAA-----FGTPNERFLLLNYYPPCPDPALALGLSSHSDVGGITILLQDATSGL  251

Query  500   HVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTP  321
              V  LN   W+ V P+ GA V+N+GD LQ+LSNG+YKS EHRV  N    R+S+ +F  P
Sbjct  252   QV--LNEGQWIPVKPLPGAFVVNVGDQLQVLSNGKYKSVEHRVVLNSECPRLSIALFYNP  309

Query  320   DPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETI  189
                  V P+ E+L     PLYKE  +SDY + F+ K  DGK  I
Sbjct  310   SFNTVVSPVEELLDESHPPLYKEFTFSDYKKRFYAKL-DGKACI  352



>gb|KDO63054.1| hypothetical protein CISIN_1g046644mg [Citrus sinensis]
Length=234

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 152/219 (69%), Gaps = 13/219 (6%)
 Frame = -3

Query  911  EEKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAME  732
            +EKRKYSK NSP+ N R+G+SF   +E+ LEWKD+LS+FYVS++E AA WP  C+ E +E
Sbjct  26   KEKRKYSKENSPTNNARFGSSFVLHAERALEWKDFLSMFYVSEEEIAAFWPSVCKDEMLE  85

Query  731  YMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRH  552
            Y                 GLN++ R+D+ +  + +G++R+N NYYP CPNPE  VGVGRH
Sbjct  86   YTKSS------------EGLNVK-RIDEIRALMLLGSRRVNLNYYPMCPNPEHTVGVGRH  132

Query  551  SDISTITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRV  372
            SDIST T+LLQD IGGLHVRK N + W+HV  +  + +INI D LQI+S GR+KS E+ V
Sbjct  133  SDISTFTILLQDDIGGLHVRKDNGNGWIHVSLISRSFIINIWDPLQIISKGRHKSIEYCV  192

Query  371  SANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYK  255
             ANG  + I V +FV P PE  + P PEVLA G+KPLYK
Sbjct  193  IANGSQNMILVLLFVNPKPEGILCPFPEVLANGKKPLYK  231



>ref|XP_002983443.1| oxidoreductase [Selaginella moellendorffii]
 gb|EFJ15344.1| oxidoreductase [Selaginella moellendorffii]
Length=349

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/337 (38%), Positives = 187/337 (55%), Gaps = 16/337 (5%)
 Frame = -3

Query  1184  RGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW--DDPAVSRAVCEAA  1011
             +GVK L D G+  +P +YI+PP  R   + IV    IP ID++    D     + +C+A+
Sbjct  17    KGVKALMDNGLVTIPGRYIKPPSHRAVKHLIVPGVEIPVIDMAALESDREKFVQTLCKAS  76

Query  1010  EEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKY--SKANSPSENVRYGTSFSPE  837
              EWG FQ+INHG+PV  ++ +       F LP+EEK KY   +   P   VRY TS +P 
Sbjct  77    SEWGIFQVINHGIPVATMQGMVHGVLELFDLPIEEKMKYYTEEVFVP---VRYCTSMTPS  133

Query  836   SEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEER  657
              E  +EW D+    Y S+ E    WP  CR  A  Y++    + + L+  L  GL ++  
Sbjct  134   QETHMEWHDHFQ-HYFSNREKEHPWPEKCRRLASSYVSSVRHLSQTLMSALSEGLGLDSN  192

Query  656   -LDKSKEPLFMGAKRI-NFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLN  483
              L KS    F  ++ I   NYYP CPNP+LA+G+  H+D   +T+L +D +GGL  RK  
Sbjct  193   CLAKS----FGDSEMILRSNYYPLCPNPDLALGMNGHTDSGGLTILFEDQVGGLQARK--  246

Query  482   SDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRV  303
              D W  + P+  A ++NI D LQILSNG+YKS EHRV       R+S+  F  P  +  +
Sbjct  247   GDLWYDLKPIKNAFIVNIADQLQILSNGKYKSIEHRVLVQPDQTRLSIVAFCNPSRDAVI  306

Query  302   GPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKET  192
             GPLPE++     PLYK  +Y +++ + + K  DGK +
Sbjct  307   GPLPELIDEQNPPLYKSTLYQEHITNVYTKYLDGKHS  343



>ref|XP_002975246.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
 gb|EFJ24031.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
Length=362

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 138/347 (40%), Positives = 189/347 (54%), Gaps = 17/347 (5%)
 Frame = -3

Query  1184  RGVKGLSDMGIKALPSQYI-QPPKERIAANAIVADDSIPTIDISNWDDPAVSR---AVCE  1017
             RGVK L D GI+ LP  YI    + R+ ++ +     +P +D+   D     R   AV  
Sbjct  22    RGVKDLVDSGIRELPRFYIGSDSRMRVQSSVLPPGGEVPIVDLRELDGSDRGRIVEAVAR  81

Query  1016  AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPE  837
             A+EEWGFFQ+INHGV    +  +      FF +PVE++ +   A+   +  R+GTS +P 
Sbjct  82    ASEEWGFFQVINHGVEAATIHEMVEVAKEFFAMPVEDRMEIFSADL-FKRTRFGTSHNPS  140

Query  836   SEKTLEWKDYLSLFYVSDDEAAALWP--PAC-RHEAMEYMTQCNAMIKNLLEMLMSGLNI  666
              E +LEWKDYL    +  +E+   WP  PA  R  A +Y      +   LLE+L   L +
Sbjct  141   RETSLEWKDYLRHPCLPLEESMQSWPTKPASYRRVASDYCRGVKGLADKLLEVLSESLGL  200

Query  665   EERLDKSKEPLFMGAKRIN---FNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHV  495
             E R   S      G++R+     NYYP CPNPEL +G+G HSD+  IT+LLQ+ + GL V
Sbjct  201   ERRYLGS----VFGSERLQEMFCNYYPPCPNPELTIGIGEHSDVGGITLLLQNEVEGLEV  256

Query  494   RKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDP  315
              K     W  + PV  A V+N+GD LQILSNGR+KS EHR   +    RIS+P F  P  
Sbjct  257   CK--DGHWYSIKPVKDAFVVNLGDQLQILSNGRFKSVEHRAKVSSDKLRISIPTFYQPSR  314

Query  314   ECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
               R+ P+PE+L     P YKE+ + DYL  FF     GK  ++  KI
Sbjct  315   GARIRPIPELLDEEHPPAYKEVTFQDYLADFFKHKLQGKRCLDSYKI  361



>ref|XP_009607354.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like, partial [Nicotiana 
tomentosiformis]
Length=168

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 130/159 (82%), Gaps = 2/159 (1%)
 Frame = -3

Query  1220  SESVVDFVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDD-  1044
             S ++ +FVVNEG GVKGLS++G+K LP QYIQP +ERI  + I+ DDSIP ID+SNWDD 
Sbjct  10    SNNITEFVVNEGNGVKGLSELGLKTLPKQYIQPHEERITTSTIIVDDSIPIIDMSNWDDN  69

Query  1043  -PAVSRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSEN  867
              P +   +C+AAE WGFFQIINHG+P+E+L+++K ATYRFF+   EEK K+SK NS + N
Sbjct  70    NPKICEKICDAAENWGFFQIINHGIPLEVLDTVKAATYRFFRQSAEEKNKHSKENSTTNN  129

Query  866   VRYGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPAC  750
             VRYGT F+P++EKT EWKDYLSLFYVSD+EAAALWP AC
Sbjct  130   VRYGTRFTPQAEKTGEWKDYLSLFYVSDEEAAALWPSAC  168



>ref|XP_002983526.1| 2-oxoglutarate-Iron(II)-dependent oxygenase [Selaginella moellendorffii]
 gb|EFJ15427.1| 2-oxoglutarate-Iron(II)-dependent oxygenase [Selaginella moellendorffii]
Length=362

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/344 (38%), Positives = 186/344 (54%), Gaps = 17/344 (5%)
 Frame = -3

Query  1184  RGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW--DDPAVSRAVCEAA  1011
             +GVK L D G+  +P +YI+PP  R   + IV    IP ID++    D     + +C+A+
Sbjct  17    KGVKALMDNGLVTIPGRYIKPPSHRAVKHLIVPGVEIPVIDMAELESDREKFVQTLCKAS  76

Query  1010  EEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESE  831
              EWG FQ+INHG+PV  ++ +       F LP+EEK KY         VRY TS +P  E
Sbjct  77    SEWGIFQVINHGIPVATMQGMVHGVLELFDLPIEEKMKYY-TEEVFVPVRYCTSMTPSQE  135

Query  830   KTLEWKDYLSLFYVSDDEAAALWP--PACRHEAMEYMTQCNAM-------IKNLLEMLMS  678
               +EW D+    Y S+ E    WP  PAC  E   ++  C  +       +K+L + LMS
Sbjct  136   THMEWHDHFQ-HYFSNREKEHPWPEKPACYKEIAWFLGYCRRLASSYVSSVKHLSQTLMS  194

Query  677   GLNIEERLDKSKEPLFMGAKRINF--NYYPKCPNPELAVGVGRHSDISTITVLLQDHIGG  504
              L+    LD +      G   +    NYYP CPNP+LA+G+  H+D   +T+L +D +GG
Sbjct  195   ALSEGLGLDSNCLAKSFGDSEMILRSNYYPPCPNPDLALGMNGHTDSGGLTILFEDQVGG  254

Query  503   LHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVT  324
             L  RK   D W  + P+  A ++NI D LQILSNG+YKS EHRV       R+S+  F  
Sbjct  255   LQARK--GDLWYDLKPIKNAFIVNIADQLQILSNGKYKSIEHRVLVQPDQTRLSIVAFCN  312

Query  323   PDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKET  192
             P  +  +GPLPE++     PLYK  +Y +++ + + K  DGK +
Sbjct  313   PSQDAVIGPLPELIDEQNPPLYKSTLYQEHITNVYTKYLDGKHS  356



>ref|XP_002983428.1| 2-oxoglutarate-iron(II)-dependent oxygenase [Selaginella moellendorffii]
 gb|EFJ15329.1| 2-oxoglutarate-iron(II)-dependent oxygenase [Selaginella moellendorffii]
Length=347

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 132/341 (39%), Positives = 187/341 (55%), Gaps = 15/341 (4%)
 Frame = -3

Query  1193  NEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW--DDPAVSRAVC  1020
             N+  GVK L D G+  +P +YI+PP  R   + IV    IP ID++    D     + +C
Sbjct  9     NQHTGVKALMDNGLVTIPGRYIKPPSHRAVKHLIVPGVEIPVIDMAALESDREEFVQTLC  68

Query  1019  EAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSP  840
              A+ EWG FQ+INHG+PVE ++ +       F LP+EEK KY         VRY TS +P
Sbjct  69    MASSEWGIFQVINHGIPVETMQGMVYGVLELFDLPIEEKMKY-YTEEVFVPVRYCTSMTP  127

Query  839   ESEKTLEWKDYLSLFYVSDDEAAALWP--PAC-RHEAMEYMTQCNAMIKNLLEMLMSGLN  669
               E  +EW D+    Y S+ E    WP  PAC R  A  Y++    + + LL  L  GL 
Sbjct  128   SQETHMEWHDHFQ-HYFSNREKEHPWPEKPACYRRLASSYVSSVKHLSQTLLSALSEGLG  186

Query  668   IEER-LDKSKEPLFMGAKRI-NFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHV  495
             ++   L KS    F  ++ I   NYYP CPNP+LA+G+  H+D   +T+L +D +GGL  
Sbjct  187   LDSNCLAKS----FGDSEMILRSNYYPPCPNPDLALGMNGHTDSGGLTILFEDQVGGLQA  242

Query  494   RKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDP  315
             RK   D W  + P+  A ++NI D LQILSNG+YKS EHRV       R+S+  F  P  
Sbjct  243   RK--GDLWYDLKPIKNAFIVNIADQLQILSNGKYKSIEHRVLVQPDQTRLSIVAFCNPSR  300

Query  314   ECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKET  192
             +  +GPLPE +     PLY+  +Y +++ + + K  DGK +
Sbjct  301   DVVIGPLPEFIDQQNPPLYRSTLYEEHITNVYTKYLDGKHS  341



>ref|XP_002973855.1| 2-oxoglutarate-iron(II)-dependent oxygenase [Selaginella moellendorffii]
 gb|EFJ24810.1| 2-oxoglutarate-iron(II)-dependent oxygenase [Selaginella moellendorffii]
Length=350

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/335 (37%), Positives = 184/335 (55%), Gaps = 11/335 (3%)
 Frame = -3

Query  1184  RGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW--DDPAVSRAVCEAA  1011
             +GVK L D G+  +P +Y++PP  R   + IV    IP ID++    D     + +C+A+
Sbjct  17    KGVKALMDNGLVTIPGRYVKPPSHRAVKHLIVPGVEIPVIDMAALESDREKFVQTLCKAS  76

Query  1010  EEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESE  831
              EWG FQ+INHG+PV  ++ +       F LP+EEK KY         VRY TS +P  E
Sbjct  77    SEWGIFQVINHGIPVATMQGMVHGVLELFDLPIEEKMKY-YTEEVFVPVRYCTSMTPSQE  135

Query  830   KTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEER-L  654
               +EW D+   ++ S     A +   CR  A  Y++    + + L+  L  GL ++   L
Sbjct  136   THMEWHDHFQHYFSSGFHEIAWFLGYCRRLASSYVSSVRHLSQTLMSALSEGLGLDSNCL  195

Query  653   DKSKEPLFMGAKRI-NFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSD  477
              KS    F  ++ I   NYYP CPNP+LA+G+  H+D   +T+L +D +GGL  RK   D
Sbjct  196   AKS----FGDSEMILRSNYYPPCPNPDLALGMNGHTDSGGLTILFEDQVGGLQARK--GD  249

Query  476   TWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGP  297
              W  + P+  A ++NI D L+ILSNG+YKS EHRV       R+S+  F  P  +  +GP
Sbjct  250   LWYDLKPIKNAFIVNIADQLEILSNGKYKSIEHRVLVQPDQTRLSIVAFCNPSRDAVIGP  309

Query  296   LPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKET  192
             LPE++     PLYK  +Y +++ + + K  DGK +
Sbjct  310   LPELIDEQNPPLYKSTLYQEHITNVYTKYLDGKHS  344



>ref|XP_004251240.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like isoform X1 [Solanum 
lycopersicum]
Length=257

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 150/229 (66%), Gaps = 2/229 (1%)
 Frame = -3

Query  860  YGTSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLM  681
            + ++   ++EK LEW+D L     +    +  WPP  R++ +EY      + K LLE+L+
Sbjct  31   FWSAIGEKNEKVLEWRDSLR-HGCNPQNDSNHWPPQTRNQVLEYQKWAKPLAKKLLEVLL  89

Query  680  SGLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGL  501
             GLN+ E +D+S EPL MG   IN NYYP CPNP +A+G  RH D+  IT+LLQD  GGL
Sbjct  90   KGLNVNE-IDESLEPLLMGTMSINVNYYPPCPNPSVAIGFRRHCDMDCITLLLQDDTGGL  148

Query  500  HVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTP  321
            +VR    D W+HV P+ GAL +NIGD+LQI+SN RYKS EH V+ +    RISVP+FV P
Sbjct  149  YVRGTKGDNWIHVNPIKGALAVNIGDSLQIMSNDRYKSIEHCVAVDSSRARISVPLFVNP  208

Query  320  DPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              +  +GP P++L  GEKP+YK +++SDY  H F K   GK +++FAKI
Sbjct  209  SFDSVIGPFPQMLKDGEKPVYKHILFSDYWDHCFIKRPSGKASLDFAKI  257



>gb|KDO63049.1| hypothetical protein CISIN_1g046402mg, partial [Citrus sinensis]
Length=255

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 138/354 (39%), Positives = 185/354 (52%), Gaps = 105/354 (30%)
 Frame = -3

Query  1202  FVVNEGRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRAV  1023
             FV+N+G G KGLS+M +KALP QYI P +ERI    ++               P  S AV
Sbjct  5     FVINQGNGAKGLSEMRLKALPKQYIHPLEERIDEAKVL---------------PQASIAV  49

Query  1022  CEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFS  843
              + +                            F L   EK++YSK  SPS N        
Sbjct  50    NDMS----------------------------FGLSAYEKKRYSKEPSPSNN--------  73

Query  842   PESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIE  663
                                                + ++T  N  ++  LE         
Sbjct  74    -----------------------------------VRFVTSFNTQVEKALEW--------  90

Query  662   ERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLN  483
                   K+ L     + N N+ P C NPEL +GVGRHSD+ST+TVLLQD IGG +VR  +
Sbjct  91    ------KDFL----SQTNLNFCPICLNPELTIGVGRHSDVSTLTVLLQDSIGGFYVRGND  140

Query  482   SDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRV  303
              ++W+ V P+DG+L+INIGDALQILSNGRYKS EH V A+G  + ISVPIF+ P P+  +
Sbjct  141   GESWIDVHPIDGSLLINIGDALQILSNGRYKSVEHCVVASGSKNSISVPIFINPRPQDTI  200

Query  302   GPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI*A-MHIVSSCF  144
              PLPEVLA GEKP+YK ++YSDY++H F KAHDGK+T+ FAK+   + +V++CF
Sbjct  201   CPLPEVLASGEKPIYKPVLYSDYVKHVFRKAHDGKKTVGFAKMSKFLTVVANCF  254



>ref|XP_007152332.1| hypothetical protein PHAVU_004G121000g [Phaseolus vulgaris]
 gb|AGV54269.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein 1 [Phaseolus 
vulgaris]
 gb|ESW24326.1| hypothetical protein PHAVU_004G121000g [Phaseolus vulgaris]
Length=367

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/349 (40%), Positives = 192/349 (55%), Gaps = 21/349 (6%)
 Frame = -3

Query  1187  GRGVKGLSDMGIKALPSQYIQPPKERIAANAIVADD--SIPTIDISNW--DDPAVSRAVC  1020
             G GVKGL D GI  +P  ++ PP E +AA+   +     IP ID+ ++  D   V   + 
Sbjct  27    GGGVKGLVDAGITKVPRIFVMPP-EDLAASGDRSHTHFKIPFIDLKDFAGDRSVVIDRIR  85

Query  1019  EAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSP  840
             +AAE+ GFFQ++NHGVPV+LLE +  A   F +LP E K +Y      ++ V+Y T+F  
Sbjct  86    QAAEKVGFFQVVNHGVPVKLLEDMLAAAREFHELPQEVKGEYY-TREKTKKVKYWTNFDL  144

Query  839   ESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGL----  672
                K   W+D L+     +       PP CR   ME+  Q   +   L E+L   L    
Sbjct  145   YQSKYANWRDTLNCTMAPEPLDPQELPPVCRDVIMEFSKQGQVLGSLLFELLSEALGLMP  204

Query  671   NIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVR  492
             N  E +D +K  L +       +YYP CP PEL +G+  H+D   +TVLLQDHIGGL V 
Sbjct  205   NHLEDMDCAKGHLILS------HYYPSCPQPELTMGLSSHTDPDFLTVLLQDHIGGLQV-  257

Query  491   KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPD--  318
              L  + W+ VPP+ GALV+NIGD LQ+LSN R+KS EHRV  N G  R+S+  F T D  
Sbjct  258   -LVQNQWIDVPPIPGALVVNIGDLLQLLSNDRFKSVEHRVMVNQGQARVSIAFFFTHDHC  316

Query  317   PECRV-GPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
             P  R+ GP+ ++L+    PLY+E    D+  HF+ K   G   +   K+
Sbjct  317   PSTRMYGPIKQLLSEDNPPLYRETTLQDFNDHFYKKGLHGIPALSHFKL  365



>ref|XP_002983440.1| 2-oxoglutarate-Iron(II)-dependent oxygenase [Selaginella moellendorffii]
 gb|EFJ15341.1| 2-oxoglutarate-Iron(II)-dependent oxygenase [Selaginella moellendorffii]
Length=349

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/335 (37%), Positives = 182/335 (54%), Gaps = 12/335 (4%)
 Frame = -3

Query  1184  RGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW--DDPAVSRAVCEAA  1011
             +GVK L D G+  +P +YI+PP  R   + IV    IP ID++    D     + +C+A+
Sbjct  17    KGVKALMDNGLVTIPGRYIKPPSHRAVKHLIVPGVEIPVIDMAALESDREKFVQTLCKAS  76

Query  1010  EEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESE  831
              EWG FQ+INHG+PV  ++ +       F LP+EEK KY         VRY TS +P  E
Sbjct  77    SEWGIFQVINHGIPVATMQGMVHGVLELFDLPIEEKMKYY-TEEVFVPVRYCTSMTPSQE  135

Query  830   KTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEER-L  654
               +EW D+    Y S+ E    WP  CR  A  Y++    + + L+  L  GL ++   L
Sbjct  136   THMEWHDHFQ-HYFSNREKEHPWPEYCRRLASSYVSSVRHLSQTLMSALSEGLGLDSNCL  194

Query  653   DKSKEPLFMGAKRI-NFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSD  477
              KS    F  ++ I   NYY  CPNP+LA+G+  H+D   +T+L +D +GGL  RK   D
Sbjct  195   AKS----FGDSEMILRSNYYLPCPNPDLALGMNGHTDSGGLTILFEDQVGGLQARK--GD  248

Query  476   TWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGP  297
              W  + P+  A ++NI D L+ILSNG+YKS EHRV       R+S+  F  P  +  +GP
Sbjct  249   LWYDLKPIKNAFIVNIADQLEILSNGKYKSIEHRVLVQPDQTRLSIVAFCNPSRDAVIGP  308

Query  296   LPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKET  192
             L E++      LYK  +Y +++ + + K  DGK +
Sbjct  309   LLELIDEQNPLLYKSTLYQEHITNVYTKYLDGKHS  343



>ref|XP_002974207.1| oxidoreductase [Selaginella moellendorffii]
 gb|EFJ24429.1| oxidoreductase [Selaginella moellendorffii]
Length=354

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/332 (39%), Positives = 184/332 (55%), Gaps = 13/332 (4%)
 Frame = -3

Query  1151  KALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRAV---CEAAEEWGFFQIIN  981
             ++LP +YI+P   R+  N  +A   IP ID S     + S+ +     AA+EWGFFQ+IN
Sbjct  28    QSLPDKYIKPEIARVRCNTPLA--GIPLIDFSQIHGQSRSKIIQDIANAAQEWGFFQVIN  85

Query  980   HGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLS  801
             H VP+ L++++ +A   FF LP+EEK  Y   +     +R+ TSF P +E   +W D L+
Sbjct  86    HSVPLALMDAMMSAGLEFFNLPLEEKMAYFSEDY-KLKLRFCTSFVPSTEAHWDWHDNLT  144

Query  800   LFY--VSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFM  627
              ++    D+      PP+    A EY  +  A+ K +   L  GL +E   D   +    
Sbjct  145   HYFPPYGDEHPWPKQPPSYEKAAREYFDEVLALGKTISRALSQGLGLEP--DFLIKAFRE  202

Query  626   GAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSDTWVHVPPVDG  447
             G   I  NYYP CP P+LAVG+  HSD    T+L+QD  GGL V++  +  W  V PV G
Sbjct  203   GMNSIRLNYYPPCPRPDLAVGMSPHSDFGGFTILMQDQAGGLQVKR--NGEWYSVKPVRG  260

Query  446   ALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLA-GGE  270
             + V+NI D LQI SNG+++SAEHRV+ N  S R+S+  F  P  +  V P+PE+L    E
Sbjct  261   SFVVNISDQLQIFSNGKFQSAEHRVAVNSSSQRLSIATFFEPSEDVVVAPIPELLLRNSE  320

Query  269   KPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P YKE ++  YL   F K  D K TI+  +I
Sbjct  321   PPRYKESLFGTYLGKQFSKYFDSKNTIQALEI  352



>gb|KHN26844.1| 1-aminocyclopropane-1-carboxylate oxidase like 5 [Glycine soja]
Length=213

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 143/214 (67%), Gaps = 7/214 (3%)
 Frame = -3

Query  800  LFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGA  621
            + Y SD+EA   WP  C+  A+EY+   + M+++++E L+S L +   LD SK    +G 
Sbjct  1    MVYSSDEEALQHWPNQCKEVALEYLKLSSKMVRDIVEALISKLGVA--LDDSKIEGLLGL  58

Query  620  KRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVR-----KLNSDTWVHVPP  456
            K +N NYYP CPNPEL VGVGRHSD+  ITVLLQD IGGL+V+           W+ +PP
Sbjct  59   KMVNMNYYPACPNPELTVGVGRHSDMGAITVLLQDGIGGLYVKVEEDEDAGKGEWLEIPP  118

Query  455  VDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAG  276
            + GALVINIGD +QILSNG+YKSAEHRV       R+SVP+F  P    R+GPLPEV+  
Sbjct  119  IPGALVINIGDTIQILSNGKYKSAEHRVRTTSTQSRVSVPVFTMPIATDRIGPLPEVVKK  178

Query  275  GEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
                 Y+E+V  DY+ +FFG AH GK++++FA+I
Sbjct  179  DGLARYREVVLQDYMNNFFGNAHAGKKSLDFARI  212



>ref|XP_003548216.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Glycine max]
Length=369

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 192/350 (55%), Gaps = 23/350 (7%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPKERIAANAIV-----ADDSIPTIDISNW--DDPAVSRAV  1023
             GVKGL D GI  LP  +++PP++  AA+ +      A  +IP ID+     +   V   V
Sbjct  27    GVKGLVDSGITKLPKIFVRPPEDLAAADPVSDNPAGAQFTIPVIDLDGLTGERSGVVAGV  86

Query  1022  CEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFS  843
               AAE  GFFQ++NHG+P+++LE    A + F +LP E K +Y  +    + V+YG++F 
Sbjct  87    RRAAETMGFFQVVNHGIPLKVLEETMAAVHEFHELPQELKAEYY-SREQMKKVKYGSNFD  145

Query  842   PESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIE  663
                 K   W+D L      D       PP CR  AMEY  Q   + + L  +L   L ++
Sbjct  146   LYQSKYANWRDTLFCVMGPDPLDPQELPPICRDVAMEYSRQVQLLGRVLFGLLSEALGLD  205

Query  662   ----ERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHV  495
                 E +D +K         I F+YYP CP PEL +G  RHSD   +T+LLQDHIGGL V
Sbjct  206   PDHLEGMDCAK------GHSILFHYYPSCPEPELTMGTTRHSDPDFLTILLQDHIGGLQV  259

Query  494   RKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPD-  318
               L    WV VPPV GALV+NIGD LQ++SN ++KS EHRV AN    R+SV  F T   
Sbjct  260   --LGPYGWVDVPPVPGALVVNIGDLLQLISNDKFKSVEHRVLANRIGPRVSVACFFTLHL  317

Query  317   -PECRV-GPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P  R+ GP+ E+L+  + P+Y+E    D++ ++  K  DG   ++   I
Sbjct  318   YPTTRIYGPIKELLSEEKPPVYRETSLKDFIAYYDNKGLDGNSALDHFMI  367



>ref|XP_002965941.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
 gb|EFJ33361.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
Length=345

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/327 (39%), Positives = 195/327 (60%), Gaps = 21/327 (6%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRA-----VCE  1017
             GVK L D G+  LP  YIQ  +ER   NA+  ++S P +D+    + + +RA     + E
Sbjct  11    GVKNLVDSGLDKLPGIYIQSKEER--PNAVHREESFPVLDLGAALNSSEARAALVPQIRE  68

Query  1016  AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPE  837
             A  +WGFFQ+INHGVP  L++ +++    F  LP EEK +Y   ++ S  +RYGTSF+  
Sbjct  69    ACVQWGFFQVINHGVPHSLVDEMQSVAREFHALPNEEKMRYFSTDTESR-MRYGTSFNVT  127

Query  836   SEKTLEWKDYLSLFYVSDDEAAALWP--PAC-RHEAMEYMTQCNAMIKNLLEMLMSGLNI  666
              +K   W+DYL    +   E   LWP  PA  R    +Y T+   + K LLE++   L++
Sbjct  128   QDKVFSWRDYLRHSCLPLAEMQELWPEKPASYRKVTADYSTRVRNLAKFLLELISESLDL  187

Query  665   -EERLDKSKEPLFMGAKRI-NFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVR  492
              ++ +DK+    F G  ++   N+YP CP P+L +G+G HSD  +IT+LLQDH+ GL V 
Sbjct  188   PKDYIDKA----FNGCSQVMALNFYPACPEPDLVLGIGPHSDPGSITLLLQDHVEGLQV-  242

Query  491   KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPE  312
              ++ + W  V P+  + V+N+GD +QILSN +YKSA+HR   N   DR+S+P+ + P+ +
Sbjct  243   -MHGNEWYSVKPIPYSFVVNLGDQIQILSNDKYKSAQHRAVVNSSEDRMSIPVAIGPNWQ  301

Query  311   CRVGPLPEVLAGGEKPLYKELVYSDYL  231
               V P  +++ G   P++K +VY DY+
Sbjct  302   SLVHPASKLVEGS--PVFKPMVYKDYM  326



>ref|XP_002965940.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
 gb|EFJ33360.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
Length=345

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/327 (39%), Positives = 196/327 (60%), Gaps = 21/327 (6%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRA-----VCE  1017
             GVK L D G+  LP  YI+  +ER   NA+  ++S P +D+    + + +RA     + E
Sbjct  11    GVKNLVDSGLDKLPGIYIRSKEER--PNAVHREESFPVLDLGAALNSSEARAALVPQIRE  68

Query  1016  AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPE  837
             A  +WGFFQ+INHGVP  L++ +++    F  LP EEK +Y   ++ S  +RYGTSF+  
Sbjct  69    ACVKWGFFQVINHGVPHSLVDEMQSVAREFHALPNEEKMRYFSTDTESR-MRYGTSFNVT  127

Query  836   SEKTLEWKDYLSLFYVSDDEAAALWP--PACRHEAM-EYMTQCNAMIKNLLEMLMSGLNI  666
              +K   W+DYL    +   E   LWP  PA   E   +Y T+   + K LLE++   L++
Sbjct  128   QDKVFSWRDYLRHSCLPLAEMQELWPEKPASYREVTADYSTRVRNLAKFLLELISESLDL  187

Query  665   -EERLDKSKEPLFMGAKRI-NFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVR  492
              ++ +DK+    F G  +I   N+YP CP P+L +G+G HSD  +IT+LLQDH+ GL V 
Sbjct  188   PKDYIDKA----FNGCSQIMALNFYPACPEPDLVLGIGPHSDPGSITLLLQDHVEGLQV-  242

Query  491   KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPE  312
              ++++ W  V P+  + V+N+G+ +QILSN +YKSAEHR   N   DR+S+P+ + P+ E
Sbjct  243   -MHANEWYSVKPIPYSFVVNLGEQIQILSNDKYKSAEHRAVVNSSEDRMSIPVAMGPNWE  301

Query  311   CRVGPLPEVLAGGEKPLYKELVYSDYL  231
               V P  +++ G   P++K +VY DY+
Sbjct  302   SLVHPASKLVEGS--PVFKPMVYKDYM  326



>ref|XP_002968370.1| 2-oxoacid dioxygenase [Selaginella moellendorffii]
 gb|EFJ30624.1| 2-oxoacid dioxygenase [Selaginella moellendorffii]
Length=345

 Score =   226 bits (576),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 126/327 (39%), Positives = 195/327 (60%), Gaps = 21/327 (6%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRA-----VCE  1017
             GVK L D G+  LP  YI+  +ER   NA+  ++S P +D+    + + +RA     + E
Sbjct  11    GVKNLVDSGLDKLPGIYIRSKEER--PNAVHREESFPVLDLGAALNSSEARAALVPQIRE  68

Query  1016  AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPE  837
             A  +WGFFQ+INHGVP  L++ +++    F  LP EEK +Y   ++ S  +RYGTSF+  
Sbjct  69    ACVQWGFFQVINHGVPHSLVDEMQSVAREFHALPNEEKMRYFSTDTESR-MRYGTSFNVT  127

Query  836   SEKTLEWKDYLSLFYVSDDEAAALWP--PACRHEAM-EYMTQCNAMIKNLLEMLMSGLNI  666
              +K   W+DYL    +   E   LWP  PA   E   +Y T+   + K LLE++   L++
Sbjct  128   QDKVFSWRDYLRHSCLPLAEMQELWPEKPASYREVTADYSTRVRNLAKFLLELISESLDL  187

Query  665   -EERLDKSKEPLFMGAKRI-NFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVR  492
              ++ +DK+    F G  ++   N+YP CP P+L +G+G HSD  +IT+LLQDH+ GL V 
Sbjct  188   PKDYIDKA----FNGCSQVMALNFYPACPEPDLVLGIGPHSDPGSITLLLQDHVEGLQV-  242

Query  491   KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPE  312
              ++   W  V P+  + V+N+GD +QILSN +YKSA+HR   N   DR+S+P+ + P+ E
Sbjct  243   -MHGHEWYSVKPIPYSFVVNLGDQIQILSNDKYKSAQHRAVVNSSEDRMSIPVAMGPNWE  301

Query  311   CRVGPLPEVLAGGEKPLYKELVYSDYL  231
               V P+ +++ G   P++K +VY DY+
Sbjct  302   SLVHPVTKLVEGS--PVFKPMVYKDYI  326



>ref|XP_002965939.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
 gb|EFJ33359.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
Length=345

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/327 (39%), Positives = 194/327 (59%), Gaps = 21/327 (6%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRA-----VCE  1017
             GVK L D G+  LP  YIQ  +ER   NA+  ++S P +D+    + + +RA     + E
Sbjct  11    GVKNLVDSGLDKLPGIYIQSKEER--PNAVHREESFPVLDLGAALNSSEARAALVPQIRE  68

Query  1016  AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPE  837
             A  +WGFFQ+INHGVP  L++ +++    F  L  EEK +Y   ++ S  +RYGTSF+  
Sbjct  69    ACVQWGFFQVINHGVPHSLVDEMQSVAREFHALANEEKMRYFSTDTESR-MRYGTSFNVT  127

Query  836   SEKTLEWKDYLSLFYVSDDEAAALWP--PAC-RHEAMEYMTQCNAMIKNLLEMLMSGLNI  666
              +K   W+DYL    +   E   LWP  PA  R    +Y T+   + K LLE++   L++
Sbjct  128   QDKVFSWRDYLRHSCLPLAEMQELWPEKPASYRKVTADYSTRVRNLAKFLLELISESLDL  187

Query  665   -EERLDKSKEPLFMGAKRI-NFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVR  492
              ++ +DK+    F G  ++   N+YP CP P+L +G+G HSD  +IT+LLQDH+ GL V 
Sbjct  188   PKDYIDKA----FNGCSQVMALNFYPACPEPDLVLGIGPHSDPGSITLLLQDHVEGLQV-  242

Query  491   KLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPE  312
              ++ + W  V P+  + V+N+GD +QILSN +YKSA+HR   N   DR+S+P+ + P+ E
Sbjct  243   -MHGNEWYSVKPIPYSFVVNLGDQIQILSNDKYKSAQHRAVVNSSEDRMSIPVAIGPNWE  301

Query  311   CRVGPLPEVLAGGEKPLYKELVYSDYL  231
               V P  +++ G   P++K +VY DY+
Sbjct  302   SLVHPASKLVEGS--PVFKPMVYKDYM  326



>ref|XP_002975060.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
 gb|EFJ23845.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
Length=354

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/332 (38%), Positives = 182/332 (55%), Gaps = 13/332 (4%)
 Frame = -3

Query  1151  KALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRAV---CEAAEEWGFFQIIN  981
             ++LP +YI+P   R+  N  +A   IP ID S     + S+ +     AA+EWGFFQ++N
Sbjct  28    QSLPDKYIKPEIARVRCNTPLA--GIPLIDFSQIHGESRSKIIQDIANAAQEWGFFQVVN  85

Query  980   HGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESEKTLEWKDYLS  801
             H VP+ L++++ +A   FF LP+EEK  Y   +     +R+ TSF P +E   +W D L+
Sbjct  86    HSVPLALMDAMMSAGLEFFNLPLEEKMAYFSEDY-KLKLRFCTSFVPSTEAHWDWHDNLT  144

Query  800   LFY--VSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFM  627
              ++    DD      PP+    A EY  +  A+ K +   L  GL +E   D   +    
Sbjct  145   HYFPPYGDDHPWPKKPPSYEKAAREYFDEVLALGKTISRALSQGLGLEP--DFLIKAFGE  202

Query  626   GAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSDTWVHVPPVDG  447
             G   I  NYYP CP P+LAVG+  HSD    T+L+QD  GGL V++  +  W  V PV G
Sbjct  203   GMNSIRVNYYPPCPRPDLAVGMSPHSDFGGFTILMQDQAGGLQVKR--NGEWYSVKPVRG  260

Query  446   ALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGPLPE-VLAGGE  270
             + V+NI D LQI SNG+++SAEHR + N  S R+S+  F  P  +  V P+PE +L   E
Sbjct  261   SFVVNISDQLQIFSNGKFQSAEHRAAVNSSSQRLSIVTFFEPSEDVVVAPIPELLLRNSE  320

Query  269   KPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P YKE ++  YL   F K  D K  I+  +I
Sbjct  321   PPRYKESLFGTYLGKQFSKYFDSKNAIQALEI  352



>ref|XP_010692279.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
4-like [Beta vulgaris subsp. vulgaris]
Length=365

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 134/338 (40%), Positives = 193/338 (57%), Gaps = 14/338 (4%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRAVCEAAEEW  1002
             GVKGL D GI  +PS +  P +  + +   V  D IP ID+S+   P V   + +AA ++
Sbjct  30    GVKGLVDSGITRIPSIFHHPQQNLVNSPNSVDVDPIPVIDLSD-PTPDVVDQIRKAAGKF  88

Query  1001  GFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESEKTL  822
             GFFQ+INHGVPV LL+ L T    F +LP EE+  + + + P   V Y ++      K  
Sbjct  89    GFFQVINHGVPVSLLDRLVTGVRAFHELPDEERMSHYRRD-PVNGVNYFSNVDLFVSKAA  147

Query  821   EWKDYLSLFY---VSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLD  651
              W+D L L     ++D +A    PP CR E +E+  +   + + L+ +L  GL +    +
Sbjct  148   SWRDTLQLRLGPIMADIDAI---PPICRSEILEWDKEVKQLGEKLMGLLSQGLGVNA--N  202

Query  650   KSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSDTW  471
             K +E   +G + +  +YYP CP P   VG+  H+D   +TVLLQD +GGL V+  +   W
Sbjct  203   KLEEMSCLGGRVMVGHYYPYCPEPNKTVGIAHHTDPGILTVLLQDQVGGLQVK--HDGKW  260

Query  470   VHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD-RISVPIFVTPD-PECRVGP  297
             V V PV GALVIN+GD LQI+SN +Y S EHRV AN   + R+SV +F  P   E   GP
Sbjct  261   VDVKPVHGALVINVGDLLQIISNDKYTSVEHRVYANPLHEPRVSVAVFFNPSMRENLYGP  320

Query  296   LPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEF  183
             LPEV++  E  LY+E  Y++++  FF K  DGK   ++
Sbjct  321   LPEVVSAEEPALYREFTYTEFITRFFKKELDGKSLAKY  358



>ref|XP_002315859.2| hypothetical protein POPTR_0010s11780g [Populus trichocarpa]
 gb|EEF02030.2| hypothetical protein POPTR_0010s11780g [Populus trichocarpa]
Length=408

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 136/350 (39%), Positives = 196/350 (56%), Gaps = 20/350 (6%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPK-------ERIAANAIVADDSIPTIDISNWDDP----AV  1035
             GVKGL D GI ++P  +I PP+       +R         + IPTIDIS  +D     AV
Sbjct  65    GVKGLIDSGITSIPRIFIHPPETLSDLKSKRSTRLPDSESNLIPTIDISGLEDSNRRSAV  124

Query  1034  SRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYG  855
                V  A  E+GFFQ++NHGVP+E+L+        F +LP EEK ++ +    S  V + 
Sbjct  125   VDKVGRACREFGFFQVVNHGVPLEVLDRTIGGIKGFHELPTEEKMRWYRREMGS-GVSFL  183

Query  854   TSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLL-EMLMS  678
             ++      K   W+D L +    +       P  CR+E +++  QC   +  LL E+L  
Sbjct  184   SNVDLFHSKAASWRDTLQMTLGPNLPELEEIPEICRNELVDW-NQCAKQLGELLMELLCE  242

Query  677   GLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLH  498
             GL +     K K+  F+ A+ +  +YYP CP P+L VG+  H+D   +TVLLQD IGGL 
Sbjct  243   GLGLNA--GKLKDLTFLDARTMAAHYYPYCPQPDLTVGIMSHTDPGVLTVLLQDQIGGLQ  300

Query  497   VRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD-RISVPIFVTP  321
             V+  + + WV V PV GA+VIN+GD +QILSN  YKS EHRV ANG  + RIS+ IF  P
Sbjct  301   VK--HGEGWVDVKPVPGAIVINVGDIMQILSNDEYKSNEHRVLANGCHEPRISIAIFFNP  358

Query  320   -DPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
                +   GP PE+++  +  +Y+E +Y+DY++ FF K  DGK    + K+
Sbjct  359   LKRDSLFGPFPELISPEKPAVYREFIYTDYIKRFFTKELDGKSLTNYYKL  408



>gb|ABK96576.1| unknown [Populus trichocarpa x Populus deltoides]
Length=408

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 133/349 (38%), Positives = 195/349 (56%), Gaps = 18/349 (5%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPK-------ERIAANAIVADDSIPTIDISNWDDP----AV  1035
             GVKGL D GI ++P  +I PP+       +R         + IPTIDIS  +D     AV
Sbjct  65    GVKGLIDSGITSIPRIFIHPPETLSDLKSKRSTRLPDSESNLIPTIDISGLEDSNRRSAV  124

Query  1034  SRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYG  855
                V  A  E+GFFQ++NHGVP+E+L+        F +LP EEK ++ +    S  V + 
Sbjct  125   VDKVGRACREFGFFQVVNHGVPLEVLDRTIGGIKGFHELPTEEKMRWYRREMGS-GVSFL  183

Query  854   TSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSG  675
             ++      K   W+D L +    +       P  CR+E +++      + + L+E+L  G
Sbjct  184   SNVDLFHSKAASWRDTLQMTLGPNLPELEEIPEICRNELVDWNQCAKQLGEVLMELLCEG  243

Query  674   LNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHV  495
             L +     K K+  F+ A+ +  +YYP CP P+L VG+  H+D   +TVLLQD IGGL V
Sbjct  244   LGLNA--GKLKDLTFLDARTMAAHYYPYCPQPDLTVGIMSHTDPGVLTVLLQDQIGGLQV  301

Query  494   RKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD-RISVPIFVTP-  321
             +  + + WV V PV GA+VIN+GD +QILSN  YKS EHRV ANG  + RIS+ IF  P 
Sbjct  302   K--HGEGWVDVKPVPGAIVINVGDIMQILSNDEYKSNEHRVLANGCHEPRISIAIFFNPL  359

Query  320   DPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
               +   GP PE+++  +  +Y+E +Y+DY++ FF K  DGK    + K+
Sbjct  360   KRDSLFGPFPELISPEKPAVYREFIYTDYIKRFFTKELDGKSLTNYYKL  408



>ref|XP_004296614.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Fragaria vesca subsp. vesca]
Length=369

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 129/350 (37%), Positives = 188/350 (54%), Gaps = 22/350 (6%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPKERIAANAIVADD---SIPTIDISNWDDPAVSRAVC---  1020
             GVKGL D GI  +P  +  PP +    N    ++   +IP +D+    DPA  + +    
Sbjct  28    GVKGLVDAGITEIPRIFHHPPDQYNIINTSDIEENQFTIPVVDLGGLSDPAKQKEIVARV  87

Query  1019  -EAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFS  843
              EA+E WGFFQIINHG+PV +LE +K    RF++   E K+++   +  S+  +Y ++F 
Sbjct  88    GEASETWGFFQIINHGIPVPVLEEMKNGVLRFYEQDSEVKKQFYCRDDFSKPWQYNSNFD  147

Query  842   PESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIE  663
               S  +  W+D    +           P  CR E  EY  +   + K L E+L   L +E
Sbjct  148   LYSAPSTNWRDTFMCYMAPTPTKPEDMPEVCRDEMAEYSKEVMKLGKILFELLSEALGLE  207

Query  662   ----ERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHV  495
                   +D  +  L +G      +YYP C  PEL +G  +H+D   +TVLLQDHIGGL V
Sbjct  208   PSHLNDIDCGEGLLVLG------HYYPACSQPELTMGTSKHADGGFLTVLLQDHIGGLQV  261

Query  494   RKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPD-  318
               L+ + W+HVPPV GALV+NIGD LQ++SN R++S EHRV AN    RISV  F     
Sbjct  262   --LHQNKWIHVPPVTGALVVNIGDLLQLISNDRFRSVEHRVLANHRGPRISVASFFCTGM  319

Query  317   -PECRV-GPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              P  ++ GP+ ++L+    P Y+E    DY+ +   K  DGK ++   K+
Sbjct  320   LPSTKLYGPIKDLLSEDNPPKYRETTVRDYVAYHSQKGLDGKSSLSHVKL  369



>ref|XP_011021786.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
4-like [Populus euphratica]
Length=408

 Score =   226 bits (575),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 135/350 (39%), Positives = 196/350 (56%), Gaps = 20/350 (6%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPK-------ERIAANAIVADDSIPTIDISNWDDP----AV  1035
             GVKGL D GI ++P  +I PP+       +R         + IPTIDIS  +D     AV
Sbjct  65    GVKGLIDSGITSIPRIFIHPPETLSDLKSKRSTRLPDSESNLIPTIDISGLEDSNRRSAV  124

Query  1034  SRAVCEAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYG  855
                V  A  E+GFFQ++NHGVP+E+L+    +   F +LP EEK ++ +    S  V + 
Sbjct  125   VDKVGHACREFGFFQVVNHGVPLEVLDRTIGSIKGFHELPTEEKMRWYRREMGS-GVSFL  183

Query  854   TSFSPESEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLL-EMLMS  678
             ++      K   W+D L +    +       P  CR+E +++  QC   +  LL E+L  
Sbjct  184   SNVDLFHSKAASWRDTLQMTLGPNLPELEEIPEICRNELVDW-NQCAKQLGELLMELLCE  242

Query  677   GLNIEERLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLH  498
             GL +     K K+  F+ A+ +  +YYP CP P+L VG+  H+D   +TVLLQD IGGL 
Sbjct  243   GLGLNA--GKLKDLTFLDARTMAAHYYPYCPQPDLTVGIMSHTDPGVLTVLLQDQIGGLQ  300

Query  497   VRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD-RISVPIFVTP  321
             V+  + + WV V PV GA+VIN+GD +QILSN  YKS EHRV ANG  + R+S+ IF +P
Sbjct  301   VK--HGEGWVDVKPVPGAIVINVGDIMQILSNDEYKSNEHRVLANGCQEPRVSIAIFFSP  358

Query  320   -DPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
                +   GP PE+++  +   Y+E  Y+DY++ FF K  DGK    + K+
Sbjct  359   LKRDSLFGPFPELISPEKPAAYREFTYTDYIKRFFTKELDGKSLTNYYKL  408



>ref|XP_002278004.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase [Vitis vinifera]
 emb|CBI34621.3| unnamed protein product [Vitis vinifera]
Length=348

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/341 (36%), Positives = 184/341 (54%), Gaps = 14/341 (4%)
 Frame = -3

Query  1169  LSDM--GIKALPSQYIQPPKERIAANAIVADD-SIPTIDISNWDDPA---VSRAVCEAAE  1008
             L+DM  G+  +PS Y++PP ER     + A D SIP ID+ +   P    V + + +A +
Sbjct  10    LTDMVLGVDHVPSNYVRPPSERPNFKDVQASDVSIPLIDLQDLQGPGRPDVVKQIGQACQ  69

Query  1007  EWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESEK  828
               GFFQI NHGV   ++ ++      FF+LP  E+ K + +++PS+  R  TSF+ ++EK
Sbjct  70    HDGFFQIKNHGVSETMISNMLRLARDFFQLPESERLK-NYSDNPSKTTRLSTSFNVKTEK  128

Query  827   TLEWKDYLSLFYVSDDEAAALWP---PACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEER  657
                W+D+L L     ++    WP   P  R +  EY T    ++  LLE +   L +E+ 
Sbjct  129   VANWRDFLRLHCYPLEDYVHEWPSNPPTFREDVAEYCTSTRELVLRLLEAISESLGLEKN  188

Query  656   LDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSD  477
               K    L    + +  NYYP CP PEL  G+  H+D + ITVLLQD + GL V  L ++
Sbjct  189   YVKGV--LSKQGQHMAMNYYPPCPQPELTYGLPGHTDPNLITVLLQDDVPGLQV--LRNE  244

Query  476   TWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGP  297
              WV V P+    +INIGD +Q++SN RYKS  HR   N   DRIS+P F  P P+  +GP
Sbjct  245   KWVAVNPIPNTFIINIGDQMQVISNDRYKSVLHRAVVNCNKDRISIPTFYCPSPDAVIGP  304

Query  296   LPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              PE++      +YK   Y DY   F+ +    +  ++  KI
Sbjct  305   APELVKDDRPAVYKNFTYGDYYTQFWNRGLATECCLDTFKI  345



>ref|XP_002968365.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
 gb|EFJ30619.1| 2-oxoacid-dependent dioxygenase [Selaginella moellendorffii]
Length=362

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 189/326 (58%), Gaps = 20/326 (6%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNWDDPAVSRA-----VCE  1017
             GVK L D G+  +P  YIQ  + R   NA+  ++S P +D+    + + +RA     + E
Sbjct  29    GVKNLVDSGLHKVPDIYIQSKEGR--PNAVHREESFPVLDLGTALNSSKARAALVSQIRE  86

Query  1016  AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPE  837
             A   WGFFQ+INHGVP  L++ + +    F  LP EEK +Y   ++ S  +RYGTSF+  
Sbjct  87    ACVNWGFFQVINHGVPHSLVDEMLSVAREFHALPNEEKMRYFSTDTESR-MRYGTSFNVT  145

Query  836   SEKTLEWKDYLSLFYVSDDEAAALWP--PACRHEAMEYMTQCNAMIKNLLEMLMSGLNI-  666
              +K   W+DYL    +   E   LWP  PA      +Y T+   + K LLE++   L++ 
Sbjct  146   QDKVFSWRDYLRHSCLPLAEMQDLWPEKPASYKVTADYSTRVRNLAKFLLELISESLDLP  205

Query  665   EERLDKSKEPLFMGAKRI-NFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRK  489
             ++ +DK+    F G  ++   N+YP CP P+L +G+G HSD  +IT+LLQDH+ GL V  
Sbjct  206   KDYIDKA----FNGCSQVMALNFYPACPEPDLVLGIGPHSDPGSITLLLQDHVEGLQV--  259

Query  488   LNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPEC  309
             ++ + W  V P+  + V+N+GD +QILSN +YKS EHR   N   DR+S+P+ + P  E 
Sbjct  260   MHGNEWYSVKPIPYSFVVNLGDQIQILSNDKYKSPEHRAVVNSSEDRMSIPVAMGPSWES  319

Query  308   RVGPLPEVLAGGEKPLYKELVYSDYL  231
              V P  E++ G   P++K +VY DY+
Sbjct  320   LVLPASELVEGS--PVFKPMVYRDYM  343



>ref|XP_002974050.1| 2-oxoglutarate-iron(II)-dependent oxygenase [Selaginella moellendorffii]
 gb|EFJ25005.1| 2-oxoglutarate-iron(II)-dependent oxygenase [Selaginella moellendorffii]
Length=359

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 174/317 (55%), Gaps = 15/317 (5%)
 Frame = -3

Query  1184  RGVKGLSDMGIKALPSQYIQPPKERIAANAIVADDSIPTIDISNW--DDPAVSRAVCEAA  1011
             +GVK L D G+  +P +YI+PP  R   + IV    IP ID++    D     + +C+A+
Sbjct  17    KGVKALMDNGLVTIPGRYIKPPSHRAVKHLIVPGVEIPVIDMAALESDQEKFVQTLCKAS  76

Query  1010  EEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPESE  831
              EWG FQ+INHG+PV  ++ +       F LP+EEK KY         VRY TS +P  E
Sbjct  77    SEWGIFQVINHGIPVATMQGMVYGVLELFDLPIEEKMKY-YTEEVFVPVRYCTSMTPSQE  135

Query  830   KTLEWKDYLSLFYVSDDEAAALWP--PAC-RHEAMEYMTQCNAMIKNLLEMLMSGLNIEE  660
               +EW D+    Y S+ E    WP  PAC R  A  Y++    + + L+  L  GL ++ 
Sbjct  136   THMEWHDHFQ-HYFSNTEKEHPWPEKPACYRRLASSYVSSVRHLSQTLMSALSEGLGLDS  194

Query  659   R-LDKSKEPLFMGAKRI-NFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKL  486
               L KS    F  ++ I   NYYP CPNP+LA+G+  H+D   +T+L +D +GGL  RK 
Sbjct  195   NCLAKS----FGDSEMILRSNYYPPCPNPDLALGMNGHTDSGGLTILFEDQVGGLQARK-  249

Query  485   NSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIFVTPDPECR  306
               D W  + P+  A ++NI D L++LSNG+YKS EHRV       R+S+  F  P  +  
Sbjct  250   -GDLWYDLKPIKNAFIVNIADQLEVLSNGKYKSIEHRVLVQPDQTRLSIVAFCNPSRDAV  308

Query  305   VGPLPEVLAGGEKPLYK  255
             +GPLPE++      LYK
Sbjct  309   IGPLPELIDEQNPDLYK  325



>ref|XP_010313495.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like isoform X2 [Solanum 
lycopersicum]
Length=202

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 135/198 (68%), Gaps = 1/198 (1%)
 Frame = -3

Query  767  LWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEERLDKSKEPLFMGAKRINFNYYPKC  588
            LW  + R++ +EY      + K LLE+L+ GLN+ E +D+S EPL MG   IN NYYP C
Sbjct  6    LWHSSIRNQVLEYQKWAKPLAKKLLEVLLKGLNVNE-IDESLEPLLMGTMSINVNYYPPC  64

Query  587  PNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNSDTWVHVPPVDGALVINIGDALQIL  408
            PNP +A+G  RH D+  IT+LLQD  GGL+VR    D W+HV P+ GAL +NIGD+LQI+
Sbjct  65   PNPSVAIGFRRHCDMDCITLLLQDDTGGLYVRGTKGDNWIHVNPIKGALAVNIGDSLQIM  124

Query  407  SNGRYKSAEHRVSANGGSDRISVPIFVTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLR  228
            SN RYKS EH V+ +    RISVP+FV P  +  +GP P++L  GEKP+YK +++SDY  
Sbjct  125  SNDRYKSIEHCVAVDSSRARISVPLFVNPSFDSVIGPFPQMLKDGEKPVYKHILFSDYWD  184

Query  227  HFFGKAHDGKETIEFAKI  174
            H F K   GK +++FAKI
Sbjct  185  HCFIKRPSGKASLDFAKI  202



>ref|XP_004960372.1| PREDICTED: protein SRG1-like [Setaria italica]
Length=365

 Score =   222 bits (565),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 127/351 (36%), Positives = 187/351 (53%), Gaps = 25/351 (7%)
 Frame = -3

Query  1178  VKGLSDMGIKALPSQYIQPPKERIAANAIVA-------DDSIPTIDISNWDDPAVSRAVC  1020
             V+ LS+ G   +P +Y++P  ER A             +  IP +D+S+  DPA  RAV 
Sbjct  15    VQSLSESGAATIPDRYVKPEAERPATALADDGAATAATEVGIPVVDLSSPGDPATVRAVS  74

Query  1019  EAAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSP  840
             EA  +WGFFQ +NHGVP ELL   +     FF+ P+E K++Y  ANSP+    YG+    
Sbjct  75    EACRDWGFFQAVNHGVPAELLRRARGVWRGFFRQPMEVKQRY--ANSPATYEGYGSRLGV  132

Query  839   ESEKTLEWKDYLSLF----YVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGL  672
             E    L+W DY  L     ++SD +     PP  R    EY  +  A+   L+  +  GL
Sbjct  133   EKGAVLDWGDYYFLHVRPPHLSDPDKWPYLPPELRGTTEEYSREVAALCGRLMTAMSLGL  192

Query  671   NIE-ERLDKSKEPLFMGAKR----INFNYYPKCPNPELAVGVGRHSDISTITVLL-QDHI  510
              +   RL ++    F GA+     +  NYYP+CP PEL +G+  HSD   +TVLL  D +
Sbjct  193   GVAPSRLHEA----FGGAEGAGVCVRVNYYPRCPQPELTLGLSSHSDPGGMTVLLADDRV  248

Query  509   GGLHVRKLNSDTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSDRISVPIF  330
              GL VR+  +  WV V PV  A ++N+GD +Q+L+N  Y+S EHRV  N   +R+SV +F
Sbjct  249   RGLQVRRRGA--WVTVDPVPDAFIVNVGDQIQVLTNATYRSVEHRVMVNAADERLSVALF  306

Query  329   VTPDPECRVGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAK  177
               P  +  + P+PE+++     LYK + + +Y  +   K   GK  +E  K
Sbjct  307   YNPRSDLPLSPMPELVSPDRPSLYKNMTFDEYRLYIRRKGPRGKSQVESLK  357



>gb|KDP38107.1| hypothetical protein JCGZ_04750 [Jatropha curcas]
Length=371

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 126/344 (37%), Positives = 191/344 (56%), Gaps = 14/344 (4%)
 Frame = -3

Query  1181  GVKGLSDMGIKALPSQYIQPPKERIAANAIVADDS--IPTIDISNWDD---PAVSRAVCE  1017
             GVKGL D G+ ++P  +I P         ++   S  IPTID+S ++    PA+   +  
Sbjct  34    GVKGLIDSGLTSIPRIFIHPSDALANLKPVLRPRSEVIPTIDLSGFNSDRRPAIVEKLSR  93

Query  1016  AAEEWGFFQIINHGVPVELLESLKTATYRFFKLPVEEKRKYSKANSPSENVRYGTSFSPE  837
             A+ E GFFQI+NHGVPVE+++   +    F + P E K+++ + +  +  V + ++    
Sbjct  94    ASRELGFFQIVNHGVPVEVMDRAISGIKAFHEQPSEIKKQWYRRDGGT-GVSFISNIDLF  152

Query  836   SEKTLEWKDYLSLFYVSDDEAAALWPPACRHEAMEYMTQCNAMIKNLLEMLMSGLNIEE-  660
               K   W+D L +            P  CR+E +E+  Q   + + L+E+L  GL ++  
Sbjct  153   RAKAASWRDTLQVMLGPSLPELEKIPEICRNEVIEWNKQATNVAEMLMELLSEGLGLDAG  212

Query  659   RLDKSKEPLFMGAKRINFNYYPKCPNPELAVGVGRHSDISTITVLLQDHIGGLHVRKLNS  480
             RL K      +  K +  +YYP CP P+L  G+  H+D   +TVLLQDHIGGL V+  + 
Sbjct  213   RLKKMS---CLEGKTMVAHYYPHCPQPDLTFGITSHTDPGVLTVLLQDHIGGLQVK--HG  267

Query  479   DTWVHVPPVDGALVINIGDALQILSNGRYKSAEHRVSANGGSD-RISVPIFVTPDP-ECR  306
             D W+ V PV GALVINIGD  QILSN  YKS +HRV AN   D R+S+ +F  P   +C 
Sbjct  268   DEWIDVKPVPGALVINIGDIFQILSNDEYKSVDHRVLANPSPDPRVSIAVFFNPSKRDCL  327

Query  305   VGPLPEVLAGGEKPLYKELVYSDYLRHFFGKAHDGKETIEFAKI  174
              GP+PE+++  +  LY++   +DY+R FF K  + K    F ++
Sbjct  328   YGPIPELISPEKPALYRQFTLTDYMRRFFSKDLEDKTLTNFYRL  371



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3476474534244