BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c41859_g1_i1 len=154 path=[132:0-153]

Length=154
                                                                      Score     E

gb|EYU39689.1|  hypothetical protein MIMGU_mgv1a007853mg                102   1e-24   
ref|XP_004250019.1|  PREDICTED: uncharacterized protein LOC101259105    101   1e-23   
ref|XP_006360511.1|  PREDICTED: uncharacterized protein LOC102588...    101   1e-23   
gb|EPS74489.1|  hypothetical protein M569_00268                       95.1    2e-23   
ref|XP_011094473.1|  PREDICTED: uncharacterized protein LOC105174166    100   2e-23   
ref|XP_009796927.1|  PREDICTED: uncharacterized protein LOC104243441    100   3e-23   
ref|XP_009605312.1|  PREDICTED: uncharacterized protein LOC104099882    100   3e-23   
gb|KCW65263.1|  hypothetical protein EUGRSUZ_G02731                   98.2    8e-23   
ref|XP_006379503.1|  hypothetical protein POPTR_0008s02950g           98.2    9e-23   
ref|XP_010067183.1|  PREDICTED: uncharacterized protein LOC104454...  98.2    9e-23   
ref|XP_010241636.1|  PREDICTED: uncharacterized protein LOC104586176  99.0    1e-22   
ref|XP_010665620.1|  PREDICTED: uncharacterized protein LOC104882...  97.1    2e-22   
ref|XP_006485291.1|  PREDICTED: uncharacterized protein LOC102619...  97.1    2e-22   
gb|KDO45164.1|  hypothetical protein CISIN_1g014179mg                 97.4    2e-22   
emb|CDO99828.1|  unnamed protein product                              98.6    2e-22   
ref|XP_006436558.1|  hypothetical protein CICLE_v10031613mg           97.4    2e-22   
ref|XP_010067180.1|  PREDICTED: uncharacterized protein LOC104454...  98.2    2e-22   
ref|XP_010067181.1|  PREDICTED: uncharacterized protein LOC104454...  98.2    2e-22   
ref|XP_010067182.1|  PREDICTED: uncharacterized protein LOC104454...  97.8    2e-22   
ref|XP_007144258.1|  hypothetical protein PHAVU_007G141300g           97.4    3e-22   
ref|XP_008232060.1|  PREDICTED: uncharacterized protein LOC103331222  97.1    3e-22   
ref|XP_010665617.1|  PREDICTED: uncharacterized protein LOC104882...  97.1    4e-22   
ref|XP_010106825.1|  hypothetical protein L484_001718                 97.4    4e-22   
ref|XP_010665619.1|  PREDICTED: uncharacterized protein LOC104882...  97.1    4e-22   
gb|KHN00938.1|  hypothetical protein glysoja_000606                   96.3    4e-22   
ref|XP_011031581.1|  PREDICTED: uncharacterized protein LOC105130...  96.3    5e-22   
ref|XP_011024303.1|  PREDICTED: uncharacterized protein LOC105125...  96.3    5e-22   
ref|XP_011024304.1|  PREDICTED: uncharacterized protein LOC105125...  96.3    5e-22   
ref|XP_010106826.1|  hypothetical protein L484_001719                 97.1    6e-22   
ref|XP_011031580.1|  PREDICTED: uncharacterized protein LOC105130...  95.9    7e-22   
ref|XP_011024302.1|  PREDICTED: uncharacterized protein LOC105125...  96.3    8e-22   
ref|XP_011031579.1|  PREDICTED: uncharacterized protein LOC105130...  95.9    8e-22   
ref|XP_008456557.1|  PREDICTED: uncharacterized protein LOC103496...  95.1    1e-21   
ref|XP_010267342.1|  PREDICTED: uncharacterized protein LOC104604608  94.7    2e-21   
ref|XP_008456554.1|  PREDICTED: uncharacterized protein LOC103496...  95.1    2e-21   
ref|XP_004138835.1|  PREDICTED: uncharacterized protein LOC101202832  94.7    2e-21   
ref|XP_009361423.1|  PREDICTED: uncharacterized protein LOC103951703  95.1    2e-21   
ref|XP_008345275.1|  PREDICTED: uncharacterized protein LOC103408182  94.7    3e-21   
ref|XP_009348871.1|  PREDICTED: uncharacterized protein LOC103940484  94.7    3e-21   
ref|XP_006606301.1|  PREDICTED: uncharacterized protein LOC100791...  94.4    4e-21   
ref|XP_004496153.1|  PREDICTED: uncharacterized protein LOC101504...  94.4    5e-21   
ref|XP_004496151.1|  PREDICTED: uncharacterized protein LOC101504...  94.4    5e-21   
emb|CBI23432.3|  unnamed protein product                              93.2    6e-21   
ref|XP_006589359.1|  PREDICTED: uncharacterized protein LOC100778...  94.0    6e-21   
ref|XP_006589358.1|  PREDICTED: uncharacterized protein LOC100778...  94.0    6e-21   
ref|XP_002270302.1|  PREDICTED: uncharacterized protein LOC100249674  93.2    8e-21   Vitis vinifera
gb|KDP45061.1|  hypothetical protein JCGZ_01561                       92.4    2e-20   
ref|XP_002532917.1|  conserved hypothetical protein                   91.3    2e-20   Ricinus communis
gb|KEH43351.1|  DNA-binding protein PD2                               90.5    1e-19   
ref|XP_010503943.1|  PREDICTED: uncharacterized protein LOC104781059  89.0    3e-19   
emb|CAB41337.1|  putative protein                                     87.4    1e-18   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD90705.1|  plastid enverope DNA-binding protein                 86.7    2e-18   Brassica napus [oilseed rape]
ref|NP_190785.2|  DNA binding protein                                 87.0    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877846.1|  DNA binding protein                              87.0    2e-18   
ref|XP_009136662.1|  PREDICTED: uncharacterized protein LOC103860748  86.3    2e-18   
ref|XP_006290973.1|  hypothetical protein CARUB_v10017088mg           86.7    2e-18   
emb|CDX90614.1|  BnaA03g41670D                                        86.3    2e-18   
ref|XP_010515667.1|  PREDICTED: uncharacterized protein LOC104791468  86.7    3e-18   
ref|XP_006664069.1|  PREDICTED: dentin sialophosphoprotein-like       86.3    3e-18   
ref|XP_004307145.1|  PREDICTED: uncharacterized protein LOC101292839  85.9    5e-18   
ref|XP_010426822.1|  PREDICTED: uncharacterized protein LOC104711769  85.5    8e-18   
ref|XP_006403834.1|  hypothetical protein EUTSA_v10010306mg           85.1    1e-17   
dbj|BAD90707.1|  plastid envelope DNA binding protein                 85.1    1e-17   Pisum sativum [garden pea]
dbj|BAD90706.1|  plastid DNA-binding protein                          84.7    1e-17   Brassica napus [oilseed rape]
emb|CAA67292.1|  DNA-binding protein PD2                              85.1    2e-17   Pisum sativum [garden pea]
ref|XP_010237218.1|  PREDICTED: uncharacterized protein LOC100838408  83.6    4e-17   
ref|XP_008661486.1|  PREDICTED: hypothetical protein isoform X1       83.2    4e-17   
emb|CDX95321.1|  BnaC04g28370D                                        84.3    4e-17   
ref|NP_001136597.1|  hypothetical protein                             83.2    5e-17   Zea mays [maize]
gb|EMS62787.1|  hypothetical protein TRIUR3_25804                     82.8    6e-17   
ref|XP_002443272.1|  hypothetical protein SORBIDRAFT_08g016720        82.0    1e-16   Sorghum bicolor [broomcorn]
ref|XP_010554661.1|  PREDICTED: uncharacterized protein LOC104824...  82.0    1e-16   
ref|XP_010554660.1|  PREDICTED: uncharacterized protein LOC104824...  82.0    1e-16   
ref|XP_010554659.1|  PREDICTED: uncharacterized protein LOC104824...  82.0    1e-16   
gb|EEC69405.1|  hypothetical protein OsI_38558                        81.3    2e-16   Oryza sativa Indica Group [Indian rice]
emb|CDY23193.1|  BnaA04g05660D                                        81.3    3e-16   
gb|ABA99306.2|  expressed protein                                     80.9    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007010086.1|  DNA binding, putative isoform 2                  80.1    3e-16   
ref|NP_001066911.1|  Os12g0528000                                     80.1    4e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007010085.1|  DNA binding, putative isoform 1                  80.1    4e-16   
gb|ABG22034.1|  expressed protein                                     80.1    5e-16   
ref|XP_004962881.1|  PREDICTED: uncharacterized protein LOC101783...  79.7    6e-16   
ref|XP_004962882.1|  PREDICTED: uncharacterized protein LOC101783...  79.3    7e-16   
gb|KHG02286.1|  Cytochrome c biogenesis CcsB                          79.0    1e-15   
ref|NP_001168604.1|  hypothetical protein                             79.0    1e-15   Zea mays [maize]
ref|NP_001143140.1|  uncharacterized protein LOC100275620             79.0    1e-15   Zea mays [maize]
ref|XP_008793668.1|  PREDICTED: uncharacterized protein LOC103709...  78.6    2e-15   
ref|XP_011102206.1|  PREDICTED: uncharacterized protein LOC105180232  76.3    1e-14   
ref|XP_006842976.1|  hypothetical protein AMTR_s00076p00068170        75.9    3e-14   
ref|XP_009413008.1|  PREDICTED: uncharacterized protein LOC103994414  74.3    5e-14   
emb|CAN72251.1|  hypothetical protein VITISV_011585                   73.6    2e-13   Vitis vinifera
ref|XP_008375645.1|  PREDICTED: uncharacterized protein LOC103438880  72.0    4e-13   
ref|XP_010931947.1|  PREDICTED: uncharacterized protein LOC105052722  70.5    1e-12   
gb|ABK24879.1|  unknown                                               68.9    3e-12   Picea sitchensis
ref|XP_008793671.1|  PREDICTED: uncharacterized protein LOC103709...  68.9    5e-12   
emb|CDY29069.1|  BnaC07g32750D                                        65.1    6e-12   
ref|XP_003619792.1|  Plastid DNA-binding protein                      67.4    1e-11   
ref|XP_009767141.1|  PREDICTED: uncharacterized protein LOC104218361  64.3    1e-10   
ref|XP_010918029.1|  PREDICTED: uncharacterized protein LOC105042...  64.3    1e-10   
ref|XP_004152907.1|  PREDICTED: uncharacterized protein LOC101209410  63.9    1e-10   
ref|XP_010918028.1|  PREDICTED: serrate RNA effector molecule hom...  64.3    1e-10   
ref|XP_008800428.1|  PREDICTED: uncharacterized protein LOC103714...  63.9    2e-10   
ref|XP_008800429.1|  PREDICTED: uncharacterized protein LOC103714...  63.9    2e-10   
ref|XP_008800426.1|  PREDICTED: uncharacterized protein LOC103714...  63.9    2e-10   
ref|NP_200629.2|  hydroxyproline-rich glycoprotein family protein     63.5    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008457506.1|  PREDICTED: uncharacterized protein LOC103497...  62.8    3e-10   
ref|XP_002864556.1|  hypothetical protein ARALYDRAFT_495927           63.2    4e-10   
ref|XP_008457504.1|  PREDICTED: uncharacterized protein LOC103497...  62.8    4e-10   
ref|XP_006281465.1|  hypothetical protein CARUB_v10027548mg           61.2    8e-10   
ref|XP_004512688.1|  PREDICTED: uncharacterized protein LOC101498906  62.0    1e-09   
ref|XP_009621458.1|  PREDICTED: uncharacterized protein LOC104113...  61.2    2e-09   
ref|XP_009621457.1|  PREDICTED: uncharacterized protein LOC104113...  61.2    2e-09   
ref|XP_010528546.1|  PREDICTED: uncharacterized protein LOC104805...  60.8    2e-09   
ref|XP_010528547.1|  PREDICTED: uncharacterized protein LOC104805...  60.8    3e-09   
emb|CDP17378.1|  unnamed protein product                              60.5    4e-09   
gb|KHM99765.1|  hypothetical protein glysoja_023906                   60.5    5e-09   
ref|XP_006587409.1|  PREDICTED: lisH domain-containing protein C1...  60.5    5e-09   
ref|XP_006587410.1|  PREDICTED: lisH domain-containing protein C1...  60.1    6e-09   
ref|XP_010662027.1|  PREDICTED: uncharacterized protein LOC100855...  59.3    7e-09   
ref|XP_010662030.1|  PREDICTED: uncharacterized protein LOC100855...  59.3    7e-09   
ref|XP_011074424.1|  PREDICTED: uncharacterized protein LOC105159...  58.9    8e-09   
gb|EMT17733.1|  hypothetical protein F775_09008                       59.7    9e-09   
gb|AFK39831.1|  unknown                                               57.4    1e-08   
gb|AFK44423.1|  unknown                                               57.4    1e-08   
ref|XP_011017553.1|  PREDICTED: uncharacterized protein LOC105120...  57.0    2e-08   
gb|KHN24475.1|  hypothetical protein glysoja_014079                   58.5    2e-08   
ref|XP_006599673.1|  PREDICTED: uncharacterized protein LOC102668185  58.5    2e-08   
ref|XP_006401117.1|  hypothetical protein EUTSA_v10014108mg           57.8    3e-08   
ref|XP_006372275.1|  hypothetical protein POPTR_0018s14880g           57.4    3e-08   
ref|XP_010528548.1|  PREDICTED: uncharacterized protein LOC104805...  57.0    4e-08   
ref|XP_002439445.1|  hypothetical protein SORBIDRAFT_09g006534        54.7    5e-08   Sorghum bicolor [broomcorn]
ref|XP_011017551.1|  PREDICTED: uncharacterized protein LOC105120...  56.6    5e-08   
ref|XP_011017552.1|  PREDICTED: uncharacterized protein LOC105120...  56.6    5e-08   
ref|XP_010248500.1|  PREDICTED: uncharacterized protein LOC104591...  57.0    6e-08   
ref|XP_006478233.1|  PREDICTED: uncharacterized protein LOC102608427  54.3    1e-07   
ref|XP_007010893.1|  Uncharacterized protein isoform 3                55.1    1e-07   
ref|XP_002454228.1|  hypothetical protein SORBIDRAFT_04g027130        54.3    2e-07   Sorghum bicolor [broomcorn]
ref|XP_010453323.1|  PREDICTED: uncharacterized protein LOC104735262  55.5    2e-07   
ref|XP_010443535.1|  PREDICTED: uncharacterized protein LOC104726387  55.8    2e-07   
ref|XP_007010891.1|  Uncharacterized protein isoform 1                55.1    3e-07   
ref|XP_007152508.1|  hypothetical protein PHAVU_004G136200g           55.5    3e-07   
ref|XP_007010892.1|  Uncharacterized protein isoform 2                54.7    3e-07   
ref|XP_008348813.1|  PREDICTED: uncharacterized protein LOC103411980  54.7    4e-07   
gb|EEC73666.1|  hypothetical protein OsI_08211                        54.7    4e-07   Oryza sativa Indica Group [Indian rice]
ref|NP_001047531.1|  Os02g0638000                                     54.3    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009345950.1|  PREDICTED: uncharacterized protein LOC103937726  54.3    4e-07   
ref|XP_009132074.1|  PREDICTED: uncharacterized protein LOC103856708  54.3    5e-07   
emb|CDX88662.1|  BnaA03g09870D                                        54.3    5e-07   
emb|CDY58571.1|  BnaC03g12500D                                        54.3    6e-07   
ref|XP_006648871.1|  PREDICTED: uncharacterized protein LOC102720772  53.9    7e-07   
ref|XP_009400410.1|  PREDICTED: uncharacterized protein LOC103984605  53.1    7e-07   
ref|XP_006478154.1|  PREDICTED: uncharacterized protein LOC102627...  53.9    8e-07   
gb|EMT04577.1|  hypothetical protein F775_28747                       53.9    9e-07   
ref|XP_009375273.1|  PREDICTED: uncharacterized protein LOC103964106  53.5    1e-06   
ref|XP_004953229.1|  PREDICTED: uncharacterized protein LOC101775724  53.5    1e-06   
ref|XP_006441494.1|  hypothetical protein CICLE_v10020800mg           53.1    1e-06   
ref|XP_009390637.1|  PREDICTED: uncharacterized protein LOC103976...  52.0    2e-06   
ref|XP_009390612.1|  PREDICTED: uncharacterized protein LOC103976...  52.0    2e-06   
ref|XP_006351526.1|  PREDICTED: uncharacterized protein LOC102603...  52.4    2e-06   
ref|XP_006351528.1|  PREDICTED: uncharacterized protein LOC102603...  52.4    2e-06   
ref|XP_008237313.1|  PREDICTED: uncharacterized abhydrolase domai...  52.4    3e-06   
gb|AGG23394.1|  hypothetical protein                                  50.8    9e-06   
dbj|BAJ94543.1|  predicted protein                                    50.4    1e-05   
ref|XP_004300054.1|  PREDICTED: uncharacterized protein LOC101299586  50.4    1e-05   
ref|NP_001145114.1|  hypothetical protein                             50.1    1e-05   Zea mays [maize]
ref|XP_007201052.1|  hypothetical protein PRUPE_ppa006501mg           50.4    2e-05   
gb|EMS61434.1|  hypothetical protein TRIUR3_32999                     49.7    2e-05   
ref|XP_010248508.1|  PREDICTED: uncharacterized protein LOC104591...  49.3    2e-05   
ref|XP_010086781.1|  hypothetical protein L484_006203                 47.8    3e-05   
ref|XP_004234319.1|  PREDICTED: uncharacterized protein LOC101251...  48.9    3e-05   
ref|XP_010317546.1|  PREDICTED: uncharacterized protein LOC101251...  48.9    3e-05   
ref|XP_010037047.1|  PREDICTED: uncharacterized protein LOC104425...  48.5    4e-05   
ref|XP_010037044.1|  PREDICTED: uncharacterized protein LOC104425...  48.5    5e-05   
ref|XP_006857341.1|  hypothetical protein AMTR_s00067p00095130        48.9    8e-05   
gb|EMS58731.1|  hypothetical protein TRIUR3_11620                     47.4    1e-04   
ref|XP_002978664.1|  hypothetical protein SELMODRAFT_418465           47.0    3e-04   
ref|XP_002984597.1|  hypothetical protein SELMODRAFT_423782           46.6    4e-04   
ref|XP_010688723.1|  PREDICTED: uncharacterized protein LOC104902...  45.8    5e-04   
ref|XP_010688725.1|  PREDICTED: uncharacterized protein LOC104902...  45.8    5e-04   
ref|XP_003580180.1|  PREDICTED: uncharacterized protein LOC100830379  45.1    6e-04   
gb|EMT33237.1|  hypothetical protein F775_08321                       44.7    6e-04   
gb|AFW63139.1|  hypothetical protein ZEAMMB73_732239                  45.1    8e-04   
ref|XP_008676968.1|  PREDICTED: uncharacterized protein LOC100276...  45.4    8e-04   



>gb|EYU39689.1| hypothetical protein MIMGU_mgv1a007853mg [Erythranthe guttata]
Length=393

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +SKEERKSMVE+FIN YQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   KSKEERKSMVESFINKYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_004250019.1| PREDICTED: uncharacterized protein LOC101259105 [Solanum lycopersicum]
Length=514

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERKSMVETFI  YQKSN+GNFPSLNLTHKEVGGSFYTVRE+VREIIQ
Sbjct  30   RSKEERKSMVETFIKKYQKSNDGNFPSLNLTHKEVGGSFYTVRELVREIIQ  80



>ref|XP_006360511.1| PREDICTED: uncharacterized protein LOC102588960 isoform X1 [Solanum 
tuberosum]
 ref|XP_006360512.1| PREDICTED: uncharacterized protein LOC102588960 isoform X2 [Solanum 
tuberosum]
Length=517

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERKSMVETFI  YQKSN+GNFPSLNLTHKEVGGSFYTVRE+VREIIQ
Sbjct  30   RSKEERKSMVETFIKKYQKSNDGNFPSLNLTHKEVGGSFYTVRELVREIIQ  80



>gb|EPS74489.1| hypothetical protein M569_00268, partial [Genlisea aurea]
Length=109

 Score = 95.1 bits (235),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RS EERK MVE+F+  YQKSNNG+FPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSNEERKEMVESFVKMYQKSNNGSFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_011094473.1| PREDICTED: uncharacterized protein LOC105174166 [Sesamum indicum]
 ref|XP_011094474.1| PREDICTED: uncharacterized protein LOC105174166 [Sesamum indicum]
 ref|XP_011094475.1| PREDICTED: uncharacterized protein LOC105174166 [Sesamum indicum]
Length=512

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+FI  YQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKAMVESFIKKYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_009796927.1| PREDICTED: uncharacterized protein LOC104243441 [Nicotiana sylvestris]
Length=515

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEER+SMVETFI  YQ SNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERRSMVETFIKKYQTSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_009605312.1| PREDICTED: uncharacterized protein LOC104099882 [Nicotiana tomentosiformis]
 ref|XP_009605319.1| PREDICTED: uncharacterized protein LOC104099882 [Nicotiana tomentosiformis]
Length=515

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVETFI  YQ SNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKTMVETFIKKYQTSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>gb|KCW65263.1| hypothetical protein EUGRSUZ_G02731 [Eucalyptus grandis]
Length=440

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERKSMVE FI  +QKSN+GNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  32   RSKEERKSMVEAFIKKHQKSNDGNFPSLNLTHKEVGGSFYTVREIVREIIQ  82



>ref|XP_006379503.1| hypothetical protein POPTR_0008s02950g [Populus trichocarpa]
 gb|ERP57300.1| hypothetical protein POPTR_0008s02950g [Populus trichocarpa]
Length=429

 Score = 98.2 bits (243),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK MVE+FI TYQ  NNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKGMVESFIKTYQNLNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_010067183.1| PREDICTED: uncharacterized protein LOC104454131 isoform X4 [Eucalyptus 
grandis]
 ref|XP_010067184.1| PREDICTED: uncharacterized protein LOC104454131 isoform X4 [Eucalyptus 
grandis]
 ref|XP_010067185.1| PREDICTED: uncharacterized protein LOC104454131 isoform X4 [Eucalyptus 
grandis]
 gb|KCW65261.1| hypothetical protein EUGRSUZ_G02731 [Eucalyptus grandis]
 gb|KCW65262.1| hypothetical protein EUGRSUZ_G02731 [Eucalyptus grandis]
Length=445

 Score = 98.2 bits (243),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERKSMVE FI  +QKSN+GNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  32   RSKEERKSMVEAFIKKHQKSNDGNFPSLNLTHKEVGGSFYTVREIVREIIQ  82



>ref|XP_010241636.1| PREDICTED: uncharacterized protein LOC104586176 [Nelumbo nucifera]
 ref|XP_010241637.1| PREDICTED: uncharacterized protein LOC104586176 [Nelumbo nucifera]
Length=502

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+FI  YQ SNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKAMVESFIKKYQSSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_010665620.1| PREDICTED: uncharacterized protein LOC104882901 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=411

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE FI  YQ SNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKTMVELFIKRYQSSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_006485291.1| PREDICTED: uncharacterized protein LOC102619025 isoform X2 [Citrus 
sinensis]
Length=416

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+F+  YQ SNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  31   RSKEERKAMVESFVKKYQTSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  81



>gb|KDO45164.1| hypothetical protein CISIN_1g014179mg [Citrus sinensis]
 gb|KDO45165.1| hypothetical protein CISIN_1g014179mg [Citrus sinensis]
Length=429

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+F+  YQ SNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  31   RSKEERKAMVESFVKKYQTSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  81



>emb|CDO99828.1| unnamed protein product [Coffea canephora]
Length=592

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+FI  YQ SNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKAMVESFIKKYQNSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_006436558.1| hypothetical protein CICLE_v10031613mg [Citrus clementina]
 ref|XP_006485290.1| PREDICTED: uncharacterized protein LOC102619025 isoform X1 [Citrus 
sinensis]
 gb|ESR49798.1| hypothetical protein CICLE_v10031613mg [Citrus clementina]
Length=429

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+F+  YQ SNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  31   RSKEERKAMVESFVKKYQTSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  81



>ref|XP_010067180.1| PREDICTED: uncharacterized protein LOC104454131 isoform X1 [Eucalyptus 
grandis]
Length=503

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERKSMVE FI  +QKSN+GNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  90   RSKEERKSMVEAFIKKHQKSNDGNFPSLNLTHKEVGGSFYTVREIVREIIQ  140



>ref|XP_010067181.1| PREDICTED: uncharacterized protein LOC104454131 isoform X2 [Eucalyptus 
grandis]
Length=498

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERKSMVE FI  +QKSN+GNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  90   RSKEERKSMVEAFIKKHQKSNDGNFPSLNLTHKEVGGSFYTVREIVREIIQ  140



>ref|XP_010067182.1| PREDICTED: uncharacterized protein LOC104454131 isoform X3 [Eucalyptus 
grandis]
Length=496

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERKSMVE FI  +QKSN+GNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  83   RSKEERKSMVEAFIKKHQKSNDGNFPSLNLTHKEVGGSFYTVREIVREIIQ  133



>ref|XP_007144258.1| hypothetical protein PHAVU_007G141300g [Phaseolus vulgaris]
 gb|ESW16252.1| hypothetical protein PHAVU_007G141300g [Phaseolus vulgaris]
Length=491

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+FI  YQ SNNGNFPSLNLTHKEVGGSFYTVREIVR+IIQ
Sbjct  30   RSKEERKAMVESFIKKYQHSNNGNFPSLNLTHKEVGGSFYTVREIVRDIIQ  80



>ref|XP_008232060.1| PREDICTED: uncharacterized protein LOC103331222 [Prunus mume]
 ref|XP_008232061.1| PREDICTED: uncharacterized protein LOC103331222 [Prunus mume]
Length=466

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+FI TYQK NNG+FPSLNLTHKEVGGSFYTVREIVR+IIQ
Sbjct  30   RSKEERKAMVESFIKTYQKLNNGSFPSLNLTHKEVGGSFYTVREIVRDIIQ  80



>ref|XP_010665617.1| PREDICTED: uncharacterized protein LOC104882901 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010665618.1| PREDICTED: uncharacterized protein LOC104882901 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=486

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE FI  YQ SNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKTMVELFIKRYQSSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_010106825.1| hypothetical protein L484_001718 [Morus notabilis]
 gb|EXC11977.1| hypothetical protein L484_001718 [Morus notabilis]
Length=510

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+FI  YQK NNGNFPSLNLTHKEVGGSFYTVREIVR++IQ
Sbjct  72   RSKEERKAMVESFIKKYQKLNNGNFPSLNLTHKEVGGSFYTVREIVRDVIQ  122



>ref|XP_010665619.1| PREDICTED: uncharacterized protein LOC104882901 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=484

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE FI  YQ SNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKTMVELFIKRYQSSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>gb|KHN00938.1| hypothetical protein glysoja_000606 [Glycine soja]
Length=439

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSK+ERK+MVE+FI  YQ+SNNGNFPSLNLTHKEVGGSFYTVREIVR++IQ
Sbjct  30   RSKQERKAMVESFIKKYQESNNGNFPSLNLTHKEVGGSFYTVREIVRDVIQ  80



>ref|XP_011031581.1| PREDICTED: uncharacterized protein LOC105130674 isoform X3 [Populus 
euphratica]
Length=429

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK MVE+FI TYQ  NNG+FPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKGMVESFIKTYQNLNNGHFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_011024303.1| PREDICTED: uncharacterized protein LOC105125518 isoform X2 [Populus 
euphratica]
 ref|XP_011024305.1| PREDICTED: uncharacterized protein LOC105125518 isoform X4 [Populus 
euphratica]
Length=442

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK MVE+FI  YQ  NNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKGMVESFIKKYQSLNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_011024304.1| PREDICTED: uncharacterized protein LOC105125518 isoform X3 [Populus 
euphratica]
Length=442

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK MVE+FI  YQ  NNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKGMVESFIKKYQSLNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_010106826.1| hypothetical protein L484_001719 [Morus notabilis]
 gb|EXC11978.1| hypothetical protein L484_001719 [Morus notabilis]
Length=535

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+FI  YQK NNGNFPSLNLTHKEVGGSFYTVREIVR++IQ
Sbjct  72   RSKEERKAMVESFIKKYQKLNNGNFPSLNLTHKEVGGSFYTVREIVRDVIQ  122



>ref|XP_011031580.1| PREDICTED: uncharacterized protein LOC105130674 isoform X2 [Populus 
euphratica]
Length=448

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK MVE+FI TYQ  NNG+FPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  61   RSKEERKGMVESFIKTYQNLNNGHFPSLNLTHKEVGGSFYTVREIVREIIQ  111



>ref|XP_011024302.1| PREDICTED: uncharacterized protein LOC105125518 isoform X1 [Populus 
euphratica]
Length=480

 Score = 96.3 bits (238),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK MVE+FI  YQ  NNGNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKGMVESFIKKYQSLNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_011031579.1| PREDICTED: uncharacterized protein LOC105130674 isoform X1 [Populus 
euphratica]
Length=460

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK MVE+FI TYQ  NNG+FPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  61   RSKEERKGMVESFIKTYQNLNNGHFPSLNLTHKEVGGSFYTVREIVREIIQ  111



>ref|XP_008456557.1| PREDICTED: uncharacterized protein LOC103496473 isoform X2 [Cucumis 
melo]
Length=431

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE FI  YQ+SNNG+FPSLNLTHKEVGGSFYTVREIVR+IIQ
Sbjct  30   RSKEERKAMVEVFIKKYQESNNGSFPSLNLTHKEVGGSFYTVREIVRDIIQ  80



>ref|XP_010267342.1| PREDICTED: uncharacterized protein LOC104604608 [Nelumbo nucifera]
 ref|XP_010267343.1| PREDICTED: uncharacterized protein LOC104604608 [Nelumbo nucifera]
 ref|XP_010267344.1| PREDICTED: uncharacterized protein LOC104604608 [Nelumbo nucifera]
 ref|XP_010267346.1| PREDICTED: uncharacterized protein LOC104604608 [Nelumbo nucifera]
Length=430

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+FI  YQ  NNGNFPSL+LTHKEVGGSFYTVREIVREIIQ
Sbjct  30   RSKEERKAMVESFIKKYQSKNNGNFPSLSLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_008456554.1| PREDICTED: uncharacterized protein LOC103496473 isoform X1 [Cucumis 
melo]
 ref|XP_008456555.1| PREDICTED: uncharacterized protein LOC103496473 isoform X1 [Cucumis 
melo]
 ref|XP_008456556.1| PREDICTED: uncharacterized protein LOC103496473 isoform X1 [Cucumis 
melo]
Length=449

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE FI  YQ+SNNG+FPSLNLTHKEVGGSFYTVREIVR+IIQ
Sbjct  30   RSKEERKAMVEVFIKKYQESNNGSFPSLNLTHKEVGGSFYTVREIVRDIIQ  80



>ref|XP_004138835.1| PREDICTED: uncharacterized protein LOC101202832 [Cucumis sativus]
 ref|XP_004165097.1| PREDICTED: uncharacterized protein LOC101228428 [Cucumis sativus]
 gb|KGN63028.1| hypothetical protein Csa_2G384970 [Cucumis sativus]
Length=449

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE FI  YQ+SNNG+FPSLNLTHKEVGGSFYTVREIVR+IIQ
Sbjct  30   RSKEERKAMVEVFIKKYQESNNGSFPSLNLTHKEVGGSFYTVREIVRDIIQ  80



>ref|XP_009361423.1| PREDICTED: uncharacterized protein LOC103951703 [Pyrus x bretschneideri]
Length=492

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+FI  YQK NNG+FPSLNLTHKEVGGSFYTVREIVR+IIQ
Sbjct  30   RSKEERKAMVESFIKKYQKLNNGSFPSLNLTHKEVGGSFYTVREIVRDIIQ  80



>ref|XP_008345275.1| PREDICTED: uncharacterized protein LOC103408182 [Malus domestica]
Length=493

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+FI  YQK NNG+FPSLNLTHKEVGGSFYTVREIVR+IIQ
Sbjct  30   RSKEERKAMVESFIKKYQKINNGSFPSLNLTHKEVGGSFYTVREIVRDIIQ  80



>ref|XP_009348871.1| PREDICTED: uncharacterized protein LOC103940484 [Pyrus x bretschneideri]
Length=492

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+MVE+FI  YQK NNG+FPSLNLTHKEVGGSFYTVREIVR+IIQ
Sbjct  30   RSKEERKAMVESFIKKYQKINNGSFPSLNLTHKEVGGSFYTVREIVRDIIQ  80



>ref|XP_006606301.1| PREDICTED: uncharacterized protein LOC100791460 isoform X1 [Glycine 
max]
 ref|XP_006606302.1| PREDICTED: uncharacterized protein LOC100791460 isoform X2 [Glycine 
max]
Length=490

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSK+ERK+MVE+FI  YQ+ NNGNFPSLNLTHKEVGGSFYTVREIVR+IIQ
Sbjct  30   RSKQERKAMVESFIKKYQELNNGNFPSLNLTHKEVGGSFYTVREIVRDIIQ  80



>ref|XP_004496153.1| PREDICTED: uncharacterized protein LOC101504590 isoform X3 [Cicer 
arietinum]
Length=510

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK++VE+FI  YQ+SN+GNFPSLNLTHKEVGGSFYTVREIVR+IIQ
Sbjct  31   RSKEERKALVESFIKKYQESNSGNFPSLNLTHKEVGGSFYTVREIVRDIIQ  81



>ref|XP_004496151.1| PREDICTED: uncharacterized protein LOC101504590 isoform X1 [Cicer 
arietinum]
 ref|XP_004496152.1| PREDICTED: uncharacterized protein LOC101504590 isoform X2 [Cicer 
arietinum]
Length=523

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK++VE+FI  YQ+SN+GNFPSLNLTHKEVGGSFYTVREIVR+IIQ
Sbjct  31   RSKEERKALVESFIKKYQESNSGNFPSLNLTHKEVGGSFYTVREIVRDIIQ  81



>emb|CBI23432.3| unnamed protein product [Vitis vinifera]
Length=422

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  11   EERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            EERK MVE+FI  YQKSN+GNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  33   EERKEMVESFIKKYQKSNDGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>ref|XP_006589359.1| PREDICTED: uncharacterized protein LOC100778620 isoform X3 [Glycine 
max]
Length=491

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSK+ERK+MVE+FI  YQ+ NNGNFPSLNLTHKEVGGSFYTVREIVR++IQ
Sbjct  30   RSKQERKAMVESFIKKYQELNNGNFPSLNLTHKEVGGSFYTVREIVRDVIQ  80



>ref|XP_006589358.1| PREDICTED: uncharacterized protein LOC100778620 isoform X2 [Glycine 
max]
 ref|XP_003535488.2| PREDICTED: uncharacterized protein LOC100778620 isoform X1 [Glycine 
max]
 gb|KHN37866.1| hypothetical protein glysoja_016990 [Glycine soja]
Length=493

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSK+ERK+MVE+FI  YQ+ NNGNFPSLNLTHKEVGGSFYTVREIVR++IQ
Sbjct  30   RSKQERKAMVESFIKKYQELNNGNFPSLNLTHKEVGGSFYTVREIVRDVIQ  80



>ref|XP_002270302.1| PREDICTED: uncharacterized protein LOC100249674 [Vitis vinifera]
 ref|XP_010646581.1| PREDICTED: uncharacterized protein LOC100249674 [Vitis vinifera]
 ref|XP_010646582.1| PREDICTED: uncharacterized protein LOC100249674 [Vitis vinifera]
Length=444

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  11   EERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            EERK MVE+FI  YQKSN+GNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  33   EERKEMVESFIKKYQKSNDGNFPSLNLTHKEVGGSFYTVREIVREIIQ  80



>gb|KDP45061.1| hypothetical protein JCGZ_01561 [Jatropha curcas]
Length=459

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK MVE+FI  YQ  NNGNFPSL LTHKEVGGSFYTVREIVREIIQ
Sbjct  59   RSKEERKEMVESFIKKYQSLNNGNFPSLRLTHKEVGGSFYTVREIVREIIQ  109



>ref|XP_002532917.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29459.1| conserved hypothetical protein [Ricinus communis]
Length=375

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            SKEERK MVE+FI  +Q  NNGNFPSLNLTHKEVGGSFYT+REIVREIIQ
Sbjct  49   SKEERKEMVESFIKKHQSLNNGNFPSLNLTHKEVGGSFYTIREIVREIIQ  98



>gb|KEH43351.1| DNA-binding protein PD2 [Medicago truncatula]
Length=515

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK+M+++FI  YQ+SN+GNFPS+ LTHKEVGGSFYTVREIVR+IIQ
Sbjct  31   RSKEERKTMIQSFIQKYQESNSGNFPSITLTHKEVGGSFYTVREIVRDIIQ  81



>ref|XP_010503943.1| PREDICTED: uncharacterized protein LOC104781059 [Camelina sativa]
 ref|XP_010503945.1| PREDICTED: uncharacterized protein LOC104781059 [Camelina sativa]
 ref|XP_010503946.1| PREDICTED: uncharacterized protein LOC104781059 [Camelina sativa]
 ref|XP_010503947.1| PREDICTED: uncharacterized protein LOC104781059 [Camelina sativa]
Length=500

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++VE+FI  +QK NNGNFPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  32   KEERKTLVESFIKKHQKLNNGNFPSLSLTHKEVGGSFYTIREIVREIIQ  80



>emb|CAB41337.1| putative protein [Arabidopsis thaliana]
Length=490

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++VE+FI  +QK NNG+FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  57   KEERKTLVESFIKKHQKLNNGSFPSLSLTHKEVGGSFYTIREIVREIIQ  105



>dbj|BAD90705.1| plastid enverope DNA-binding protein [Brassica napus]
Length=441

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++V++FIN +Q+ NNG+FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  48   KEERKTLVKSFINKHQRLNNGSFPSLSLTHKEVGGSFYTIREIVREIIQ  96



>ref|NP_190785.2| DNA binding protein [Arabidopsis thaliana]
 ref|NP_001190069.1| DNA binding protein [Arabidopsis thaliana]
 gb|AAM20147.1| unknown protein [Arabidopsis thaliana]
 gb|AEE78907.1| DNA binding protein [Arabidopsis thaliana]
 gb|AEE78908.1| DNA binding protein [Arabidopsis thaliana]
Length=499

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++VE+FI  +QK NNG+FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  32   KEERKTLVESFIKKHQKLNNGSFPSLSLTHKEVGGSFYTIREIVREIIQ  80



>ref|XP_002877846.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54105.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=504

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++VE+FI  +QK NNG+FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  32   KEERKTLVESFIKKHQKLNNGSFPSLSLTHKEVGGSFYTIREIVREIIQ  80



>ref|XP_009136662.1| PREDICTED: uncharacterized protein LOC103860748 [Brassica rapa]
Length=436

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++V++FIN +Q+ NNG+FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  32   KEERKTLVKSFINKHQRLNNGSFPSLSLTHKEVGGSFYTIREIVREIIQ  80



>ref|XP_006290973.1| hypothetical protein CARUB_v10017088mg [Capsella rubella]
 gb|EOA23871.1| hypothetical protein CARUB_v10017088mg [Capsella rubella]
Length=493

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++VE+FI  +QK NNG+FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  32   KEERKTLVESFIKKHQKLNNGSFPSLSLTHKEVGGSFYTIREIVREIIQ  80



>emb|CDX90614.1| BnaA03g41670D [Brassica napus]
Length=440

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++V++FIN +Q+ NNG+FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  32   KEERKTLVKSFINKHQRLNNGSFPSLSLTHKEVGGSFYTIREIVREIIQ  80



>ref|XP_010515667.1| PREDICTED: uncharacterized protein LOC104791468 [Camelina sativa]
 ref|XP_010515669.1| PREDICTED: uncharacterized protein LOC104791468 [Camelina sativa]
 ref|XP_010515670.1| PREDICTED: uncharacterized protein LOC104791468 [Camelina sativa]
 ref|XP_010515671.1| PREDICTED: uncharacterized protein LOC104791468 [Camelina sativa]
Length=500

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++VE+FI  +QK NNG FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  32   KEERKTLVESFIKKHQKLNNGTFPSLSLTHKEVGGSFYTIREIVREIIQ  80



>ref|XP_006664069.1| PREDICTED: dentin sialophosphoprotein-like [Oryza brachyantha]
Length=468

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            ++KEER+ MVE+F+NTY+ SN+G FPS+NLTHKEVGGS+Y VREIVR+IIQ
Sbjct  55   KTKEERREMVESFVNTYRVSNDGKFPSVNLTHKEVGGSYYIVREIVRDIIQ  105



>ref|XP_004307145.1| PREDICTED: uncharacterized protein LOC101292839 [Fragaria vesca 
subsp. vesca]
Length=483

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            RSKEERK MV  FI  YQ  +NG+FPSLNLTHKEVGGSFYTVREIVR++IQ
Sbjct  30   RSKEERKEMVVAFIKKYQNLHNGSFPSLNLTHKEVGGSFYTVREIVRDVIQ  80



>ref|XP_010426822.1| PREDICTED: uncharacterized protein LOC104711769 [Camelina sativa]
 ref|XP_010426823.1| PREDICTED: uncharacterized protein LOC104711769 [Camelina sativa]
 ref|XP_010426824.1| PREDICTED: uncharacterized protein LOC104711769 [Camelina sativa]
 ref|XP_010426825.1| PREDICTED: uncharacterized protein LOC104711769 [Camelina sativa]
Length=511

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++VE+FI  +QK N+G+FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  32   KEERKTLVESFIKKHQKLNSGSFPSLSLTHKEVGGSFYTIREIVREIIQ  80



>ref|XP_006403834.1| hypothetical protein EUTSA_v10010306mg [Eutrema salsugineum]
 gb|ESQ45287.1| hypothetical protein EUTSA_v10010306mg [Eutrema salsugineum]
Length=504

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++VE+FI  +Q  NNG+FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  33   KEERKALVESFIKKHQNLNNGSFPSLSLTHKEVGGSFYTIREIVREIIQ  81



>dbj|BAD90707.1| plastid envelope DNA binding protein [Pisum sativum]
Length=613

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            SK++RK+MVE+FI  YQ+SN GNFP + +THKEVGGSFYTVREIVRE+IQ
Sbjct  31   SKDKRKAMVESFIKKYQESNGGNFPPITVTHKEVGGSFYTVREIVREVIQ  80



>dbj|BAD90706.1| plastid DNA-binding protein [Brassica napus]
Length=476

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++VE+FI  +Q  NNG FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  51   KEERKTLVESFIKKHQSLNNGRFPSLSLTHKEVGGSFYTIREIVREIIQ  99



>emb|CAA67292.1| DNA-binding protein PD2 [Pisum sativum]
Length=632

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            SK++RK+MVE+FI  YQ+SN GNFP + +THKEVGGSFYTVREIVRE+IQ
Sbjct  31   SKDKRKAMVESFIKKYQESNGGNFPPITVTHKEVGGSFYTVREIVREVIQ  80



>ref|XP_010237218.1| PREDICTED: uncharacterized protein LOC100838408 [Brachypodium 
distachyon]
 ref|XP_010237219.1| PREDICTED: uncharacterized protein LOC100838408 [Brachypodium 
distachyon]
Length=496

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            ++KEER+ MVE+F+NTY+ SNNG FPS+NLTHKEVGGS+Y VREIVR+IIQ
Sbjct  64   KTKEERREMVESFVNTYRVSNNGKFPSVNLTHKEVGGSYYIVREIVRDIIQ  114



>ref|XP_008661486.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW56574.1| hypothetical protein ZEAMMB73_819209 [Zea mays]
Length=479

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +SKEER+ MVE+FIN+Y+ SN G FPS+NLTHKEVGGS+Y VREIVR+IIQ
Sbjct  60   KSKEERREMVESFINSYRASNEGKFPSVNLTHKEVGGSYYIVREIVRDIIQ  110



>emb|CDX95321.1| BnaC04g28370D [Brassica napus]
Length=866

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++VE+FI  +Q  NNG FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  440  KEERKTLVESFIKKHQSLNNGRFPSLSLTHKEVGGSFYTIREIVREIIQ  488



>ref|NP_001136597.1| hypothetical protein [Zea mays]
 gb|ACF82242.1| unknown [Zea mays]
 gb|AFW56573.1| hypothetical protein ZEAMMB73_819209 [Zea mays]
Length=483

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +SKEER+ MVE+FIN+Y+ SN G FPS+NLTHKEVGGS+Y VREIVR+IIQ
Sbjct  60   KSKEERREMVESFINSYRASNEGKFPSVNLTHKEVGGSYYIVREIVRDIIQ  110



>gb|EMS62787.1| hypothetical protein TRIUR3_25804 [Triticum urartu]
Length=488

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            ++KEER+ MVE+F++ Y+ SNNG FPS+NLTHKEVGGS+Y VREI+R+IIQ
Sbjct  60   KTKEERREMVESFVDMYRVSNNGKFPSVNLTHKEVGGSYYIVREIMRDIIQ  110



>ref|XP_002443272.1| hypothetical protein SORBIDRAFT_08g016720 [Sorghum bicolor]
 gb|EES17110.1| hypothetical protein SORBIDRAFT_08g016720 [Sorghum bicolor]
Length=494

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +SKEER+ MVE+FIN Y+ SN G FPS+NLTHKEVGGS+Y VREIVR+IIQ
Sbjct  67   KSKEERREMVESFINGYRLSNEGKFPSVNLTHKEVGGSYYIVREIVRDIIQ  117



>ref|XP_010554661.1| PREDICTED: uncharacterized protein LOC104824314 isoform X3 [Tarenaya 
hassleriana]
Length=516

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +EERK++VE+FI  +Q+ N+GNFPSL+LTHKEVGGSFYT+REI REIIQ
Sbjct  43   REERKALVESFIKKHQRLNSGNFPSLSLTHKEVGGSFYTIREIFREIIQ  91



>ref|XP_010554660.1| PREDICTED: uncharacterized protein LOC104824314 isoform X2 [Tarenaya 
hassleriana]
Length=534

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +EERK++VE+FI  +Q+ N+GNFPSL+LTHKEVGGSFYT+REI REIIQ
Sbjct  32   REERKALVESFIKKHQRLNSGNFPSLSLTHKEVGGSFYTIREIFREIIQ  80



>ref|XP_010554659.1| PREDICTED: uncharacterized protein LOC104824314 isoform X1 [Tarenaya 
hassleriana]
Length=545

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +EERK++VE+FI  +Q+ N+GNFPSL+LTHKEVGGSFYT+REI REIIQ
Sbjct  43   REERKALVESFIKKHQRLNSGNFPSLSLTHKEVGGSFYTIREIFREIIQ  91



>gb|EEC69405.1| hypothetical protein OsI_38558 [Oryza sativa Indica Group]
Length=467

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            ++KEER+ MVE+F+NTY+ SN+G FPS+NLTHKEVGGS+Y VREIVR+IIQ
Sbjct  62   KTKEERREMVESFVNTYRVSNDGKFPSVNLTHKEVGGSYYIVREIVRDIIQ  112



>emb|CDY23193.1| BnaA04g05660D [Brassica napus]
Length=556

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            KEERK++VE+FI  +Q  NN  FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  32   KEERKTLVESFIKKHQSLNNERFPSLSLTHKEVGGSFYTIREIVREIIQ  80



>gb|ABA99306.2| expressed protein [Oryza sativa Japonica Group]
 gb|EEE53324.1| hypothetical protein OsJ_36322 [Oryza sativa Japonica Group]
Length=467

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            ++KEER+ MVE+F+NTY+ SN+G FPS+NLTHKEVGGS+Y VREIVR+IIQ
Sbjct  62   KTKEERREMVESFVNTYRVSNDGKFPSVNLTHKEVGGSYYIVREIVRDIIQ  112



>ref|XP_007010086.1| DNA binding, putative isoform 2 [Theobroma cacao]
 gb|EOY18896.1| DNA binding, putative isoform 2 [Theobroma cacao]
Length=406

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFY  121
            RSKEERK+MVE+FI  YQKSNNGNFPSLNLTHKEVGGSFY
Sbjct  30   RSKEERKAMVESFIRKYQKSNNGNFPSLNLTHKEVGGSFY  69



>ref|NP_001066911.1| Os12g0528000 [Oryza sativa Japonica Group]
 gb|ABG22033.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29930.1| Os12g0528000 [Oryza sativa Japonica Group]
Length=426

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            ++KEER+ MVE+F+NTY+ SN+G FPS+NLTHKEVGGS+Y VREIVR+IIQ
Sbjct  62   KTKEERREMVESFVNTYRVSNDGKFPSVNLTHKEVGGSYYIVREIVRDIIQ  112



>ref|XP_007010085.1| DNA binding, putative isoform 1 [Theobroma cacao]
 gb|EOY18895.1| DNA binding, putative isoform 1 [Theobroma cacao]
Length=437

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFY  121
            RSKEERK+MVE+FI  YQKSNNGNFPSLNLTHKEVGGSFY
Sbjct  30   RSKEERKAMVESFIRKYQKSNNGNFPSLNLTHKEVGGSFY  69



>gb|ABG22034.1| expressed protein [Oryza sativa Japonica Group]
Length=452

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            ++KEER+ MVE+F+NTY+ SN+G FPS+NLTHKEVGGS+Y VREIVR+IIQ
Sbjct  62   KTKEERREMVESFVNTYRVSNDGKFPSVNLTHKEVGGSYYIVREIVRDIIQ  112



>ref|XP_004962881.1| PREDICTED: uncharacterized protein LOC101783488 isoform X1 [Setaria 
italica]
Length=452

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +SKEER+ MVE+FIN+Y+ +N+G FPS+NLTHKEVGGS+Y VREIVR++IQ
Sbjct  71   KSKEERREMVESFINSYRVANDGKFPSVNLTHKEVGGSYYIVREIVRDVIQ  121



>ref|XP_004962882.1| PREDICTED: uncharacterized protein LOC101783488 isoform X2 [Setaria 
italica]
Length=428

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +SKEER+ MVE+FIN+Y+ +N+G FPS+NLTHKEVGGS+Y VREIVR++IQ
Sbjct  71   KSKEERREMVESFINSYRVANDGKFPSVNLTHKEVGGSYYIVREIVRDVIQ  121



>gb|KHG02286.1| Cytochrome c biogenesis CcsB [Gossypium arboreum]
Length=438

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFY  121
            RSKEERKSMVE+FI  YQ+SNNGNFPSLNLTHKEVGGSFY
Sbjct  30   RSKEERKSMVESFIKKYQESNNGNFPSLNLTHKEVGGSFY  69



>ref|NP_001168604.1| hypothetical protein [Zea mays]
 gb|ACN28834.1| unknown [Zea mays]
 tpg|DAA55351.1| TPA: hypothetical protein ZEAMMB73_338124 [Zea mays]
Length=499

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +SKEER+ MVE+FI +Y+ SN G FPS+NLTHKEVGGS+Y VREI+R+IIQ
Sbjct  68   KSKEERREMVESFIKSYRVSNEGKFPSINLTHKEVGGSYYIVREIMRDIIQ  118



>ref|NP_001143140.1| uncharacterized protein LOC100275620 [Zea mays]
 gb|ACG29292.1| hypothetical protein [Zea mays]
Length=499

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +SKEER+ MVE+FI +Y+ SN G FPS+NLTHKEVGGS+Y VREI+R+IIQ
Sbjct  68   KSKEERREMVESFIKSYRVSNEGKFPSINLTHKEVGGSYYIVREIMRDIIQ  118



>ref|XP_008793668.1| PREDICTED: uncharacterized protein LOC103709915 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008793669.1| PREDICTED: uncharacterized protein LOC103709915 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008793670.1| PREDICTED: uncharacterized protein LOC103709915 isoform X1 [Phoenix 
dactylifera]
Length=494

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  26   MVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            MVE+FI  Y+ SNNG+FPSLNLTHKEVGGSFY VREIVR+IIQ
Sbjct  38   MVESFIKKYRTSNNGSFPSLNLTHKEVGGSFYIVREIVRDIIQ  80



>ref|XP_011102206.1| PREDICTED: uncharacterized protein LOC105180232 [Sesamum indicum]
Length=498

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +2

Query  50   YQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            YQKSN+GNFPSLNLTHKEVGGSFYTVREIVREIIQ
Sbjct  65   YQKSNDGNFPSLNLTHKEVGGSFYTVREIVREIIQ  99



>ref|XP_006842976.1| hypothetical protein AMTR_s00076p00068170 [Amborella trichopoda]
 gb|ERN04651.1| hypothetical protein AMTR_s00076p00068170 [Amborella trichopoda]
Length=743

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  26   MVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            M+E+FI  Y+ S NGNFPSL LTHKEVGGSFYT+R+I+REI+Q
Sbjct  93   MIESFIEKYRNSKNGNFPSLTLTHKEVGGSFYTIRDIIREIVQ  135



>ref|XP_009413008.1| PREDICTED: uncharacterized protein LOC103994414 [Musa acuminata 
subsp. malaccensis]
Length=478

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  26   MVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +VE+FI+ Y+  NNG FPSLNLTHKEVGGSFY VREIVR+IIQ
Sbjct  38   LVESFIDKYRTLNNGKFPSLNLTHKEVGGSFYIVREIVRDIIQ  80



>emb|CAN72251.1| hypothetical protein VITISV_011585 [Vitis vinifera]
Length=663

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  50   YQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            YQKSN+GNFPSLNLTHK VGGSFYTVREIVREIIQ
Sbjct  196  YQKSNDGNFPSLNLTHKAVGGSFYTVREIVREIIQ  230



>ref|XP_008375645.1| PREDICTED: uncharacterized protein LOC103438880 [Malus domestica]
Length=456

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  50   YQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            YQK NNG+FPSLNLTHKEVGGSFYTVREIVR+IIQ
Sbjct  12   YQKLNNGSFPSLNLTHKEVGGSFYTVREIVRDIIQ  46



>ref|XP_010931947.1| PREDICTED: uncharacterized protein LOC105052722 [Elaeis guineensis]
Length=496

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  23   SMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +MVE+FI  Y+ SN+G FPSLNLTHKEVGGSFY VREIVR+IIQ
Sbjct  37   AMVESFIKKYRTSNSGKFPSLNLTHKEVGGSFYIVREIVRDIIQ  80



>gb|ABK24879.1| unknown [Picea sitchensis]
Length=363

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREII  151
            R KEER+ MVE+F+  Y+ +N G FP L  THKEVGG FY +REI++E+I
Sbjct  58   RKKEERRIMVESFVQKYRSANGGKFPRLGFTHKEVGGCFYIIREIMQEMI  107



>ref|XP_008793671.1| PREDICTED: uncharacterized protein LOC103709915 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008793672.1| PREDICTED: uncharacterized protein LOC103709915 isoform X2 [Phoenix 
dactylifera]
Length=469

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  50   YQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            Y+ SNNG+FPSLNLTHKEVGGSFY VREIVR+IIQ
Sbjct  21   YRTSNNGSFPSLNLTHKEVGGSFYIVREIVRDIIQ  55



>emb|CDY29069.1| BnaC07g32750D [Brassica napus]
Length=100

 Score = 65.1 bits (157),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  50   YQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            +++ NNG+FPSL+LTHKEVGGSFYT+REIVREIIQ
Sbjct  50   HRRLNNGSFPSLSLTHKEVGGSFYTIREIVREIIQ  84



>ref|XP_003619792.1| Plastid DNA-binding protein [Medicago truncatula]
 gb|AES76010.1| hypothetical protein MTR_6g069010 [Medicago truncatula]
Length=378

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK ER++MVE+F+N Y+  N G FP++  T KEVGGS+YTVR+I++E+
Sbjct  67   SKHERRAMVESFVNKYKSENAGKFPAIKYTQKEVGGSYYTVRDIIQEL  114



>ref|XP_009767141.1| PREDICTED: uncharacterized protein LOC104218361 [Nicotiana sylvestris]
Length=314

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREII  151
            SK+ERK+MVE F+N Y+  N+G FP      KEVGGS+YT+R++V+E++
Sbjct  48   SKDERKAMVEAFVNKYKAMNSGKFPPTKEAMKEVGGSYYTIRKLVQELL  96



>ref|XP_010918029.1| PREDICTED: uncharacterized protein LOC105042492 isoform X2 [Elaeis 
guineensis]
Length=328

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +SKEER++M+E F++TY+ SN G FP+ +   +E+GGS+Y +REI++E+
Sbjct  49   KSKEERRTMIEAFVDTYKASNAGKFPTASHIRQEIGGSYYVIREIIQEL  97



>ref|XP_004152907.1| PREDICTED: uncharacterized protein LOC101209410 [Cucumis sativus]
 gb|KGN65696.1| hypothetical protein Csa_1G502350 [Cucumis sativus]
Length=306

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SKEER++MVE+F++ Y+ SN G FPS   T KEVGGS+Y VR+I++E+
Sbjct  71   SKEERRAMVESFVHKYKASNTGKFPSAANTCKEVGGSYYVVRKILQEL  118



>ref|XP_010918028.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Elaeis 
guineensis]
Length=338

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +SKEER++M+E F++TY+ SN G FP+ +   +E+GGS+Y +REI++E+
Sbjct  49   KSKEERRTMIEAFVDTYKASNAGKFPTASHIRQEIGGSYYVIREIIQEL  97



>ref|XP_008800428.1| PREDICTED: uncharacterized protein LOC103714793 isoform X2 [Phoenix 
dactylifera]
Length=377

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +SKEER++MVE F++ Y+ SN G FP+ +   +E+GGS+Y VREI++E+
Sbjct  70   KSKEERRAMVEAFVDKYKSSNAGKFPTASHIRQEIGGSYYVVREIIQEL  118



>ref|XP_008800429.1| PREDICTED: uncharacterized protein LOC103714793 isoform X3 [Phoenix 
dactylifera]
Length=373

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +SKEER++MVE F++ Y+ SN G FP+ +   +E+GGS+Y VREI++E+
Sbjct  49   KSKEERRAMVEAFVDKYKSSNAGKFPTASHIRQEIGGSYYVVREIIQEL  97



>ref|XP_008800426.1| PREDICTED: uncharacterized protein LOC103714793 isoform X1 [Phoenix 
dactylifera]
Length=394

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +SKEER++MVE F++ Y+ SN G FP+ +   +E+GGS+Y VREI++E+
Sbjct  70   KSKEERRAMVEAFVDKYKSSNAGKFPTASHIRQEIGGSYYVVREIIQEL  118



>ref|NP_200629.2| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
 ref|NP_974955.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
 ref|NP_974956.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
 ref|NP_001078765.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
 dbj|BAC43253.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH20048.1| AT5G58210 [Arabidopsis thaliana]
 gb|AED97014.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
 gb|AED97015.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
 gb|AED97016.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
 gb|AED97017.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
Length=380

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK++R+++VE+F+N Y+ +N G FPSL+ THK+VGGS+Y VR+I +E+
Sbjct  50   SKDDRRALVESFVNEYRATNAGRFPSLDATHKQVGGSYYIVRDIFQEL  97



>ref|XP_008457506.1| PREDICTED: uncharacterized protein LOC103497179 isoform X2 [Cucumis 
melo]
Length=305

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  11   EERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            E+R++M+E+F++ Y+ SN G FPSL  T KEVGGS+Y VR+I++E+
Sbjct  73   EKRRAMIESFVHKYKASNTGKFPSLATTFKEVGGSYYVVRKIIQEL  118



>ref|XP_002864556.1| hypothetical protein ARALYDRAFT_495927 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40815.1| hypothetical protein ARALYDRAFT_495927 [Arabidopsis lyrata subsp. 
lyrata]
Length=331

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S+++R+++VE+F+N Y+ +N G FPSL+ T KEVGG +Y VREI++E+
Sbjct  46   SRDDRRALVESFVNEYRANNAGRFPSLSSTRKEVGGCYYVVREILQEL  93



>ref|XP_008457504.1| PREDICTED: uncharacterized protein LOC103497179 isoform X1 [Cucumis 
melo]
 ref|XP_008457505.1| PREDICTED: uncharacterized protein LOC103497179 isoform X1 [Cucumis 
melo]
Length=312

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  11   EERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            E+R++M+E+F++ Y+ SN G FPSL  T KEVGGS+Y VR+I++E+
Sbjct  80   EKRRAMIESFVHKYKASNTGKFPSLATTFKEVGGSYYVVRKIIQEL  125



>ref|XP_006281465.1| hypothetical protein CARUB_v10027548mg [Capsella rubella]
 gb|EOA14363.1| hypothetical protein CARUB_v10027548mg [Capsella rubella]
Length=268

 Score = 61.2 bits (147),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            S+E+R+ +VE ++N Y+ +N G FP++  T+KEVGGS+Y VREI +E+++
Sbjct  50   SREDRRVLVEAYVNEYRAANAGRFPTMYATYKEVGGSYYIVREIFQELMK  99



>ref|XP_004512688.1| PREDICTED: uncharacterized protein LOC101498906 [Cicer arietinum]
 ref|XP_004517312.1| PREDICTED: uncharacterized protein LOC101498176 [Cicer arietinum]
Length=452

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            K ER++MVE F+N Y+  N G FP++  T KEVGG +Y +REI++E+
Sbjct  65   KHERRAMVECFVNKYRSENAGKFPAIKYTQKEVGGGYYVIREIIQEL  111



>ref|XP_009621458.1| PREDICTED: uncharacterized protein LOC104113073 isoform X2 [Nicotiana 
tomentosiformis]
Length=321

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK+ERK+MVE F+N Y+  N G FP      KEVGGS+YT++ +V+E+
Sbjct  48   SKDERKAMVEAFVNKYRAMNGGKFPPTKKAMKEVGGSYYTIKRLVQEL  95



>ref|XP_009621457.1| PREDICTED: uncharacterized protein LOC104113073 isoform X1 [Nicotiana 
tomentosiformis]
Length=329

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK+ERK+MVE F+N Y+  N G FP      KEVGGS+YT++ +V+E+
Sbjct  48   SKDERKAMVEAFVNKYRAMNGGKFPPTKKAMKEVGGSYYTIKRLVQEL  95



>ref|XP_010528546.1| PREDICTED: uncharacterized protein LOC104805620 isoform X1 [Tarenaya 
hassleriana]
Length=355

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S++ER+++V +F+  Y+ +N G FP+L  THKEVGGS+Y VR+I +E+
Sbjct  70   SRDERRALVVSFVTRYRATNGGKFPNLKATHKEVGGSYYIVRDIFQEL  117



>ref|XP_010528547.1| PREDICTED: uncharacterized protein LOC104805620 isoform X2 [Tarenaya 
hassleriana]
Length=348

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S++ER+++V +F+  Y+ +N G FP+L  THKEVGGS+Y VR+I +E+
Sbjct  70   SRDERRALVVSFVTRYRATNGGKFPNLKATHKEVGGSYYIVRDIFQEL  117



>emb|CDP17378.1| unnamed protein product [Coffea canephora]
Length=366

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK+ER+SMVE+F++ Y+  N+G FP+++   +EVGGS+YTVR +V+E+
Sbjct  81   SKDERRSMVESFVHRYRVLNSGKFPTVSEAQREVGGSYYTVRMLVQEL  128



>gb|KHM99765.1| hypothetical protein glysoja_023906 [Glycine soja]
Length=462

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            + ER++MVE+F+N Y+  N G FP ++ T K+VGGS+Y +REI++E+
Sbjct  68   RHERRAMVESFVNNYRAENAGKFPRISDTQKQVGGSYYVIREIIQEL  114



>ref|XP_006587409.1| PREDICTED: lisH domain-containing protein C1711.05-like isoform 
X1 [Glycine max]
Length=462

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            + ER++MVE+F+N Y+  N G FP ++ T K+VGGS+Y +REI++E+
Sbjct  68   RHERRAMVESFVNNYRAENAGKFPRISDTQKQVGGSYYVIREIIQEL  114



>ref|XP_006587410.1| PREDICTED: lisH domain-containing protein C1711.05-like isoform 
X2 [Glycine max]
Length=455

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            + ER++MVE+F+N Y+  N G FP ++ T K+VGGS+Y +REI++E+
Sbjct  68   RHERRAMVESFVNNYRAENAGKFPRISDTQKQVGGSYYVIREIIQEL  114



>ref|XP_010662027.1| PREDICTED: uncharacterized protein LOC100855088 isoform X1 [Vitis 
vinifera]
 ref|XP_010662028.1| PREDICTED: uncharacterized protein LOC100855088 isoform X1 [Vitis 
vinifera]
 ref|XP_010662029.1| PREDICTED: uncharacterized protein LOC100855088 isoform X1 [Vitis 
vinifera]
Length=336

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            K+ERK MVE+F+N Y+  N G FP+++   K VGGS+Y VRE+V+E+
Sbjct  65   KDERKVMVESFVNKYRGMNAGKFPTVSEAQKHVGGSYYIVRELVQEL  111



>ref|XP_010662030.1| PREDICTED: uncharacterized protein LOC100855088 isoform X2 [Vitis 
vinifera]
 emb|CBI26400.3| unnamed protein product [Vitis vinifera]
Length=326

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            K+ERK MVE+F+N Y+  N G FP+++   K VGGS+Y VRE+V+E+
Sbjct  65   KDERKVMVESFVNKYRGMNAGKFPTVSEAQKHVGGSYYIVRELVQEL  111



>ref|XP_011074424.1| PREDICTED: uncharacterized protein LOC105159162 isoform X1 [Sesamum 
indicum]
Length=299

 Score = 58.9 bits (141),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK+ERK+MVE ++N Y++ N G FP+ +   K+VGGS+Y VR+I++E+
Sbjct  70   SKDERKTMVENYVNKYREMNAGKFPTASDAVKDVGGSYYVVRQILQEL  117



>gb|EMT17733.1| hypothetical protein F775_09008 [Aegilops tauschii]
Length=451

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  50   YQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            Y+ SNNG FPS+NLTHKEVGGS+Y VREI+R+IIQ
Sbjct  39   YRVSNNGKFPSVNLTHKEVGGSYYIVREIMRDIIQ  73



>gb|AFK39831.1| unknown [Lotus japonicus]
Length=209

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK++R+++VE+F+N ++  N G FP++    K+VGG FY++REI++E+
Sbjct  66   SKQQRRAIVESFVNKHRSENAGKFPTITDIQKQVGGGFYSIREIIKEL  113



>gb|AFK44423.1| unknown [Lotus japonicus]
Length=217

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK++R+++VE+F+N ++  N G FP++    K+VGG FY++REI++E+
Sbjct  66   SKQQRRAIVESFVNKHRSENAGKFPTITDIQKQVGGGFYSIREIIKEL  113



>ref|XP_011017553.1| PREDICTED: uncharacterized protein LOC105120868 isoform X3 [Populus 
euphratica]
Length=229

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK++R++MVE+++N Y++++ G FPS++   KE GG++Y +R+IV+E+
Sbjct  57   SKDDRRAMVESYVNKYRETHAGKFPSISDAQKEAGGNYYFIRKIVQEL  104



>gb|KHN24475.1| hypothetical protein glysoja_014079 [Glycine soja]
Length=457

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            + +R++MVE+F+N Y+  N G FP ++ T K+VGGS+Y +REIV E+
Sbjct  68   RHQRRAMVESFVNKYRAENAGKFPKISDTQKQVGGSYYVIREIVLEL  114



>ref|XP_006599673.1| PREDICTED: uncharacterized protein LOC102668185 [Glycine max]
Length=457

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            + +R++MVE+F+N Y+  N G FP ++ T K+VGGS+Y +REIV E+
Sbjct  68   RHQRRAMVESFVNKYRAENAGKFPKISDTQKQVGGSYYVIREIVLEL  114



>ref|XP_006401117.1| hypothetical protein EUTSA_v10014108mg [Eutrema salsugineum]
 gb|ESQ42570.1| hypothetical protein EUTSA_v10014108mg [Eutrema salsugineum]
Length=323

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK++R++ VE+F++ Y+ +N G FPSL+ THKEVGG +Y VR+I +E+
Sbjct  46   SKDDRRAAVESFVSNYRAANAGRFPSLSATHKEVGGGYYFVRKIFQEL  93



>ref|XP_006372275.1| hypothetical protein POPTR_0018s14880g [Populus trichocarpa]
 gb|ERP50072.1| hypothetical protein POPTR_0018s14880g [Populus trichocarpa]
Length=289

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK++R++MVE+++N Y++++ G FPS++   K+VGG++Y +R+IV+E+
Sbjct  57   SKDDRRAMVESYVNKYRETHAGKFPSISDARKQVGGNYYFIRKIVQEL  104



>ref|XP_010528548.1| PREDICTED: uncharacterized protein LOC104805620 isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010528549.1| PREDICTED: uncharacterized protein LOC104805620 isoform X3 [Tarenaya 
hassleriana]
Length=297

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S++ER+++V +F+  Y+ +N G FP+L  THKEVGGS+Y VR+I +E+
Sbjct  12   SRDERRALVVSFVTRYRATNGGKFPNLKATHKEVGGSYYIVRDIFQEL  59



>ref|XP_002439445.1| hypothetical protein SORBIDRAFT_09g006534 [Sorghum bicolor]
 gb|EES17875.1| hypothetical protein SORBIDRAFT_09g006534 [Sorghum bicolor]
Length=100

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVRE  145
            +K+ER+ M+  F+  Y+ SN G FPS+    +++GGS YTVREI++E
Sbjct  54   AKQERRIMIVEFVQKYRASNEGKFPSITYVRQQLGGSHYTVREIIQE  100



>ref|XP_011017551.1| PREDICTED: uncharacterized protein LOC105120868 isoform X1 [Populus 
euphratica]
Length=288

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK++R++MVE+++N Y++++ G FPS++   KE GG++Y +R+IV+E+
Sbjct  57   SKDDRRAMVESYVNKYRETHAGKFPSISDAQKEAGGNYYFIRKIVQEL  104



>ref|XP_011017552.1| PREDICTED: uncharacterized protein LOC105120868 isoform X2 [Populus 
euphratica]
Length=284

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK++R++MVE+++N Y++++ G FPS++   KE GG++Y +R+IV+E+
Sbjct  57   SKDDRRAMVESYVNKYRETHAGKFPSISDAQKEAGGNYYFIRKIVQEL  104



>ref|XP_010248500.1| PREDICTED: uncharacterized protein LOC104591401 isoform X1 [Nelumbo 
nucifera]
Length=343

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK ER++MVE+F++ ++ SN G FP+ ++  K +GGS+Y +R+I++E+
Sbjct  64   SKAERRAMVESFVDEFRASNAGKFPTPSVARKHLGGSYYVIRQILQEL  111



>ref|XP_006478233.1| PREDICTED: uncharacterized protein LOC102608427 [Citrus sinensis]
 ref|XP_006491613.1| PREDICTED: uncharacterized protein LOC102631321 [Citrus sinensis]
Length=189

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            ++ERK+MVE+F+N Y+ +++G FP+ +   K VGGS+Y V+ I++E++ 
Sbjct  60   RDERKAMVESFVNKYRVTHDGKFPTASDVCKNVGGSYYVVKIILQEVVH  108



>ref|XP_007010893.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
 gb|EOY19703.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
Length=265

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK+ER++M+E+FI  Y+  N G FPS +   KEVGGS+Y VR++++E+
Sbjct  39   SKDERRAMIESFITRYRSVNAGKFPSASAAQKEVGGSYYVVRKVLQEL  86



>ref|XP_002454228.1| hypothetical protein SORBIDRAFT_04g027130 [Sorghum bicolor]
 gb|EES07204.1| hypothetical protein SORBIDRAFT_04g027130 [Sorghum bicolor]
Length=222

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  11   EERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREII  151
            +ERK+++  F+  Y+ SN G FP++  T +++GGS+YTVR++++E++
Sbjct  57   QERKALIVEFVENYRASNEGKFPTVTNTRQQIGGSYYTVRDVLQEMV  103



>ref|XP_010453323.1| PREDICTED: uncharacterized protein LOC104735262 [Camelina sativa]
Length=352

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SKE+R+ +VE+++N Y+ SN G FP+L+ T K VGGS Y +R I++E+
Sbjct  52   SKEDRRVLVESYVNEYRASNAGKFPTLSATLKAVGGSRYILRVILQEL  99



>ref|XP_010443535.1| PREDICTED: uncharacterized protein LOC104726387 [Camelina sativa]
 ref|XP_010443536.1| PREDICTED: uncharacterized protein LOC104726387 [Camelina sativa]
Length=477

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SKE+R+ +VE+++N Y+ SN G FP+L    KEVGGS Y +R I++E+
Sbjct  51   SKEDRRVLVESYVNEYRASNAGKFPTLKAIRKEVGGSPYILRVILQEL  98



>ref|XP_007010891.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY19701.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=349

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK+ER++M+E+FI  Y+  N G FPS +   KEVGGS+Y VR++++E+
Sbjct  50   SKDERRAMIESFITRYRSVNAGKFPSASAAQKEVGGSYYVVRKVLQEL  97



>ref|XP_007152508.1| hypothetical protein PHAVU_004G136200g [Phaseolus vulgaris]
 gb|ESW24502.1| hypothetical protein PHAVU_004G136200g [Phaseolus vulgaris]
Length=460

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +++R+ MVE F+N Y+  N G FP++     +VGGSFY +R+I++E+
Sbjct  68   RDKRRDMVELFVNKYRAENQGKFPTITDAQNQVGGSFYAIRDIIQEL  114



>ref|XP_007010892.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY19702.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=313

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK+ER++M+E+FI  Y+  N G FPS +   KEVGGS+Y VR++++E+
Sbjct  50   SKDERRAMIESFITRYRSVNAGKFPSASAAQKEVGGSYYVVRKVLQEL  97



>ref|XP_008348813.1| PREDICTED: uncharacterized protein LOC103411980 [Malus domestica]
Length=341

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            K ER+ M+E+F+N Y+  N G FP+++   KE+GGS+Y V+ I++E+
Sbjct  65   KAERQVMLESFVNQYRAKNAGAFPTVSYAQKELGGSYYVVKSILQEL  111



>gb|EEC73666.1| hypothetical protein OsI_08211 [Oryza sativa Indica Group]
Length=313

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +K+ER+  +E F+  Y+ SN+G FP++    + VGG  YTVREIV+E+
Sbjct  54   TKQERRVKIEKFVEEYKASNDGKFPTMTTVRQHVGGGHYTVREIVQEL  101



>ref|NP_001047531.1| Os02g0638000 [Oryza sativa Japonica Group]
 dbj|BAD25338.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD25893.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09445.1| Os02g0638000 [Oryza sativa Japonica Group]
 dbj|BAG97759.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57445.1| hypothetical protein OsJ_07660 [Oryza sativa Japonica Group]
Length=313

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +K+ER+  +E F+  Y+ SN+G FP++    + VGG  YTVREIV+E+
Sbjct  54   TKQERRVKIEKFVEEYKASNDGKFPTMTTVRQHVGGGHYTVREIVQEL  101



>ref|XP_009345950.1| PREDICTED: uncharacterized protein LOC103937726 [Pyrus x bretschneideri]
Length=341

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            K ER+ M+E+F+N Y+  N G FP+++   KE+GGS+Y V+ I++E+
Sbjct  65   KAERQVMLESFVNQYRAKNAGAFPTVSYAQKELGGSYYVVKNILQEL  111



>ref|XP_009132074.1| PREDICTED: uncharacterized protein LOC103856708 [Brassica rapa]
Length=377

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S+++R+ +VE+F++ Y+ +N G FP+L +T KEVGG +Y VR+I++E+
Sbjct  46   SRDDRRLVVESFVSKYRAANAGKFPTLKVTVKEVGGGYYVVRDILQEL  93



>emb|CDX88662.1| BnaA03g09870D [Brassica napus]
Length=370

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S+++R+ +VE+F++ Y+ +N G FP+L +T KEVGG +Y VR+I++E+
Sbjct  46   SRDDRRLVVESFVSKYRAANAGKFPTLKVTVKEVGGGYYVVRDILQEL  93



>emb|CDY58571.1| BnaC03g12500D [Brassica napus]
Length=375

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S+++R+ +VE+F++ Y+ +N G FP+L +T KEVGG +Y VR+I++E+
Sbjct  46   SRDDRRLVVESFVSKYRAANAGKFPTLKVTVKEVGGGYYVVRDILQEL  93



>ref|XP_006648871.1| PREDICTED: uncharacterized protein LOC102720772 [Oryza brachyantha]
Length=314

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +K+ER+  +E FI  Y+ SN+G FP++    + VGGS YTVREI +E+
Sbjct  55   TKQERRVKIEKFIEEYKASNDGKFPNMTTVRQHVGGSHYTVREIFQEL  102



>ref|XP_009400410.1| PREDICTED: uncharacterized protein LOC103984605 [Musa acuminata 
subsp. malaccensis]
Length=251

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +K+ER+++V++F++ Y+ SN G FP++    +E GGS+Y+++ IV+EI
Sbjct  60   TKQERRTLVKSFVDKYRASNAGRFPAVTYVLRETGGSYYSLKLIVQEI  107



>ref|XP_006478154.1| PREDICTED: uncharacterized protein LOC102627661 isoform X1 [Citrus 
sinensis]
 gb|KDO55988.1| hypothetical protein CISIN_1g018234mg [Citrus sinensis]
Length=359

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            ++ERK+MVE+F+N Y+ +++G FP+ +   K VGGS+Y V+ I++E++ 
Sbjct  60   RDERKAMVESFVNKYRVTHDGKFPTASDVCKNVGGSYYVVKIILQEVVH  108



>gb|EMT04577.1| hypothetical protein F775_28747 [Aegilops tauschii]
Length=390

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK ERK+ ++ FI  YQ SN+G FP++ +  + VGG  YT+R+++ E+
Sbjct  56   SKNERKARMKEFIEGYQASNDGRFPTMQMIRQSVGGGHYTIRDVLSEV  103



>ref|XP_009375273.1| PREDICTED: uncharacterized protein LOC103964106 [Pyrus x bretschneideri]
Length=341

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            K ER+ M+E+F+N Y+  N G FP+++   KE+GGS+Y V+ I++E+
Sbjct  65   KVERQVMLESFVNQYRAKNAGAFPTVSYAQKELGGSYYVVKNILQEL  111



>ref|XP_004953229.1| PREDICTED: uncharacterized protein LOC101775724 [Setaria italica]
Length=338

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +K+ER+  +  F++ ++ SN+G FPS+    ++VGGS+YTVREI++E+
Sbjct  55   AKQERRVRIVEFVDKFRASNDGKFPSITNARQQVGGSYYTVREILQEL  102



>ref|XP_006441494.1| hypothetical protein CICLE_v10020800mg [Citrus clementina]
 gb|ESR54734.1| hypothetical protein CICLE_v10020800mg [Citrus clementina]
Length=359

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREIIQ  154
            ++ERK+MVE+F+N Y+  ++G FP+ +   K VGGS+Y V+ I++E++ 
Sbjct  60   RDERKAMVESFVNKYRVRHDGKFPTASDVRKNVGGSYYVVKIILQEVVH  108



>ref|XP_009390637.1| PREDICTED: uncharacterized protein LOC103976963 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=252

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S++ER+++VE+F++ Y+ SN G FP ++   +E+GGS+Y ++++V+E+
Sbjct  60   SEQERRALVESFVDKYRASNAGRFPPVSHVRQEIGGSYYIIKQLVQEM  107



>ref|XP_009390612.1| PREDICTED: uncharacterized protein LOC103976963 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390620.1| PREDICTED: uncharacterized protein LOC103976963 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390628.1| PREDICTED: uncharacterized protein LOC103976963 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=253

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S++ER+++VE+F++ Y+ SN G FP ++   +E+GGS+Y ++++V+E+
Sbjct  60   SEQERRALVESFVDKYRASNAGRFPPVSHVRQEIGGSYYIIKQLVQEM  107



>ref|XP_006351526.1| PREDICTED: uncharacterized protein LOC102603185 isoform X1 [Solanum 
tuberosum]
 ref|XP_006351527.1| PREDICTED: uncharacterized protein LOC102603185 isoform X2 [Solanum 
tuberosum]
Length=275

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  11   EERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            EER +MVE F+N Y+  N G FPS     KEVGG +YTV++IV+E+
Sbjct  56   EERIAMVEGFVNKYRAMNGGKFPSAYAAMKEVGGGYYTVKKIVQEM  101



>ref|XP_006351528.1| PREDICTED: uncharacterized protein LOC102603185 isoform X3 [Solanum 
tuberosum]
Length=274

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  11   EERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            EER +MVE F+N Y+  N G FPS     KEVGG +YTV++IV+E+
Sbjct  55   EERIAMVEGFVNKYRAMNGGKFPSAYAAMKEVGGGYYTVKKIVQEM  100



>ref|XP_008237313.1| PREDICTED: uncharacterized abhydrolase domain-containing protein 
DDB_G0269086 [Prunus mume]
Length=432

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK ER++M+E F+N Y+  N G FP+++ T KE+GGS+Y V+ I++E+
Sbjct  72   SKAERQAMLEPFVNKYRAMNAGAFPTVSCTQKELGGSYYVVKSILQEL  119



>gb|AGG23394.1| hypothetical protein [Hordeum vulgare]
Length=380

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK ERK+ ++ FI  YQ SN+G FP+  +  K VGGS YT+R+++ E+
Sbjct  56   SKNERKARMKEFIEGYQASNDGRFPTSQMIRKSVGGSHYTIRDVLSEV  103



>dbj|BAJ94543.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK ERK+ ++ FI  YQ SN+G FP+  +  K VGGS YT+R+++ E+
Sbjct  56   SKNERKARMKEFIEGYQASNDGRFPTSQMIRKSVGGSHYTIRDVLSEV  103



>ref|XP_004300054.1| PREDICTED: uncharacterized protein LOC101299586 [Fragaria vesca 
subsp. vesca]
Length=360

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RSKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            RSK+E  ++VET +N Y+  N G FP +  T K+VGG +Y +R I++E+
Sbjct  54   RSKKELHAVVETVVNEYKAMNAGKFPGIKYTKKQVGGCYYRIRGILQEL  102



>ref|NP_001145114.1| hypothetical protein [Zea mays]
 gb|ACG45212.1| hypothetical protein [Zea mays]
 gb|AFW72501.1| hypothetical protein ZEAMMB73_525690 [Zea mays]
Length=347

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +K+ER++ +  FI  Y+ SN+G FP++    ++VGGS YT REI++E+
Sbjct  99   TKQERRTRIMEFIENYRASNDGKFPTIKNIRQQVGGSHYTAREIIQEM  146



>ref|XP_007201052.1| hypothetical protein PRUPE_ppa006501mg [Prunus persica]
 gb|EMJ02251.1| hypothetical protein PRUPE_ppa006501mg [Prunus persica]
Length=409

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK ER++M+E F+N Y+  N G FP+++   KE+GGS+Y V+ I++E+
Sbjct  70   SKAERQAMLEPFVNKYRAMNAGAFPTVSCAQKELGGSYYVVKGILQEL  117



>gb|EMS61434.1| hypothetical protein TRIUR3_32999 [Triticum urartu]
Length=395

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK ERK+ ++ FI  YQ SN+G FP++ +  + VGG  YT+R+++ E+
Sbjct  56   SKNERKARMKEFIEGYQASNDGRFPTMQMIRQSVGGGHYTIRDVLSEV  103



>ref|XP_010248508.1| PREDICTED: uncharacterized protein LOC104591401 isoform X2 [Nelumbo 
nucifera]
Length=273

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  26   MVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            MVE+F++ ++ SN G FP+ ++  K +GGS+Y +R+I++E+
Sbjct  1    MVESFVDEFRASNAGKFPTPSVARKHLGGSYYVIRQILQEL  41



>ref|XP_010086781.1| hypothetical protein L484_006203 [Morus notabilis]
 gb|EXB23621.1| hypothetical protein L484_006203 [Morus notabilis]
Length=194

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S+ +R+ MVE F+  Y+  N+G  P  +   KEVGGS+Y V++I +E+
Sbjct  54   SRAQRRDMVEAFVLKYKAMNDGKLPYASNVAKEVGGSYYVVKQIFQEL  101



>ref|XP_004234319.1| PREDICTED: uncharacterized protein LOC101251753 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010317543.1| PREDICTED: uncharacterized protein LOC101251753 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010317545.1| PREDICTED: uncharacterized protein LOC101251753 isoform X1 [Solanum 
lycopersicum]
Length=277

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S EER +MV+ F+N Y+  N G FP      KEVGG +Y V++IV+E+
Sbjct  54   STEERIAMVQDFVNKYRAMNGGKFPPAYAAMKEVGGGYYNVKKIVQEM  101



>ref|XP_010317546.1| PREDICTED: uncharacterized protein LOC101251753 isoform X2 [Solanum 
lycopersicum]
Length=276

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S EER +MV+ F+N Y+  N G FP      KEVGG +Y V++IV+E+
Sbjct  53   STEERIAMVQDFVNKYRAMNGGKFPPAYAAMKEVGGGYYNVKKIVQEM  100



>ref|XP_010037047.1| PREDICTED: uncharacterized protein LOC104425890 isoform X2 [Eucalyptus 
grandis]
 gb|KCW48683.1| hypothetical protein EUGRSUZ_K02337 [Eucalyptus grandis]
 gb|KCW48684.1| hypothetical protein EUGRSUZ_K02337 [Eucalyptus grandis]
Length=284

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            K+ER++MVE ++N Y+ +N G FP+ +     VGGS+Y +R+I++E+
Sbjct  64   KDERQAMVERYVNEYRSNNAGKFPTASDAMNHVGGSYYVIRKIIQEL  110



>ref|XP_010037044.1| PREDICTED: uncharacterized protein LOC104425890 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010037046.1| PREDICTED: uncharacterized protein LOC104425890 isoform X1 [Eucalyptus 
grandis]
 gb|KCW48685.1| hypothetical protein EUGRSUZ_K02337 [Eucalyptus grandis]
Length=285

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            K+ER++MVE ++N Y+ +N G FP+ +     VGGS+Y +R+I++E+
Sbjct  64   KDERQAMVERYVNEYRSNNAGKFPTASDAMNHVGGSYYVIRKIIQEL  110



>ref|XP_006857341.1| hypothetical protein AMTR_s00067p00095130 [Amborella trichopoda]
 gb|ERN18808.1| hypothetical protein AMTR_s00067p00095130 [Amborella trichopoda]
Length=773

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +KE+R   ++TF+  Y   N G FP   L H+EVGGS+Y ++ I+ ++
Sbjct  32   AKEQRTLAIKTFVKKYMMLNPGTFPKATLVHQEVGGSWYILKNILSDL  79



>gb|EMS58731.1| hypothetical protein TRIUR3_11620 [Triticum urartu]
Length=388

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +KEER+  VE F+  Y+ S+ G FPS     K+VGGS+Y +  +++E+
Sbjct  129  TKEERRDRVEEFVENYRASHEGKFPSATYVRKQVGGSYYVLWALLQEL  176



>ref|XP_002978664.1| hypothetical protein SELMODRAFT_418465 [Selaginella moellendorffii]
 gb|EFJ20111.1| hypothetical protein SELMODRAFT_418465 [Selaginella moellendorffii]
Length=766

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S++ER ++V++F+  Y   NNG FP+L L  KE GGS   V++I+ ++
Sbjct  110  SRDERAALVKSFVEKYASENNGEFPTLALVLKETGGSRAVVKDILADL  157



>ref|XP_002984597.1| hypothetical protein SELMODRAFT_423782 [Selaginella moellendorffii]
 gb|EFJ14242.1| hypothetical protein SELMODRAFT_423782 [Selaginella moellendorffii]
Length=758

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            S++ER ++V++F+  Y   NNG FP+L L  KE GGS   V++I+ ++
Sbjct  110  SRDERAALVKSFVEKYASENNGEFPTLALVLKETGGSRAVVKDILADL  157



>ref|XP_010688723.1| PREDICTED: uncharacterized protein LOC104902598 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=328

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK  RK+M+E ++  Y+  N G FP      K VGGS+YTV+ I++E+
Sbjct  63   SKLRRKAMIEDYVKKYRSMNAGKFPLAKNVQKHVGGSYYTVKTILQEL  110



>ref|XP_010688725.1| PREDICTED: uncharacterized protein LOC104902598 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=327

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            SK  RK+M+E ++  Y+  N G FP      K VGGS+YTV+ I++E+
Sbjct  62   SKLRRKAMIEDYVKKYRSMNAGKFPLAKNVQKHVGGSYYTVKTILQEL  109



>ref|XP_003580180.1| PREDICTED: uncharacterized protein LOC100830379 [Brachypodium 
distachyon]
Length=239

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +K+ER++ VE F+  Y+ S+ G FP  +   ++VGGS+Y  R +++E+
Sbjct  55   TKQERRARVEEFVQNYRASHEGKFPCASSVRQQVGGSYYVARALLQEL  102



>gb|EMT33237.1| hypothetical protein F775_08321 [Aegilops tauschii]
Length=215

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +KEER++ VE F+  ++ S+ G FP      ++VGGS+YTV  +++E+
Sbjct  84   TKEERRARVEEFVENFRASHEGKFPHATYVRQQVGGSYYTVLALLQEL  131



>gb|AFW63139.1| hypothetical protein ZEAMMB73_732239 [Zea mays]
Length=324

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +K+ER+  +  F+  Y+ SN G FP++    +++GG +Y VRE+++E+
Sbjct  55   TKQERRVRIVEFVENYRASNEGKFPTVKNICQQIGGGYYAVRELLQEM  102



>ref|XP_008676968.1| PREDICTED: uncharacterized protein LOC100276558 isoform X1 [Zea 
mays]
Length=380

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    SKEERKSMVETFINTYQKSNNGNFPSLNLTHKEVGGSFYTVREIVREI  148
            +K+ER+  +  F+  Y+ SN G FP++    +++GG +Y VRE+++E+
Sbjct  116  TKQERRVRIVEFVENYRASNEGKFPTVKNICQQIGGGYYAVRELLQEM  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522492721668