BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c41492_g1_i1 len=188 path=[1:0-187]

Length=188
                                                                      Score     E

ref|XP_006350567.1|  PREDICTED: probable receptor-like protein ki...  90.1    4e-19   
ref|XP_009786425.1|  PREDICTED: probable receptor-like protein ki...  87.4    3e-18   
ref|XP_004234168.1|  PREDICTED: probable receptor-like protein ki...  85.1    2e-17   
ref|XP_009592347.1|  PREDICTED: probable receptor-like protein ki...  84.3    4e-17   
ref|XP_009780293.1|  PREDICTED: probable receptor-like protein ki...  58.5    4e-08   
ref|XP_009592348.1|  PREDICTED: probable receptor-like protein ki...  57.8    8e-08   
ref|XP_006350566.1|  PREDICTED: uncharacterized protein LOC102581761  55.8    2e-07   
ref|XP_009760918.1|  PREDICTED: probable receptor-like protein ki...  56.6    2e-07   
ref|XP_009760919.1|  PREDICTED: probable receptor-like protein ki...  52.0    7e-06   
ref|XP_009596789.1|  PREDICTED: probable receptor-like protein ki...  51.6    9e-06   
ref|XP_009596790.1|  PREDICTED: probable receptor-like protein ki...  51.6    1e-05   
ref|XP_009765438.1|  PREDICTED: probable receptor-like protein ki...  49.3    7e-05   
ref|XP_011084499.1|  PREDICTED: probable receptor-like protein ki...  47.0    4e-04   



>ref|XP_006350567.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=640

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 4/62 (6%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSHRCYDDTGFDLPLP  8
            LSSI  A+SYG E+SW R +LCR+CE S G+CF +        TCSHRCYDD+GFDLPLP
Sbjct  204  LSSIEGALSYGFELSWKRTFLCRECEASQGNCFAEGD----GFTCSHRCYDDSGFDLPLP  259

Query  7    CS  2
            CS
Sbjct  260  CS  261



>ref|XP_009786425.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=637

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 4/62 (6%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSHRCYDDTGFDLPLP  8
            LSSI  A+ YG E+SW R +LCR+CE S G+CF D   D Y  +CSHRCYDDTG DLPLP
Sbjct  201  LSSIQDALRYGFELSWKRTFLCRECEASQGNCFADG--DGY--SCSHRCYDDTGMDLPLP  256

Query  7    CS  2
            CS
Sbjct  257  CS  258



>ref|XP_004234168.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Solanum 
lycopersicum]
Length=638

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 4/62 (6%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSHRCYDDTGFDLPLP  8
            LSSI  A+SYG E+SW R +LCR+CE S G+CF     D Y  TCSHRCYDDTGFDLPLP
Sbjct  201  LSSIEGALSYGFELSWKRTFLCRECEASQGNCFAVG--DRY--TCSHRCYDDTGFDLPLP  256

Query  7    CS  2
            CS
Sbjct  257  CS  258



>ref|XP_009592347.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
tomentosiformis]
Length=637

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 4/62 (6%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSHRCYDDTGFDLPLP  8
            LSSI  A+ YG E+SW R +LCR+CE S G+CF +   D Y  +C+HRCYDDTG DLPLP
Sbjct  201  LSSIQDALRYGFELSWKRTFLCRECEASKGNCFAEG--DGY--SCNHRCYDDTGMDLPLP  256

Query  7    CS  2
            CS
Sbjct  257  CS  258



>ref|XP_009780293.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=640

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 4/63 (6%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSH-RCYDDTGFDLPL  11
            LSSI  A+SYG E+SW R +LCR+C+    +CF +      +    H RC D + FDLPL
Sbjct  202  LSSIQDALSYGSELSWKRTFLCRECQD---YCFSEGNDYRCSRNNRHLRCDDGSPFDLPL  258

Query  10   PCS  2
            PCS
Sbjct  259  PCS  261



>ref|XP_009592348.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
tomentosiformis]
Length=652

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 8/62 (13%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSHRCYDDTGFDLPLP  8
            LS+I AA++YG E SW R +LCR+CE   G+CF +         C HRC D++G +L +P
Sbjct  218  LSNIQAALAYGFEFSWKRTFLCRECE---GYCFAEGD----GFVC-HRCKDNSGMNLHIP  269

Query  7    CS  2
            CS
Sbjct  270  CS  271



>ref|XP_006350566.1| PREDICTED: uncharacterized protein LOC102581761 [Solanum tuberosum]
Length=323

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 2/52 (4%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSHRCYDD  32
            L+S H A++YG EVSW    LCR+CE S G C+ +D  D   VTC H C +D
Sbjct  200  LASTHQALAYGFEVSWKYGLLCRECEASDGSCYLEDNSD--VVTCIHYCKED  249



>ref|XP_009760918.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nicotiana sylvestris]
Length=653

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 8/62 (13%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSHRCYDDTGFDLPLP  8
            LS+I  A++YG E+SW R +LCR+CE   G+CF +         C HRC D++G +L +P
Sbjct  218  LSNIQTALAYGFELSWKRTFLCRECE---GYCFAEGD----GFLC-HRCKDNSGMNLHIP  269

Query  7    CS  2
            CS
Sbjct  270  CS  271



>ref|XP_009760919.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nicotiana sylvestris]
Length=646

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 8/60 (13%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSHRCYDDTGFDLPLP  8
            LS+I  A++YG E+SW R +LCR+CE   G+CF +         C HRC D++G +L +P
Sbjct  218  LSNIQTALAYGFELSWKRTFLCRECE---GYCFAEGD----GFLC-HRCKDNSGMNLHIP  269



>ref|XP_009596789.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nicotiana tomentosiformis]
Length=688

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 6/62 (10%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSHRCYDDTGFD-LPL  11
            LSSIHAA++ G E+SW R + CR+CE  G  C  DD       +CS+ CY     + +PL
Sbjct  248  LSSIHAALTDGFELSWKRAFTCRECEARGAFCSEDD-----GYSCSNPCYSYWVMERIPL  302

Query  10   PC  5
            PC
Sbjct  303  PC  304



>ref|XP_009596790.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nicotiana tomentosiformis]
Length=677

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 6/62 (10%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSHRCYDDTGFD-LPL  11
            LSSIHAA++ G E+SW R + CR+CE  G  C  DD       +CS+ CY     + +PL
Sbjct  248  LSSIHAALTDGFELSWKRAFTCRECEARGAFCSEDD-----GYSCSNPCYSYWVMERIPL  302

Query  10   PC  5
            PC
Sbjct  303  PC  304



>ref|XP_009765438.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=644

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 6/62 (10%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSHRCYDDTGFD-LPL  11
            LSSI+AA++ G E+SW R  LCR+C+  G  CF DD        CS+ CY     +  PL
Sbjct  204  LSSINAALTDGFELSWKRALLCRECDVRGAFCFEDD-----GYRCSNPCYSYYVTERFPL  258

Query  10   PC  5
            PC
Sbjct  259  PC  260



>ref|XP_011084499.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Sesamum 
indicum]
Length=641

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 5/53 (9%)
 Frame = -2

Query  187  LSSIHAAMSYGVEVSWMRPYLCRDCEQSGGHCFFDDPLDPYAVTCSHRCYDDT  29
            L+SI+  ++YG E+SW R  LC +CE++ G+C     L+   ++C H C +DT
Sbjct  207  LASIYDGLAYGFELSWFR-VLCAECERTYGYC----SLEGNTISCKHYCREDT  254



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525646009952