BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c41138_g1_i1 len=931 path=[909:0-930]

Length=931
                                                                      Score     E

gb|ABB97547.1|  sporamin A precursor                                    125   2e-30   Ipomoea batatas [batate]
gb|ABY19576.1|  sporamin A precursor                                    120   1e-28   Ipomoea batatas [batate]
gb|AFR60855.1|  sporamin A                                              120   2e-28   
gb|ABB97544.1|  sporamin A precursor                                    119   2e-28   Ipomoea batatas [batate]
gb|AAB52547.1|  sporamin precursor                                      118   5e-28   Ipomoea batatas [batate]
gb|AAL55800.1|AF289060_1  sporamin                                      118   5e-28   Ipomoea batatas [batate]
sp|P14715.1|SPOR1_IPOBA  RecName: Full=Sporamin A; AltName: Full=...    118   6e-28   Ipomoea batatas [batate]
gb|AAB52548.1|  sporamin precursor                                      118   6e-28   Ipomoea batatas [batate]
sp|P10917.1|SPORA_IPOBA  RecName: Full=Sporamin A; Flags: Precursor     118   7e-28   Ipomoea batatas [batate]
gb|ABB97549.1|  sporamin A precursor                                    118   7e-28   Ipomoea batatas [batate]
gb|ABG26229.1|  sporamin A                                              118   7e-28   Ipomoea trifida
gb|ABB97543.1|  sporamin A precursor                                    117   1e-27   Ipomoea batatas [batate]
gb|ABB97545.1|  sporamin A precursor                                    117   1e-27   Ipomoea batatas [batate]
gb|AAD05567.1|  sporamin A                                              117   1e-27   Ipomoea batatas [batate]
gb|ABG26230.1|  sporamin A                                              117   1e-27   Ipomoea trifida
gb|AAA33391.1|  sporamin A precursor                                    117   1e-27   Ipomoea batatas [batate]
gb|ABG26224.1|  sporamin A                                              117   2e-27   Ipomoea leucantha
gb|ABG26235.1|  sporamin A                                              117   2e-27   Ipomoea trifida
gb|ABB90968.1|  sporamin B precursor                                    117   2e-27   Ipomoea batatas [batate]
gb|ABG26222.1|  sporamin A                                              117   2e-27   Ipomoea leucantha
gb|AFR60862.1|  sporamin B                                              116   3e-27   
gb|AFR60859.1|  sporamin B                                              115   5e-27   
gb|AFR60856.1|  sporamin A                                              115   6e-27   
gb|AFR60867.1|  sporamin B                                              115   6e-27   
gb|ABG26236.1|  sporamin A                                              115   7e-27   Ipomoea trifida
gb|ABG26232.1|  sporamin A                                              115   7e-27   Ipomoea trifida
gb|AAA33390.1|  sporamin B                                              115   8e-27   Ipomoea batatas [batate]
gb|ABG26227.1|  sporamin A                                              115   8e-27   Ipomoea leucantha
gb|AAD40288.1|  sporamin A precursor                                    115   1e-26   Ipomoea batatas [batate]
gb|AFR60865.1|  sporamin B                                              114   1e-26   
gb|ABG26238.1|  sporamin A                                              114   2e-26   Ipomoea trifida
gb|AFR60860.1|  sporamin B                                              114   2e-26   
gb|AFR60858.1|  sporamin A                                              113   3e-26   
sp|P14716.1|SPOR2_IPOBA  RecName: Full=Sporamin B; AltName: Full=...    113   3e-26   Ipomoea batatas [batate]
sp|P10965.1|SPORB_IPOBA  RecName: Full=Sporamin B; Flags: Precursor     113   3e-26   Ipomoea batatas [batate]
gb|AFR60864.1|  sporamin B                                              113   5e-26   
gb|AFR60863.1|  sporamin B                                              113   5e-26   
gb|ABG26231.1|  sporamin A                                              112   8e-26   Ipomoea trifida
gb|AAA86670.1|  preprosporamin                                          112   8e-26   Ipomoea batatas [batate]
gb|AFR60852.1|  sporamin                                                111   3e-25   
gb|ABB97542.1|  sporamin A precursor                                    109   8e-25   Ipomoea batatas [batate]
gb|AAB52549.1|  sporamin                                              80.5    2e-15   Ipomoea batatas [batate]
gb|AAB52550.1|  sporamin                                              69.7    5e-11   Ipomoea batatas [batate]
ref|XP_006372633.1|  hypothetical protein POPTR_0017s03430g           69.7    8e-11   
ref|XP_006372632.1|  hypothetical protein POPTR_0017s03420g           69.3    1e-10   
ref|XP_006372654.1|  hypothetical protein POPTR_0017s03600g           69.3    1e-10   
ref|XP_007029360.1|  Kunitz family trypsin and protease inhibitor...  67.0    6e-10   
emb|CAI77769.1|  kunitz trypsin inhibitor                             67.4    7e-10   Populus tremula [European aspen]
ref|XP_006495061.1|  PREDICTED: miraculin-like                        67.0    7e-10   
emb|CAI77768.1|  kunitz trypsin inhibitor                             67.0    7e-10   Populus tremula [European aspen]
gb|ADD51186.1|  tumor-related protein                                 67.0    8e-10   Vitis cinerea var. helleri x Vitis riparia
emb|CAI77782.1|  kunitz trypsin inhibitor                             66.6    1e-09   Populus tremula [European aspen]
emb|CAI77795.1|  kunitz trypsin inhibitor                             66.2    1e-09   Populus tremula [European aspen]
emb|CAI77786.1|  kunitz trypsin inhibitor                             65.9    2e-09   Populus tremula [European aspen]
emb|CAI77773.1|  kunitz trypsin inhibitor                             65.9    2e-09   Populus tremula [European aspen]
ref|XP_006495063.1|  PREDICTED: miraculin-like                        65.9    2e-09   
emb|CAI77803.1|  kunitz trypsin inhibitor                             65.9    2e-09   Populus tremula [European aspen]
ref|XP_006495064.1|  PREDICTED: miraculin-like                        65.5    3e-09   
emb|CAI77770.1|  kunitz trypsin inhibitor                             65.5    3e-09   Populus tremula [European aspen]
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg           65.5    3e-09   
emb|CAI77765.1|  kunitz trypsin inhibitor                             65.5    3e-09   Populus tremula [European aspen]
emb|CAI77775.1|  kunitz trypsin inhibitor                             65.5    3e-09   Populus tremula [European aspen]
emb|CAI77766.1|  kunitz trypsin inhibitor                             65.5    3e-09   Populus tremula [European aspen]
ref|XP_006372631.1|  trypsin protein inhibitor 3                      65.5    3e-09   
emb|CAI77777.1|  kunitz trypsin inhibitor                             65.5    3e-09   Populus tremula [European aspen]
gb|ACS92500.1|  Kunitz-type protease inhibitor KPI-D9                 65.5    3e-09   Populus trichocarpa x Populus nigra
emb|CAI77793.1|  kunitz trypsin inhibitor                             65.5    3e-09   Populus tremula [European aspen]
emb|CAI77790.1|  kunitz trypsin inhibitor                             65.1    4e-09   Populus tremula [European aspen]
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg           65.1    4e-09   
emb|CDP19136.1|  unnamed protein product                              65.1    4e-09   
emb|CDP21779.1|  unnamed protein product                              65.1    4e-09   
ref|XP_011046091.1|  PREDICTED: miraculin-like                        64.7    5e-09   
emb|CAI77798.1|  kunitz trypsin inhibitor                             64.7    5e-09   Populus tremula [European aspen]
ref|XP_011035402.1|  PREDICTED: 21 kDa seed protein-like              64.7    5e-09   
gb|ACS92516.1|  Kunitz-type protease inhibitor KPI-D12                64.7    5e-09   Populus trichocarpa x Populus deltoides
emb|CAI77783.1|  kunitz trypsin inhibitor                             64.7    5e-09   Populus tremula [European aspen]
emb|CAI77764.1|  kunitz trypsin inhibitor                             64.7    6e-09   Populus tremula [European aspen]
emb|CAI77774.1|  kunitz trypsin inhibitor                             64.7    6e-09   Populus tremula [European aspen]
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg           64.3    6e-09   
emb|CAI77772.1|  kunitz trypsin inhibitor                             64.7    6e-09   Populus tremula [European aspen]
ref|XP_006493433.1|  PREDICTED: miraculin-like                        64.7    6e-09   
gb|ABK96521.1|  unknown                                               64.3    6e-09   Populus trichocarpa x Populus deltoides
ref|XP_006493430.1|  PREDICTED: miraculin-like                        63.9    8e-09   
gb|AFL91226.1|  Kunitz-like protease inhibitor                        63.5    9e-09   
ref|XP_010537532.1|  PREDICTED: miraculin                             63.9    9e-09   
gb|AEK26936.1|  Kunitz-type trypsin inhibitor B3                      63.9    1e-08   
gb|ADW95389.1|  Kunitz-type trypsin inhibitor                         63.9    1e-08   
gb|ACO40080.1|  kunitz trypsin inhibitor 4                            63.2    1e-08   Populus balsamifera [balsam poplar]
ref|XP_002265965.1|  PREDICTED: miraculin                             63.5    1e-08   Vitis vinifera
emb|CAN81015.1|  hypothetical protein VITISV_025776                   63.5    1e-08   Vitis vinifera
ref|NP_001237333.1|  uncharacterized protein LOC100500648 precursor   63.5    1e-08   
ref|XP_011035403.1|  PREDICTED: 21 kDa seed protein-like              63.2    2e-08   
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg           63.2    2e-08   
gb|AFL91231.1|  Kunitz-like protease inhibitor                        62.4    2e-08   
ref|XP_002270111.1|  PREDICTED: miraculin                             62.8    2e-08   Vitis vinifera
emb|CAN65022.1|  hypothetical protein VITISV_027379                   62.8    2e-08   Vitis vinifera
emb|CAI77800.1|  kunitz trypsin inhibitor                             62.8    2e-08   Populus tremula [European aspen]
gb|ACO40078.1|  kunitz trypsin inhibitor 4                            62.4    3e-08   Populus balsamifera [balsam poplar]
gb|AFL91228.1|  Kunitz-like protease inhibitor                        62.0    3e-08   
ref|XP_007210537.1|  hypothetical protein PRUPE_ppa011653mg           62.4    3e-08   
emb|CAI77785.1|  kunitz trypsin inhibitor                             62.4    3e-08   Populus tremula [European aspen]
gb|AFR60853.1|  truncated sporamin                                    61.2    3e-08   
gb|AEK26927.1|  Kunitz-type trypsin inhibitor B4                      62.4    4e-08   
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg           62.0    4e-08   
ref|XP_010416122.1|  PREDICTED: trypsin inhibitor BvTI-like           62.0    4e-08   
gb|AFL91232.1|  Kunitz-like protease inhibitor                        61.2    5e-08   
gb|AFL91227.1|  Kunitz-like protease inhibitor                        61.2    5e-08   
gb|ACS92519.1|  Kunitz-type protease inhibitor KPI-D8                 61.6    6e-08   Populus trichocarpa x Populus nigra
emb|CBI35464.3|  unnamed protein product                              62.0    6e-08   
emb|CAN75396.1|  hypothetical protein VITISV_028636                   61.6    6e-08   Vitis vinifera
ref|XP_002266430.1|  PREDICTED: miraculin                             61.2    7e-08   Vitis vinifera
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg           61.2    8e-08   
ref|XP_002305034.2|  hypothetical protein POPTR_0004s06610g           60.8    1e-07   Populus trichocarpa [western balsam poplar]
gb|ADW95380.1|  Kunitz-type trypsin inhibitor                         61.2    1e-07   
gb|AEK26933.1|  Kunitz-type trypsin inhibitor B2                      60.8    1e-07   
gb|AFL91233.1|  Kunitz-like protease inhibitor                        60.1    1e-07   
ref|XP_004234331.1|  PREDICTED: miraculin                             60.5    1e-07   
gb|ABK01288.1|  miraculin-like protein                                60.5    2e-07   Coffea arabica [arabica coffee]
gb|ACO40133.1|  kunitz trypsin inhibitor 4                            59.7    2e-07   Populus balsamifera [balsam poplar]
gb|ACO40153.1|  kunitz trypsin inhibitor 4                            59.7    2e-07   Populus balsamifera [balsam poplar]
ref|XP_011035401.1|  PREDICTED: miraculin-like                        60.1    2e-07   
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg           60.1    2e-07   
gb|ACO40077.1|  kunitz trypsin inhibitor 4                            59.3    2e-07   Populus balsamifera [balsam poplar]
ref|XP_002305033.1|  trypsin protein inhibitor 3                      59.7    3e-07   Populus trichocarpa [western balsam poplar]
emb|CAI77825.1|  kunitz trypsin inhibitor                             59.7    3e-07   Populus tremula [European aspen]
ref|XP_010428249.1|  PREDICTED: trypsin inhibitor BvTI-like           59.3    3e-07   
ref|XP_011046090.1|  PREDICTED: miraculin-like                        59.3    4e-07   
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg           59.3    4e-07   
gb|AEK26926.1|  Kunitz-type trypsin inhibitor B1                      58.9    5e-07   
gb|ACO40082.1|  kunitz trypsin inhibitor 4                            58.5    5e-07   Populus balsamifera [balsam poplar]
emb|CAI77767.1|  kunitz trypsin inhibitor                             58.9    6e-07   Populus tremula [European aspen]
gb|ACO40086.1|  kunitz trypsin inhibitor 4                            58.2    6e-07   Populus balsamifera [balsam poplar]
emb|CAI77771.1|  kunitz trypsin inhibitor                             58.9    7e-07   Populus tremula [European aspen]
ref|XP_003534082.1|  PREDICTED: miraculin-like                        58.5    7e-07   
gb|AAQ84217.1|  Kunitz trypsin inhibitor 4                            58.5    7e-07   Populus trichocarpa x Populus deltoides
ref|XP_006493432.1|  PREDICTED: miraculin-like                        59.7    8e-07   
gb|ACO40084.1|  kunitz trypsin inhibitor 4                            57.8    9e-07   Populus balsamifera [balsam poplar]
gb|ACO40073.1|  kunitz trypsin inhibitor 4                            57.8    9e-07   Populus balsamifera [balsam poplar]
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg           58.9    1e-06   
ref|XP_011012012.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  58.2    1e-06   
gb|AEK26932.1|  Kunitz-type trypsin inhibitor C6                      57.8    1e-06   
gb|ACO40145.1|  kunitz trypsin inhibitor 4                            57.8    1e-06   Populus balsamifera [balsam poplar]
gb|ACS92509.1|  Kunitz-type protease inhibitor KPI-D2.3               58.2    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_002305032.2|  trypsin protein inhibitor 3                      58.2    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010428240.1|  PREDICTED: trypsin inhibitor BvTI-like           57.8    1e-06   
ref|NP_001241106.1|  uncharacterized protein LOC100790688 precursor   57.8    1e-06   
gb|ACO40144.1|  kunitz trypsin inhibitor 4                            57.4    1e-06   Populus balsamifera [balsam poplar]
emb|CAI77836.1|  kunitz trypsin inhibitor                             57.8    2e-06   Populus tremula [European aspen]
gb|ACO40104.1|  kunitz trypsin inhibitor 4                            56.6    2e-06   Populus balsamifera [balsam poplar]
gb|ACO40119.1|  kunitz trypsin inhibitor 4                            56.6    2e-06   Populus balsamifera [balsam poplar]
gb|ACO40154.1|  kunitz trypsin inhibitor 4                            56.6    2e-06   Populus balsamifera [balsam poplar]
sp|P80691.1|LSPI_CARPA  RecName: Full=Latex serine proteinase inh...  56.6    2e-06   Carica papaya [mamon]
gb|ACO40074.1|  kunitz trypsin inhibitor 4                            56.6    2e-06   Populus balsamifera [balsam poplar]
gb|AAN15685.1|  putative trypsin inhibitor                            57.0    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96757.1|  putative trypsin inhibitor                            56.6    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg              56.6    4e-06   
gb|KDP46945.1|  hypothetical protein JCGZ_07962                       55.8    4e-06   
gb|ACO40093.1|  kunitz trypsin inhibitor 4                            55.8    4e-06   Populus balsamifera [balsam poplar]
gb|AAG52121.1|AC010556_3  putative trypsin inhibitor; 19671-20297     56.2    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565061.1|  kunitz trypsin inhibitor 1                          56.2    4e-06   Arabidopsis thaliana [mouse-ear cress]
pdb|3S8J|A  Chain A, Crystal Structure Of A Papaya Latex Serine P...  55.8    4e-06   
ref|NP_173228.1|  kunitz family trypsin and protease inhibitor pr...  55.8    5e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KHM99732.1|  Miraculin                                             56.2    5e-06   
gb|ACO40100.1|  kunitz trypsin inhibitor 4                            55.8    5e-06   Populus balsamifera [balsam poplar]
ref|XP_006353921.1|  PREDICTED: cysteine protease inhibitor 9-like    56.2    5e-06   
emb|CAI77815.1|  kunitz trypsin inhibitor                             56.2    6e-06   Populus tremula [European aspen]
emb|CAI77814.1|  kunitz trypsin inhibitor                             55.8    6e-06   Populus tremula [European aspen]
gb|ADW95381.1|  Kunitz-type trypsin inhibitor                         55.8    6e-06   
ref|XP_002326017.2|  hypothetical protein POPTR_0019s11800g           56.2    6e-06   Populus trichocarpa [western balsam poplar]
gb|ACS92505.1|  Kunitz-type protease inhibitor KPI-E1                 55.8    6e-06   Populus trichocarpa x Populus deltoides
ref|XP_010101167.1|  hypothetical protein L484_005403                 55.5    6e-06   
ref|XP_006351546.1|  PREDICTED: miraculin-like                        55.5    7e-06   
ref|XP_007029361.1|  Kunitz family trypsin and protease inhibitor...  55.5    8e-06   
ref|XP_003534083.1|  PREDICTED: miraculin-like                        55.5    8e-06   
ref|XP_011023016.1|  PREDICTED: endogenous alpha-amylase/subtilis...  55.1    9e-06   
ref|XP_011035408.1|  PREDICTED: miraculin-like                        55.1    1e-05   
ref|XP_010428238.1|  PREDICTED: trypsin inhibitor BvTI-like           55.1    1e-05   
gb|ACO40081.1|  kunitz trypsin inhibitor 4                            54.7    1e-05   Populus balsamifera [balsam poplar]
ref|XP_010683194.1|  PREDICTED: miraculin-like                        55.1    1e-05   
gb|AAQ96377.1|  miraculin-like protein                                55.1    1e-05   Solanum palustre
emb|CAI77835.1|  kunitz trypsin inhibitor                             55.1    1e-05   Populus tremula [European aspen]
emb|CAI77808.1|  kunitz trypsin inhibitor                             55.1    1e-05   Populus tremula [European aspen]
ref|XP_011072079.1|  PREDICTED: miraculin                             55.1    1e-05   
emb|CAI77823.1|  kunitz trypsin inhibitor                             55.1    1e-05   Populus tremula [European aspen]
emb|CAI77818.1|  kunitz trypsin inhibitor                             55.1    1e-05   Populus tremula [European aspen]
sp|P13087.3|MIRA_SYNDU  RecName: Full=Miraculin; Short=MIR; Flags...  55.1    1e-05   Synsepalum dulcificum [miracle fruit]
gb|KHM99737.1|  Miraculin                                             54.7    2e-05   
gb|AFZ84561.1|  Kunitz trypsin inhibitor                              54.7    2e-05   
gb|AEK26928.1|  Kunitz-type trypsin inhibitor D2                      54.7    2e-05   
ref|XP_006441462.1|  hypothetical protein CICLE_v10022041mg           55.1    2e-05   
gb|ACO39676.1|  kunitz trypsin inhibitor 5                            53.9    2e-05   Populus balsamifera [balsam poplar]
emb|CAI77809.1|  kunitz trypsin inhibitor                             54.3    2e-05   Populus tremula [European aspen]
ref|XP_003534081.1|  PREDICTED: miraculin-like                        54.3    2e-05   
gb|ACO39684.1|  kunitz trypsin inhibitor 5                            53.9    2e-05   Populus balsamifera [balsam poplar]
ref|XP_011002518.1|  PREDICTED: sporamin A-like                       55.1    2e-05   
gb|KDP27288.1|  hypothetical protein JCGZ_21019                       53.9    2e-05   
gb|AAK84063.1|AF401200_1  trypsin inhibitor                           53.5    2e-05   Phanera variegata [mountain ebony]
gb|AFZ84560.1|  Kunitz trypsin inhibitor                              54.3    2e-05   
ref|XP_003638409.1|  Alpha-amylase/subtilisin inhibitor               53.9    3e-05   
ref|XP_011016416.1|  PREDICTED: sporamin A-like                       54.3    3e-05   
sp|P83595.1|ITRY_BAUVA  RecName: Full=Trypsin inhibitor BvTI          53.1    3e-05   Phanera variegata [mountain ebony]
ref|XP_006304577.1|  hypothetical protein CARUB_v10011616mg           53.5    3e-05   
ref|XP_006302823.1|  hypothetical protein CARUB_v10020954mg           53.9    3e-05   
gb|AFZ84559.1|  Kunitz trypsin inhibitor                              53.9    3e-05   
gb|ACS92497.1|  Kunitz-type protease inhibitor KPI-E5.1               53.9    3e-05   Populus trichocarpa x Populus deltoides
gb|AFZ84562.1|  Kunitz trypsin inhibitor                              53.5    4e-05   
emb|CAI77813.1|  kunitz trypsin inhibitor                             53.5    5e-05   Populus tremula [European aspen]
ref|XP_002309884.2|  hypothetical protein POPTR_0007s03650g           53.1    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010428237.1|  PREDICTED: miraculin-like                        53.1    5e-05   
ref|XP_009406658.1|  PREDICTED: miraculin-like                        53.1    5e-05   
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg           53.1    5e-05   
emb|CAI77830.1|  kunitz trypsin inhibitor                             53.1    6e-05   Populus tremula [European aspen]
ref|XP_010683193.1|  PREDICTED: miraculin-like                        52.8    6e-05   
ref|XP_010476950.1|  PREDICTED: miraculin-like                        52.8    6e-05   
ref|XP_002890252.1|  trypsin and protease inhibitor family protein    52.4    7e-05   
ref|XP_010683391.1|  PREDICTED: trypsin inhibitor 2-like              52.8    7e-05   
ref|XP_003548289.1|  PREDICTED: miraculin-like                        52.8    7e-05   
gb|ADW95385.1|  Kunitz-type trypsin inhibitor                         52.4    7e-05   
gb|AFK36436.1|  unknown                                               52.8    7e-05   
emb|CDX96746.1|  BnaA08g22890D                                        52.4    8e-05   
ref|XP_007036748.1|  21 kDa seed protein, putative                    52.8    8e-05   
gb|AAV41234.1|  putative 21 kDa trypsin inhibitor                     52.8    8e-05   Theobroma microcarpum
ref|XP_006371005.1|  truncated Kunitz trypsin inhibitor family pr...  52.4    9e-05   
gb|ABX76298.1|  sexual organ expressed protein                        53.1    9e-05   Nicotiana alata [flowering tobacco]
gb|AEK26923.1|  Kunitz-type trypsin inhibitor C7                      52.0    9e-05   
ref|XP_004299457.1|  PREDICTED: miraculin-like                        52.4    9e-05   
ref|XP_002309881.2|  hypothetical protein POPTR_0007s03620g           52.0    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_004235491.1|  PREDICTED: cysteine protease inhibitor 8-like    52.8    1e-04   
ref|XP_011023019.1|  PREDICTED: endogenous alpha-amylase/subtilis...  52.0    1e-04   
gb|AAQ84218.1|  Kunitz trypsin inhibitor 5                            52.0    1e-04   Populus trichocarpa x Populus deltoides
ref|XP_003620184.1|  Pathogen-inducible trypsin-inhibitor-like pr...  52.0    1e-04   
gb|AFL91229.1|  Kunitz-like protease inhibitor                        51.2    1e-04   
ref|XP_003620169.1|  Kunitz-type trypsin inhibitor alpha chain        52.0    1e-04   
emb|CDX83886.1|  BnaC08g17590D                                        51.6    1e-04   
ref|XP_006478134.1|  PREDICTED: miraculin-like                        52.4    1e-04   
ref|XP_008778295.1|  PREDICTED: miraculin                             51.6    1e-04   
ref|XP_010918417.1|  PREDICTED: miraculin-like                        51.6    2e-04   
ref|XP_003534100.1|  PREDICTED: miraculin-like                        52.0    2e-04   
gb|ADW95376.1|  Kunitz-type trypsin inhibitor                         51.6    2e-04   
ref|XP_010416116.1|  PREDICTED: miraculin-like                        51.6    2e-04   
emb|CAC40756.1|  putative miraculin                                   51.6    2e-04   Atropa belladonna [deadly nightshade]
emb|CDQ51987.1|  alpha amylase/subtilisin inhibitor                   51.6    2e-04   
emb|CDP20822.1|  unnamed protein product                              51.2    2e-04   
ref|XP_009608866.1|  PREDICTED: miraculin-like                        51.2    2e-04   
sp|P81726.1|ICI2_CANLI  RecName: Full=Subtilisin inhibitor CLSI-I...  50.8    2e-04   Canavalia lineata
ref|XP_009777240.1|  PREDICTED: miraculin-like                        51.2    2e-04   
gb|AFL91234.1|  Kunitz-like protease inhibitor                        50.4    2e-04   
sp|P83594.1|IFXA_BAUUN  RecName: Full=Factor Xa inhibitor BuXI        50.4    3e-04   Bauhinia ungulata
ref|XP_004137639.1|  PREDICTED: miraculin-like                        51.2    3e-04   
gb|ACO39854.1|  kunitz trypsin inhibitor                              50.8    3e-04   Populus balsamifera [balsam poplar]
gb|ACO39842.1|  kunitz trypsin inhibitor                              50.4    3e-04   Populus balsamifera [balsam poplar]
gb|AFZ84563.1|  Kunitz trypsin inhibitor                              50.8    4e-04   
emb|CDO98560.1|  unnamed protein product                              50.8    4e-04   
emb|CAI77832.1|  kunitz trypsin inhibitor                             50.8    4e-04   Populus tremula [European aspen]
ref|XP_009105982.1|  PREDICTED: subtilisin inhibitor CLSI-II-like     50.4    4e-04   
gb|AHJ25677.1|  Kunitz-type trypsin inhibitor                         50.4    4e-04   
emb|CAI77811.1|  kunitz trypsin inhibitor                             50.1    6e-04   Populus tremula [European aspen]
emb|CDP16462.1|  unnamed protein product                              50.1    6e-04   
gb|ACS92520.1|  Kunitz-type protease inhibitor KPI-F9                 49.7    7e-04   Populus trichocarpa x Populus deltoides
dbj|BAC55863.1|  mwti1b                                               49.7    7e-04   
emb|CDY59714.1|  BnaC02g46470D                                        50.1    7e-04   
ref|XP_009630289.1|  PREDICTED: miraculin-like                        50.1    8e-04   
emb|CAI77812.1|  kunitz trypsin inhibitor                             49.7    8e-04   Populus tremula [European aspen]
gb|AFL91230.1|  Kunitz-like protease inhibitor                        48.9    8e-04   
ref|XP_008238584.1|  PREDICTED: miraculin-like                        49.7    8e-04   
gb|ACO39903.1|  kunitz trypsin inhibitor                              49.3    8e-04   Populus balsamifera [balsam poplar]
gb|ACO39846.1|  kunitz trypsin inhibitor                              49.3    9e-04   Populus balsamifera [balsam poplar]
emb|CAI77810.1|  kunitz trypsin inhibitor                             49.7    0.001   Populus tremula [European aspen]
gb|ACO39860.1|  kunitz trypsin inhibitor                              49.3    0.001   Populus balsamifera [balsam poplar]



>gb|ABB97547.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97548.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 105/193 (54%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +   G   G G +LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEIRAGGNYYMVSAIWGVG-GGGPRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  HMLRTTRLALSNS  208



>gb|ABY19576.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 107/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++QD   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T +AL+NS
Sbjct  196  HMLRTTRIALSNS  208



>gb|AFR60855.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 107/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
              +  T LAL+NS
Sbjct  196  HMSRTTRLALSNS  208



>gb|ABB97544.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 107/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++QD   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T +AL+NS
Sbjct  196  HMLRTTRIALSNS  208



>gb|AAB52547.1| sporamin precursor [Ipomoea batatas]
 gb|ABB97540.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97541.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97546.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  HMLRTTRLALSNS  208



>gb|AAL55800.1|AF289060_1 sporamin [Ipomoea batatas]
Length=219

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PLMRTTRLALSNS  208



>sp|P14715.1|SPOR1_IPOBA RecName: Full=Sporamin A; AltName: Full=Clone PIM0335; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33197.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 105/193 (54%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C  D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  HMLRTTRLALSNS  208



>gb|AAB52548.1| sporamin precursor [Ipomoea batatas]
Length=219

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMLRTTRLALSNS  208



>sp|P10917.1|SPORA_IPOBA RecName: Full=Sporamin A; Flags: Precursor [Ipomoea batatas]
 emb|CAA31862.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 103/191 (54%), Gaps = 15/191 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+     G A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVYAILG-ACGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D    C +D++V   +L  GD +  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+ L+KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQYDSASGQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFKD  195

Query  604  WATGNTHLALT  636
                 T LAL+
Sbjct  196  PMLRTTRLALS  206



>gb|ABB97549.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97550.1| sporamin A precursor [Ipomoea batatas]
 gb|AFR60854.1| sporamin [Ipomoea batatas]
Length=219

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMLRTTRLALSNS  208



>gb|ABG26229.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 105/193 (54%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V    L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNGLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLRV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMLRTTRLALSNS  208



>gb|ABB97543.1| sporamin A precursor [Ipomoea batatas]
Length=199

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 104/188 (55%), Gaps = 13/188 (7%)
 Frame = +1

Query  112  AALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAP  273
            +  +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA LD  + 
Sbjct  3    SRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHLDMMSK  61

Query  274  CPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKLSWKVE  438
            C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + ++W ++
Sbjct  62   CASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNVNWGIQ  120

Query  439  QDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGN  618
             D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D     
Sbjct  121  HDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRT  180

Query  619  THLALTNS  642
            T LAL+NS
Sbjct  181  TRLALSNS  188



>gb|ABB97545.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D+++   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIISPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMLRTTRLALSNS  208



>gb|AAD05567.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 104/191 (54%), Gaps = 15/191 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YYL +   G A G G++LA L
Sbjct  20   PAHSG--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYLVSAILG-ACGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D    C +D++V   +L  GD +  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D    + L+KAGE+V + +N F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQYDSASVQSLLKAGESVSDKTNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFND  195

Query  604  WATGNTHLALT  636
                 T LAL+
Sbjct  196  PMLRTTRLALS  206



>gb|ABG26230.1| sporamin A [Ipomoea trifida]
 gb|AFR60857.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMLRTTRLALSNS  208



>gb|AAA33391.1| sporamin A precursor [Ipomoea batatas]
 gb|ABG26237.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMLRTTRLALSNS  208



>gb|ABG26224.1| sporamin A [Ipomoea leucantha]
 gb|ABG26226.1| sporamin A [Ipomoea leucantha]
 gb|ABG26228.1| sporamin A [Ipomoea leucantha]
 gb|ABG26233.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPPSSQTPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DTMSKCASDVIVSPNDLDNGDPITITPAAADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMLRTTRLALSNS  208



>gb|ABG26235.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPSSSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D   + ++ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPATADPESSVIMTSTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W +  D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIRHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMMRTTRLALSNS  208



>gb|ABB90968.1| sporamin B precursor [Ipomoea batatas]
Length=216

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 110/194 (57%), Gaps = 14/194 (7%)
 Frame = +1

Query  91   AAPPHSAAALDPIRLPTAGQ------PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLA  252
            A P HS    +PIRL  A +      PV+D++G  + AG  YY+ +   G A G G++L 
Sbjct  16   ANPAHSK--FNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG-AGGGGLRLV  72

Query  253  KLDFTA-PCPNDIVVPS--FNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDK  420
            +LD ++  C +D++V    F+ GDP+  TPA  +   V+ STFQT  F  A       + 
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCV-NN  131

Query  421  LSWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYL  600
            ++W ++ D E G+  VKAGE V + SN F+IE V+     YK++YC    + C++VGRY 
Sbjct  132  VNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYY  191

Query  601  DWATGNTHLALTNS  642
            D  T  T LAL+N+
Sbjct  192  DPLTRATRLALSNT  205



>gb|ABG26222.1| sporamin A [Ipomoea leucantha]
 gb|ABG26223.1| sporamin A [Ipomoea leucantha]
 gb|ABG26225.1| sporamin A [Ipomoea leucantha]
 gb|ABG26234.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 107/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPPSSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TP+  D   + ++ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMLRTTRLALSNS  208



>gb|AFR60862.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 110/194 (57%), Gaps = 14/194 (7%)
 Frame = +1

Query  91   AAPPHSAAALDPIRLPTAGQ------PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLA  252
            A P HS    +PIRL  A +      PV+D++G  + AG  YY+ +   G A G G++L 
Sbjct  16   ANPAHSK--FNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG-AGGGGLRLV  72

Query  253  KLDFTA-PCPNDIVVPS--FNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDK  420
            +LD ++  C +D++V    F+ GDP+  TPA  +   V+ STFQT  F  A       + 
Sbjct  73   RLDSSSNECASDVMVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCV-NN  131

Query  421  LSWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYL  600
            ++W ++ D E G+  VKAGE V + SN F+IE V+     YK++YC    + C++VGRY 
Sbjct  132  VNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYY  191

Query  601  DWATGNTHLALTNS  642
            D  T  T LAL+N+
Sbjct  192  DPLTRATRLALSNT  205



>gb|AFR60859.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 109/192 (57%), Gaps = 14/192 (7%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQ------PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRL  A +      PV+D++G  + AG  YY+ +   G A G G++L +L
Sbjct  18   PAHSK--FNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG-AGGGGLRLVRL  74

Query  259  DFTA-PCPNDIVVPS--FNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLS  426
            D ++  C +D++V    F+ GDP+  TPA  +   V+ STFQT  F  A       + ++
Sbjct  75   DSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCV-NNVN  133

Query  427  WKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDW  606
            W ++ D E G+  VKAGE V + SN F+IE V+     YK++YC    + C++VGRY D 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  607  ATGNTHLALTNS  642
             T  T LAL+N+
Sbjct  194  LTRATRLALSNT  205



>gb|AFR60856.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 105/191 (55%), Gaps = 15/191 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++QD   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQQDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFKD  195

Query  604  WATGNTHLALT  636
                 T LAL+
Sbjct  196  PMLRTTRLALS  206



>gb|AFR60867.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 109/192 (57%), Gaps = 14/192 (7%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQ------PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRL  A +      PV+D++G  + AG  YY+ +   G A G G++L +L
Sbjct  18   PAHSK--FNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG-AGGGGLRLVRL  74

Query  259  DFTA-PCPNDIVVPS--FNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLS  426
            D ++  C +D+VV    F+ GDP+  TPA  +   V+ STFQT  F  A       + ++
Sbjct  75   DSSSNECASDVVVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCV-NNVN  133

Query  427  WKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDW  606
            W ++ D E G+  VKAGE V + SN F+IE V+     YK++YC    + C++VGRY D 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  607  ATGNTHLALTNS  642
             T  T LAL+N+
Sbjct  194  LTRATRLALSNT  205



>gb|ABG26236.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 104/186 (56%), Gaps = 13/186 (7%)
 Frame = +1

Query  118  LDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCP  279
             +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA LD  + C 
Sbjct  25   FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHLDTMSKCA  83

Query  280  NDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKLSWKVEQD  444
            +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + ++W+++ D
Sbjct  84   SDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCV-NNVNWRIQHD  142

Query  445  DEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTH  624
               G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D     T 
Sbjct  143  SASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTR  202

Query  625  LALTNS  642
            LAL++S
Sbjct  203  LALSDS  208



>gb|ABG26232.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL++S
Sbjct  196  PMLRTTRLALSDS  208



>gb|AAA33390.1| sporamin B [Ipomoea batatas]
 gb|AFR60866.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 109/192 (57%), Gaps = 14/192 (7%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQ------PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRL  A +      PV+D++G  + AG  YY+ +   G A G G++L +L
Sbjct  18   PAHSK--FNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG-AGGGGLRLVRL  74

Query  259  DFTA-PCPNDIVVPS--FNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLS  426
            D ++  C +D++V    F+ GDP+  TPA  +   V+ STFQT  F  A       + ++
Sbjct  75   DSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCV-NNVN  133

Query  427  WKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDW  606
            W ++ D E G+  VKAGE V + SN F+IE V+     YK++YC    + C++VGRY D 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  607  ATGNTHLALTNS  642
             T  T LAL+N+
Sbjct  194  LTRATRLALSNT  205



>gb|ABG26227.1| sporamin A [Ipomoea leucantha]
Length=219

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPPPSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D+ V   +L  GDP+  TP+  D   + ++ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVTVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMLRTTRLALSNS  208



>gb|AAD40288.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 103/191 (54%), Gaps = 15/191 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +   G A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAILG-ACGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D    C +D++V   +L  GD +  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D    + L+KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFND  195

Query  604  WATGNTHLALT  636
                 T LA++
Sbjct  196  PMLRTTRLAIS  206



>gb|AFR60865.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 109/192 (57%), Gaps = 14/192 (7%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQ------PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRL  A +      PV+D++G  + AG  YY+ +   G A G G++L +L
Sbjct  18   PTHSK--FNPIRLRPAHETASSETPVLDINGDEVRAGENYYMVSAIWG-AGGGGLRLVRL  74

Query  259  DFTA-PCPNDIVVPS--FNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLS  426
            D ++  C +D++V    F+ GDP+  TPA  +   V+ ST+QT  F  A       + ++
Sbjct  75   DSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTYQTFRFNIATNKLCV-NNVN  133

Query  427  WKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDW  606
            W ++ D E G+  VKAGE V + SN F+IE V+     YK++YC    + C++VGRY D 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  607  ATGNTHLALTNS  642
             T  T LAL+N+
Sbjct  194  LTRATRLALSNT  205



>gb|ABG26238.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 105/193 (54%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+  T+QT  F  A       + +
Sbjct  77   DTMSKCASDVIVSPNDLDDGDPITITPAAADPESTVVMALTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCRFGSDKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMLRTTRLALSNS  208



>gb|AFR60860.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 110/194 (57%), Gaps = 14/194 (7%)
 Frame = +1

Query  91   AAPPHSAAALDPIRLPTAGQ------PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLA  252
            A P +S    +PIRL  A +      PV+D++G  + AG  YY+ +   G A G G++L 
Sbjct  16   ANPAYSK--FNPIRLRPARETASSETPVLDINGDEVRAGENYYIVSAIWG-AGGGGLRLV  72

Query  253  KLDFTA-PCPNDIVVPS--FNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDK  420
            +LD ++  C +D++V    F+ GDP+  TPA  +   V+ STFQT  F  A       + 
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCV-NN  131

Query  421  LSWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYL  600
            ++W ++ D E G+  VKAGE V + SN F+IE V+     YK++YC    + C++VGRY 
Sbjct  132  VNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYY  191

Query  601  DWATGNTHLALTNS  642
            D  T  T LAL+N+
Sbjct  192  DPLTRATRLALSNT  205



>gb|AFR60858.1| sporamin A [Ipomoea batatas]
Length=216

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 109/192 (57%), Gaps = 14/192 (7%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQ------PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRL  A +      PV+D++G  + AG  YY+ +   G A G G++L +L
Sbjct  18   PAHSK--FNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG-AGGGGLRLVRL  74

Query  259  DFTA-PCPNDIVVPS--FNLGDPVVFTPAVKD-NFVIESTFQTISFTaaaaaeecaDKLS  426
            D ++  C +D++V    F+ GDP+  TPA  +   V+ ST+QT  F  A       + ++
Sbjct  75   DSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCV-NNVN  133

Query  427  WKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDW  606
            W ++ D E G+  VKAGE V + SN F+IE V+     YK++YC    + C++VGRY D 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  607  ATGNTHLALTNS  642
             T  T LAL+N+
Sbjct  194  LTRATRLALSNT  205



>sp|P14716.1|SPOR2_IPOBA RecName: Full=Sporamin B; AltName: Full=Clone PIM0535; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33198.1| unnamed protein product [Ipomoea batatas]
Length=216

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 108/191 (57%), Gaps = 14/191 (7%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQ------PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRL  A +      PV+D++G  + AG  YY+ +   G A G G++L +L
Sbjct  18   PTHSK--FNPIRLRPAHETASSETPVLDINGDEVRAGENYYMVSAIWG-AGGGGLRLVRL  74

Query  259  DFTA-PCPNDIVVPS--FNLGDPVVFTPAVKD-NFVIESTFQTISFTaaaaaeecaDKLS  426
            D ++  C +D++V    F+ GDP+  TPA  +   V+ ST+QT  F  A       + ++
Sbjct  75   DSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCV-NNVN  133

Query  427  WKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDW  606
            W ++ D E G+  VKAGE V + SN F+IE V+     YK++YC    + C++VGRY D 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  607  ATGNTHLALTN  639
             T  T LAL+N
Sbjct  194  LTRATRLALSN  204



>sp|P10965.1|SPORB_IPOBA RecName: Full=Sporamin B; Flags: Precursor [Ipomoea batatas]
 emb|CAA31863.1| unnamed protein product [Ipomoea batatas]
 gb|AFR60861.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 109/192 (57%), Gaps = 14/192 (7%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQ------PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRL  A +      PV+D++G  + AG  YY+ +   G A G G++L +L
Sbjct  18   PAHSK--FNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG-AGGGGLRLVRL  74

Query  259  DFTA-PCPNDIVVPS--FNLGDPVVFTPAVKD-NFVIESTFQTISFTaaaaaeecaDKLS  426
            D ++  C +D++V    F+ GDP+  TPA  +   V+ ST+QT  F  A       + ++
Sbjct  75   DSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCV-NNVN  133

Query  427  WKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDW  606
            W ++ D E G+  VKAGE V + SN F+IE V+     YK++YC    + C++VGRY D 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  607  ATGNTHLALTNS  642
             T  T LAL+N+
Sbjct  194  LTRATRLALSNT  205



>gb|AFR60864.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 108/192 (56%), Gaps = 14/192 (7%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQ------PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRL  A +      PV+D++G  + AG  YY+ +   G A G G++L +L
Sbjct  18   PAHSK--FNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG-AGGGGLRLVRL  74

Query  259  DFTA-PCPNDIVVPS--FNLGDPVVFTPAVKD-NFVIESTFQTISFTaaaaaeecaDKLS  426
            D ++  C +D++V    F+ GDP   TPA  +   V+ ST+QT  F  A       + ++
Sbjct  75   DSSSNECASDVIVSRSDFDNGDPTTITPADPEATVVMPSTYQTFRFNIATNKLCV-NNVN  133

Query  427  WKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDW  606
            W ++ D E G+  VKAGE V + SN F+IE V+     YK++YC    + C++VGRY D 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEAVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  607  ATGNTHLALTNS  642
             T  T LAL+N+
Sbjct  194  LTRATRLALSNT  205



>gb|AFR60863.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 108/192 (56%), Gaps = 14/192 (7%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQ------PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRL  A +      PV+D++G  + AG  YY+ +   G A G G++L +L
Sbjct  18   PAHSK--FNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG-AGGGGLRLVRL  74

Query  259  DFTA-PCPNDIVVPS--FNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLS  426
            D ++  C +D++V    F+ GDP+   PA  +   V+ STFQT  F+         + ++
Sbjct  75   DSSSNECASDVIVSRSDFDNGDPITIRPADPESTVVMPSTFQTFRFSIPTNKLCV-NNVN  133

Query  427  WKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDW  606
            W ++ D E G+  VKAGE V + SN F+IE V+     YK++YC    + C++VGRY D 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  607  ATGNTHLALTNS  642
             T  T LAL+N+
Sbjct  194  LTRATRLALSNT  205



>gb|ABG26231.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 105/193 (54%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE  D     YKLTYC    D C++VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVDDANLNFYKLTYCQFGSDKCHNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMLRTTRLALSNS  208



>gb|AAA86670.1| preprosporamin [Ipomoea batatas]
Length=219

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 104/193 (54%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIANNKLCVKN-V  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +K GE V + SN F+IE VD     YKLTYC    D CY+ GR+ D
Sbjct  136  NWGIQHDSASGQYFLKDGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNCGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  PMLRTTRLALSNS  208



>gb|AFR60852.1| sporamin [Ipomoea batatas]
Length=219

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 104/191 (54%), Gaps = 15/191 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPPSSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPATADPEATVVMTSTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D    + L+KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFND  195

Query  604  WATGNTHLALT  636
                 T LAL+
Sbjct  196  PMLRTTRLALS  206



>gb|ABB97542.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 105/193 (54%), Gaps = 15/193 (8%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++L  L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLGHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F  A       + +
Sbjct  77   DMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNV  135

Query  424  SWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            +W ++ D   G+  +KAGE V + SN F+IE VD     YKLTYC    D CY+VGR+ D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGADKCYNVGRFHD  195

Query  604  WATGNTHLALTNS  642
                 T LAL+NS
Sbjct  196  HMLRTTRLALSNS  208



>gb|AAB52549.1| sporamin [Ipomoea batatas]
Length=121

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 60/111 (54%), Gaps = 4/111 (4%)
 Frame = +1

Query  319  VVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVE  489
            +  TPA  D     V+ ST+QT  F  A       + ++W ++ D   G+  +KAGE V 
Sbjct  1    ITITPATADPESTVVMASTYQTFRFNIATNKLCV-NNVNWGIQHDSASGQYFLKAGEFVS  59

Query  490  NVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTHLALTNS  642
            + SN F+IE VD     YKLTYC    D CY+VGR+ D     T LAL+NS
Sbjct  60   DNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDHMLRTTRLALSNS  110



>gb|AAB52550.1| sporamin [Ipomoea batatas]
Length=171

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
 Frame = +1

Query  352  VIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVENVSNLFRIEPVDIG  531
            V+ ST+QT  F  A       + ++W ++ D    + L+KAGE V + SN F+IE VD  
Sbjct  65   VMASTYQTFRFNIATNKLCV-NNVNWGIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDAN  123

Query  532  PQIYKLTYCPRDEDNCYDVGRYLDWATGNTHLALTN  639
               YKLTYC    D CY+VGR+ D     T LAL++
Sbjct  124  LNFYKLTYCLFGSDKCYNVGRFKDPMLRTTRLALSS  159



>ref|XP_006372633.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
 gb|ERP50430.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
Length=206

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 86/179 (48%), Gaps = 23/179 (13%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A +PV+DV GK+L  G+ YY+      R RG G+K+A       CP D+V   +    G 
Sbjct  28   APEPVLDVTGKILRTGTSYYILPVI--RGRGGGLKMAS-TVRRTCPLDVVQDRYEASNGL  84

Query  316  PVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV--  486
            P+ FTP   K   V   T   I F+   AA  C    +WK++  DE+ +Q     + V  
Sbjct  85   PLKFTPVNTKKGVVRVHTDLNIRFS---AASICHQSTAWKLDNYDEWTKQWFVTTDGVEG  141

Query  487  ----ENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
                E  +N F+IE  +     YKL +CP    +    C D+G Y+D A G   LALTN
Sbjct  142  NPGPETTNNWFKIEKFE---DKYKLVFCPTVCQHCKVMCKDIGIYVD-AKGVRRLALTN  196



>ref|XP_006372632.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
 gb|ERP50429.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
Length=206

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 86/179 (48%), Gaps = 23/179 (13%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A +PV+DV GK+L  G+ YY+      R RG G+K+A       CP D+V   +    G 
Sbjct  28   APEPVLDVTGKILRIGTSYYILPVI--RGRGGGLKMAS-TVRRTCPLDVVQDRYEASNGL  84

Query  316  PVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV--  486
            P+ FTP   K   V   T   I F+   AA  C    +WK++  DE+ +Q     + V  
Sbjct  85   PLKFTPVNTKKGVVRVHTDLNIRFS---AASICHQSTAWKLDNYDEWTKQWFVTTDGVEG  141

Query  487  ----ENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
                E  +N F+IE  +     YKL +CP    +    C D+G Y+D A G   LALTN
Sbjct  142  NPGPETTNNWFKIEKFE---DKYKLVFCPTVCQHCKVMCKDIGIYVD-AKGVRRLALTN  196



>ref|XP_006372654.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
 gb|ERP50451.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
Length=206

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 85/179 (47%), Gaps = 23/179 (13%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A +PV+DV GK+L  G+ YY+      R RG G+K+A       CP D+V   +    G 
Sbjct  28   APEPVLDVTGKILRTGTSYYILPVI--RGRGGGLKMAS-TVRRTCPLDVVQDRYEASNGL  84

Query  316  PVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV--  486
            P+ FTP   K   V   T   I F+   A   C    +WK++  DE+ +Q     + V  
Sbjct  85   PLKFTPVNTKKGVVRVHTDLNIRFS---AGSICHQSTAWKLDNYDEWTKQWFVTTDGVEG  141

Query  487  ----ENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
                E  +N F+IE  +     YKL +CP    +    C D+G Y+D A G   LALTN
Sbjct  142  NPGPETTNNWFKIEKFE---DKYKLVFCPTVCQHCKVMCKDIGIYVD-AKGVRRLALTN  196



>ref|XP_007029360.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
 gb|EOY09862.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
Length=195

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 85/179 (47%), Gaps = 24/179 (13%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGD--  315
            A  PV+D+ GK L  G++YY+   F  R RG G+ LA       CP D+V     + D  
Sbjct  18   APDPVLDISGKKLRTGTDYYILPVF--RGRGGGLTLASTG-NESCPLDVVQEQLEVSDGL  74

Query  316  PVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL------VKA  474
            PV F+P  +K   V  ST Q I F+AA    +      WK++  D+  RQ       V+ 
Sbjct  75   PVTFSPVNIKKGVVRVSTDQNIKFSAATICVQPT---LWKLDSFDDSTRQWFVTTGGVEG  131

Query  475  GEAVENVSNLFRIEPVDIGPQIYKLTYCPRDED----NCYDVGRYLDWATGNTHLALTN  639
                E + N F+IE  +     YKL +CP   D     C DVG ++D   G   LAL++
Sbjct  132  NPGRETIDNWFKIEKYE---DDYKLVFCPTVCDFCKVMCRDVGVFID--GGVRRLALSD  185



>emb|CAI77769.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77787.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 94/192 (49%), Gaps = 29/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEKA--GVLGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  192

Query  646  ESLDNSLIVFKE  681
            + L   L+VFK+
Sbjct  193  DKLSPFLVVFKK  204



>ref|XP_006495061.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 88/185 (48%), Gaps = 23/185 (12%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP--  297
            P+R   +  PV+D+ GK L AGS+YY+      + RG G+ LA       CP D+V    
Sbjct  22   PVRGNASPDPVLDIAGKQLRAGSKYYILP--VTKGRGGGLTLAGRSNNKTCPLDVVQEQH  79

Query  298  SFNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVK  471
            SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D  FG+ LV 
Sbjct  80   SFRNGLPVTFSPVNPKKGVVRESTDLNIKF---DAATSCAQSTVWKLDNFDAAFGQWLVT  136

Query  472  AGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTH  624
             G    N     + N F+IE    G   YKL YCP         C DVG +++   G   
Sbjct  137  TGGVEGNPGPRTMRNWFKIEKF-FGD--YKLVYCPSVCNFCRGLCRDVGIFIN--GGVRR  191

Query  625  LALTN  639
            LAL++
Sbjct  192  LALSD  196



>emb|CAI77768.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 93/191 (49%), Gaps = 26/191 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVSATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F+   A +  +    WK+++  + E  R +   GE    
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQRLVTTGGEEGNP  139

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNSTE  648
              +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + ++
Sbjct  140  GCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLSD  194

Query  649  SLDNSLIVFKE  681
             L   L++FK+
Sbjct  195  KLSPFLVLFKK  205



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 89/195 (46%), Gaps = 29/195 (15%)
 Frame = +1

Query  91   AAPPHSAAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTA  270
            A  P S AA       +A  PV+D +GK L +G +YY+   F  R RG G+ LA      
Sbjct  16   AVKPFSVAA------ESAPDPVLDTEGKKLRSGVDYYILPVF--RGRGGGLTLASTG-NE  66

Query  271  PCPNDIVVPSFNL--GDPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ  441
             CP D+V     +  G P+ FTP      VI  ST   I F+A+    +      WK+E 
Sbjct  67   TCPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTICVQST---LWKLEY  123

Query  442  DDEFGRQLVKAG-----EAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCY----DVGR  594
            D+  G++ V  G        E + N F+IE  D     YKL +CP   D C     D+G 
Sbjct  124  DESSGQRFVTTGGVEGNPGRETLDNWFKIEKYD---DDYKLVFCPTVCDFCKPVCGDIGI  180

Query  595  YLDWATGNTHLALTN  639
            Y+    G   LAL++
Sbjct  181  YIQ--NGYRRLALSD  193



>emb|CAI77782.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77794.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 94/192 (49%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L+VFK+
Sbjct  194  DKLSPFLVVFKK  205



>emb|CAI77795.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 94/192 (49%), Gaps = 29/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVSATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEKA--GVLGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  192

Query  646  ESLDNSLIVFKE  681
            + L   L+VFK+
Sbjct  193  DKLSPFLVVFKK  204



>emb|CAI77786.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (49%), Gaps = 29/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEKA--GVLGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  192

Query  646  ESLDNSLIVFKE  681
            + L   L++FK+
Sbjct  193  DKLSPFLVLFKK  204



>emb|CAI77773.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (49%), Gaps = 29/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEKA--GVLGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  192

Query  646  ESLDNSLIVFKE  681
            + L   L++FK+
Sbjct  193  DKLSPFLVLFKK  204



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 87/185 (47%), Gaps = 23/185 (12%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP--  297
            P+R   +  PV+D+ GK L AGS+YY+      + RG G+ LA       CP D+V    
Sbjct  22   PVRGNASPDPVLDIAGKQLRAGSKYYILP--VTKGRGGGLTLAGRSNNKTCPLDVVQEQH  79

Query  298  SFNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVK  471
            SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D  FG+ LV 
Sbjct  80   SFRNGLPVTFSPVNPKKGVVRESTDLNIKF---DAATSCAQSTVWKLDNFDTAFGQWLVT  136

Query  472  AGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTH  624
             G    N     + N F+IE        YKL +CP         C DVG +++   G   
Sbjct  137  TGGVEGNPGPRTMRNWFKIEKFY---GDYKLVFCPSVCNFCRGLCRDVGIFIN--GGVRR  191

Query  625  LALTN  639
            LAL++
Sbjct  192  LALSD  196



>emb|CAI77803.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 94/192 (49%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVSATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L+VFK+
Sbjct  194  DKLSPFLVVFKK  205



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 87/185 (47%), Gaps = 23/185 (12%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP--  297
            P++      PV+D+ GK L AGS+YY+      + RG G+ LA       CP D+V    
Sbjct  22   PVKGNAQPDPVLDISGKQLRAGSKYYILP--VTKGRGGGLTLAGRSNNKTCPVDVVQEQH  79

Query  298  SFNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVK  471
            SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D  FG+ LV 
Sbjct  80   SFKNGFPVTFSPVNPKKGVVRESTDLNIKF---DAATSCAQSTVWKLDNFDAAFGQWLVT  136

Query  472  AGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTH  624
             G    N     + N F+IE    G   YKL YCP         C DVG +++   G   
Sbjct  137  TGGVEGNPGPRTMRNWFKIEKF-FGD--YKLVYCPSVCNFCRGLCRDVGIFIN--GGVRR  191

Query  625  LALTN  639
            LAL++
Sbjct  192  LALSD  196



>emb|CAI77770.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (49%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFETNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L++FK+
Sbjct  194  DKLSPFLVLFKK  205



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 87/185 (47%), Gaps = 23/185 (12%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP--  297
            P+R   +  PV+D+ GK L AGS+YY+      + RG G+ LA       CP D+V    
Sbjct  22   PVRGNASADPVLDIAGKQLRAGSKYYILP--VTKGRGGGLTLAGRSNNKTCPVDVVQEQH  79

Query  298  SFNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVK  471
            SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D   G+ LV 
Sbjct  80   SFRNGLPVTFSPVNPKKGVVRESTDINIKFD---AATSCAQSTVWKLDNFDAAIGQWLVT  136

Query  472  AGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTH  624
             G    N     + N F+IE    G   YKL YCP         C DVG +++   G   
Sbjct  137  TGGVEGNPGPRTMRNWFKIEKF-FGD--YKLVYCPSVCNFCRGLCRDVGIFIN--GGVRR  191

Query  625  LALTN  639
            LAL++
Sbjct  192  LALSD  196



>emb|CAI77765.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77792.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77796.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77797.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77801.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (49%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L++FK+
Sbjct  194  DKLSPFLVLFKK  205



>emb|CAI77775.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (49%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L++FK+
Sbjct  194  DKLSPFLVLFKK  205



>emb|CAI77766.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 93/192 (48%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +   N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFINWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFETNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L+VFK+
Sbjct  194  DKLSPFLVVFKK  205



>ref|XP_006372631.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ERP50428.1| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=209

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (47%), Gaps = 25/183 (14%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A +PV+D+DG+ L+AG+EYY+   F  R RG G+ +A       CP  +V     +  G 
Sbjct  24   AAEPVLDIDGEKLVAGTEYYILPVF--RGRGGGITMA--SNKTSCPLAVVQDRLEVSKGL  79

Query  316  PVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVE  489
            P+ FTPA  D    ++ ST   I F    A   C     WK+ +      Q   +   VE
Sbjct  80   PLTFTPAADDKKGVILVSTDLNIKF---LAKTTCPQSTVWKITKSSNSKVQWFVSTGGVE  136

Query  490  ------NVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
                   V+N F+IE  D     YK+ +CP    N    C D+G Y++   G   L+L++
Sbjct  137  GNPGFNTVTNWFQIEKAD---DDYKIVFCPTKVCNCGVLCRDIGIYIE-DNGTRTLSLSD  192

Query  640  STE  648
            + +
Sbjct  193  ALQ  195



>emb|CAI77777.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (49%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L++FK+
Sbjct  194  DKLSPFLVLFKK  205



>gb|ACS92500.1| Kunitz-type protease inhibitor KPI-D9 [Populus trichocarpa x 
Populus nigra]
Length=211

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 96/191 (50%), Gaps = 28/191 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G ARG  V          CP+D++  S +   G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWG-ARGGDVSAT----NKTCPDDVIKYSSDRLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  139

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTNSTE  648
             ++ ++N F+IE   IG   YKL  CP D  +    C D+G Y +    N    + + ++
Sbjct  140  GIDTLTNWFKIEKAGIG---YKLVSCPEDICHCGVLCRDIGIYRE----NNGRKILSLSD  192

Query  649  SLDNSLIVFKE  681
             L   L++FK+
Sbjct  193  QLSPFLVLFKK  203



>emb|CAI77793.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (49%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L++FK+
Sbjct  194  DKLSPFLVLFKK  205



>emb|CAI77790.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (49%), Gaps = 29/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVSATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEKA--GVLGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  192

Query  646  ESLDNSLIVFKE  681
            + L   L++FK+
Sbjct  193  DKLSPFLVLFKK  204



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 86/185 (46%), Gaps = 23/185 (12%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP--  297
            P+R   +  PV+D+ GK L AGS+YY+      + RG G+ LA       CP D+V    
Sbjct  22   PVRGNASPDPVLDIAGKQLRAGSKYYILP--VTKGRGGGLTLAGRSNNKTCPVDVVQEQH  79

Query  298  SFNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVK  471
            SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D   G+ LV 
Sbjct  80   SFRNGLPVTFSPVNPKKGVVRESTDLNIKFD---AATSCAQSTVWKLDNFDAALGQWLVT  136

Query  472  AGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTH  624
             G    N     + N F+IE        YKL YCP         C DVG +++   G   
Sbjct  137  TGGVEGNPGPRTMRNWFKIEKFFGN---YKLVYCPSVCNFCRGLCRDVGIFIN--GGVRR  191

Query  625  LALTN  639
            LAL++
Sbjct  192  LALSD  196



>emb|CDP19136.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 80/189 (42%), Gaps = 23/189 (12%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVV--PSFNLGDPV  321
             PV+D +G+ +  G +YY+ + F G  RG GV   K      CP  +V   P FN G PV
Sbjct  25   NPVVDFNGEEIRPGVDYYVVSVFPG-GRGSGVTYGKGPGNEICPLAVVQARPDFNRGHPV  83

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL-----VKAGEA  483
             FTP   +  V+  ST   I F+       C     WKV  ++   +       V+    
Sbjct  84   TFTPVNPEESVVRVSTDLNIKFSEPPFINFCRGSNVWKVHFNEALKQHFVLTDGVEGNSG  143

Query  484  VENVSNLFRIEPVDIGPQIYKLTYCP-----RDEDNCYDVGRYLDWATGNTHLALTNSTE  648
             E  +N F+IE    G   YK  +CP       E  C DVG Y D   G   LAL+    
Sbjct  144  CETEANWFKIELT--GNVGYKFVFCPAVCDSSSEAICKDVGIYYD-DDGTRRLALS----  196

Query  649  SLDNSLIVF  675
              D   +VF
Sbjct  197  --DQPFVVF  203



>emb|CDP21779.1| unnamed protein product [Coffea canephora]
Length=213

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 72/173 (42%), Gaps = 18/173 (10%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGDPVVF  327
             PV+D +G+ +  G EYY+ T F     G GV   K      CP  +V      GDPV F
Sbjct  25   NPVLDTNGEEIRPGVEYYMGTIFR---PGGGVTYGKGPGNEICPLAVVQAWLQRGDPVTF  81

Query  328  TPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL-----VKAGEAVE  489
            TP   +  V+  ST   I F        C     WKV  ++   +       V+     E
Sbjct  82   TPVNPEEGVVRVSTDLNIKFAEPPIINFCRGSNVWKVHFNEALKQHFVLTDGVEGNSGCE  141

Query  490  NVSNLFRIEPVDIGPQIYKLTYCP-----RDEDNCYDVGRYLDWATGNTHLAL  633
              +N F+IE V    + YK  +CP       E  C DVG Y+D   G   LAL
Sbjct  142  TTANWFKIEAVS--DRDYKFVFCPTVCDSSSEAICKDVGIYMD--DGTRRLAL  190



>ref|XP_011046091.1| PREDICTED: miraculin-like [Populus euphratica]
Length=206

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 88/189 (47%), Gaps = 23/189 (12%)
 Frame = +1

Query  106  SAAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPND  285
            +A  L  +    A +PV++V GK+L  G+ YY+      R RG G+K+A       CP D
Sbjct  16   AANQLPRVAATAAPEPVLNVTGKILRTGTGYYIL--LVIRGRGGGLKMAS-TVRRTCPLD  72

Query  286  IVVPSFNL--GDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFG  456
            +V   +    G P+ FTP   K   V   T   I F+   AA  C    +WK++  DE+ 
Sbjct  73   VVQERYEASNGLPLKFTPVNTKKGVVRVHTDLNIRFS---AASICQQSTAWKLDSYDEWT  129

Query  457  RQL------VKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDW  606
            +Q       V+     E  +N F+IE ++     YKL  CP    +    C D+G Y+D 
Sbjct  130  KQWFVTTNGVEGNPGSETTNNWFKIEKLE---DKYKLVVCPTVCQHCKVMCKDIGIYVD-  185

Query  607  ATGNTHLAL  633
            A G   LAL
Sbjct  186  AIGVRRLAL  194



>emb|CAI77798.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77799.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77806.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77807.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (49%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVSATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L++FK+
Sbjct  194  DKLSPFLVLFKK  205



>ref|XP_011035402.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 93/191 (49%), Gaps = 27/191 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+   G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGAEYIISSAIWGAGGGDVSATNK-----TCPDDVIQYSLDLLRGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQ-LVKAGEA----  483
             F+PA  D+ VI  ST   I F+   A +  +    WK+++      Q  V  G A    
Sbjct  83   TFSPASSDDDVIRVSTDLNIKFSIEKACDHSS---VWKIQKSSNSEVQWFVTTGGAEGNP  139

Query  484  -VENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTNSTE  648
             V+ + N F+IE    G   YKL +CP+D  +    C D+G Y +    N    + + ++
Sbjct  140  GVDTLFNWFKIEKA--GILGYKLVFCPKDICHCGVLCRDIGIYFE----NNRGRILSLSD  193

Query  649  SLDNSLIVFKE  681
             L   ++VFK+
Sbjct  194  QLSPFVVVFKK  204



>gb|ACS92516.1| Kunitz-type protease inhibitor KPI-D12 [Populus trichocarpa x 
Populus deltoides]
Length=206

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 85/179 (47%), Gaps = 23/179 (13%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A +PV+DV GK+L  G+ YY+      R RG G+K+A       CP D+V   +    G 
Sbjct  28   APEPVLDVTGKILRTGTGYYILPVI--RGRGGGLKMASTGRRT-CPLDVVQDRYEASNGL  84

Query  316  PVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL------VKA  474
            P+ FTP   K   V   T   I F+   AA  C    +WK+   DE+ +Q       V+ 
Sbjct  85   PLKFTPVNTKKGVVRVHTDLNIRFS---AASICHQSTAWKLGSYDEWTKQWFVTTNGVEG  141

Query  475  GEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
                E  +N F+IE  +     YKL +CP    +    C D+G Y+D A G   LAL++
Sbjct  142  NPGPETTNNWFKIEKFE---DKYKLVFCPTVCQHCKVMCKDIGIYVD-AKGVRRLALSS  196



>emb|CAI77783.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77784.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77788.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77789.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77804.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77805.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 93/192 (48%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L+ FK+
Sbjct  194  DKLSPFLVFFKK  205



>emb|CAI77764.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 92/191 (48%), Gaps = 26/191 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWLVTTGGEEGNP  139

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNSTE  648
              +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + ++
Sbjct  140  GCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLSD  194

Query  649  SLDNSLIVFKE  681
             L   L++FK+
Sbjct  195  KLSPFLVLFKK  205



>emb|CAI77774.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 92/191 (48%), Gaps = 26/191 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWLVTTGGEEGNP  139

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNSTE  648
              +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + ++
Sbjct  140  GCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLSD  194

Query  649  SLDNSLIVFKE  681
             L   L++FK+
Sbjct  195  KLSPFLVLFKK  205



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 87/186 (47%), Gaps = 27/186 (15%)
 Frame = +1

Query  133  LPTAGQ----PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP-  297
            LP  G     PV+D+ GK L AGS+YY+      + RG G+ LA       CP D+V   
Sbjct  21   LPVKGNAQPDPVLDIAGKQLRAGSKYYILP--VTKGRGGGLTLAGRGNNKTCPLDVVQEQ  78

Query  298  -SFNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLV  468
             SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D  FG+ LV
Sbjct  79   HSFKNGLPVTFSPVNPKKGVVRESTDLNIKF---DAATSCAQSTVWKLDNFDAAFGQWLV  135

Query  469  KAGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNT  621
              G    N     + N F+IE    G   YKL YCP         C DVG +++   G  
Sbjct  136  TTGGVEGNPGPRTMRNWFKIEKF-FGD--YKLVYCPSVCNFCRGLCRDVGIFIN--GGVR  190

Query  622  HLALTN  639
             LAL++
Sbjct  191  RLALSD  196



>emb|CAI77772.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77776.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77780.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77781.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77791.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77802.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (49%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVSATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L++FK+
Sbjct  194  DKLSPFLVLFKK  205



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 87/186 (47%), Gaps = 27/186 (15%)
 Frame = +1

Query  133  LPTAGQ----PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP-  297
            LP  G     PV+D+ GK L AGS+YY+      + RG G+ LA       CP D+V   
Sbjct  21   LPVKGNAQPDPVLDIAGKQLRAGSKYYILP--VTKGRGGGLTLAGRRNNKTCPLDVVQEQ  78

Query  298  -SFNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLV  468
             SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D  FG+ LV
Sbjct  79   HSFKNGLPVTFSPVNPKKGVVRESTDLNIKF---DAATSCAQSTVWKLDNFDAAFGQWLV  135

Query  469  KAGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNT  621
              G    N     + N F+IE    G   YKL YCP         C DVG +++   G  
Sbjct  136  TTGGVEGNPGPRTMRNWFKIEKF-FGD--YKLVYCPSVCNFCRGLCRDVGIFIN--GGVR  190

Query  622  HLALTN  639
             LAL++
Sbjct  191  RLALSD  196



>gb|ABK96521.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ACS92517.1| Kunitz-type protease inhibitor KPI-D11 [Populus trichocarpa x 
Populus deltoides]
Length=212

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 92/191 (48%), Gaps = 27/191 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+   G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEQLKAGTEYIISSAIWGAGGGDVSATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F+     +  +    WK+++  + E    +   GE    
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFSIKKDCDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  139

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTNSTE  648
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +    N    + + ++
Sbjct  140  GVHTITNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE----NNRGRILSLSD  193

Query  649  SLDNSLIVFKE  681
             L   L++FK+
Sbjct  194  KLSPFLVLFKK  204



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 87/185 (47%), Gaps = 23/185 (12%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP--  297
            P++      PV+D+ GK L AGS+YY+      + RG G+ LA       CP D+V    
Sbjct  22   PVKGNAQPDPVLDISGKQLRAGSKYYILP--VTKGRGGGLTLAGRSNNKTCPVDVVQEQH  79

Query  298  SFNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVK  471
            SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D  FG+ +V 
Sbjct  80   SFRNGLPVTFSPVNPKKGVVRESTDLNIKF---DAATSCAQSTVWKLDNFDAAFGQWVVT  136

Query  472  AGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTH  624
             G    N     + N F+IE    G   YKL YCP         C DVG +++   G   
Sbjct  137  TGGVEGNPGPRTMRNWFKIEKF-FGD--YKLVYCPSVCNFCRGLCRDVGIFIN--GGVRR  191

Query  625  LALTN  639
            LAL++
Sbjct  192  LALSD  196



>gb|AFL91226.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 75/154 (49%), Gaps = 21/154 (14%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPVVF  327
            V D+DG +L +G+EYY+   F  R RG GV LA       CP D+V   F L  G P+ F
Sbjct  4    VRDIDGNLLRSGTEYYILPVF--RGRGGGVTLAPTR-NESCPLDVVQEGFELDNGLPLTF  60

Query  328  TPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV------  486
            TP   K   + EST   I F+A++   +      W +E   E+  Q + +G         
Sbjct  61   TPVDPKKGVIRESTDLNIIFSASSICIQSN---VWMLE---EYEGQRIISGRGTSGNPGG  114

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDV  588
            E +SN F+IE  + G   YKL YCP   D C  V
Sbjct  115  ETISNWFKIEKYENG---YKLVYCPTVCDLCRPV  145



>ref|XP_010537532.1| PREDICTED: miraculin [Tarenaya hassleriana]
Length=202

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (47%), Gaps = 23/183 (13%)
 Frame = +1

Query  127  IRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN  306
            + +  A +PV D+ GK + AG +YY+      R RG G+ +A       CP  +V   F 
Sbjct  21   VAIDAASEPVRDIRGKPVRAGLDYYILP--VVRGRGGGLTMASAG-NKTCPMSVVQDKFE  77

Query  307  L--GDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL-----  465
            +  G P+ F+P+ K   V  ST Q + F+   AA  C     WK+E  DE  +Q      
Sbjct  78   VSPGFPLTFSPSDKSRIVGISTDQNVKFS---AATICVQSTVWKLESFDETTKQWFVTTG  134

Query  466  -VKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTHLA  630
             V+     E +SN F+IE +      YKL +CP      +  C D+G ++    G   LA
Sbjct  135  GVEGNPGRETISNWFKIEKLG---NDYKLVFCPTVCNFCKVICRDIGVFVQ--DGKRRLA  189

Query  631  LTN  639
            L++
Sbjct  190  LSD  192



>gb|AEK26936.1| Kunitz-type trypsin inhibitor B3 [Populus nigra]
Length=209

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (47%), Gaps = 25/183 (14%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A +PV+D+DG+ L+AG++YY+   F  R RG G+ +A       CP  +V     +  G 
Sbjct  24   AAEPVLDIDGEKLVAGTKYYILPVF--RGRGGGITMA--SNKTSCPLAVVQDRLEVSNGL  79

Query  316  PVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVE  489
            P+ FTPA  D    ++ ST   I F    A   C     WK+ +      Q   +   VE
Sbjct  80   PLTFTPAADDKKGVILVSTDLNIKF---LAKTTCPQSTVWKIIKSSNSKVQWFVSTGGVE  136

Query  490  ------NVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
                   V+N F+IE  D     YKL +CP    N    C D+G Y++   G   L+L++
Sbjct  137  GNPGFNTVTNWFQIEKAD---DDYKLVFCPTKVCNCGVLCRDIGIYIE-DNGTRTLSLSD  192

Query  640  STE  648
            + +
Sbjct  193  ALQ  195



>gb|ADW95389.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=209

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (47%), Gaps = 25/183 (14%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A +PV+D+DG+ L+AG++YY+   F  R RG G+ +A       CP  +V     +  G 
Sbjct  24   AAEPVLDIDGEKLVAGTKYYILPVF--RGRGGGITMA--SNKTSCPLAVVQDRLEVSKGL  79

Query  316  PVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVE  489
            P+ FTPA  D    ++ ST   I F    A   C     WK+ +      Q   +   VE
Sbjct  80   PLTFTPAADDKKGVILVSTDLNIKF---LAKTTCPQSTVWKIIKSSNSKVQWFVSTGGVE  136

Query  490  ------NVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
                   V+N F+IE  D     YKL +CP    N    C D+G Y++   G   L+L++
Sbjct  137  GNPGFNTVTNWFQIEKAD---DDYKLVFCPTKVCNCGVLCRDIGIYIE-DNGTRTLSLSD  192

Query  640  STE  648
            + +
Sbjct  193  ALQ  195



>gb|ACO40080.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=180

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 89/177 (50%), Gaps = 25/177 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +++ F G ARG  V          CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSIFWG-ARGGDVSAT----NKTCPDDVIKYSSDRLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQ--LVKAGE----  480
             F+PA  ++ VI  ST   I F+   A +  +    WK+++      Q  +   GE    
Sbjct  68   TFSPASSEDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNLEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
             ++ ++N F+IE   IG   YKL  CP D  +    C D+G Y +   G   L+L++
Sbjct  125  GIDTLTNWFKIEKAGIG---YKLVSCPEDICHCGVLCRDIGIYRE-NNGRKILSLSD  177



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 91/193 (47%), Gaps = 29/193 (15%)
 Frame = +1

Query  109  AAALDPIRLPTAGQ----PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPC  276
            A A +P  LP A +    PV+D++GK L +G +YY+      R RG G+ +A +     C
Sbjct  15   ALAFNP--LPGAAEAAPDPVLDIEGKQLRSGVDYYILPVI--RGRGGGLTVASVR-NKTC  69

Query  277  PNDIVVPSFNL--GDPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDD  447
            P D+V     +  G P+ FTP      VI  ST   I F+   AA  CA    WK+E D+
Sbjct  70   PLDVVQDKLEVSHGLPLTFTPVNPKQDVIRVSTDHNIKFS---AATICAQSTVWKLEYDE  126

Query  448  EFGRQLVKAGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPRDED----NCYDVGRYL  600
              G++ +  G    N     +SN F+IE        YKL +CP   +     C DVG Y+
Sbjct  127  STGQRFITTGGVEGNPGRGTLSNWFKIEKYG---DDYKLVFCPTVCNFCKVICRDVGVYI  183

Query  601  DWATGNTHLALTN  639
                G   LALT 
Sbjct  184  Q--KGYRRLALTT  194



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 85/184 (46%), Gaps = 23/184 (13%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSF  303
            P+   ++  PV+D +GK L +G +YY+      R RG G+ LA       CP D+V    
Sbjct  21   PVAAESSPDPVLDTEGKQLRSGVDYYILPVI--RGRGGGLTLASTG-NENCPLDVVQEQH  77

Query  304  NL--GDPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKA  474
             +  G P+ FTP      VI  ST   I F+   A+  C     WK+E D+  G++ V  
Sbjct  78   EVSNGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDESSGQRFVTT  134

Query  475  G-----EAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCY----DVGRYLDWATGNTHL  627
            G        E + N F+IE  +     YKL +CP   D C     D+G Y+    G   L
Sbjct  135  GGVEGNPGXETLDNWFKIEKYE---DDYKLVFCPTVCDFCKPVCGDIGIYIQ--NGYRRL  189

Query  628  ALTN  639
            AL++
Sbjct  190  ALSD  193



>ref|NP_001237333.1| uncharacterized protein LOC100500648 precursor [Glycine max]
 gb|ACU15788.1| unknown [Glycine max]
Length=213

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 91/206 (44%), Gaps = 31/206 (15%)
 Frame = +1

Query  124  PIRLPTAG---QPVMDVDGKVLLAGSEYYLS-------TDFAGRARGQGVKLAKLDFTAP  273
            P+ L  AG   +PV+D  GK L A + Y++          F     G G+ L  +D +  
Sbjct  18   PLLLGAAGAAPEPVIDTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDSIDES--  75

Query  274  CPNDIVVPSFNLGDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDE  450
            CP D+++   N G P+ F+P      VI  +     F + +          W ++Q D  
Sbjct  76   CPLDVIIEKANEGLPLRFSPVNTKKGVIRVSTDLNIFFSDSDERCPHHSTVWMLDQFDAS  135

Query  451  FGRQLVKAGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPRDEDNCY----DVGRYLD  603
             G+  V  G  V N     + N F+I+  +     YKL YCPR   +C+    D+G ++D
Sbjct  136  IGQTYVTTGGVVGNPGEHTILNWFKIQKYE---DAYKLVYCPRVCPSCHHLCKDIGMFVD  192

Query  604  WATGNTHLALTNSTESLDNSLIVFKE  681
             A    HLAL++     D   I FKE
Sbjct  193  -ANRRMHLALSD-----DPFKIKFKE  212



>ref|XP_011035403.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 94/191 (49%), Gaps = 27/191 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +S+   G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGAEYIISSAIWGAGGGDVSATNK-----TCPDDVIQYSLDLLRGLPV  82

Query  322  VFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA   D+ +  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  83   TFSPANYGDDVIRISTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  139

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTNSTE  648
             V+ ++N F+IE    G   YKL +CP+D  +    C D+G Y +    N    + + ++
Sbjct  140  GVDTLTNWFKIEKA--GILGYKLVFCPKDICHCGVLCRDIGIYFE----NNRGRILSLSD  193

Query  649  SLDNSLIVFKE  681
             L   ++VFK+
Sbjct  194  QLSPFVVVFKK  204



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 86/185 (46%), Gaps = 23/185 (12%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP--  297
            P+R   +  PV+D+ GK L AGS+YY+      + RG G+ LA       CP D+V    
Sbjct  22   PVRGNASPDPVLDIAGKQLRAGSKYYILP--VTKGRGGGLTLAGRSNNKTCPLDVVQEQH  79

Query  298  SFNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVK  471
            SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D   G+ LV 
Sbjct  80   SFRNGLPVTFSPVNPKKGVVRESTDINIKF---DAATSCAQSTVWKLDNFDAALGQWLVT  136

Query  472  AGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTH  624
             G    N     + N F+IE        YKL +CP         C DVG +++   G   
Sbjct  137  TGGVEGNPGPRTMRNWFKIEKFY---GDYKLVFCPSVCNIFRGLCRDVGIFIN--GGVRR  191

Query  625  LALTN  639
            LAL++
Sbjct  192  LALSD  196



>gb|AFL91231.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 75/154 (49%), Gaps = 21/154 (14%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGD--PVVF  327
            V D+DG ++ +G+EYY+   F  R RG GV LA       CP D+V   F L D  P+ F
Sbjct  4    VRDIDGNLVRSGTEYYILPVF--RGRGGGVTLAPTR-NESCPLDVVQEGFELDDGLPLTF  60

Query  328  TPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV------  486
            TP   K   + EST   I F+A++   +      W +E   E+  Q + +G         
Sbjct  61   TPVDPKKGVIRESTDLNIIFSASSICIQSN---VWMLE---EYEGQRIISGRGTAGNPGG  114

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDV  588
            E +SN F+IE  + G   YKL YCP   D C  V
Sbjct  115  ETISNWFKIEKYENG---YKLVYCPTVCDLCRPV  145



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 85/184 (46%), Gaps = 23/184 (13%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSF  303
            P+   ++  PV+D +GK L +G +YY+      R RG G+ LA       CP D+V    
Sbjct  21   PVAAESSPDPVLDTEGKQLWSGVDYYILPVI--RGRGGGLTLASTG-NENCPLDVVQEQH  77

Query  304  NL--GDPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKA  474
             +  G P+ FTP      VI  ST   I F+   A+  C     WK+E D+  G++ V  
Sbjct  78   EVSNGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDESSGQRFVTT  134

Query  475  G-----EAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCY----DVGRYLDWATGNTHL  627
            G        E + N F+IE  +     YKL +CP   D C     D+G Y+    G   L
Sbjct  135  GGVEGNPGHETLDNWFKIEKYE---DDYKLVFCPTVCDFCKPVCGDIGIYIQ--NGYRRL  189

Query  628  ALTN  639
            AL++
Sbjct  190  ALSD  193



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 87/192 (45%), Gaps = 29/192 (15%)
 Frame = +1

Query  100  PHSAAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCP  279
            P S AA       +A  PV+D +GK L +G +YY+   F  R RG G+ LA       CP
Sbjct  19   PFSVAA------ESAPDPVLDTEGKKLRSGVDYYILPVF--RGRGGGLTLASTG-NESCP  69

Query  280  NDIVVPSFNL--GDPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDE  450
             D+V     +  G P+ FTP      VI  ST   I F+   A+  C     WK+E D+ 
Sbjct  70   LDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDES  126

Query  451  FGRQLVKAG-----EAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCY----DVGRYLD  603
             G+  V  G        E + N F+IE  +     YKL +CP   D C     D+G Y+ 
Sbjct  127  SGQWFVTTGGVEGNPGRETLDNWFKIEKYE---DDYKLVFCPTVCDFCKPVCGDIGIYIQ  183

Query  604  WATGNTHLALTN  639
               G   LAL++
Sbjct  184  --NGYRRLALSD  193



>emb|CAI77800.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 93/192 (48%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGD--PV  321
            +PV+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L    PV
Sbjct  28   EPVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQVLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L++FK+
Sbjct  194  DKLSPFLVLFKK  205



>gb|ACO40078.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=180

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 90/177 (51%), Gaps = 25/177 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +++ F G ARG  V          CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSIFWG-ARGGDVSATN----KTCPDDVIKYSSDRLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSEDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
             ++ ++N F+IE   IG   YKL  CP D  +    C D+G Y +   G   L+L++
Sbjct  125  GIDTLTNWFKIEKAGIG---YKLVSCPEDICHCGVLCRDIGIYRE-NNGRKILSLSD  177



>gb|AFL91228.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 73/154 (47%), Gaps = 21/154 (14%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGD--PVVF  327
            V D+DG ++  G EYY+   F  R RG GV LA       CP D+V   F L D  P+ F
Sbjct  4    VRDIDGNLVXXGXEYYILPXF--RGRGGGVTLAPTR-NESCPLDVVQEGFELDDGLPLTF  60

Query  328  TPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV------  486
            TP   K   + EST   I F+A++   +      W +E   E+  Q + +G         
Sbjct  61   TPVDPKKGVIRESTDLNIIFSASSICIQSN---VWMLE---EYEGQRIISGRGTAGNPGG  114

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDV  588
            E +SN F+IE  + G   YKL YCP   D C  V
Sbjct  115  ETISNWFKIEKYENG---YKLVYCPTVCDLCRPV  145



>ref|XP_007210537.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
 gb|EMJ11736.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
Length=202

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 79/166 (48%), Gaps = 23/166 (14%)
 Frame = +1

Query  91   AAPPHSAAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTA  270
            +A P S AA        A  PV+D+ GK L  G++YY+      R RG G+ LA    T 
Sbjct  15   SAKPWSVAA------DAAPSPVLDITGKKLRTGTDYYILPVI--RGRGGGLTLASTSNTT  66

Query  271  PCPNDIVVPSFNL--GDPVVFTPAV-KDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ  441
             CP D+V     +  G P+ F+P   K   V  ST   I F+   AA  C     WK+++
Sbjct  67   SCPLDVVQEQHEVSNGLPLTFSPVNPKKGVVRVSTDHNIKFS---AATICVQSTMWKLDK  123

Query  442  -DDEFGRQLVKAGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCP  561
             D++ G+  V +G    N      SN F+IE  D   + YKL +CP
Sbjct  124  FDEQTGQWFVTSGGVEGNPGRQTTSNWFKIEKYD---EDYKLVFCP  166



>emb|CAI77785.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 93/192 (48%), Gaps = 28/192 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            + V+D+ G+ L AG+EY +S+ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   ESVLDIQGEELKAGTEYIISSIFWGAGGGDVAATNK-----TCPDDVIQYSLDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNST  645
               +  +N F+IE    G   YKL YCP D       C DVG Y +   G     + + +
Sbjct  139  PGCDTFTNWFKIEK-GAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGR----ILSLS  193

Query  646  ESLDNSLIVFKE  681
            + L   L++FK+
Sbjct  194  DKLSPFLVLFKK  205



>gb|AFR60853.1| truncated sporamin [Ipomoea batatas]
Length=146

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 70/131 (53%), Gaps = 15/131 (11%)
 Frame = +1

Query  97   PPHSAAALDPIRLPTAGQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL  258
            P HS    +PIRLPT  +P      V+D++G  + AG  YY+ +     A G G++LA L
Sbjct  20   PAHSR--FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAI-WGAGGGGLRLAHL  76

Query  259  DFTAPCPNDIVVPSFNL--GDPVVFTPAVKD---NFVIESTFQTISFTaaaaaeecaDKL  423
            D  + C +D++V   +L  GDP+  TPA  D     V+ ST+QT  F   A  + C + +
Sbjct  77   DTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFN-IATNKLCVNNV  135

Query  424  SWKVEQDDEFG  456
            +W ++ D   G
Sbjct  136  NWGIQHDSASG  146



>gb|AEK26927.1| Kunitz-type trypsin inhibitor B4 [Populus nigra]
Length=211

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 90/194 (46%), Gaps = 27/194 (14%)
 Frame = +1

Query  106  SAAALDPIRLPTAGQPVMDVDGKVLLAGSEYY--LSTDFAGRARGQGVKLAKLDFTAPCP  279
            +A  L  +    A +PV+D+ GKVL  G+ YY  L  +   R RG G+  A     + CP
Sbjct  19   AAKPLPRVAAGAAPEPVLDIAGKVLRTGTNYYDILPVE---RGRGGGITFAITGHKS-CP  74

Query  280  NDIVVPSFNLGD--PVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDE  450
             D+++  +   D  P+ F PA +   VI  ST   I F   A+    A    WKVE+ D+
Sbjct  75   VDVMLEDYEDSDGLPLQFIPANRKKGVIRLSTDLNIKFPGPASCAATA---VWKVEKYDK  131

Query  451  FGRQL------VKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN-----CYDVGRY  597
               Q+      V+     E V N F+IE        YKL +CP   ++     C D+G Y
Sbjct  132  LTSQMFISTSGVEGNPGPETVDNWFKIEKYG---NDYKLVFCPTVCNDHCKVLCKDIGIY  188

Query  598  LDWATGNTHLALTN  639
            +D   G   LAL++
Sbjct  189  VD-KEGFKRLALSD  201



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 86/186 (46%), Gaps = 27/186 (15%)
 Frame = +1

Query  133  LPTAGQ----PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP-  297
            LP  G     PV+D+ GK L AGS+YY+      + RG G+ LA       CP D+V   
Sbjct  21   LPVKGNAQPDPVLDIAGKQLRAGSKYYILP--VTKGRGGGLTLAGRGNNKTCPLDVVQEQ  78

Query  298  -SFNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLV  468
             SF  G PV F+P   K   V EST   I      AA  CA    WK++  D  FG+ LV
Sbjct  79   HSFKNGLPVTFSPVNPKKGVVRESTDINIKL---DAATSCAQSTVWKLDNFDAAFGQWLV  135

Query  469  KAGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNT  621
              G    N     + N F+IE    G   YKL YCP         C DVG +++   G  
Sbjct  136  TTGGVEGNPGPRTMRNWFKIEKF-FGD--YKLVYCPSVCNFCRGLCRDVGIFIN--GGVR  190

Query  622  HLALTN  639
             LAL++
Sbjct  191  RLALSD  196



>ref|XP_010416122.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=207

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 87/184 (47%), Gaps = 18/184 (10%)
 Frame = +1

Query  145  GQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDP  318
             QPV+D+DG ++  GS Y L      R +G G+ LA      PCP DIV  S  +  G P
Sbjct  22   AQPVLDIDGDIIFDGSYYVLPVI---RGQGGGLTLAGRG-DQPCPLDIVQESSEVDEGIP  77

Query  319  VVFTP-AVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVENV  495
            V F+    +  FV ES  + ++     AA  C     W V+   +F    V AG   E  
Sbjct  78   VKFSNWRSRVGFVPES--ENLNIETDVAATICVQSTYWWVDTKAKF---RVTAGPKPEEE  132

Query  496  SNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTHLALTNSTESLDNS--LI  669
            S L   +  ++    Y+  +CP     CYDVG ++D   G   LALT  +   DN+  L+
Sbjct  133  SLLSFFQIQNVYDHYYQFAFCPSGPKGCYDVGIFVD-ENGVRRLALTKRS---DNTPFLV  188

Query  670  VFKE  681
            +FK+
Sbjct  189  MFKK  192



>gb|AFL91232.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=172

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 73/154 (47%), Gaps = 21/154 (14%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGD--PVVF  327
            V D+DG ++  G EYY+   F  R RG GV LA       CP D+V   F L D  P+ F
Sbjct  1    VRDIDGNLVXXGXEYYILPVF--RGRGGGVTLAPTR-NESCPLDVVQEGFELDDGLPLTF  57

Query  328  TPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV------  486
            TP   K   + EST   I F+A++   +      W +E   E+  Q + +G         
Sbjct  58   TPVDPKKGVIRESTDLNIIFSASSICIQSN---VWMLE---EYEGQRIISGRGTAGNPGG  111

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDV  588
            E +SN F+IE  + G   YKL YCP   D C  V
Sbjct  112  ETISNWFKIEKYENG---YKLVYCPTVCDLCRPV  142



>gb|AFL91227.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 74/154 (48%), Gaps = 21/154 (14%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGD--PVVF  327
            V D DG ++ +G+EYY+   F  R RG GV LA       CP D+V   F L D  P+ F
Sbjct  4    VRDXDGNLVXSGTEYYILPVF--RGRGGGVTLAPTR-NESCPLDVVQEGFELDDGLPLTF  60

Query  328  TPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV------  486
            TP   K   + EST   I F+A++   +      W +E   E+  Q + +G         
Sbjct  61   TPVDPKKGVIRESTDLNIIFSASSICIQSN---VWMLE---EYEGQRIISGRGTAGNPGG  114

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDV  588
            E +SN F+IE  + G   YKL YCP   D C  V
Sbjct  115  ETISNWFKIEKYENG---YKLVYCPTVCDLCRPV  145



>gb|ACS92519.1| Kunitz-type protease inhibitor KPI-D8 [Populus trichocarpa x 
Populus nigra]
Length=211

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 93/187 (50%), Gaps = 20/187 (11%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +++ F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIITSIFWGALGGDVSATNK-----TCPDDVIQYSSDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ +I  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  83   TFSPASSEDDIIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  139

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTHLALTNSTESLDN  660
             ++ ++N F+IE   IG   YKL  CP +  +C  + R +     N    + + ++ L  
Sbjct  140  GIDTLTNWFKIEKAGIG---YKLVSCPENICHCGVLCRDIGIYRENNGRRILSLSDKLSP  196

Query  661  SLIVFKE  681
             L++FK+
Sbjct  197  FLVLFKK  203



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 82/179 (46%), Gaps = 27/179 (15%)
 Frame = +1

Query  100  PHSAAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCP  279
            P S AA       +A  PV+D +GK L +G +YY+   F  R RG G+ LA       CP
Sbjct  41   PFSVAA------ESAPDPVLDTEGKKLRSGVDYYILPVF--RGRGGGLTLASTG-NETCP  91

Query  280  NDIVVPSFNL--GDPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDE  450
             D+V     +  G P+ FTP      VI  ST   I F+   A+  C     WK+E D+ 
Sbjct  92   LDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDES  148

Query  451  FGRQLVKAG-----EAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCY----DVGRYL  600
             G++ V  G        E + N F+IE  +     YKL +CP   D C     D+G Y+
Sbjct  149  SGQRFVTTGGVEGNPGRETLDNWFKIEKYE---DDYKLVFCPTVCDFCKPVCGDIGIYI  204



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 82/179 (46%), Gaps = 27/179 (15%)
 Frame = +1

Query  100  PHSAAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCP  279
            P S AA       +A  PV+D +GK L +G +YY+   F  R RG G+ LA       CP
Sbjct  19   PFSVAA------ESAPDPVLDTEGKKLRSGVDYYILPVF--RGRGGGLTLASTG-NETCP  69

Query  280  NDIVVPSFNL--GDPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDE  450
             D+V     +  G P+ FTP      VI  ST   I F+   A+  C     WK+E D+ 
Sbjct  70   LDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDES  126

Query  451  FGRQLVKAG-----EAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCY----DVGRYL  600
             G++ V  G        E + N F+IE  +     YKL +CP   D C     D+G Y+
Sbjct  127  SGQRFVTTGGVEGNPGRETLDNWFKIEKYE---DDYKLVFCPTVCDFCKPVCGDIGIYI  182



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 89/203 (44%), Gaps = 30/203 (15%)
 Frame = +1

Query  100  PHSAAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCP  279
            P S AA       +A  PV+D +GK L +G +YY+   F  R RG G+ LA       CP
Sbjct  19   PFSVAA------ESAPDPVLDTEGKKLRSGVDYYILPVF--RGRGGGLTLASTG-NETCP  69

Query  280  NDIVVPSFNL--GDPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDE  450
             D+V     +  G P+ FTP      VI  ST   I F+   A+  C     WK+E D+ 
Sbjct  70   LDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDES  126

Query  451  FGRQLVKAG-----EAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATG  615
             G++ V  G        E + N F+IE  +     YKL +CP   D C  V        G
Sbjct  127  SGQRFVTTGGVEGNPGRETLDNWFKIEKYE---DDYKLVFCPTVCDFCKPV-------CG  176

Query  616  NTHLALTNSTESLDNSLIVFKEK  684
            +  + + N    L  S + FK K
Sbjct  177  DIGIYIQNEYRRLALSDVPFKVK  199



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 86/185 (46%), Gaps = 23/185 (12%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP--  297
            P+R   +  PV+DV GK L AGS+YY+      + +G G+ LA       CP D+V    
Sbjct  22   PVRGNASPDPVLDVAGKKLRAGSKYYILP--VTKGQGGGLTLAGRSNNKTCPLDVVQEQH  79

Query  298  SFNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVK  471
            SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D   G+ LV 
Sbjct  80   SFRNGLPVTFSPVNPKKGVVRESTDFNIKF---DAATSCAQSTVWKLDNFDAALGQWLVT  136

Query  472  AGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTH  624
             G    N     + N F+IE        YKL +CP         C DVG +++   G   
Sbjct  137  TGGVEGNPGPRTMRNWFKIEKFY---GDYKLVFCPSVCNFCRGLCRDVGIFIN--GGVRR  191

Query  625  LALTN  639
            LAL++
Sbjct  192  LALSD  196



>ref|XP_002305034.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
 gb|EEE85545.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
Length=207

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 88/192 (46%), Gaps = 24/192 (13%)
 Frame = +1

Query  106  SAAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPND  285
            +A  L  +    A +PV+D+ GKVL  G+ Y +      R RG G+  A     + CP D
Sbjct  16   AAKPLPRVAAGAAPEPVLDIAGKVLRTGTYYDILP--VERGRGGGITFACTGHKS-CPVD  72

Query  286  IVVPSFNLGD--PVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFG  456
            +++  +   D  P+ F PA +   VI  ST   I F   A+    A    WKVE+ DE  
Sbjct  73   VMLEDYEDSDGLPLQFIPANRKKGVIRLSTDLNIKFPGPASCAATA---VWKVEKYDELT  129

Query  457  RQL------VKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN-----CYDVGRYLD  603
             Q+      V+     E V N F+IE        YKL +CP   ++     C D+G Y+D
Sbjct  130  SQMFISTSGVEGNPGPETVDNWFKIEKYG---NDYKLVFCPTVCNDHCKVLCKDIGIYVD  186

Query  604  WATGNTHLALTN  639
               G   LAL++
Sbjct  187  -KEGFKRLALSD  197



>gb|ADW95380.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=210

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 88/192 (46%), Gaps = 24/192 (13%)
 Frame = +1

Query  106  SAAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPND  285
            +A  L  +    A +PV+D+ GKVL  G+ Y +      R RG G+  A     + CP D
Sbjct  19   AAKPLPRVAAGAAPEPVLDIAGKVLRTGTYYDILP--VERGRGGGITFACTGHKS-CPVD  75

Query  286  IVVPSFNLGD--PVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFG  456
            +++  +   D  P+ F PA +   VI  ST   I F   A+    A    WKVE+ DE  
Sbjct  76   VMLEDYEDSDGLPLQFIPANRKKGVIRLSTDLNIKFPGPASCAATA---VWKVEKYDELT  132

Query  457  RQL------VKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN-----CYDVGRYLD  603
             Q+      V+     E V N F+IE        YKL +CP   ++     C D+G Y+D
Sbjct  133  SQMFISTSGVEGNPGPETVDNWFKIEKYG---NDYKLVFCPTVCNDHCKVLCKDIGIYVD  189

Query  604  WATGNTHLALTN  639
               G   LAL++
Sbjct  190  -KEGFKRLALSD  200



>gb|AEK26933.1| Kunitz-type trypsin inhibitor B2 [Populus nigra]
Length=215

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 78/165 (47%), Gaps = 21/165 (13%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A + V+D DG+ L AG+EYY+   F  R RG G+ +A       CP D+V     +  G 
Sbjct  29   ATEAVLDTDGEKLRAGTEYYILPVF--RGRGGGLTMASTR-DETCPLDVVQDPLEISKGL  85

Query  316  PVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL------VKA  474
            P+ FTP      VI  ST   I F+A++   +      WK+++      Q       V+ 
Sbjct  86   PLTFTPVNPKKGVIRVSTDLNIKFSASSICVQST---VWKIQKSVNSEIQWFVTTGGVEG  142

Query  475  GEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN---CYDVGRYL  600
               +E ++N F+IE  D     YKL +CP   D    C DVG Y+
Sbjct  143  NPGIETITNWFKIEKAD---DDYKLVFCPTVCDCGALCRDVGIYI  184



>gb|AFL91233.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 74/154 (48%), Gaps = 21/154 (14%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGD--PVVF  327
            V D+DG ++ +G+EYY+   F  R  G GV LA       CP D+V   F L D  P+ F
Sbjct  4    VRDIDGNLVXSGTEYYILPVF--RGXGGGVTLAPTR-NESCPLDVVQEGFELDDGLPLTF  60

Query  328  TPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV------  486
            TP   K   + EST   I F+A++   +      W +E   E+  Q + +G         
Sbjct  61   TPVDPKKGVIRESTDLNIIFSASSICIQSN---VWMLE---EYEGQRIISGRGTAGNPGG  114

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDV  588
            E +SN F+IE  + G   YKL YCP   D C  V
Sbjct  115  ETISNWFKIEKYENG---YKLVYCPTVCDLCRPV  145



>ref|XP_004234331.1| PREDICTED: miraculin [Solanum lycopersicum]
 gb|AAC63057.1| Lemir [Solanum lycopersicum]
Length=205

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 84/176 (48%), Gaps = 25/176 (14%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN---LGDPVV  324
            V+D+DGK+L  G +YY+      R RG G+ +  +     CP D VV   N    G P+ 
Sbjct  31   VVDIDGKILRTGVDYYILP--VVRGRGGGLTMDSIG-DKMCPLDAVVQEHNEIDQGLPLT  87

Query  325  FTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDE-FGRQLVKAG-----EA  483
            FTP   K   + EST   I F+A +   +      WK++  DE  G+  +  G       
Sbjct  88   FTPVDPKKGVIRESTDLNIIFSANSICVQTT---QWKLDDFDETTGQYFITLGGDQGNPG  144

Query  484  VENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
            VE +SN F+IE  D   + YKL YCP   D     C D+G ++    G   LAL++
Sbjct  145  VETISNWFKIEKYD---RDYKLLYCPTVCDFCKVICRDIGIFI--QDGVRRLALSD  195



>gb|ABK01288.1| miraculin-like protein [Coffea arabica]
Length=214

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 72/172 (42%), Gaps = 17/172 (10%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGDPVVFT  330
            PV+D++G+ +  G EYY+ T F     G GV   K      CP  +       G PV FT
Sbjct  26   PVLDINGEEIRPGVEYYIGTTF---RPGGGVTYGKGPGNEICPLAVAQAWLQRGLPVTFT  82

Query  331  PAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL-----VKAGEAVEN  492
            P   +  V+  ST   I F        C+    WKV  +D F +       V+       
Sbjct  83   PVNPEEGVVRVSTDLNIKFAEPPVGRICSGSNVWKVHFNDLFEKHFVLTDGVEGNSGCGT  142

Query  493  VSNLFRIEPVDIGPQIYKLTYCP-----RDEDNCYDVGRYLDWATGNTHLAL  633
             +N F+IE V  G + YKL +CP       E  C  VG Y D   G   LAL
Sbjct  143  TANWFKIEAV--GDRGYKLVFCPTVCDSSSEAICKYVGIYHD-DDGTRRLAL  191



>gb|ACO40133.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 79/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  D+ VI  ST   I F+   A    +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSDDDVIRVSTDLNIKFSIKKACVHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>gb|ACO40153.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 79/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQ--LVKAGE----  480
             F+PA  D+ VI  ST   I F+   A +  +    WK+++      Q  +   GE    
Sbjct  68   TFSPASSDDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSKVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>ref|XP_011035401.1| PREDICTED: miraculin-like [Populus euphratica]
Length=215

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 93/210 (44%), Gaps = 42/210 (20%)
 Frame = +1

Query  7    LLLLNSFSIYLTMKIQltlffslsffilAAPPHSAAALDPIRLPTAGQPVMDVDGKVLLA  186
            LL+L+SF ++                + +A P  A  LD      A + V+D DG+ L A
Sbjct  5    LLVLSSFLVF---------------ALASARPSIAGDLD------ATEAVLDTDGEKLRA  43

Query  187  GSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPVVFTPAVKDNFVIE  360
            G+EYY+   F  R RG G+ +A     A CP D+V     +  G P+ FTP      VI 
Sbjct  44   GTEYYILPVF--RGRGGGLTMASTGDEA-CPLDVVQDPLEISKGLPLTFTPVNPKKGVIR  100

Query  361  -STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL------VKAGEAVENVSNLFRIEP  519
             ST   I F+   A+  C     WK+++      Q       V+    +E ++N F+IE 
Sbjct  101  VSTDLNIKFS---ASSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETITNWFKIEK  157

Query  520  VDIGPQIYKLTYCPRDEDN---CYDVGRYL  600
                   YKL +CP   D    C D+G Y+
Sbjct  158  AG---DDYKLVFCPTVCDCGALCRDIGIYI  184



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 86/185 (46%), Gaps = 23/185 (12%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSF  303
            P+R   +  PV+D+ GK L AGS+YY+      + +G G+ LA       CP D+V    
Sbjct  22   PVRGNASPDPVLDIAGKQLRAGSKYYILP--VTKGQGGGLTLAGRSNNKTCPLDVVQEQH  79

Query  304  NL--GDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVK  471
            +L  G PV F+P   K   V EST   I F    AA  CA    WK++  D   G+ LV 
Sbjct  80   SLRNGFPVTFSPVNPKKGVVRESTDLNIKF---DAATSCAQSTVWKLDNFDAALGQWLVT  136

Query  472  AGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTH  624
             G    N     + N F+IE        YKL +CP         C DVG +++   G   
Sbjct  137  TGGVEGNPGPRTMRNWFKIEKFY---GDYKLVFCPSVCNFCRGLCRDVGIFIN--GGVRR  191

Query  625  LALTN  639
            LAL++
Sbjct  192  LALSD  196



>gb|ACO40077.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40090.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40115.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40116.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40120.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40132.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40156.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 80/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  D+ VI  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSDDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>ref|XP_002305033.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|EEE85544.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92484.1| Kunitz-type protease inhibitor KPI-D1.2 [Populus trichocarpa]
 gb|ADW95379.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=212

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 92/191 (48%), Gaps = 27/191 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  28   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  139

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTNSTE  648
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +    N    + + ++
Sbjct  140  GVHTLTNWFKIEKA--GTLGYKLVFCPEDICHCGVLCRDIGIYFE----NNRGRILSLSD  193

Query  649  SLDNSLIVFKE  681
             L   +++FK+
Sbjct  194  KLSPFVVLFKK  204



>emb|CAI77825.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 91/188 (48%), Gaps = 19/188 (10%)
 Frame = +1

Query  109  AAALDPIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPND  285
            A+ L P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D
Sbjct  11   ASTLLPEAVRASGNPVLDVKGSGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLD  67

Query  286  IV-VPSFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEF  453
            ++ + +F + G PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +  
Sbjct  68   VILLENFCVTGTPVTFSIASGDQELFITDSTDVYISF--DSTSNCTNETMVWMHESINGS  125

Query  454  GRQLVKAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWAT  612
              +L+  G    +V+ LFRI  V++G      YKL  Y P   D      DVG   D+ T
Sbjct  126  STELLTIGGVEGDVNTLFRI--VNVGGSFVSNYKLVAYKPSSYDLALTTSDVGAVFDFTT  183

Query  613  GNTHLALT  636
            G  +LALT
Sbjct  184  GIRYLALT  191



>ref|XP_010428249.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
 ref|XP_010428250.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=208

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 85/182 (47%), Gaps = 14/182 (8%)
 Frame = +1

Query  145  GQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDP  318
             QPV+D+DG ++  GS YY+    +G+  G G+ LA      PCP DIV  S  +  G P
Sbjct  23   AQPVLDIDGDIIFRGS-YYVLPVISGQ--GGGLTLAGRG-DQPCPLDIVQESSEVDEGIP  78

Query  319  VVFTP-AVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVENV  495
            V F+    +  FV ES  + ++      A  C     W V+   +F    V AG   E  
Sbjct  79   VKFSNWRSRVGFVPES--ENLNIETDVKATICVQSTYWWVDTKAKF---RVTAGPKPEEE  133

Query  496  SNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTHLALTNSTESLDNSLIVF  675
            S L   +   +    Y+  +CP     CYDVG ++D   G   LALT  T+     L++F
Sbjct  134  SLLSFFQIQHVYDHFYQFAFCPSGPKGCYDVGIFVD-ENGVRRLALTKRTDDTP-FLVMF  191

Query  676  KE  681
            K+
Sbjct  192  KK  193



>ref|XP_011046090.1| PREDICTED: miraculin-like [Populus euphratica]
Length=209

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 82/183 (45%), Gaps = 25/183 (14%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSF--NLGD  315
            A +PV+D+DG+ L+AG++YY+   F  R RG G+ +A       CP  +V      + G 
Sbjct  24   AAEPVLDIDGEKLVAGTKYYILPVF--RGRGGGITMA--SNQTSCPLAVVQDRLEASKGL  79

Query  316  PVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVE  489
            P+ FTPA  D    ++ ST   I F              WK+ +      Q   +   VE
Sbjct  80   PLTFTPAADDKKGVILVSTDLNIKFLDKTTCPHST---VWKIIKSSNSKVQWFVSTGGVE  136

Query  490  N------VSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
                   V N F+IE  D     YKL +CP         C D+G Y++   G   L+L++
Sbjct  137  GNPGFNTVGNWFQIEKAD---DDYKLVFCPTKVCKCGVLCRDIGIYIE-DNGTRTLSLSD  192

Query  640  STE  648
            + +
Sbjct  193  ALQ  195



>ref|XP_006441446.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
 gb|ESR54686.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
Length=206

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 86/185 (46%), Gaps = 23/185 (12%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP--  297
            P+R   +  PV+D+ GK L AGS+YY+      + RG G+ LA       C  D+V    
Sbjct  22   PVRGNASPDPVLDIAGKQLRAGSKYYILP--VTKGRGGGLTLAGRSNNKTCLLDVVQEQH  79

Query  298  SFNLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVK  471
            SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D   G+ L+ 
Sbjct  80   SFRNGLPVTFSPVNPKKGVVRESTDLNIKFD---AATSCAQSTVWKLDNFDAVLGQWLLT  136

Query  472  AGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTH  624
             G    N     + N F+IE    G   YKL YCP         C DVG +++   G   
Sbjct  137  TGGVEGNPGPRTMRNWFKIEKF-FGD--YKLVYCPSVCNFCRGLCRDVGIFIN--GGVRR  191

Query  625  LALTN  639
            LAL++
Sbjct  192  LALSD  196



>gb|AEK26926.1| Kunitz-type trypsin inhibitor B1 [Populus nigra]
Length=212

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 92/191 (48%), Gaps = 27/191 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  28   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  139

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTNSTE  648
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +    N    + + ++
Sbjct  140  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE----NNRGRILSLSD  193

Query  649  SLDNSLIVFKE  681
             L   +++FK+
Sbjct  194  KLSPFVVLFKK  204



>gb|ACO40082.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40094.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40118.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40124.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40128.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40146.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 80/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSEDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GTLGYKLVFCPEDICHCGVLCRDIGIYFE  167



>emb|CAI77767.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77778.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77779.1| kunitz trypsin inhibitor [Populus tremula]
Length=215

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 93/193 (48%), Gaps = 28/193 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +++ F G   G      K      CP+D++  S ++  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIITSIFRGAGGGDVAATNK-----TCPDDVIQYSLDVFQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEP-VDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNS  642
               +  +N F+IE         YKL +CP D       C DVG Y +   G     + + 
Sbjct  139  PGCDTFTNWFKIEKGAGTFGYNYKLVFCPEDICPSVGLCRDVGIYFESNRGR----ILSL  194

Query  643  TESLDNSLIVFKE  681
            ++ L   L+VF++
Sbjct  195  SDKLSPFLVVFRK  207



>gb|ACO40086.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40141.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40149.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40150.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40151.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 79/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F+   A    +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSEDDVIRVSTDLNIKFSIKKACVHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>emb|CAI77771.1| kunitz trypsin inhibitor [Populus tremula]
Length=215

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 93/193 (48%), Gaps = 28/193 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY +++ F G   G      K      CP+D++  S ++  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIITSIFRGAGGGDVAATNK-----TCPDDVIQYSLDVFQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLS-WKVEQ--DDEFGRQLVKAGE---  480
             F+PA  ++ VI  ST   I F+     ++  D+ S WK+++  + E    +   GE   
Sbjct  83   TFSPASSEDDVIRVSTDLNIKFS----IKKACDRSSVWKIQKSSNSEVQWLVTTGGEEGN  138

Query  481  -AVENVSNLFRIEP-VDIGPQIYKLTYCPRD----EDNCYDVGRYLDWATGNTHLALTNS  642
               +  +N F+IE         YKL +CP D       C DVG Y +   G     + + 
Sbjct  139  PGCDTFTNWFKIEKGAGTFGYNYKLVFCPEDICPSVGLCRDVGIYFESNRGR----ILSL  194

Query  643  TESLDNSLIVFKE  681
            ++ L   L+VF++
Sbjct  195  SDKLSPFLVVFRK  207



>ref|XP_003534082.1| PREDICTED: miraculin-like [Glycine max]
 gb|KHM99736.1| Miraculin [Glycine soja]
Length=211

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 80/180 (44%), Gaps = 18/180 (10%)
 Frame = +1

Query  139  TAGQPVMDVDGKVLLAGSEY--YLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLG  312
            T+ + V+D  GKVL  G  Y   +S  +      QG+ L+K+  +  CP D+VV   N  
Sbjct  27   TSPEQVLDTSGKVLREGVNYNILISMPYTSCRSPQGLGLSKIGNS--CPLDVVVVDINHR  84

Query  313  DPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVKAGEAV  486
             P+ F P      VI  +T   I F            + WKV+      G +LV  G  V
Sbjct  85   LPLRFIPVNPKKGVIRVATDLNIMFPDRNVTCPHHSTV-WKVDNFHVSKGHRLVTTGGVV  143

Query  487  -----ENVSNLFRIEPVDIGPQIYKLTY----CPRDEDNCYDVGRYLDWATGNTHLALTN  639
                 E + N F+IE  D G   YKL Y    CP  +  C +VG  +D   GN  LAL++
Sbjct  144  GYPGRETIGNWFKIEKYD-GAYNYKLVYCPSVCPSCKHECKNVGMVVD-QNGNQRLALSD  201



>gb|AAQ84217.1| Kunitz trypsin inhibitor 4 [Populus trichocarpa x Populus deltoides]
 gb|ACS92488.1| Kunitz-type protease inhibitor KPI-D10.2 [Populus trichocarpa 
x Populus deltoides]
Length=212

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 90/187 (48%), Gaps = 19/187 (10%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG+EY + + F G   G      K      CP+D++  S +L  G PV
Sbjct  28   EPVLDIQGEELKAGTEYIIGSIFFGAGGGDVSATNK-----TCPDDVIQYSSDLLQGLPV  82

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  D+ VI  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  83   TFSPASSDDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  139

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTHLALTNSTESLDN  660
             ++ ++N F+IE    G   YKL  CP    +C  + R +     N    + + ++ L  
Sbjct  140  GIDTLTNWFKIEKA--GILGYKLVSCPEGICHCGVLCRDIGIYRENDGRRILSLSDKLSP  197

Query  661  SLIVFKE  681
             L++FK+
Sbjct  198  FLVLFKK  204



>ref|XP_006493432.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=342

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 85/186 (46%), Gaps = 27/186 (15%)
 Frame = +1

Query  133  LPTAGQ----PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP-  297
            LP  G     PV+D+ GK L AGS+YY+      + RG G+ LA       CP D+V   
Sbjct  21   LPVNGNASPDPVVDIAGKQLRAGSKYYILP--VTKGRGGGLTLAGRSNNKTCPLDVVQEQ  78

Query  298  -SFNLGDPVVFTPAV-KDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLV  468
             SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D   G+ LV
Sbjct  79   HSFRNGLPVTFSPVNPKKGVVRESTDLNIKF---DAATSCAQSTVWKLDNFDAVLGQWLV  135

Query  469  KAGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNT  621
              G    N     + N F+IE        YKL +CP         C DVG +++   G  
Sbjct  136  TTGGVEGNPGPRTMRNWFKIEKFY---GDYKLVFCPSVCNFCRGLCRDVGIFIN--GGVR  190

Query  622  HLALTN  639
             LAL++
Sbjct  191  RLALSD  196



>gb|ACO40084.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 80/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+++ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLEIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  D+ VI  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSDDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>gb|ACO40073.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40075.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40076.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40079.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40085.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40087.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40088.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40089.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40092.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40095.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40096.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40097.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40098.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40099.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40102.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40103.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40107.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40109.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40111.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40112.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40113.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40114.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40121.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40122.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40125.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40126.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40129.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40131.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40134.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40135.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40136.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40137.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40147.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40152.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40160.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40162.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40164.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 80/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSEDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 85/185 (46%), Gaps = 23/185 (12%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP--  297
            P+    +  PV+D+ GK L  GS+YY+      + RG G+ LA       CP D+V    
Sbjct  65   PVNGNASPDPVLDIAGKQLRTGSKYYILP--VTKGRGGGLTLAGRSNNKTCPLDVVQEQH  122

Query  298  SFNLGDPVVFTPAV-KDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVK  471
            SF  G PV F+P   K   V EST   I F    AA  CA    WK++  D   G+ L+ 
Sbjct  123  SFKNGLPVTFSPVNPKKGVVRESTDLNIKF---DAATSCAQSTVWKLDNFDAVLGQWLLT  179

Query  472  AGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTH  624
             G    N     + N F+IE    G   YKL YCP         C DVG +++   G   
Sbjct  180  TGGVEGNPGPRTMRNWFKIEKF-FGD--YKLVYCPSVCNFCRGLCRDVGIFIN--GGVRR  234

Query  625  LALTN  639
            LAL++
Sbjct  235  LALSD  239



>ref|XP_011012012.1| PREDICTED: alpha-amylase/subtilisin inhibitor-like [Populus euphratica]
Length=200

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 69/151 (46%), Gaps = 22/151 (15%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCP----NDIVVPSFNL  309
            PV+D DG+ L +G EYY+    TD  G        L  +D    CP     + + P  + 
Sbjct  26   PVLDADGQPLRSGVEYYVLPGVTDVGG-------GLTLVDRNGSCPLYVGQEPLAPMVSR  78

Query  310  GDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKV-EQDDEFGRQLVKAGEAV  486
            G PVVFTP V D  + ES   T++F+    A  C    +W V E++ E  R+ V  G   
Sbjct  79   GIPVVFTPRVGDTIIRESRDFTVAFS---GASTCVQSTAWMVGEENPETRRRYVVTGMEP  135

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNC  579
               S L+     + G  +Y L +CP    NC
Sbjct  136  RPSSTLWYFNIENNGQGVYALRWCP----NC  162



>gb|AEK26932.1| Kunitz-type trypsin inhibitor C6 [Populus nigra]
Length=200

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 72/160 (45%), Gaps = 25/160 (16%)
 Frame = +1

Query  133  LPTAGQP---VMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCP----N  282
            + TA QP   V+D DG+ L +G EYY+    TD  G        L  +D    CP     
Sbjct  17   ISTAAQPWPPVLDADGQPLRSGVEYYVLPGVTDVGG-------GLTLVDRNGSCPLYVGQ  69

Query  283  DIVVPSFNLGDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKV-EQDDEFGR  459
            + + P  + G PVVFTP V D  + ES   T+ F+    A  C    +W V E++ E  R
Sbjct  70   EPLAPMVSRGIPVVFTPRVGDTIIRESRDFTVEFS---GASTCGQSTAWMVGEENPETSR  126

Query  460  QLVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNC  579
            + V  G      S L+     + G  +Y L +CP    NC
Sbjct  127  RYVVTGMEPRPSSTLWYFNIENNGQGVYALRWCP----NC  162



>gb|ACO40145.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 79/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  D+ VI  S    I F+   A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSDDDVIRVSADLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>gb|ACS92509.1| Kunitz-type protease inhibitor KPI-D2.3 [Populus trichocarpa]
 gb|ACS92510.1| Kunitz-type protease inhibitor KPI-D2 [Populus trichocarpa x 
Populus deltoides]
Length=215

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 76/165 (46%), Gaps = 21/165 (13%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A + V+D DG+ L AG+EYY+   F  R RG G+ +A       CP D+V     +  G 
Sbjct  29   ATEAVLDTDGEKLRAGTEYYILPVF--RGRGGGLTMASTR-DETCPLDVVQDPLEISKGL  85

Query  316  PVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL------VKA  474
            P+ FTP      VI  ST   I F+   A+  C     WK+++      Q       V+ 
Sbjct  86   PLTFTPVNPKKGVIRVSTDLNIKFS---ASSICVQSTVWKIQKSVNSEIQWFVTTGGVEG  142

Query  475  GEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN---CYDVGRYL  600
               +E ++N F+IE        YKL +CP   D    C DVG Y+
Sbjct  143  NPGIETITNWFKIEKAG---DDYKLVFCPTVCDCGALCRDVGIYI  184



>ref|XP_002305032.2| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92483.1| Kunitz-type protease inhibitor KPI-D2.2 [Populus trichocarpa]
 gb|ADW95386.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|EEE85543.2| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=215

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 76/165 (46%), Gaps = 21/165 (13%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A + V+D DG+ L AG+EYY+   F  R RG G+ +A       CP D+V     +  G 
Sbjct  29   ATEAVLDTDGEKLRAGTEYYILPVF--RGRGGGLTMASTR-DETCPLDVVQDPLEISKGL  85

Query  316  PVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL------VKA  474
            P+ FTP      VI  ST   I F+   A+  C     WK+++      Q       V+ 
Sbjct  86   PLTFTPVNPKKGVIRVSTDLNIKFS---ASSICVQSTVWKIQKSVNSEIQWFVTTGGVEG  142

Query  475  GEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN---CYDVGRYL  600
               +E ++N F+IE        YKL +CP   D    C DVG Y+
Sbjct  143  NPGIETITNWFKIEKAG---DDYKLVFCPTVCDCGALCRDVGIYI  184



>ref|XP_010428240.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=210

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 91/189 (48%), Gaps = 25/189 (13%)
 Frame = +1

Query  145  GQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDP  318
             QPV+D DG ++  GS Y L      R +G G+ LA      PCP DIV  S  +  G P
Sbjct  23   AQPVLDTDGDIIFGGSYYVLPVI---RGQGGGLTLAGRG-DQPCPLDIVQESSEVDEGIP  78

Query  319  VVFTP-AVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAG----EA  483
            V F+    K  FV ES    ++     AA  C     W V+++ +F    V AG    E 
Sbjct  79   VKFSNWRSKVGFVPESA--NLNIETEVAATICVQSAYWWVDENAKF---RVTAGPKPDEL  133

Query  484  V-ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTHLALTNSTESLDN  660
            V E+  + F+I+  ++    Y+  +CP    +C DVG ++D   G   LALT      DN
Sbjct  134  VKESYLSFFQIQ--NVYDHFYQFAFCPTGPKSCSDVGVFVD-ENGVRRLALTKRA---DN  187

Query  661  S--LIVFKE  681
            +  L++FK+
Sbjct  188  TPFLVMFKK  196



>ref|NP_001241106.1| uncharacterized protein LOC100790688 precursor [Glycine max]
 gb|ACU23857.1| unknown [Glycine max]
 gb|KHM99731.1| Miraculin [Glycine soja]
Length=209

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 82/177 (46%), Gaps = 19/177 (11%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYL--STDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGDPV  321
            + V+D  GK L  G+ YY+  S  +      +G+ LA +     CP D+VV +   G PV
Sbjct  29   EQVVDTLGKKLRVGTNYYIVPSLPYTKIRTTRGLGLASVG-KPYCPLDVVVVNGYHGLPV  87

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL------VKAGE  480
             F+P      VI  ST   I F+A  +       + WK++  D   RQ       V    
Sbjct  88   TFSPVNPKKGVIRVSTDLNIKFSARTSCPRQYSTV-WKLDDFDFSKRQWFVTTGGVVGNP  146

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTHLALTN  639
            ++E + N F+IE  D     YKL YCP      +  C +VG ++D   GN  LALT+
Sbjct  147  SLETIHNWFKIEKYD---GAYKLVYCPSVVKCPKHLCKNVGLFVD-EKGNKRLALTD  199



>gb|ACO40144.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40158.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 79/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F    A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSEDDVIRVSTDLNIKFYIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GTLGYKLVFCPEDICHCGVLCRDIGIYFE  167



>emb|CAI77836.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77840.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77849.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 91/188 (48%), Gaps = 19/188 (10%)
 Frame = +1

Query  109  AAALDPIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPND  285
            A+ L P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D
Sbjct  11   ASTLLPEAVRASGNPVLDVKGSGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLD  67

Query  286  IV-VPSFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEF  453
            ++ + +F + G PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +  
Sbjct  68   VILLENFCVTGTPVTFSIASGDQELFITDSTDVYISF--DSTSNCTNETMVWMHESINGS  125

Query  454  GRQLVKAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWAT  612
              +L+  G    +V+ LFRI  V++G      YKL  Y     D      DVG   D+AT
Sbjct  126  STELLTIGGVEGDVNTLFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFAT  183

Query  613  GNTHLALT  636
            G  +LALT
Sbjct  184  GIRYLALT  191



>gb|ACO40104.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40105.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40106.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40110.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40139.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40140.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40159.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40161.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40163.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 78/165 (47%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G  V
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLTV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQ--LVKAGE----  480
             F+PA  D+ VI  ST   I F+   A +  +    WK+++      Q  +   GE    
Sbjct  68   TFSPASSDDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSKVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>gb|ACO40119.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40127.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40130.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40142.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40157.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 79/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  S    I F+   A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSEDDVIRVSADLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GTLGYKLVFCPEDICHCGVLCRDIGIYFE  167



>gb|ACO40154.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 79/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G  V
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLTV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  D+ VI  ST   I F+   A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSDDDVIRVSTDLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>sp|P80691.1|LSPI_CARPA RecName: Full=Latex serine proteinase inhibitor [Carica papaya]
Length=184

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 73/148 (49%), Gaps = 12/148 (8%)
 Frame = +1

Query  139  TAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGDP  318
             A +P++D+DGK +L G +Y++ +   G A G G+ +        CP  +V   F+ G+P
Sbjct  1    VAPKPIVDIDGKPVLYGVDYFVVSAIWG-AGGGGLTVYGPGNKKKCPLSVVQDPFDNGEP  59

Query  319  VVFTPA--VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVKAGE---  480
            ++F+    VKDN V ES    + F        C +  +WKV++     G  +   GE   
Sbjct  60   IIFSAIKNVKDNIVFESVDLNVKFN---ITINCNETTAWKVDRFPGVIGWTVTLGGEKGY  116

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCP  561
               E+  ++F+I+   + P  YK  +CP
Sbjct  117  HGFESTHSMFKIKKAGL-PFSYKFHFCP  143



>gb|ACO40074.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40083.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40091.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40101.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40108.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40117.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40123.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40138.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40148.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40155.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 79/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F    A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSEDDVIRVSTDLNIKFYIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>gb|AAN15685.1| putative trypsin inhibitor [Arabidopsis thaliana]
Length=215

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 85/188 (45%), Gaps = 22/188 (12%)
 Frame = +1

Query  115  ALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVV  294
            AL  +    A   V+D+DG  +   S Y L      R RG G+ LA      PCP DIV 
Sbjct  17   ALTAVLASNAYGAVVDIDGNAMFHESYYVLPVI---RGRGGGLTLAGRG-GQPCPYDIVQ  72

Query  295  PSFNL--GDPVVFTP-AVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQ-  462
             S  +  G PV F+   +K  FV ES  Q ++      A  C     W+V + D   RQ 
Sbjct  73   ESSEVDEGIPVKFSNWRLKVAFVPES--QNLNIETDVGATICIQSTYWRVGEFDHERRQY  130

Query  463  LVKAGEAVE-----NVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATG  615
             V AG   E     ++ + F+IE    G   YK  +CPR  D+    C DVG ++D   G
Sbjct  131  FVVAGPKPEGFGQDSLKSFFKIEKS--GEDAYKFVFCPRTCDSGNPKCSDVGIFID-ELG  187

Query  616  NTHLALTN  639
               LAL++
Sbjct  188  VRRLALSD  195



>gb|AAK96757.1| putative trypsin inhibitor [Arabidopsis thaliana]
Length=205

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 85/188 (45%), Gaps = 22/188 (12%)
 Frame = +1

Query  115  ALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVV  294
            AL  +    A   V+D+DG  +   S Y L      R RG G+ LA      PCP DIV 
Sbjct  17   ALTAVLASNAYGAVVDIDGNAMFHESYYVLPVI---RGRGGGLTLAGRG-GQPCPYDIVQ  72

Query  295  PSFNL--GDPVVFTP-AVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQ-  462
             S  +  G PV F+   +K  FV ES  Q ++      A  C     W+V + D   RQ 
Sbjct  73   ESSEVDEGIPVKFSNWRLKVAFVPES--QNLNIETDVGATICIQSTYWRVGEFDHERRQY  130

Query  463  LVKAGEAVE-----NVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATG  615
             V AG   E     ++ + F+IE    G   YK  +CPR  D+    C DVG ++D   G
Sbjct  131  FVVAGPKPEGFGQDSLKSFFKIEKS--GEDAYKFVFCPRTCDSGNPKCSDVGIFID-ELG  187

Query  616  NTHLALTN  639
               LAL++
Sbjct  188  VRRLALSD  195



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 74/172 (43%), Gaps = 18/172 (10%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPVV  324
            PV+D+ GK L AG  YY+      R RG G+ LA       CP  +V     L  G P+ 
Sbjct  32   PVLDISGKELRAGVNYYILPVI--RGRGGGLSLASTGNNT-CPLSVVQEQSELKKGLPLT  88

Query  325  FTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVEN---  492
            F P   K   V  ST   I F+   A+  C     W+++ D+  G+  V  G    N   
Sbjct  89   FHPVDPKKGVVRLSTDHNIKFS---ASTICVQSTVWRLDNDESTGKYFVNTGGVEGNPGS  145

Query  493  --VSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWAT--GNTHLALT  636
              +SN F+IE    G   YKL +CP   + C  + R +      G   L LT
Sbjct  146  GSISNWFKIEAY--GSSDYKLLFCPTVCNFCKVICRDVGIVVQDGKRRLGLT  195



>gb|KDP46945.1| hypothetical protein JCGZ_07962 [Jatropha curcas]
Length=175

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 72/150 (48%), Gaps = 24/150 (16%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCP----NDIVVPSFNLG  312
            ++D DG+ L +G EY++   +TD AG        L  ++ T  CP     + +    + G
Sbjct  7    ILDTDGQPLTSGVEYFVLPAATDIAG-------GLTLVNRTGSCPLYVGQEPLSTVVSQG  59

Query  313  DPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVEN  492
             PVVFTP   D+ V E    T++F+   A+  C     W+VE D+E  R  +  G     
Sbjct  60   LPVVFTPNDGDSVVREDISFTVAFS---ASTTCVQSTGWRVENDEEVSRTFIVTGGD---  113

Query  493  VSNLFRIEPVDIGPQIYKLTYCPR-DEDNC  579
              + FRI+  D G  +Y L +CP  D  NC
Sbjct  114  -QSFFRIQIDDNG--LYNLIWCPVCDRPNC  140



>gb|ACO40093.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40143.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 79/165 (48%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  S    I F+   A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSEDDVIRVSADLNIKFSIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>gb|AAG52121.1|AC010556_3 putative trypsin inhibitor; 19671-20297 [Arabidopsis thaliana]
Length=208

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 85/188 (45%), Gaps = 22/188 (12%)
 Frame = +1

Query  115  ALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVV  294
            AL  +    A   V+D+DG  +   S Y L      R RG G+ LA      PCP DIV 
Sbjct  10   ALTAVLASNAYGAVVDIDGNAMFHESYYVLPVI---RGRGGGLTLAGRG-GQPCPYDIVQ  65

Query  295  PSFNL--GDPVVFTP-AVKDNFVIESTFQTISFTaaaaaeecaDKLSWKV-EQDDEFGRQ  462
             S  +  G PV F+   +K  FV ES  Q ++      A  C     W+V E D E  + 
Sbjct  66   ESSEVDEGIPVKFSNWRLKVAFVPES--QNLNIETDVGATICIQSTYWRVGEFDHERKQY  123

Query  463  LVKAGEAVE-----NVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATG  615
             V AG   E     ++ + F+IE    G   YK  +CPR  D+    C DVG ++D   G
Sbjct  124  FVVAGPKPEGFGQDSLKSFFKIEKS--GEDAYKFVFCPRTCDSGNPKCSDVGIFID-ELG  180

Query  616  NTHLALTN  639
               LAL++
Sbjct  181  VRRLALSD  188



>ref|NP_565061.1| kunitz trypsin inhibitor 1 [Arabidopsis thaliana]
 gb|AAL91212.1| putative trypsin inhibitor [Arabidopsis thaliana]
 gb|AAO00908.1| putative trypsin inhibitor [Arabidopsis thaliana]
 dbj|BAF02103.1| putative trypsin inhibitor [Arabidopsis thaliana]
 gb|AEE35435.1| kunitz trypsin inhibitor 1 [Arabidopsis thaliana]
Length=215

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 85/188 (45%), Gaps = 22/188 (12%)
 Frame = +1

Query  115  ALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVV  294
            AL  +    A   V+D+DG  +   S Y L      R RG G+ LA      PCP DIV 
Sbjct  17   ALTAVLASNAYGAVVDIDGNAMFHESYYVLPVI---RGRGGGLTLAGRG-GQPCPYDIVQ  72

Query  295  PSFNL--GDPVVFTP-AVKDNFVIESTFQTISFTaaaaaeecaDKLSWKV-EQDDEFGRQ  462
             S  +  G PV F+   +K  FV ES  Q ++      A  C     W+V E D E  + 
Sbjct  73   ESSEVDEGIPVKFSNWRLKVAFVPES--QNLNIETDVGATICIQSTYWRVGEFDHERKQY  130

Query  463  LVKAGEAVE-----NVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATG  615
             V AG   E     ++ + F+IE    G   YK  +CPR  D+    C DVG ++D   G
Sbjct  131  FVVAGPKPEGFGQDSLKSFFKIEKS--GEDAYKFVFCPRTCDSGNPKCSDVGIFID-ELG  187

Query  616  NTHLALTN  639
               LAL++
Sbjct  188  VRRLALSD  195



>pdb|3S8J|A Chain A, Crystal Structure Of A Papaya Latex Serine Protease 
Inhibitor (ppi) At 2.6a Resolution
 pdb|3S8J|B Chain B, Crystal Structure Of A Papaya Latex Serine Protease 
Inhibitor (ppi) At 2.6a Resolution
 pdb|3S8K|A Chain A, Crystal Structure Of A Papaya Latex Serine Protease 
Inhibitor (ppi) At 1.7a Resolution
 pdb|3S8K|B Chain B, Crystal Structure Of A Papaya Latex Serine Protease 
Inhibitor (ppi) At 1.7a Resolution
Length=184

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 73/148 (49%), Gaps = 12/148 (8%)
 Frame = +1

Query  139  TAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGDP  318
             A +P++D+DGK +L G +Y++ +   G A G G+ +        CP  +V   F+ G+P
Sbjct  1    VAPKPIVDIDGKPVLYGVDYFVVSAIWG-AGGGGLTVYGPGNKKKCPLSVVQDPFDNGEP  59

Query  319  VVFTPA--VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVKAGE---  480
            ++F+    VKDN V ES    + F        C +  +WKV++     G  +   GE   
Sbjct  60   IIFSAIKNVKDNIVRESVDLNVKFN---ITINCNETTAWKVDRFPGVIGWTVTLGGEKGY  116

Query  481  -AVENVSNLFRIEPVDIGPQIYKLTYCP  561
               E+  ++F+I+   + P  YK  +CP
Sbjct  117  HGFESTHSMFKIKKAGL-PFSYKFHFCP  143



>ref|NP_173228.1| kunitz family trypsin and protease inhibitor protein [Arabidopsis 
thaliana]
 gb|AAF97266.1|AC034106_9 Contains similarity to a tumor-related protein from Nicotiana 
tabacum gb|U66263 and contains a trypsin and protease inhibitor 
PF|00197 domain. ESTs gb|AV561824, gb|T44961, gb|H36186, 
gb|T45060, gb|N38006, gb|F19847 come from this gene [Arabidopsis 
thaliana]
 gb|AAG48779.1|AF332416_1 putative lemir (miraculin) protein [Arabidopsis thaliana]
 gb|AAK48962.1|AF370535_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK95260.1|AF410274_1 At1g17860/F2H15_8 [Arabidopsis thaliana]
 gb|AAM10091.1| unknown protein [Arabidopsis thaliana]
 gb|AAM19885.1| At1g17860/F2H15_8 [Arabidopsis thaliana]
 gb|AEE29645.1| kunitz type trypsin and protease inhibitor domain-containing 
protein [Arabidopsis thaliana]
Length=196

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 81/178 (46%), Gaps = 29/178 (16%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A +PV D++GK LL G  YY+      R RG G+ ++ L  T  CP  ++   F +  G 
Sbjct  25   AVEPVKDINGKSLLTGVNYYILPVI--RGRGGGLTMSNLK-TETCPTSVIQDQFEVSQGL  81

Query  316  PVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVE--  489
            PV F+P  K   +  ST   I F+  +          W++   DE  +Q   +   VE  
Sbjct  82   PVKFSPYDKSRTIPVSTDVNIKFSPTSI---------WELANFDETTKQWFISTCGVEGN  132

Query  490  ----NVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
                 V N F+I+  +   + YK+ +CP   +     C DVG ++    G   LAL++
Sbjct  133  PGQKTVDNWFKIDKFE---KDYKIRFCPTVCNFCKVICRDVGVFVQ--DGKRRLALSD  185



>gb|KHM99732.1| Miraculin [Glycine soja]
Length=207

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 81/191 (42%), Gaps = 28/191 (15%)
 Frame = +1

Query  160  DVDGKVLLAGSEYYLS-------TDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGDP  318
            D  GK L A + Y++          F     G G+ L  +D    CP D+++   N G P
Sbjct  27   DTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDSID--ESCPLDVIIEKANEGLP  84

Query  319  VVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVKAGEAVEN-  492
            + F+P      VI  +     F + +          W ++Q D   G+  V  G  V N 
Sbjct  85   LRFSPVNTKKGVIRVSTDLNIFFSDSDERCPHHSTVWMLDQFDASIGQTYVTTGGVVGNP  144

Query  493  ----VSNLFRIEPVDIGPQIYKLTYCPRDEDNCY----DVGRYLDWATGNTHLALTNSTE  648
                + N F+I+  +     YKL YCPR   +C+    D+G ++D A    HLAL++   
Sbjct  145  GEHTILNWFKIQKYE---DAYKLVYCPRVCPSCHHLCKDIGMFVD-ANRRMHLALSD---  197

Query  649  SLDNSLIVFKE  681
              D   I FKE
Sbjct  198  --DPFKIKFKE  206



>gb|ACO40100.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 78/165 (47%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPV  321
            +PV+D+ G+ L AG EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGREYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  ST   I F    A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSEDDVIRVSTDLNIKFYIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>ref|XP_006353921.1| PREDICTED: cysteine protease inhibitor 9-like [Solanum tuberosum]
Length=227

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 84/184 (46%), Gaps = 30/184 (16%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEY-YLSTDFAGRARGQGVKLAKLDFTAPCPNDIV---VPSFNLGDP  318
            PV+D++G  L    EY  LS  F G +    V LA +D    CPN +V      F+   P
Sbjct  38   PVLDMEGHSLKINEEYSILSIPFGGGS----VYLADIDNRTECPNGVVQDRSGDFDHSTP  93

Query  319  VVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFG------RQLVKAGE  480
            V+F     DNFV E    +I F+ +++ + C ++  W+   +   G      R ++  G 
Sbjct  94   VLF--YTMDNFVFEDQDVSIMFSTSSSTKSCFNETVWQA-GNHMLGPIRPPPRFVITGGT  150

Query  481  ----AVENVSNLFRIEPVDIG-PQIYKLTYCPRD------EDNCYDVGRYLDWATGNTHL  627
                    ++N F+IE  +   P  YKL YCP        + +C DVG Y D   G T L
Sbjct  151  LGIPGPNTLNNWFKIEKYETERPHSYKLRYCPSKYMCPTCQFDCADVGLYED--RGYTRL  208

Query  628  ALTN  639
            AL N
Sbjct  209  ALNN  212



>emb|CAI77815.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77834.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77837.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77838.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 90/188 (48%), Gaps = 19/188 (10%)
 Frame = +1

Query  109  AAALDPIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPND  285
            A+ L P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D
Sbjct  11   ASTLLPEAVRASGNPVLDVKGSGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLD  67

Query  286  IV-VPSFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEF  453
            ++ + +F + G PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +  
Sbjct  68   VILLENFCVTGTPVTFSIASGDQELFITDSTDVYISF--DSTSNCTNETMVWMHESINGS  125

Query  454  GRQLVKAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWAT  612
              +L+  G    +V+ LFRI  V++G      YKL  Y     D      DVG   D+ T
Sbjct  126  STELLTIGGVEGDVNTLFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTT  183

Query  613  GNTHLALT  636
            G  +LALT
Sbjct  184  GIRYLALT  191



>emb|CAI77814.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77816.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77817.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77820.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77821.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77822.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77841.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77846.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77847.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77848.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 90/188 (48%), Gaps = 19/188 (10%)
 Frame = +1

Query  109  AAALDPIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPND  285
            A+ L P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D
Sbjct  11   ASTLLPEAVRASGNPVLDVKGSGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLD  67

Query  286  IV-VPSFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEF  453
            ++ + +F + G PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +  
Sbjct  68   VILLENFCVTGTPVTFSIASGDQELFITDSTDVYISF--DSTSNCTNETMVWMHESINGS  125

Query  454  GRQLVKAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWAT  612
              +L+  G    +V+ LFRI  V++G      YKL  Y     D      DVG   D+ T
Sbjct  126  STELLTIGGVEGDVNTLFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTT  183

Query  613  GNTHLALT  636
            G  +LALT
Sbjct  184  GIRYLALT  191



>gb|ADW95381.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=214

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 87/183 (48%), Gaps = 19/183 (10%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VP  297
            P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + 
Sbjct  18   PEAVRASGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLE  74

Query  298  SFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLV  468
            +F + G PV FT A  D   F+ +ST   ISF   + +    + + W  E  +    +L+
Sbjct  75   NFCVTGTPVTFTIASGDQELFITDSTDLYISF--DSTSNCTNETMVWMHESSNSSSTELL  132

Query  469  KAGEAVENVSNLFRIEPVDIGPQI---YK-LTYCPRDED---NCYDVGRYLDWATGNTHL  627
              G    +V+ LFRI  V++G      YK L Y     D      DVG   D+ TG  +L
Sbjct  133  TIGGVEGDVNTLFRI--VNVGGSFVSNYKLLAYKLSSYDLALTTSDVGAVFDFTTGIRYL  190

Query  628  ALT  636
            ALT
Sbjct  191  ALT  193



>ref|XP_002326017.2| hypothetical protein POPTR_0019s11800g [Populus trichocarpa]
 gb|EEF00399.2| hypothetical protein POPTR_0019s11800g [Populus trichocarpa]
Length=218

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 87/183 (48%), Gaps = 19/183 (10%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VP  297
            P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + 
Sbjct  22   PEAVRASGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLE  78

Query  298  SFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLV  468
            +F + G PV FT A  D   F+ +ST   ISF   + +    + + W  E  +    +L+
Sbjct  79   NFCVTGTPVTFTIASGDQELFITDSTDLYISF--DSTSNCTNETMVWMHESSNSSSTELL  136

Query  469  KAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHL  627
              G    +V+ LFRI  V++G      YKL  Y     D      DVG   D+ TG  +L
Sbjct  137  TIGGVEGDVNTLFRI--VNVGGSFVSNYKLVAYKLSSYDLALTASDVGAVFDFTTGIRYL  194

Query  628  ALT  636
            ALT
Sbjct  195  ALT  197



>gb|ACS92505.1| Kunitz-type protease inhibitor KPI-E1 [Populus trichocarpa x 
Populus deltoides]
Length=214

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 87/183 (48%), Gaps = 19/183 (10%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VP  297
            P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + 
Sbjct  18   PEAVRASGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLE  74

Query  298  SFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLV  468
            +F + G PV FT A  D   F+ +ST   ISF   + +    + + W  E  +    +L+
Sbjct  75   NFCVTGTPVTFTIASGDQELFITDSTDLYISF--DSTSNCTNETMVWMHESSNSSSTELL  132

Query  469  KAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHL  627
              G    +V+ LFRI  V++G      YKL  Y     D      DVG   D+ TG  +L
Sbjct  133  TIGGVEGDVNTLFRI--VNVGGSFVSNYKLVAYKLSSYDLALTASDVGAVFDFTTGIRYL  190

Query  628  ALT  636
            ALT
Sbjct  191  ALT  193



>ref|XP_010101167.1| hypothetical protein L484_005403 [Morus notabilis]
 gb|EXB87528.1| hypothetical protein L484_005403 [Morus notabilis]
Length=197

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 85/175 (49%), Gaps = 24/175 (14%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPVVF  327
            V+D+ GK L  G +YY+      R RG G+KLA        P D+V   F +  G P+ F
Sbjct  24   VLDLSGKKLQKGVDYYILPVI--RGRGGGLKLANAR-NKTSPLDVVQDQFEVSSGFPLTF  80

Query  328  TPAVKD-NFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDE-FGRQLVKAGEAVEN---  492
            +PA ++ +FV  ST   I F+AA    +      WK++  DE  G+  V +G    N   
Sbjct  81   SPANQNQSFVCLSTDLNIKFSAATTCAQST---VWKLDSFDESLGQWFVTSGGVEGNPGR  137

Query  493  --VSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALTN  639
              +SN F+IE  +     YKL +CP   +     C DVG Y+    G   LAL++
Sbjct  138  QTISNWFKIEKYN---DDYKLVFCPTVCNFCKVLCRDVGIYIK--DGIRRLALSD  187



>ref|XP_006351546.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=205

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 83/177 (47%), Gaps = 25/177 (14%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP---SFNLGDPVV  324
            V+D+DGK+L  G +YY+      R RG G+ +  +     CP D VV      + G P+ 
Sbjct  31   VVDIDGKILRTGVDYYILP--VVRGRGGGLTMDSIG-DKICPLDAVVQEHHEIDQGLPLT  87

Query  325  FTPAV-KDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDE-FGRQLVKAG-----EA  483
            FTP   K   + EST   I F+A +   +      WK++  DE  G+  +  G       
Sbjct  88   FTPVNPKKGVIRESTDLNIIFSANSICVQTT---QWKLDDFDETTGQYFITLGGTQGNPG  144

Query  484  VENVSNLFRIEPVDIGPQIYKLTYCPRDED----NCYDVGRYLDWATGNTHLALTNS  642
             E VSN  +IE  D   + YKL YCP   D     C D+G ++    G   LAL+++
Sbjct  145  RETVSNWIKIEKFD---RDYKLLYCPTVCDICKVICKDIGIFI--QDGVRRLALSDA  196



>ref|XP_007029361.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
 gb|EOY09863.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
Length=198

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 82/175 (47%), Gaps = 23/175 (13%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPVV  324
            PV+D+ G+ L  G++YY+      R  G G+ LA       CP D+V     +  G P+ 
Sbjct  25   PVLDISGEELRTGTDYYILPVI--RGGGGGLTLASTG-NETCPLDVVQEQLEVSNGLPLT  81

Query  325  FTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGE-----AV  486
            F+P  +    V  ST   I F+   AA  C     WK++ D+   + +V  G       +
Sbjct  82   FSPVNITKGVVRVSTDLNIKFS---AATICVQSTVWKLDNDEATQKMVVTTGGVEGNPGI  138

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCY----DVGRYLDWATGNTHLALTN  639
            E +SN F+IE  +     YKL +CP   D C     D+G ++D   G   LAL++
Sbjct  139  ETLSNWFKIERYE---DDYKLVFCPGVCDFCRPVCGDLGVFID--AGIRRLALSD  188



>ref|XP_003534083.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 82/185 (44%), Gaps = 28/185 (15%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDF----AGRAR----GQGVKLAKLDFTAPCPNDIVVPSF  303
            + V+D  GK L AG  YY+         GR      G G+ LA +  +  CP D+VV   
Sbjct  28   EQVVDTSGKKLRAGLSYYIVPAVPLTRCGRYERCMGGGGLSLASIGES--CPLDVVVVPR  85

Query  304  NLGDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVKAG  477
            + G P+ F+P   K   V  ST   I F+    +      + WK++  D   G+  V  G
Sbjct  86   SHGLPLQFSPVDPKKGVVRVSTDLNIMFSTDHTSCAEYSPV-WKLDHFDVSKGKWFVSTG  144

Query  478  EAV-----ENVSNLFRIEPVDIGPQIYKLTYCP------RDEDNCYDVGRYLDWATGNTH  624
             ++     E + N F+IE  D     YK+ YCP        +  C D+G ++D   G   
Sbjct  145  GSMGNPSWETIRNWFKIEKCD---GAYKIVYCPSVFPSSSSKHMCKDIGVFVD-ENGFRR  200

Query  625  LALTN  639
            LAL+N
Sbjct  201  LALSN  205



>ref|XP_011023016.1| PREDICTED: endogenous alpha-amylase/subtilisin inhibitor-like 
[Populus euphratica]
Length=202

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 71/151 (47%), Gaps = 20/151 (13%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCP----NDIVVPSFNL  309
            PV+D DG+ L +G EYY+   +TD AG     G+ L  L+  + CP     + + P  + 
Sbjct  26   PVLDADGQPLRSGVEYYVLPAATDVAG-----GLTLVNLNNGSICPLFVGQEPLAPVVSP  80

Query  310  GDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKV-EQDDEFGRQLVKAGEAV  486
            G  V+FTP V D  + E+   T++FT       CA   +W V EQ+ E  R+ + A    
Sbjct  81   GTSVIFTPRVADTVIRETRDFTVAFT---GPTICAQSTAWMVGEQNPETRRRYILAEMDP  137

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNC  579
               SN +    V     +Y   +CP    NC
Sbjct  138  SPSSNAWHFNIVKNDQGLYNFQWCP----NC  164



>ref|XP_011035408.1| PREDICTED: miraculin-like [Populus euphratica]
Length=206

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 82/187 (44%), Gaps = 25/187 (13%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGD--  315
            A +PV+D+ GKVL  G+ Y +      R RG G+  A     + CP D++   +   D  
Sbjct  28   APEPVLDIAGKVLRTGTYYDILPVV--RGRGSGITFAITGHKS-CPVDVMQEDYEDSDGL  84

Query  316  PVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL------VKA  474
            P+ F PA +   VI  ST   I F   A+    A    WKVE+ DE   Q+      V+ 
Sbjct  85   PLQFIPANRKKGVIRLSTDLNIKFPGTASCAPTA---VWKVEKYDELTGQMFISTSGVEG  141

Query  475  GEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN-----CYDVGRYLDWATGNT--HLAL  633
                E V N F+IE        YKL +CP   ++     C D+G Y+         H  L
Sbjct  142  NPGPETVDNWFKIEKYG---NDYKLVFCPTVCNDHCKVLCKDIGIYVQEVLKIIIGHECL  198

Query  634  TNSTESL  654
            TN  + L
Sbjct  199  TNEIKWL  205



>ref|XP_010428238.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=209

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 92/189 (49%), Gaps = 25/189 (13%)
 Frame = +1

Query  145  GQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDP  318
             QPV+D DG ++  GS Y L      R +G G+ LA      PCP DIV  S  +  G P
Sbjct  22   AQPVLDTDGDIIFDGSYYVLPVI---RGQGGGLTLAGRG-DQPCPLDIVQESSEVDEGIP  77

Query  319  VVFTP-AVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAG----EA  483
            V F+    K  FV ES  + ++     AA  C     W V+++ +F    V AG    E 
Sbjct  78   VKFSNWRSKVGFVPES--ENLNIETEVAATICVQLAYWWVDENAKF---RVTAGPKPDEL  132

Query  484  V-ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTHLALTNSTESLDN  660
            V E+  + F+I+  ++    Y+  +CP    +C DVG ++D   G   L LT  +   DN
Sbjct  133  VKESYLSFFQIQ--NVYDHFYQFAFCPTGPKSCSDVGVFVD-ENGVRRLVLTKRS---DN  186

Query  661  S--LIVFKE  681
            +  L++FK+
Sbjct  187  TPFLVMFKK  195



>gb|ACO40081.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 78/165 (47%), Gaps = 23/165 (14%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN--LGDPV  321
            +PV+D+ G+ L AG+EY +++   G   G      K      CP+D++  S +   G PV
Sbjct  13   EPVLDIQGEELKAGTEYIITSAIWGAGGGDVSATNK-----TCPDDVIQYSLDQLQGLPV  67

Query  322  VFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGE----  480
             F+PA  ++ VI  S    I F    A +  +    WK+++  + E    +   GE    
Sbjct  68   TFSPASSEDDVIRVSADLNIKFYIKKACDHSS---VWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  481  AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLD  603
             V  ++N F+IE    G   YKL +CP D  +    C D+G Y +
Sbjct  125  GVHTLTNWFKIEKA--GILGYKLVFCPEDICHCGVLCRDIGIYFE  167



>ref|XP_010683194.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=208

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 72/164 (44%), Gaps = 14/164 (9%)
 Frame = +1

Query  115  ALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVV  294
             L P+    A   V+D++G+ L A S YY+      R RG G+++   + T  CP   V 
Sbjct  17   CLSPLTSTAANIAVLDINGRPLQARSNYYILPVI--RGRGGGLRMTPKNATQLCPLAYVA  74

Query  295  ---PSFNLGDPVVFTPAV-KDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQ  462
                    G P+ F P   KD  +  ST     F    AA  C     W++  D+  GR+
Sbjct  75   QEGSELANGLPLKFYPVNPKDKTISLSTDLNFVFD---AATICVQSTQWRLAFDEVTGRR  131

Query  463  LVKAGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPRDEDNC  579
             V  G  + N     VSN F+IE  + G   YK+ +CP   + C
Sbjct  132  YVGFGGEIGNPGGNTVSNWFKIEKAETGKYDYKIVFCPGVCNFC  175



>gb|AAQ96377.1| miraculin-like protein [Solanum palustre]
Length=209

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 72/152 (47%), Gaps = 19/152 (13%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVV---PSFNLGDPVV  324
            V+D+DGK+L  G +YY+      R RG G+ +  +     CP D VV      + G P+ 
Sbjct  35   VVDIDGKILRTGVDYYILP--VVRGRGGGLTMDSIG-DKICPLDAVVQEHQEIDQGLPLT  91

Query  325  FTPAV-KDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDE-FGRQLVKAG-----EA  483
            FTP   K   + EST   I F+A +   +      WK++  DE  G+  +  G       
Sbjct  92   FTPVNPKKGVIRESTDLNIIFSANSICVQTT---QWKLDDFDETTGQYFITLGGNQGNPG  148

Query  484  VENVSNLFRIEPVDIGPQIYKLTYCPRDEDNC  579
             E +SN F+IE  D   + YKL YCP   D C
Sbjct  149  RETISNWFKIEKFD---RDYKLLYCPTVCDFC  177



>emb|CAI77835.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77842.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77843.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 87/183 (48%), Gaps = 19/183 (10%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VP  297
            P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + 
Sbjct  16   PEAVRASGNPVLDVKGSGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLE  72

Query  298  SFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLV  468
            +F + G PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +    +L+
Sbjct  73   NFCVTGTPVTFSIASGDQGLFITDSTDVYISF--DSTSNCTNETMVWMHESINGSSTELL  130

Query  469  KAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHL  627
              G    +V+ +FRI  V++G      YKL  Y     D      DVG   D+ TG  HL
Sbjct  131  TIGGVEGDVNTIFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTTGIRHL  188

Query  628  ALT  636
            ALT
Sbjct  189  ALT  191



>emb|CAI77808.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 90/188 (48%), Gaps = 19/188 (10%)
 Frame = +1

Query  109  AAALDPIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPND  285
            A+ L P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D
Sbjct  11   ASTLLPEAVRASGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLD  67

Query  286  IV-VPSFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEF  453
            ++ + +F + G PV F+ A  +   F+ +ST   ISF   + +    + + W  E  +  
Sbjct  68   VILLENFCVTGTPVTFSIASGNQELFITDSTDVYISF--DSTSNCTNETMVWMHESINGS  125

Query  454  GRQLVKAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWAT  612
              +L+  G    +V+ +FRI  V++G      YKL  Y     D      DVG   D+ T
Sbjct  126  STELLTIGGVEGDVNTIFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTT  183

Query  613  GNTHLALT  636
            G  HLALT
Sbjct  184  GIRHLALT  191



>ref|XP_011072079.1| PREDICTED: miraculin [Sesamum indicum]
Length=206

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 83/192 (43%), Gaps = 31/192 (16%)
 Frame = +1

Query  100  PHSAAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCP  279
            P SAAA +P        PV+D D  ++ AG +YY+      R RG G+ LA       CP
Sbjct  21   PLSAAAEEP-------APVLDTDRNLVRAGVDYYILPVI--RGRGGGLTLASTG-NETCP  70

Query  280  NDIVVPSFNL--GDPVVFTPAV-KDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DD  447
             D+V     +  G P+ F P   K   V  ST Q I F+    A  C     WK++  D 
Sbjct  71   LDVVQEQLEVRNGLPLTFRPVNPKKGVVRVSTDQNIKFS---GATICVQSTVWKLDNYDA  127

Query  448  EFGRQLVKAGE-----AVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYL  600
              G+  +  G        E +SN F+IE        YKL +CP   +     C DVG ++
Sbjct  128  STGKYFITTGGVEGKPGRETISNWFKIETYG---DDYKLVFCPTVCNYCKVICKDVGIFM  184

Query  601  DWATGNTHLALT  636
                G   LALT
Sbjct  185  Q--DGKRRLALT  194



>emb|CAI77823.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77824.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77839.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77844.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77850.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77851.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 90/188 (48%), Gaps = 19/188 (10%)
 Frame = +1

Query  109  AAALDPIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPND  285
            A+ L P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D
Sbjct  11   ASTLLPEAVRASGNPVLDVKGSGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLD  67

Query  286  IV-VPSFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEF  453
            ++ + +F + G PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +  
Sbjct  68   VILLENFCVTGTPVTFSIASGDQELFITDSTDVYISF--DSTSNCTNETMVWMHESINGS  125

Query  454  GRQLVKAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWAT  612
              +L+  G    +V+ +FRI  V++G      YKL  Y     D      DVG   D+ T
Sbjct  126  STELLTIGGVEGDVNTIFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTT  183

Query  613  GNTHLALT  636
            G  +LALT
Sbjct  184  GIRYLALT  191



>emb|CAI77818.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77819.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77828.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77831.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77845.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 90/188 (48%), Gaps = 19/188 (10%)
 Frame = +1

Query  109  AAALDPIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPND  285
            A+ L P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D
Sbjct  11   ASTLLPEAVRASGNPVLDVKGSGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLD  67

Query  286  IV-VPSFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEF  453
            ++ + +F + G PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +  
Sbjct  68   VILLENFCVTGTPVTFSIASGDQELFITDSTDVYISF--DSTSNCTNETMVWMHESINGS  125

Query  454  GRQLVKAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWAT  612
              +L+  G    +V+ +FRI  V++G      YKL  Y     D      DVG   D+ T
Sbjct  126  STELLTIGGVEGDVNTIFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTT  183

Query  613  GNTHLALT  636
            G  +LALT
Sbjct  184  GIRYLALT  191



>sp|P13087.3|MIRA_SYNDU RecName: Full=Miraculin; Short=MIR; Flags: Precursor [Synsepalum 
dulcificum]
 dbj|BAA07603.1| miraculin precursor [Synsepalum dulcificum]
 dbj|BAH84844.1| miraculin [Synsepalum dulcificum]
Length=220

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 86/192 (45%), Gaps = 16/192 (8%)
 Frame = +1

Query  139  TAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIV--VPSFNLG  312
            +A  PV+D+DG+ L  G+ YY+         G  V     + T  CP  +V      +  
Sbjct  31   SAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHD  90

Query  313  DPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL------VK  471
             P+ F P   K++ V  ST   I+F+A       +  + W++++ DE   Q       VK
Sbjct  91   RPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTV-WRLDKYDESTGQYFVTIGGVK  149

Query  472  AGEAVENVSNLFRIEPVDIGPQIYKLTYCP----RDEDNCYDVGRYLDWATGNTHLALTN  639
                 E +S+ F+IE    G   YKL +CP      +  C DVG Y+D   G   LAL++
Sbjct  150  GNPGPETISSWFKIEEF-CGSGFYKLVFCPTVCGSCKVKCGDVGIYID-QKGRRRLALSD  207

Query  640  STESLDNSLIVF  675
               + + +  V+
Sbjct  208  KPFAFEFNKTVY  219



>gb|KHM99737.1| Miraculin [Glycine soja]
Length=215

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 80/184 (43%), Gaps = 28/184 (15%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYL-------STDFAGRARGQGVKLAKLDFTAPCPNDI-VVPSFNL  309
            V+D  G +L  G+ YY+        + F+      G+ LAK+      P D+ VV    L
Sbjct  30   VVDTSGNILRVGANYYIIPNPTTKCSIFSNYKGNNGLVLAKVAANKTFPLDVLVVEGQQL  89

Query  310  GDPVVFTP---AVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQ-LVKAG  477
            G P+ FTP     K   V  ST   I F+   +  +      WK++  D   R+  V  G
Sbjct  90   GQPLTFTPIHDQKKGAPVRVSTDLNIEFSMQTSCSQSN---VWKIDHFDRATRKWFVTTG  146

Query  478  EAV-----ENVSNLFRIEPVDIGPQIYKL----TYCPRDEDNCYDVGRYLDWATGNTHLA  630
              V       +SN F+IE  D     YKL    T+C   +  C D+G Y D   GN  LA
Sbjct  147  GVVGHPSWRTISNWFKIEKYD---GDYKLVSCPTFCAYCKVQCRDIGVYED-QNGNKRLA  202

Query  631  LTNS  642
            LT++
Sbjct  203  LTDA  206



>gb|AFZ84561.1| Kunitz trypsin inhibitor [Populus nigra]
Length=218

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 87/183 (48%), Gaps = 19/183 (10%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VP  297
            P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + 
Sbjct  22   PEAVRASGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLE  78

Query  298  SFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLV  468
            +F + G PV FT A  D   F+ +ST   ISF   + +    + + W  E  +    +L+
Sbjct  79   NFCVTGTPVTFTIASGDQELFITDSTDLYISF--DSTSNCTNETMVWMHESSNSSSTELL  136

Query  469  KAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHL  627
              G    +V+ +FRI  V++G      YKL  Y     D      DVG   D+ TG  +L
Sbjct  137  TIGGVEGDVNTIFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTTGIRYL  194

Query  628  ALT  636
            ALT
Sbjct  195  ALT  197



>gb|AEK26928.1| Kunitz-type trypsin inhibitor D2 [Populus nigra]
Length=218

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 87/183 (48%), Gaps = 19/183 (10%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VP  297
            P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + 
Sbjct  22   PEAVRASGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLE  78

Query  298  SFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLV  468
            +F + G PV FT A  D   F+ +ST   ISF   + +    + + W  E  +    +L+
Sbjct  79   NFCVTGTPVTFTIASGDQELFITDSTDLYISF--DSTSNCTNETMVWMHESSNSSSTELL  136

Query  469  KAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHL  627
              G    +V+ +FRI  V++G      YKL  Y     D      DVG   D+ TG  +L
Sbjct  137  TIGGVEGDVNTIFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTTGIRYL  194

Query  628  ALT  636
            ALT
Sbjct  195  ALT  197



>ref|XP_006441462.1| hypothetical protein CICLE_v10022041mg [Citrus clementina]
 dbj|BAE79510.1| miraculin-like protein 1 [Citrus jambhiri]
 gb|ESR54702.1| hypothetical protein CICLE_v10022041mg [Citrus clementina]
 gb|KDO42047.1| hypothetical protein CISIN_1g040351mg [Citrus sinensis]
Length=232

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 73/169 (43%), Gaps = 20/169 (12%)
 Frame = +1

Query  139  TAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIV--VPSFNLG  312
            +  +P++DV G  + +   YYL +   G   G G+   K      CP D++   P    G
Sbjct  25   SESEPILDVYGNQVDSSHRYYLVSALWGVKTGGGISADK-GKNGQCPTDVIQLSPKDKRG  83

Query  313  DPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDD-EFGRQLVKAGEAVE  489
              +V  P      V EST   + F+  ++ ++C     WKV+ D+   G+Q +  GE  +
Sbjct  84   KNLVLLPNDNSIIVRESTNIKLKFSRVSSLQQCNKDSLWKVDNDNASLGKQFITIGEG-K  142

Query  490  NVSNLFRIEPVDIG----------PQIYKLTYCPRDEDN-----CYDVG  591
               NLF++E V             P +YK+ +C    +      C DVG
Sbjct  143  TCQNLFKLEKVSASIFDMKIALDIPCLYKIVHCSTPVNGSCDTLCKDVG  191



>gb|ACO39676.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39677.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39678.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39679.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39680.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39681.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39682.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39683.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39685.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39686.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39687.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39688.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39689.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39690.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39691.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39692.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39693.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39694.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39695.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39696.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39697.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39698.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39699.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39700.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39701.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39702.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39703.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39704.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39705.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39706.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39707.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39708.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39709.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39710.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39711.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39712.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39713.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39714.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39715.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39716.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39717.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39718.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39719.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39720.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39721.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39722.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39723.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39724.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39725.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39726.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39727.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39728.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39729.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39730.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39731.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39732.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39733.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39734.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39735.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39736.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39737.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39738.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39739.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39740.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39741.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39742.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39743.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39744.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39745.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39746.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39747.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39748.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39749.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39750.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39751.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39752.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39753.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39754.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39755.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39756.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
 gb|ACO39757.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
Length=184

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 19/177 (11%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VPSFNL-G  312
            +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + +F + G
Sbjct  3    SGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLENFCVTG  59

Query  313  DPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV  486
             PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +    +L+  G   
Sbjct  60   TPVTFSIASGDQELFITDSTDLYISF--DSTSNCTNETMVWMHESSNSSSTELLTIGGVE  117

Query  487  ENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHLALT  636
             +++ LFRI  V++G      YKL  Y     D      DVG   D+ TG  +LALT
Sbjct  118  GDINTLFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTTGIRYLALT  172



>emb|CAI77809.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77826.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77827.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77829.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 90/188 (48%), Gaps = 19/188 (10%)
 Frame = +1

Query  109  AAALDPIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPND  285
            A+ L P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D
Sbjct  11   ASTLLPEAVRASGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLD  67

Query  286  IV-VPSFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEF  453
            ++ + +F + G PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +  
Sbjct  68   VILLENFCVTGTPVTFSVASGDQELFITDSTDVYISF--DSTSNCTNETMVWMHESINGS  125

Query  454  GRQLVKAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWAT  612
              +L+  G    +V+ +FRI  V++G      YKL  Y     D      DVG   D+ T
Sbjct  126  STELLTIGGVEGDVNTIFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTT  183

Query  613  GNTHLALT  636
            G  +LALT
Sbjct  184  GIRYLALT  191



>ref|XP_003534081.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 80/184 (43%), Gaps = 28/184 (15%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYL-------STDFAGRARGQGVKLAKLDFTAPCPNDI-VVPSFNL  309
            V+D  G +L  G+ YY+        + F+      G+ LAK+      P D+ VV    L
Sbjct  30   VVDTSGNILRVGANYYIIPNPTTKCSIFSKYKGNNGLVLAKVAANKTFPLDVLVVEGQQL  89

Query  310  GDPVVFTP---AVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQ-LVKAG  477
            G P+ FTP     K   V  ST   I F+   +  +      WK++  D   R+  V  G
Sbjct  90   GQPLTFTPIHDQKKGAPVRVSTDLNIEFSMQTSCSQSN---VWKIDHFDRATRKWFVTTG  146

Query  478  EAV-----ENVSNLFRIEPVDIGPQIYKL----TYCPRDEDNCYDVGRYLDWATGNTHLA  630
              V       +SN F+IE  D     YKL    T+C   +  C D+G Y D   GN  LA
Sbjct  147  GVVGHPSWRTISNWFKIEKYD---GDYKLVSCPTFCAYCKVQCRDIGVYED-QNGNKRLA  202

Query  631  LTNS  642
            LT++
Sbjct  203  LTDA  206



>gb|ACO39684.1| kunitz trypsin inhibitor 5 [Populus balsamifera]
Length=184

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 19/177 (11%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VPSFNL-G  312
            +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + +F + G
Sbjct  3    SGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLENFCVTG  59

Query  313  DPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV  486
             PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +    +L+  G   
Sbjct  60   TPVTFSIASGDQELFITDSTDLYISF--DSTSNCTNETMVWMHESSNSSSTELLTIGGVE  117

Query  487  ENVSNLFRIEPVDIGPQI---YK-LTYCPRDED---NCYDVGRYLDWATGNTHLALT  636
             +++ LFRI  V++G      YK L Y     D      DVG   D+ TG  +LALT
Sbjct  118  GDINTLFRI--VNVGGSFVSNYKLLAYKLSSYDLALTTSDVGAVFDFTTGIRYLALT  172



>ref|XP_011002518.1| PREDICTED: sporamin A-like [Populus euphratica]
Length=258

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 84/177 (47%), Gaps = 19/177 (11%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VPSFNL-G  312
            +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + +F + G
Sbjct  68   SGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLENFCVTG  124

Query  313  DPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV  486
             PV FT A  D   F+ +ST   ISF     +    + + W  E  +    +L+  G   
Sbjct  125  TPVTFTIASGDQELFITDSTDLYISF--DTTSNCTNETMVWMHESSNSSSTELLTIGGVE  182

Query  487  ENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHLALT  636
             +V+ +FRI  V++G      YKL  Y     D      DVG   D+ TG  +LALT
Sbjct  183  GDVNTIFRI--VNVGGSFVSNYKLVAYKLSSYDLGLTTSDVGAVFDFTTGIRYLALT  237



>gb|KDP27288.1| hypothetical protein JCGZ_21019 [Jatropha curcas]
 gb|KDP46944.1| hypothetical protein JCGZ_07961 [Jatropha curcas]
Length=194

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 72/150 (48%), Gaps = 24/150 (16%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCP----NDIVVPSFNLG  312
            ++D +G+ L +G EYY+   +TD AG        L  ++ T  CP     + +    + G
Sbjct  26   ILDTNGQPLTSGVEYYVLPAATDTAG-------GLTLVNRTGSCPFYVGQEPLSTVVSQG  78

Query  313  DPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVEN  492
             PVVFTP   D+ V E    T++F+   A+  C     W+VE D+E  R  +  G     
Sbjct  79   LPVVFTPNDGDSVVREDIPFTVAFS---ASTTCVQSTGWRVENDEEVSRTFIVTGGD---  132

Query  493  VSNLFRIEPVDIGPQIYKLTYCPR-DEDNC  579
              + FRI+  D G  +Y L +CP  D  NC
Sbjct  133  -QSFFRIQIDDNG--LYNLIWCPVCDRPNC  159



>gb|AAK84063.1|AF401200_1 trypsin inhibitor [Bauhinia variegata]
Length=175

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 81/180 (45%), Gaps = 17/180 (9%)
 Frame = +1

Query  154  VMDVDGK-VLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPS--FNLGDPVV  324
            V+D +G  V  +G  YY+   F  R  G G+ L ++  +  CP  +V  S   + G PVV
Sbjct  3    VLDQNGNPVRNSGGRYYIIPAF--RGNGGGLTLTRVG-SETCPRTVVQASSEHSNGLPVV  59

Query  325  FTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVENVSNL  504
             +   +  F+  S   TI F  A       +   W + QD E     VK G + E     
Sbjct  60   ISALPRSLFISTSWRVTIRFVGAPTCIP--EPSFWHIPQDSEL-EGAVKVGASDERFPLE  116

Query  505  FRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTHLALTNSTESLDNSLIVFKEK  684
            FRIE V      YKL +CP   D+C D+G  +D   GN  L + +     +N L+V  +K
Sbjct  117  FRIERVS--EDAYKLMHCPSISDSCRDLGIAID-EEGNRRLVVRD-----ENPLLVRFKK  168



>gb|AFZ84560.1| Kunitz trypsin inhibitor [Populus deltoides]
Length=218

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 19/177 (11%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VPSFNL-G  312
            +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + +F + G
Sbjct  28   SGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLENFCVTG  84

Query  313  DPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV  486
             PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +    +L+  G   
Sbjct  85   TPVTFSIASGDQEIFITDSTDLYISF--DSTSNCTNETMVWMHESSNSSSTELLTIGGVE  142

Query  487  ENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHLALT  636
             +++ LFRI  V++G      YKL  Y     D      DVG   D+ TG  +LALT
Sbjct  143  GDINTLFRI--VNVGGSFVSNYKLVAYKLSSXDLALTTSDVGAVFDFTTGIRYLALT  197



>ref|XP_003638409.1| Alpha-amylase/subtilisin inhibitor [Medicago truncatula]
 gb|KEH38528.1| Kunitz type trypsin inhibitor [Medicago truncatula]
Length=199

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 85/180 (47%), Gaps = 27/180 (15%)
 Frame = +1

Query  133  LPTAGQP----VMDVDGKVLLAGSEYYLS---TDFAGRARGQGVKLAKLDFTAPCPNDIV  291
            +PT+ QP    V+D+ G+ L +G +YY+    +DF GR     + L   + + P      
Sbjct  21   IPTSAQPENEEVLDLTGRPLESGRKYYIRSDVSDFGGR-----ITLVNKNGSCPLYVGQE  75

Query  292  VPSFNLGDPVVFTPAVKDNFVIESTFQ-TISFTaaaaaeecaDKLSWKV-EQDDEFGRQL  465
               F  G  V+ TP   D+ V++      + F+++++  +  +   WK+ ++D+  GR+L
Sbjct  76   TTDFGQGLSVILTPLENDDTVVKVNRDFKVKFSSSSSCGQSTE---WKLGDRDNRSGRRL  132

Query  466  VKAGEAVENVSNLFRIEPVDIGPQ----IYKLTYCPRDEDNCYDVGRYLDWATGNTHLAL  633
            + AG       N FRI  +  G +     Y + +CP D  NC  VG   +   G   LAL
Sbjct  133  IIAGSD----GNSFRILKISFGIEGVIGNYNIRFCPSDTVNCGTVGNLRE--NGKILLAL  186



>ref|XP_011016416.1| PREDICTED: sporamin A-like [Populus euphratica]
Length=245

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 84/177 (47%), Gaps = 19/177 (11%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VPSFNL-G  312
            +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + +F + G
Sbjct  55   SGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGD-DINGTCPLDVILLENFCVTG  111

Query  313  DPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV  486
             PV FT A  D   F+ +ST   ISF     +    + + W  E  +    +L+  G   
Sbjct  112  TPVTFTIASGDQQLFITDSTDLYISF--DTTSNCTNETMVWMHESSNSSSTELLTIGGVE  169

Query  487  ENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHLALT  636
             +V+ +FRI  V++G      YKL  Y     D      DVG   D+ TG  +LALT
Sbjct  170  GDVNTIFRI--VNVGGSFVSNYKLVAYKLSSYDLGLTTSDVGAVFDFTTGIRYLALT  224



>sp|P83595.1|ITRY_BAUVA RecName: Full=Trypsin inhibitor BvTI [Bauhinia variegata]
Length=174

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 82/180 (46%), Gaps = 19/180 (11%)
 Frame = +1

Query  154  VMDVDGKVLLA-GSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGD--PVV  324
            ++D DG+V+   G  YY+   F  R  G G+ L ++  +  CP  +V  S    D  PVV
Sbjct  3    LLDTDGEVVRNNGGPYYIIPAF--RGNGGGLTLTRVG-SETCPRTVVQASSEHSDGLPVV  59

Query  325  FTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVENVSNL  504
             +   +  F+  S   TI F  A    + +    W + QD E     VK G + E     
Sbjct  60   ISALPRSLFISTSWRVTIQFVEATCIPKPS---FWHIPQDSEL-EGAVKVGASDERFPLE  115

Query  505  FRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTHLALTNSTESLDNSLIV-FKE  681
            FRIE V      YKL +C    D+C D+G  +D   GN  L + +     +N L+V FK+
Sbjct  116  FRIERV--SEDTYKLMHCSSTSDSCRDLGISID-EEGNRRLVVRD-----ENPLLVRFKK  167



>ref|XP_006304577.1| hypothetical protein CARUB_v10011616mg [Capsella rubella]
 gb|EOA37475.1| hypothetical protein CARUB_v10011616mg [Capsella rubella]
Length=195

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 80/177 (45%), Gaps = 29/177 (16%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A + V D++GK LLAG  YY+      R RG G+ ++K +    C   ++   F +  G 
Sbjct  25   AVEAVKDINGKPLLAGYNYYILP--VVRGRGGGLTMSKPE-NKTCRTSVIQARFEVSQGL  81

Query  316  PVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVE--  489
            P+ F+P  K   V  ST Q I F+  +          W++   DE   Q   +   VE  
Sbjct  82   PLKFSPFDKSRIVRVSTDQNIKFSQTSI---------WELANFDETTSQSFISTCGVEGN  132

Query  490  ----NVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALT  636
                 VSN F+I+  D   + YK+ +CP   +     C DVG ++    G   LAL+
Sbjct  133  PGLTTVSNWFKIDKFD---KDYKIRFCPTVCNFCKVICRDVGVFVQ--DGMRRLALS  184



>ref|XP_006302823.1| hypothetical protein CARUB_v10020954mg [Capsella rubella]
 gb|EOA35721.1| hypothetical protein CARUB_v10020954mg [Capsella rubella]
Length=208

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 94/204 (46%), Gaps = 31/204 (15%)
 Frame = +1

Query  115  ALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVV  294
            AL  +    A   V+D+DG ++  GS Y L      R RG G+ LA       CP DIV 
Sbjct  10   ALTAVLATNAYGAVLDIDGNIIFRGSYYVLPLI---RGRGGGLTLAGRG-GELCPLDIVQ  65

Query  295  PSFNL--GDPVVFT---PAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGR  459
             S  +  G PV F+   P V   FV ES  + ++      A  C     W+V + DE  +
Sbjct  66   ESSEVDEGIPVKFSNWRPRV--GFVPES--EDLNIETDVGATICVQSTYWRVGEFDEERK  121

Query  460  Q-LVKAGEAVE-----NVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWA  609
            Q  V AG   E     ++ + F+IE    G   YK  +CPR  D+    C DVG ++D  
Sbjct  122  QYFVVAGPKPEGFGQDSLKSFFKIEKS--GDDAYKFVFCPRTWDSSCPKCSDVGVFVD-E  178

Query  610  TGNTHLALTNSTESLDNSLIVFKE  681
             G   LAL++     +  L++FK+
Sbjct  179  LGVWRLALSD-----EPFLVMFKK  197



>gb|AFZ84559.1| Kunitz trypsin inhibitor [Populus balsamifera]
Length=218

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 87/183 (48%), Gaps = 19/183 (10%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VP  297
            P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + 
Sbjct  22   PEAVRASGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLE  78

Query  298  SFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLV  468
            +F + G PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +    +L+
Sbjct  79   NFCVTGTPVTFSIASGDQELFITDSTDLYISF--DSTSNCTNETMVWMHESSNSSSTELL  136

Query  469  KAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHL  627
              G    +++ LFRI  V++G      YKL  Y     D      DVG   D+ TG  +L
Sbjct  137  TIGGVEGDINTLFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTTGIRYL  194

Query  628  ALT  636
            ALT
Sbjct  195  ALT  197



>gb|ACS92497.1| Kunitz-type protease inhibitor KPI-E5.1 [Populus trichocarpa 
x Populus deltoides]
Length=214

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 19/177 (11%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VPSFNL-G  312
            +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + +F + G
Sbjct  24   SGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLENFCVTG  80

Query  313  DPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV  486
             PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +    +L+  G   
Sbjct  81   TPVTFSIASGDQEIFITDSTDLYISF--DSTSNCTNETMVWMHESSNSSSTELLTIGGVE  138

Query  487  ENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHLALT  636
             +++ LFRI  V++G      YKL  Y     D      DVG   D+ TG  +LALT
Sbjct  139  GDINTLFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTTGIRYLALT  193



>gb|AFZ84562.1| Kunitz trypsin inhibitor [Populus maximowiczii]
Length=218

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 88/183 (48%), Gaps = 19/183 (10%)
 Frame = +1

Query  124  PIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VP  297
            P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + 
Sbjct  22   PEAVRASGNPVLDVKGSGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLE  78

Query  298  SFNL-GDPVVFTPA--VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLV  468
            +F + G PV F+ A   ++ F+ +ST   ISF   + +    + + W  E  +    +L+
Sbjct  79   NFCVTGTPVTFSIASGXQELFITDSTDLYISF--DSTSNCTNETMVWMHESSNSSSTELL  136

Query  469  KAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHL  627
              G    +++ LFRI  V++G      YKL  Y     D      DVG   D+ TG  +L
Sbjct  137  TIGGVEGDINTLFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTTGIRYL  194

Query  628  ALT  636
            ALT
Sbjct  195  ALT  197



>emb|CAI77813.1| kunitz trypsin inhibitor [Populus tremula]
Length=214

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 86/177 (49%), Gaps = 19/177 (11%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VPSFNL-G  312
            +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + +F + G
Sbjct  24   SGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLENFCVTG  80

Query  313  DPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV  486
             PV F+ A  +   F+ +ST   ISF   + +    + + W  E  +    +L+  G   
Sbjct  81   TPVTFSIASGNQELFITDSTDVYISF--DSTSNCTNETMVWMHESINGSSTELLTIGGVE  138

Query  487  ENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHLALT  636
             +V+ +FRI  V++G      YKL  Y P   D      DVG   D+ TG  +LALT
Sbjct  139  GDVNTIFRI--VNVGGSFVSNYKLVAYKPSSYDLALTTSDVGAVFDFTTGIRYLALT  193



>ref|XP_002309884.2| hypothetical protein POPTR_0007s03650g [Populus trichocarpa]
 gb|EEE90334.2| hypothetical protein POPTR_0007s03650g [Populus trichocarpa]
Length=207

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 69/150 (46%), Gaps = 20/150 (13%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCP----NDIVVPSFNLG  312
            V+D DG+ L +G EYY+    TD AG     G+ L  L+  + CP     + + P  + G
Sbjct  27   VLDADGQPLRSGVEYYVLPAVTDVAG-----GLTLVNLNNGSICPLFVGQEPLAPVVSRG  81

Query  313  DPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKV-EQDDEFGRQLVKAGEAVE  489
              V+FTP V D  V E+   T++FT       CA   +W V EQ+ E  R+ + A     
Sbjct  82   TSVIFTPRVADTVVRETRDFTVAFT---GVTICAQSTAWMVGEQNPETRRRYILAETDPN  138

Query  490  NVSNLFRIEPVDIGPQIYKLTYCPRDEDNC  579
              SN +    V     +Y   +CP    NC
Sbjct  139  PSSNAWHFNIVKNDQGLYNFQWCP----NC  164



>ref|XP_010428237.1| PREDICTED: miraculin-like [Camelina sativa]
Length=208

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 92/204 (45%), Gaps = 31/204 (15%)
 Frame = +1

Query  115  ALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVV  294
            AL  +    A   V+D+DG ++  GS Y L      R RG G+ L+       CP DIV 
Sbjct  10   ALTAVLATNAYGAVLDIDGNIIFRGSYYVLPVI---RGRGGGLTLSGRG-GELCPLDIVQ  65

Query  295  PSFNL--GDPVVFT---PAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGR  459
             S  +  G+PV F+   P V   FV ES  Q ++      A  C     W+V + DE  +
Sbjct  66   ESQEVDEGNPVKFSNWRPRVA--FVPES--QDLNIKTDVEATICFQSTYWRVGEFDEERK  121

Query  460  Q------LVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWA  609
            Q      L   G   ++  + F+IE    G   YK  +CP   D+    C DVG ++D  
Sbjct  122  QYFIVAGLKPEGFGQDSSKSFFKIEKS--GDDAYKFVFCPSTCDSDCPKCSDVGIFVD-E  178

Query  610  TGNTHLALTNSTESLDNSLIVFKE  681
             G   LAL++     D  L++FK+
Sbjct  179  LGVRRLALSD-----DPFLVMFKK  197



>ref|XP_009406658.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=200

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 73/161 (45%), Gaps = 24/161 (15%)
 Frame = +1

Query  139  TAGQPVMDVDGKVLLAGSEYYLS---TDFAGRARGQGVKLAKLDFTAPCPNDIVVPSF--  303
            +A +PV D DG VL  G +YY+    TD  G     G+ L   +    CP  + + S   
Sbjct  23   SADEPVRDTDGNVLQRGVDYYIRPTVTDIGG-----GLTLEARN--GSCPLSVALASLPA  75

Query  304  NLGDPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGE  480
            + G P+ F+P   D+  +E ST   + F+   A   C     WK+E D+  GR  V  G 
Sbjct  76   DNGLPLQFSPEDDDDDTVELSTDTNVIFS---AFTTCLQSTVWKLELDEGEGRYYVVIGG  132

Query  481  AV-----ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDV  588
                   E +SN F+IE       +YKL +CP   D C  V
Sbjct  133  VAGNPGKETLSNWFKIESYQ---GVYKLVFCPTVCDYCRPV  170



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 82/190 (43%), Gaps = 23/190 (12%)
 Frame = +1

Query  109  AAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDI  288
            +A L  +    A  PV+D+ G  L  G +YY+      R RG G+ LA       CP D+
Sbjct  19   SAKLRSVAADAAPSPVLDITGNKLQTGVDYYILPVI--RGRGGGLTLASTSNKTSCPLDV  76

Query  289  VVPSFNL--GDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFG  456
            V     +  G P+ F+P  V    V  ST   I F+   A   C     WK+ + D++ G
Sbjct  77   VQEQNEVSNGLPLKFSPVNVTKGVVRVSTDLNIKFS---ATTICVQSTVWKLGKFDEQTG  133

Query  457  RQLVKAGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPRDEDNCY----DVGRYLDWA  609
            +  V +G    N      SN F+IE        YKL +CP   + C     DVG +    
Sbjct  134  QWFVTSGGVEGNPGRQTTSNWFKIEKFG---DDYKLVFCPTVCNFCKVICGDVGIFFQ--  188

Query  610  TGNTHLALTN  639
             G   LAL++
Sbjct  189  DGKRRLALSD  198



>emb|CAI77830.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 90/188 (48%), Gaps = 19/188 (10%)
 Frame = +1

Query  109  AAALDPIRLPTAGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPND  285
            A+ L P  +  +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D
Sbjct  11   ASTLLPEAVRASGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLD  67

Query  286  IV-VPSFNL-GDPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEF  453
            ++ + +F + G PV F+ A  D   F+ +ST   ISF   + +    + + W  E  +  
Sbjct  68   VILLENFCVTGTPVTFSVASGDQELFITDSTDVYISF--DSTSNCTNETMVWMHESINGS  125

Query  454  GRQLVKAGEAVENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWAT  612
              +L+  G    +V+ +FRI  V++G      YKL  Y     D      DVG   D+ T
Sbjct  126  STELLTIGGVEGDVNTIFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTT  183

Query  613  GNTHLALT  636
            G  +LAL+
Sbjct  184  GIRYLALS  191



>ref|XP_010683193.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=206

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 75/174 (43%), Gaps = 17/174 (10%)
 Frame = +1

Query  118  LDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVP  297
            L P+        V+D++G+ L AG  YY+      R RG G+ +A  + T  CP  +   
Sbjct  17   LSPLTSTADNTAVLDINGRPLQAGYNYYILPVI--RGRGGGLTMASKNATELCPLYVAQE  74

Query  298  SFNL--GDPVVFTPAV-KDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLV  468
               +  G P+ F P   KD  +  S+     F    AA  C     W +  + E GR+ V
Sbjct  75   DHEVSNGLPLKFYPVNPKDKRISLSSDLNFVF---DAATTCVQSTGWSLTIEMETGRRYV  131

Query  469  KAGE-----AVENVSNLFRIEPVDIGPQIYKLTYCPRDED----NCYDVGRYLD  603
              G       VE V N F+IE    G   YK+ YCP   +     C DVG +++
Sbjct  132  GTGGEIGNPGVETVDNWFKIEKDGSGKYDYKIVYCPGVCNFCKVMCGDVGVFIE  185



>ref|XP_010476950.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 84/191 (44%), Gaps = 34/191 (18%)
 Frame = +1

Query  103  HSAAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPN  282
            H  AA +P   P   + V D++GK L     YY+      R RG G+ ++K +    CP 
Sbjct  17   HGGAATEP---PV--EAVKDINGKPLQTRFYYYILP--VVRGRGGGLTMSKAE-NKTCPR  68

Query  283  DIVVPSFNL--GDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFG  456
             ++   F +  G PV F+P  K   V  ST Q I F++ +          W++   DE  
Sbjct  69   SVIQDQFEVSQGLPVSFSPYDKSRIVRVSTDQNIKFSSTSI---------WELADFDEAT  119

Query  457  RQLVKAGEAVE------NVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDW  606
            RQ   +   VE       V N F+I+  D     YK+ +CP   +     C DVG ++  
Sbjct  120  RQNFISTCGVEGNPGQTTVDNWFKIDKFD---NDYKIRFCPTVCNFCKVICRDVGVFVQ-  175

Query  607  ATGNTHLALTN  639
              G   LAL++
Sbjct  176  -DGKRRLALSD  185



>ref|XP_002890252.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66511.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=196

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 77/177 (44%), Gaps = 29/177 (16%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A +PV D++GK LL    YY+      R RG G+ ++       CP  ++   F +  G 
Sbjct  25   AVEPVKDINGKPLLTKYNYYILP--VVRGRGGGLTMSNFK-NETCPRSVIQDQFEVSQGL  81

Query  316  PVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVE--  489
            PV F+P  K   V  ST Q I F+  +          W++   DE   Q   +   VE  
Sbjct  82   PVKFSPYDKSRIVRVSTDQNIKFSPTSI---------WELANFDERTSQWFISTCGVEGN  132

Query  490  ----NVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATGNTHLALT  636
                 V N F+I+  +   + YK+ +CP   +     C DVG ++    G   LAL+
Sbjct  133  PGQKTVGNWFKIDEFE---KDYKIRFCPTVCNFCKVICRDVGVFVQ--DGKRRLALS  184



>ref|XP_010683391.1| PREDICTED: trypsin inhibitor 2-like [Beta vulgaris subsp. vulgaris]
Length=202

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 74/173 (43%), Gaps = 14/173 (8%)
 Frame = +1

Query  133  LPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLA-KLDFTAPCPNDIVVPSFNL  309
            LPT    V+D+DG+ L  G  Y    +   +    G+ L  K D  +PCP  I   +   
Sbjct  19   LPTISTFVLDIDGEPLRNGGSY----NVVPKGFHGGLTLTQKPDNNSPCPFYITRKTACP  74

Query  310  GDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVE  489
            G PV  +  +K  ++  S    I FT    A  C + L W+V  D   G+  V  G    
Sbjct  75   GIPVKISSPLKVLYIPLSVDVNIVFT-NNNATTCMEPLGWRVTPDVTTGQFYVATGGTST  133

Query  490  NVSNLFRIEPVDIGPQ----IYKLTYCPR----DEDNCYDVGRYLDWATGNTH  624
             V++ F IE  D   +     YKL YCP     DE  C DV  + +   G T+
Sbjct  134  VVTDFFTIEEADENGRSEKYAYKLRYCPSFEGGDEKKCGDVNFFREGFVGITN  186



>ref|XP_003548289.1| PREDICTED: miraculin-like [Glycine max]
Length=201

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 75/168 (45%), Gaps = 27/168 (16%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLG  312
            A +PV+D  GK + A S YY+   S+D  G A       A+ D    CP D+V    +LG
Sbjct  23   ASEPVLDALGKKVRADSIYYIVPASSDIGGLAS------ARTD--VDCPLDVVAVDGDLG  74

Query  313  DPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVE-QDDEFGRQLVKAGEAV  486
             P+ FTP      +I  S+   I FT  +    C     WK++  DD   +  V  G  +
Sbjct  75   LPLSFTPVNDKKGIIRVSSDLNIYFT--SYTIFCPQTTVWKLKYYDDSTSQWFVTTGGEL  132

Query  487  -----ENVSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLD  603
                 + V+N F+IE  +     YKL YCP         C D+G Y D
Sbjct  133  GHPSSQTVANWFKIEKYE---DAYKLVYCPSVCSDCNHQCSDIGIYQD  177



>gb|ADW95385.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=200

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 66/151 (44%), Gaps = 22/151 (15%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCP----NDIVVPSFNL  309
            PV+D DG+ L +G EYY+    TD  G        L  +D    CP     + + P  + 
Sbjct  26   PVLDADGQPLRSGVEYYVLPGVTDVGG-------GLTLVDRNGSCPLYVGQEPLAPMVSR  78

Query  310  GDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKV-EQDDEFGRQLVKAGEAV  486
            G PV FTP V D  + ES   T+ F+    A  C    +W V E++ E   + V  G   
Sbjct  79   GIPVFFTPRVGDTIIRESRDFTVEFS---GASTCGQSTAWMVGEENPETTTRYVVTGMEP  135

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNC  579
               S L+     + G  +Y L +CP    NC
Sbjct  136  RPSSTLWYFNIENNGQGVYALRWCP----NC  162



>gb|AFK36436.1| unknown [Lotus japonicus]
Length=218

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 74/183 (40%), Gaps = 21/183 (11%)
 Frame = +1

Query  130  RLPTAGQP-----VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIV-  291
            +LPTA  P     V+DV+G  +  G  YY+     G   G GV+L K    + CP   + 
Sbjct  19   KLPTAFSPNDVEQVLDVNGDSIFPGGRYYIRPAIRGPP-GGGVRLGKTG-DSDCPVTALQ  76

Query  292  -VPSFNLGDPVVFTPA--VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQ  462
                   G PV F  A  V    +   T   I FT         +   W V  D+E G+ 
Sbjct  77   EYSEVKNGIPVRFRIAAEVSTGIIFTGTELDIEFTVKPHCV---ESPKWIVFVDNEIGKA  133

Query  463  LVKAGEAVEN-----VSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTHL  627
             V  G A ++      S  F I+    G   YKL +C +    C D+GRY D   G   L
Sbjct  134  CVGIGGAKDHPGKQTFSGTFNIQKNSAGFG-YKLVFCIKGSPTCLDIGRY-DNGEGGKRL  191

Query  628  ALT  636
             LT
Sbjct  192  NLT  194



>emb|CDX96746.1| BnaA08g22890D [Brassica napus]
Length=195

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 74/165 (45%), Gaps = 27/165 (16%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A +PV D+ G+ L  G++YY+   F  R RG G+ ++K +    CP  ++   F +  G 
Sbjct  25   AVEPVTDIYGQRLRTGTKYYILPVF--RGRGGGLTMSKAE-NKTCPRSVIQERFEVSNGL  81

Query  316  PVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVE--  489
            P+ F+P+ K   +  ST     F+A +          W ++  DE   Q       VE  
Sbjct  82   PLTFSPSDKSKVIRVSTDLNFKFSATSI---------WNLDNVDEKTNQWFIGTCGVEGN  132

Query  490  ----NVSNLFRIEPVDIGPQIYKLTYCPRDED----NCYDVGRYL  600
                 V N F+I+  +     YK+ +CP   D     C DVG ++
Sbjct  133  PGRTTVGNWFKIDKYE---DHYKIVFCPSVCDICKVMCRDVGVFV  174



>ref|XP_007036748.1| 21 kDa seed protein, putative [Theobroma cacao]
 gb|EOY21249.1| 21 kDa seed protein, putative [Theobroma cacao]
Length=219

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 77/178 (43%), Gaps = 22/178 (12%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVV---PSFNLGDP  318
            +PV+D DG+ L  G EYY+ +       G        + + P   DIVV      + G P
Sbjct  29   KPVLDTDGEELRTGVEYYVVSALWAAGGGGLALGRSRNQSCP---DIVVQRRSELDYGIP  85

Query  319  VVFTPAV-KDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVKAGEAVEN  492
            V+F+P    D F+  ST   I F     +      + WK++  D   G+  V AG    +
Sbjct  86   VIFSPVKPNDVFIRVSTDLIIEFVPLRDSLCLTTAV-WKLDDYDQSTGKWWVIAGRVAGD  144

Query  493  VS-----NLFRIEPVDIGPQIYKLTYCPRDEDNCY----DVGRYLDWATGNTHLALTN  639
                   N F+IE    G   YK TYCP   D+C     D+GRY D   G   L L++
Sbjct  145  AGPHTFPNWFKIEKN--GVFGYKFTYCPSVCDSCTTLCSDIGRYED--NGQIRLGLSD  198



>gb|AAV41234.1| putative 21 kDa trypsin inhibitor [Theobroma microcarpum]
Length=221

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 81/189 (43%), Gaps = 37/189 (20%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLST---------DFAGRARGQGVKLAKLDFTAPCPNDIVV  294
            A  PV+D+DG  L  G +YY+ +            GRA GQ            CP  +V 
Sbjct  27   ANSPVLDIDGDELRTGVQYYVVSALWGAGGGGLALGRATGQ-----------SCPEIVVQ  75

Query  295  PSFNL--GDPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQ  462
               +L  G PV+F+ A  KD  V  ST   I F            + WK++  D+  G+ 
Sbjct  76   RRSDLDDGTPVIFSNADSKDGVVRVSTDINIEFVPIRDRLCTTSTV-WKLDNYDNSAGKW  134

Query  463  L-----VKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWATG  615
                  VK       +S+ F+IEP   G   YK  +CP   D+    C D+G++ D   G
Sbjct  135  WVTTDGVKGDPGASTMSSWFKIEPA--GGIGYKFRFCPSVCDSCTKLCSDIGKHSD-DDG  191

Query  616  NTHLALTNS  642
               LAL++S
Sbjct  192  QIRLALSDS  200



>ref|XP_006371005.1| truncated Kunitz trypsin inhibitor family protein [Populus trichocarpa]
 gb|ERP48802.1| truncated Kunitz trypsin inhibitor family protein [Populus trichocarpa]
Length=200

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 66/151 (44%), Gaps = 22/151 (15%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCP----NDIVVPSFNL  309
            PV+D DG+ L +G EYY+    TD  G        L  +D    CP     + + P  + 
Sbjct  26   PVLDADGQPLRSGVEYYVLPGVTDVGG-------GLTLVDRNGSCPLYVGQEPLAPMVSR  78

Query  310  GDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKV-EQDDEFGRQLVKAGEAV  486
            G PV FTP V D  + ES   T+ F+    A  C    +W V E++ E   + V  G   
Sbjct  79   GIPVFFTPRVGDTIIRESRDFTVEFS---GASTCGQSTAWMVGEENPETTTRYVVTGMEP  135

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNC  579
               S L+     + G  +Y L +CP    NC
Sbjct  136  RPSSTLWYFNIENNGQGVYALRWCP----NC  162



>gb|ABX76298.1| sexual organ expressed protein [Nicotiana alata]
Length=242

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 91/207 (44%), Gaps = 34/207 (16%)
 Frame = +1

Query  106  SAAALDPIRLPTA-----GQP------VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLA  252
            S  + +PI LPT      G P      V+D++G+ L  G EY++ +   G A G GV L 
Sbjct  26   SFTSTNPIVLPTTTDDDKGFPIPRFSEVLDINGEPLHVGEEYHIISAIRG-AGGGGVYLT  84

Query  253  KLDFTAPCPNDIVVPSFNL--GDPVVF--TPAVKDNFVIESTFQTISFTaaaaaeecaDK  420
             +  T  CPN ++    +   G PV F  T +   N V E+T   I F+ A       ++
Sbjct  85   YVGNTK-CPNGVLQHGTDTLPGMPVKFVTTHSRPFNVVRENTDINIMFSVATTRLCV-NQ  142

Query  421  LSWKVEQDD--EFGRQLVKAGEAV-----ENVSNLFRIEPVDIGPQIYKLTYCPRD----  567
              WKV   D    G + V  G  +     E ++N F+IE V      YKL YCP      
Sbjct  143  TVWKVGDPDLTARGTRFVVTGGTLGNPGPETINNWFKIEKVTKQAPFYKLRYCPDKLLCP  202

Query  568  ---EDNCYDVGRYLDWATGNTHLALTN  639
                 +C DVG    +  G   LALTN
Sbjct  203  ECHPVDCLDVGVTDHF--GRRRLALTN  227



>gb|AEK26923.1| Kunitz-type trypsin inhibitor C7 [Populus nigra]
Length=183

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 68/143 (48%), Gaps = 16/143 (11%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCP----NDIVVPSFNLG  312
            V+D DG+ L +G EYY+    TD AG     G+ L  L+  + CP     + + P  + G
Sbjct  8    VLDADGQPLRSGVEYYVLPAVTDVAG-----GLTLVNLNNGSICPLFVGQEPLAPVVSRG  62

Query  313  DPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKV-EQDDEFGRQLVKAGEAVE  489
              V+FTP V D  V E+   T++FT       CA   +W+V E++ E  R+ + A     
Sbjct  63   TSVIFTPRVADTVVRETRDFTVAFT---GVSVCAQSTAWRVGERNPETRRRYILAETNPI  119

Query  490  NVSNLFRIEPVDIGPQIYKLTYC  558
              SN +    V     +YK  +C
Sbjct  120  PSSNAWHFNIVKNDQGLYKFQWC  142



>ref|XP_004299457.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=218

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 77/165 (47%), Gaps = 17/165 (10%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPVV  324
            PV+D+ G  +  G EY++     GR  G  +        + CP D+V     +  G P+ 
Sbjct  37   PVLDIKGHNIQTGVEYWILPVIRGRGGGLTLATTGNRNRSICPLDVVQEQQEVSNGLPLT  96

Query  325  FTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLS-WKVEQDDE-FGRQLVKAGEAVEN-  492
            F+P  +K   V  ST   I F+ +AA   C +    WK++  DE  G++ V  G    N 
Sbjct  97   FSPVNLKIGVVRLSTDLNIKFSTSAAVTICLNTSKVWKLDNLDESTGQRFVTTGGVEGNP  156

Query  493  ----VSNLFRIEPVDIGPQIYKLTYCPRDEDNCY----DVGRYLD  603
                +SN F+IE  D   + YKL +CP   + C     DVG YL+
Sbjct  157  GPKTISNWFKIEKYD---KDYKLVFCPTVCNFCKVICGDVGIYLE  198



>ref|XP_002309881.2| hypothetical protein POPTR_0007s03620g [Populus trichocarpa]
 gb|EEE90331.2| hypothetical protein POPTR_0007s03620g [Populus trichocarpa]
Length=187

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 69/145 (48%), Gaps = 16/145 (11%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCP----NDIVVPSFNL  309
            PV+D +G+ L +G EYY+    TD AG     G+ L  L+  + CP     + + P  + 
Sbjct  7    PVLDANGQPLRSGVEYYVLPAVTDVAG-----GLILVNLNNGSICPLFVGQEPLAPVVSR  61

Query  310  GDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKV-EQDDEFGRQLVKAGEAV  486
            G  V+FTP V D  + E+   T++FT       CA   +W+V E++ E  R+ + A    
Sbjct  62   GTSVIFTPRVADTVIRETRDFTVAFT---GVTICAQSTAWRVGERNPETRRRYILAETDP  118

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCP  561
               SN +    V     +Y   +CP
Sbjct  119  IPSSNAWHFNIVKNDQGLYNFQWCP  143



>ref|XP_004235491.1| PREDICTED: cysteine protease inhibitor 8-like [Solanum lycopersicum]
Length=224

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 84/186 (45%), Gaps = 27/186 (15%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPS----FNLGDP  318
            PV+D +GK L    EY +++   G   G  V L  +     CPND++  S    +N    
Sbjct  31   PVLDREGKSLKINEEYVINSIAVG---GGSVYLDNIKNRTQCPNDVLHDSSGSFYNSTAV  87

Query  319  VVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFG-----RQLVKAGEA  483
            + +T  +   FV E+   +I F+ ++ ++ C ++  W+   D   G      + V  G  
Sbjct  88   LFYTMQLGSLFVSENQDVSIMFSTSSVSKSCVNETVWQA-GDYMLGPIHPPPRFVITGAT  146

Query  484  V-----ENVSNLFRIEPVDIG-PQIYKLTYCPRD------EDNCYDVGRYLDWATGNTHL  627
            +      N+ N F+I   + G P  YKL YCP        + +C DVG Y D  +G T L
Sbjct  147  LGFPGPNNIKNWFKIVKHETGRPHSYKLRYCPSKFICPTCQVDCADVGLYKD--SGRTRL  204

Query  628  ALTNST  645
             L + T
Sbjct  205  VLNDET  210



>ref|XP_011023019.1| PREDICTED: endogenous alpha-amylase/subtilisin inhibitor-like 
[Populus euphratica]
Length=202

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 67/151 (44%), Gaps = 21/151 (14%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCP----NDIVVPSFNL  309
            PV+D DG+ L +G EYY+    TD AG     G+ L  L+  + CP     + + P  + 
Sbjct  27   PVLDADGQPLRSGVEYYVLPAVTDLAG-----GLTLVNLNNGSICPLFVGQEPLAPVVSP  81

Query  310  GDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKV-EQDDEFGRQLVKAGEAV  486
            G  V+FTP V D  + E+   T++FT            +W V EQ+ E   + + A    
Sbjct  82   GTSVIFTPRVADTVIRETRDFTVAFT----GPTICQSTAWMVGEQNPETSTRYILAETDP  137

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNC  579
               SN +    V     +Y   +CP    NC
Sbjct  138  NPSSNAWHFNIVKNDLGLYNFQWCP----NC  164



>gb|AAQ84218.1| Kunitz trypsin inhibitor 5 [Populus trichocarpa x Populus deltoides]
Length=214

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 84/177 (47%), Gaps = 19/177 (11%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYL-STDFAGRARGQGVKLAKLDFTAPCPNDIV-VPSFNL-G  312
            +G PV+DV G  LL G  YY+ S+++     G  V L   D    CP D++ + +F + G
Sbjct  24   SGNPVLDVKGLGLLPGVPYYMISSEWP--IVGGVVSLGN-DINGTCPLDVILLENFCVTG  80

Query  313  DPVVFTPAVKDN--FVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV  486
             PV F+    D   F+ +ST   ISF   + +    + + W  E  +    +L+  G   
Sbjct  81   TPVTFSIVSGDQEIFITDSTDLYISF--DSTSNCTNETMVWMHESSNSSSTELLTIGGVE  138

Query  487  ENVSNLFRIEPVDIGPQI---YKLT-YCPRDED---NCYDVGRYLDWATGNTHLALT  636
             +++ LFRI  V++G      YKL  Y     D      DVG   D+ TG  +LALT
Sbjct  139  GDINTLFRI--VNVGGSFVSNYKLVAYKLSSYDLALTTSDVGAVFDFTTGIRYLALT  193



>ref|XP_003620184.1| Pathogen-inducible trypsin-inhibitor-like protein [Medicago truncatula]
 gb|AES76402.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=204

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 82/181 (45%), Gaps = 18/181 (10%)
 Frame = +1

Query  133  LPTAGQPVMDVDGKVLLAGSEY--YLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFN  306
            L ++ + V+D+ GK L A + Y   LS  +      +G+ L+  +   PCP D++V S  
Sbjct  20   LSSSLEHVVDITGKNLRANAYYNVLLSMPYTNSRSPEGLGLSN-NIGQPCPLDVIVVSRY  78

Query  307  LGDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ-DDEFGRQLVKAGEA  483
               P+ FTP      VI  +   ++    + +        WK+++ D   G+  V     
Sbjct  79   QSLPIRFTPLNLKKGVIRVS-SDLNIMFRSNSSCPYHTTVWKLDRFDASKGKSFVTTDGF  137

Query  484  VEN-----VSNLFRIEPVDIGPQIYKLTY----CPRDEDNCYDVGRYLDWATGNTHLALT  636
            + N     +SN F+IE    G   YKL Y    CP  +  C +VG + D   GN  LAL+
Sbjct  138  IGNPGPQSISNWFKIEKYVEG---YKLVYCPIVCPSCKHECKNVGLFED-ENGNKRLALS  193

Query  637  N  639
            +
Sbjct  194  D  194



>gb|AFL91229.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=164

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 66/144 (46%), Gaps = 21/144 (15%)
 Frame = +1

Query  184  AGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGD--PVVFTPA-VKDNFV  354
            +G EYY    F GR  G GV LA       CP D+V   F L D  P+ FTP   K   +
Sbjct  3    SGXEYYXLPVFXGR--GGGVTLAPTR-NESCPLDVVQEGFELDDGLPLTFTPVDPKKGVI  59

Query  355  IESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV------ENVSNLFRIE  516
             EST   I F+A++   +      W +E   E+  Q + +G         E +SN F+IE
Sbjct  60   RESTDLNIIFSASSICIQSN---VWMLE---EYEGQRIISGRGTAGNPGGETISNWFKIE  113

Query  517  PVDIGPQIYKLTYCPRDEDNCYDV  588
              + G   YKL YCP   D C  V
Sbjct  114  KYENG---YKLVYCPTVCDLCRPV  134



>ref|XP_003620169.1| Kunitz-type trypsin inhibitor alpha chain [Medicago truncatula]
 gb|AES76387.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
 gb|AFK40758.1| unknown [Medicago truncatula]
 gb|AFK41434.1| unknown [Medicago truncatula]
Length=203

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 85/191 (45%), Gaps = 21/191 (11%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKL-DFTAPCPNDIVVPSFNL--G  312
            A +PV+D+ GK L  G +YY+      R +G G+ +A   +    CP  +V     +  G
Sbjct  22   APEPVLDISGKQLTTGVKYYILPVI--RGKGGGLTVANHGENNQTCPLYVVQEKLEVKNG  79

Query  313  DPVVFTP-AVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDE----FGRQLVKAG  477
            + V FTP   K   ++ ST   ++  +     +C     WK+ ++           V+  
Sbjct  80   EAVTFTPYNAKQGVILTST--DLNIKSFVTKTKCPQTQVWKLLKELTGVWFLATGGVEGN  137

Query  478  EAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWAT---GNTHLALTNSTE  648
             ++  V N F+IE  D   + Y L++CP +   C  + R L       GN HLAL++   
Sbjct  138  PSMATVGNWFKIEKAD---KDYVLSFCPAEACKCQTLCRELGLFVDDKGNKHLALSDQIP  194

Query  649  SLDNSLIVFKE  681
            S     +VFK 
Sbjct  195  SFR---VVFKR  202



>emb|CDX83886.1| BnaC08g17590D [Brassica napus]
Length=195

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 74/165 (45%), Gaps = 27/165 (16%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A +PV D+ G+ L AG++YY+      R RG G+ ++K +    CP  ++   F +  G 
Sbjct  25   AVEPVTDIYGQRLRAGTKYYILP--VVRGRGGGLTMSKAE-NKTCPKSVIQERFEVSNGM  81

Query  316  PVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVE--  489
            P+ F+P+ K   +  ST     F+A +          W ++  DE   Q       VE  
Sbjct  82   PLTFSPSDKSKVIRVSTDLNFKFSATSI---------WNLDNVDEKTNQWFIGTCGVEGN  132

Query  490  ----NVSNLFRIEPVDIGPQIYKLTYCPRDED----NCYDVGRYL  600
                 V N F+I+  +     YK+ +CP   D     C DVG ++
Sbjct  133  PGRTTVGNWFKIDKYE---DHYKILFCPSVCDICRVMCRDVGVFV  174



>ref|XP_006478134.1| PREDICTED: miraculin-like [Citrus sinensis]
 gb|AAG38517.1|AF283532_1 miraculin-like protein [Citrus x paradisi]
 gb|ACL78789.1| putative miraculin-like protein [Citrus unshiu]
 gb|KDO41017.1| hypothetical protein CISIN_1g026834mg [Citrus sinensis]
Length=232

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/179 (26%), Positives = 74/179 (41%), Gaps = 20/179 (11%)
 Frame = +1

Query  109  AAALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDI  288
            A A  P    +  +P++DV G  + +   YYL +   G   G G+   K      CP D+
Sbjct  15   ALATKPQLGASESEPILDVYGNQVDSSHRYYLVSALWGVKTGGGISADK-GKNGQCPTDV  73

Query  289  V--VPSFNLGDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDD-EFGR  459
            +   P    G  +   P      V EST   + F+  ++ ++C     WKV+ D+   G+
Sbjct  74   IQLSPKDKRGKNLGLLPYDNSTIVRESTNIKLKFSRVSSLQQCNKDSLWKVDNDNASLGK  133

Query  460  QLVKAGEAVENVSNLFRIEPVDIG----------PQIYKLTYCPRDEDN-----CYDVG  591
            Q +  GE  +   N F++E V             P +YK+ +C    +      C DVG
Sbjct  134  QFITIGEG-KTCQNFFKLEKVSASIFDMKIALDIPCLYKIVHCSTLVNGSCDTLCKDVG  191



>ref|XP_008778295.1| PREDICTED: miraculin, partial [Phoenix dactylifera]
Length=184

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 73/158 (46%), Gaps = 20/158 (13%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLS---TDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLG  312
            A + V+D DG  L  G EYY+    TD AG     G+ LA  + + P    + +   + G
Sbjct  29   AAEVVLDRDGNELRRGVEYYIYPGITDVAG-----GLTLASRNHSCPLDVTLAISPTSNG  83

Query  313  DPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV-  486
             P+ F PA  +++ +  ST   I F+   A   C     WK++ DD  GR  V  G    
Sbjct  84   LPLTFLPADPEEDTINTSTDLNIVFS---AVTICVQSTVWKLDFDDAAGRFYVTTGGVAG  140

Query  487  ----ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDV  588
                E ++N F+IE  D G   YKL +CP   D C  V
Sbjct  141  NPGRETLANWFKIEN-DRGA--YKLVFCPTVCDICKPV  175



>ref|XP_010918417.1| PREDICTED: miraculin-like [Elaeis guineensis]
Length=199

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 71/158 (45%), Gaps = 18/158 (11%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLS---TDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLG  312
            AG+ V+D DG  L  G EYY+    TD AG     G+ LA  + + P    + +   N G
Sbjct  21   AGEVVLDTDGNELRRGVEYYIYPGITDVAG-----GLTLASRNHSCPLDVTLAISPTNNG  75

Query  313  DPVVFTPA-VKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV-  486
             PV F PA  +++ +  ST   I F+   A   C    +WK++ D+   R  V  G    
Sbjct  76   LPVTFLPADPEEDTINTSTDLNIVFS---AFTICLQSTAWKLDFDNTTRRFYVTTGGVTG  132

Query  487  ----ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDV  588
                E + N F+I+    G   Y L +CP   + C  V
Sbjct  133  NPGRETLDNWFKIQSAS-GRSGYNLVFCPSVCNICRPV  169



>ref|XP_003534100.1| PREDICTED: miraculin-like [Glycine max]
 gb|KHM99733.1| Miraculin [Glycine soja]
Length=216

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 80/181 (44%), Gaps = 20/181 (11%)
 Frame = +1

Query  148  QPVMDVDGKVLLAGSEYYLSTDFAGRAR--------GQGVKLAKLDFTAPCPNDIVVPSF  303
            + V+D  G  L  G  YY+        R         +G+ LA +     CP D+VV   
Sbjct  28   EAVIDTSGTELQPGLSYYVVPAMRSFTRCGKFECLNAEGLSLASIG--ESCPLDVVVEQR  85

Query  304  NLGDPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaD-KLSWKVEQ-DDEFGRQLVKA  474
            + G P+ F+P   +  V+  ST   I F     +  CA+    WK++  D   G+  V  
Sbjct  86   SFGLPLSFSPLDTNESVVRVSTDLNIMFCTDRTSYSCAEYSPVWKLDHFDVSKGKWFVTT  145

Query  475  GEAV-----ENVSNLFRIEPVDIGPQI-YKLTYCPRDEDNCYDVGRYLDWATGNTHLALT  636
            G ++     E + N F+IE  D   +I Y  + CP  +  C DVG ++D   G   LAL+
Sbjct  146  GGSMGNPSWETIRNWFKIEKCDSAYRIVYCPSVCPSSKHMCKDVGVFVD-ENGYRRLALS  204

Query  637  N  639
            +
Sbjct  205  D  205



>gb|ADW95376.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=204

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 70/151 (46%), Gaps = 20/151 (13%)
 Frame = +1

Query  151  PVMDVDGKVLLAGSEYYL---STDFAGRARGQGVKLAKLDFTAPCP----NDIVVPSFNL  309
            PV+D DG+ L +G EYY+    TD AG     G+ L  L+  + CP     + + P  + 
Sbjct  27   PVLDADGQPLRSGVEYYVLPAVTDVAG-----GLILVNLNNGSICPLFVGQEPLAPVVSP  81

Query  310  GDPVVFTPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKV-EQDDEFGRQLVKAGEAV  486
            G  V+FTP V D  + E+   T+ FT       CA   +W+V E++ E  R+ + A    
Sbjct  82   GTSVIFTPRVADTVIRETRDFTVEFT---GVTICAQSTAWRVGERNPETRRRYILAETDP  138

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPRDEDNC  579
               SN +    V     +Y   +CP    NC
Sbjct  139  IPSSNAWHFNIVKNDQGLYNFQWCP----NC  165



>ref|XP_010416116.1| PREDICTED: miraculin-like [Camelina sativa]
Length=208

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 91/204 (45%), Gaps = 31/204 (15%)
 Frame = +1

Query  115  ALDPIRLPTAGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVV  294
            AL  +    A   V+D+DG ++  GS Y L      R RG G+ L+       CP DIV 
Sbjct  10   ALTAVLATNAYGAVLDIDGNIIFRGSYYVLPVI---RGRGGGLTLSGRG-GELCPLDIVQ  65

Query  295  PSFNL--GDPVVFT---PAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGR  459
             S  L  G+PV F+   P V   FV ES  Q ++      A  C     W+V + DE  +
Sbjct  66   ESQELDEGNPVKFSNWRPRVA--FVPES--QDLNIQTDVEATICFQSTYWRVGEFDEERK  121

Query  460  Q------LVKAGEAVENVSNLFRIEPVDIGPQIYKLTYCPRDEDN----CYDVGRYLDWA  609
            Q      L   G   ++  + F+IE    G   YK  +CP   D+    C DVG + D  
Sbjct  122  QYFIVAGLKPEGFGQDSSKSFFKIEKS--GDDAYKFVFCPSTCDSGCPKCSDVGIFED-E  178

Query  610  TGNTHLALTNSTESLDNSLIVFKE  681
             G   LAL++     +  L++FK+
Sbjct  179  LGVRRLALSD-----EPFLVMFKK  197



>emb|CAC40756.1| putative miraculin [Atropa belladonna]
Length=204

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 77/169 (46%), Gaps = 15/169 (9%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARG--QG--VKLAKLDFTAPCPNDIVVPSFNLGDPV  321
            V D++G++L + + Y++ +   G + G  QG  V  A  D    CP+ +V    ++G  V
Sbjct  20   VRDINGEILRSDTRYFVVSGLIGGSGGVTQGPTVNGACHDANFVCPSQVVHTPQDMGTSV  79

Query  322  VFTP-AVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQ--DDEFGRQLVKAGEAVE-  489
             F P A K   + E T   I F          +   WKV+    +E    L   G A   
Sbjct  80   YFKPKAPKQEEITEFTSLNIEFYLDNPTICKNN--VWKVDGFPGNEIPMFLSTNGVAGNP  137

Query  490  -NVSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTHLAL  633
             NVS+ F+IE V      YKL +CP +E  C D+G  +    G  HLA+
Sbjct  138  LNVSSWFQIEKVH--DNSYKLVFCPYEEHICSDIG--IKVVDGQDHLAI  182



>emb|CDQ51987.1| alpha amylase/subtilisin inhibitor, partial [Fagus sylvatica]
Length=210

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 71/153 (46%), Gaps = 25/153 (16%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLS---TDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDP  318
            V+D  G+ L  G EYY+    TD  GR          ++    CP  + + + +   G P
Sbjct  31   VLDTTGQALERGVEYYIKPAITDNGGR-------FTLINRNDSCPLYVGLENVSGLDGFP  83

Query  319  VVFTPAVKDNFVIESTFQT-ISFTaaaaaeecaDKLSWKV-EQDDEFGRQLVKAGEAV--  486
            V FTP V++  VI     T + F+A           +WK+ E+D E  R+L+  GE V  
Sbjct  84   VTFTPFVEEETVIRENRDTKVVFSAETTCV---QSTAWKLGERDPETERRLIVTGEIVVD  140

Query  487  -ENVS-----NLFRIEPVDIGPQIYKLTYCPRD  567
             EN S     N F++   D+G  IY + +CP +
Sbjct  141  EENQSWRRAGNYFKLSKSDVGDNIYNIEWCPTE  173



>emb|CDP20822.1| unnamed protein product [Coffea canephora]
Length=204

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 81/178 (46%), Gaps = 23/178 (13%)
 Frame = +1

Query  142  AGQPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GD  315
            A   V D+DGK ++ G+ YY+     GR  G  +  A       CP D++   F +  G 
Sbjct  26   ASNAVRDIDGKEVIVGAHYYILPVIRGRGGGLTLGSAD---NETCPLDVIQEQFEVKRGL  82

Query  316  PVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAG-----  477
            P+ FTP      V+  ST   I F    AA  C     WK+E D +  + ++ +G     
Sbjct  83   PLTFTPVNTTKGVVPVSTDLNIKF---FAATICVQSTVWKLEFDADISQYVIVSGGIEGN  139

Query  478  EAVENVSNLFRIEPVDIGPQIYKLTYCPRDED----NCYDVGRYLDWATGNTHLALTN  639
               E +SN F+IE  D   Q YKL YCP   +     C DVG ++    G   LAL++
Sbjct  140  PGRETISNWFKIEKYD---QDYKLVYCPTVCNFCKVICRDVGIFVQ--NGRRRLALSD  192



>ref|XP_009608866.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 82/191 (43%), Gaps = 28/191 (15%)
 Frame = +1

Query  121  DPIRLPTAG---QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIV  291
            +P  L +AG    PV+D +G  +  GS Y++      R RG G+  + +     CP DI+
Sbjct  20   NPSELLSAGPSPSPVLDTNGDKIRTGSNYFVLPVI--RGRGGGLFPSNVKQNNTCPRDII  77

Query  292  VPSFNL--GDPVVFTPAVKDNFVIE--STFQTISFTaaaaaeecaDKLSWKVEQDDEFGR  459
              S ++  G PVVFTP      VI   S      FT    A E      WKV   DE  +
Sbjct  78   QESLDVQQGLPVVFTPVDPKKGVIRLSSDLNVRFFTPTICARETI----WKVGDFDEKLK  133

Query  460  QLVKAGEAVE------NVSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWA  609
            Q       VE       VSN F+IE +      YK  +CP      +  C DVG +    
Sbjct  134  QYFVVTGGVEGNPGPQTVSNWFKIEKLGTD---YKFVFCPSVCSFCKVICKDVGIFTK--  188

Query  610  TGNTHLALTNS  642
             G   LAL+++
Sbjct  189  NGVRFLALSDT  199



>sp|P81726.1|ICI2_CANLI RecName: Full=Subtilisin inhibitor CLSI-II; Contains: RecName: 
Full=Subtilisin inhibitor CLSI-III [Canavalia lineata]
Length=190

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 68/170 (40%), Gaps = 15/170 (9%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIV--VPSFNLGDPVVF  327
            VMD   K +  G EYY+     G   G GV+LAK    + CP  ++        G PV F
Sbjct  6    VMDASSKPIFPGGEYYIMPAIWGPP-GGGVRLAKTR-NSDCPVTVLQDYGEVIFGQPVKF  63

Query  328  T-PAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVEN----  492
            T P      +I +T             ECA    W V  DDE  +  V  G   ++    
Sbjct  64   TLPGRGSGLIITNT----PVEEFIKKPECASSSKWSVFVDDEIEKACVGIGGHEDHPGEQ  119

Query  493  -VSNLFRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLDWATGNTHLALTN  639
              S  F I+        YKL +C  D   C D+GRY D   G   L LT+
Sbjct  120  VFSGTFTIQKSRTPYNSYKLVFCESDSSTCSDIGRY-DNNEGGRRLILTH  168



>ref|XP_009777240.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 77/175 (44%), Gaps = 24/175 (14%)
 Frame = +1

Query  121  DPIRLPTAG---QPVMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIV  291
            +P  L +AG    PV+D +G  + AGS Y++      R RG G+  + +     CP DI+
Sbjct  20   NPSELVSAGPSPSPVLDTNGDKIRAGSNYFVLPVI--RGRGGGLLPSNVKQNNSCPRDII  77

Query  292  VPSFNL--GDPVVFTPAVKDNFVIE-STFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQ  462
              S  +  G PVVFTP      VI  ST   + F        CA +  WK+   DE  +Q
Sbjct  78   QNSNEVQEGLPVVFTPVDPKKGVIRLSTDLNVRF---FTPTICARETIWKLGTYDEKLKQ  134

Query  463  LVKAGEAVE------NVSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRY  597
                   VE       VSN F+IE +      YK  +CP      +  C DVG Y
Sbjct  135  YFIVTGGVEGNPGPLTVSNWFKIEKLGTD---YKFVFCPSVCTFCKVICKDVGIY  186



>gb|AFL91234.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=161

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 66/143 (46%), Gaps = 21/143 (15%)
 Frame = +1

Query  187  GSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPVVFTPA-VKDNFVI  357
            G+EYY+   F  R RG GV LA       CP D+V   F L  G P+ FTP   K   + 
Sbjct  1    GTEYYILPVF--RGRGGGVTLAPTR-NESCPLDVVQEGFELDNGLPLTFTPVDPKKGVIR  57

Query  358  ESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAV------ENVSNLFRIEP  519
            EST   I F+A++   +      W +E   E+  Q + +G         E +SN F+IE 
Sbjct  58   ESTDLNIIFSASSICIQSN---VWMLE---EYEGQRIISGRGTSGNPGGETISNWFKIEK  111

Query  520  VDIGPQIYKLTYCPRDEDNCYDV  588
             +     YKL YCP   D C  V
Sbjct  112  YE---NDYKLVYCPTVCDLCRPV  131



>sp|P83594.1|IFXA_BAUUN RecName: Full=Factor Xa inhibitor BuXI [Bauhinia ungulata]
Length=172

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 67/153 (44%), Gaps = 13/153 (8%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPVVF  327
            V+D DGK +  G +YY+   F  R  G G++L ++     CP+ +V  S  +  G PV+ 
Sbjct  3    VLDTDGKPVNNGGQYYIIPAF--RGNGGGLELTRVGRET-CPHTVVQASSEISNGLPVMI  59

Query  328  TPAVKDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEF-GRQLVKAGEAVENVSNL  504
                +  F+  ST   +S               W + QD +  G   V+  E        
Sbjct  60   AALPRTMFI--STAWRVSIQFLKVPTCTPKPSYWHIPQDSDMEGSVEVRVDE---RFPLE  114

Query  505  FRIEPVDIGPQIYKLTYCPRDEDNCYDVGRYLD  603
            FRIE V      YKL +CP   D+C D+G  +D
Sbjct  115  FRIEKV--SEDAYKLMHCPSSSDSCRDLGIAID  145



>ref|XP_004137639.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64219.1| hypothetical protein Csa_1G043220 [Cucumis sativus]
Length=205

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 80/176 (45%), Gaps = 23/176 (13%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNL--GDPVVF  327
            V+D DGK L AG +YY+ + ++ R  G G+ +  +     CP +I+  S++   G P  F
Sbjct  31   VLDTDGKKLRAGDQYYILSVYS-RNSG-GLSIGGIYGYEKCPINILPESYDYLHGLPATF  88

Query  328  TPAV-KDNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQL------VKAGEAV  486
            +P   K   V  ST   I F A            WKV + DE+ +Q       +K     
Sbjct  89   SPINPKKGVVRVSTDLNIQFEANTRCGIST---VWKVGKFDEYLKQYFVTMGGMKGNPGR  145

Query  487  ENVSNLFRIEPVDIGPQIYKLTYCPR----DEDNCYDVGRYLDWATGNTHLALTNS  642
            E + N F++E      + YKL YCP      +  C DVG  L +  G   +AL ++
Sbjct  146  ETIENWFKVEKYG---KNYKLVYCPTVCKYCKVVCKDVG--LFYKNGRRVIALNDA  196



>gb|ACO39854.1| kunitz trypsin inhibitor [Populus balsamifera]
Length=200

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 13/144 (9%)
 Frame = +1

Query  154  VMDVDGKVLLAGSEYYLSTDFAGRARGQGVKLAKLDFTAPCPNDIVVPSFNLGDPVVFTP  333
            V+D  G+ + AG  Y +          + +++        C +D+++ + N G PV F+P
Sbjct  33   VLDFYGREVQAGVSYLIDQ--------EDIRVVSATINPICNSDVILSTGNEGLPVTFSP  84

Query  334  AVK--DNFVIESTFQTISFTaaaaaeecaDKLSWKVEQDDEFGRQLVKAGEAVENVSNLF  507
             +   D  + E T  T+SF A+         + WK+  +      +V  G  V+ + NLF
Sbjct  85   VINSTDGVIREGTLITVSFDASTCGMAGVTPM-WKIGFNSTAKGYIVTTG-GVDRL-NLF  141

Query  508  RIEPVDIGPQIYKLTYCPRDEDNC  579
            +I   D     Y+L+YCP  E  C
Sbjct  142  KITKYDGDSSFYQLSYCPNSEPFC  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1972844437608