BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c40907_g1_i1 len=1223 path=[1:0-1222]

Length=1223
                                                                      Score     E

ref|XP_006350651.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    444   8e-152   
gb|ABY19383.1|  putative chlorophyllase                                 442   1e-150   Nicotiana tabacum [American tobacco]
ref|XP_009597039.1|  PREDICTED: chlorophyllase-2, chloroplastic         440   3e-150   
ref|XP_009800026.1|  PREDICTED: chlorophyllase-2, chloroplastic         439   2e-149   
gb|ADZ24715.1|  chlorophyllase                                          436   3e-148   
ref|XP_004241041.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    432   5e-147   
gb|AHZ35334.1|  chlorophyllase                                          432   5e-147   
ref|XP_007145911.1|  hypothetical protein PHAVU_007G278100g             429   5e-146   
gb|KDP40227.1|  hypothetical protein JCGZ_02225                         428   2e-145   
emb|CDO99104.1|  unnamed protein product                                426   2e-144   
ref|XP_010092435.1|  Chlorophyllase-2                                   429   2e-144   
ref|XP_008224250.1|  PREDICTED: chlorophyllase-2, chloroplastic         426   3e-144   
ref|XP_006363484.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    425   4e-144   
gb|KDO74483.1|  hypothetical protein CISIN_1g020950mg                   422   4e-143   
ref|XP_010034594.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    422   8e-143   
ref|XP_006489443.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    421   1e-142   
ref|XP_006420011.1|  hypothetical protein CICLE_v10005453mg             421   1e-142   
ref|XP_004296571.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    419   2e-141   
ref|XP_002279285.1|  PREDICTED: chlorophyllase-2, chloroplastic         418   2e-141   Vitis vinifera
ref|XP_011090675.1|  PREDICTED: chlorophyllase-2, chloroplastic         416   8e-141   
ref|XP_010326690.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophylla...    416   8e-141   
ref|XP_002315752.2|  Chlorophyllase 1 family protein                    416   2e-140   Populus trichocarpa [western balsam poplar]
ref|XP_011030633.1|  PREDICTED: chlorophyllase-2, chloroplastic         414   2e-139   
ref|XP_002517075.1|  Chlorophyllase-2, chloroplast precursor, put...    412   2e-139   Ricinus communis
ref|XP_010256173.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    412   4e-139   
ref|XP_010256171.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    411   2e-138   
dbj|BAF43703.1|  Chlorophyllase 1                                       410   3e-138   
ref|XP_003537121.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    409   7e-138   
ref|XP_010256170.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    410   2e-137   
ref|XP_007222997.1|  hypothetical protein PRUPE_ppa010004mg             403   3e-136   
gb|EYU41443.1|  hypothetical protein MIMGU_mgv1a010077mg                405   3e-136   
emb|CDO99123.1|  unnamed protein product                                416   1e-135   
ref|XP_007034856.1|  Chlorophyllase isoform 1                           400   1e-134   
ref|XP_010256174.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    399   5e-134   
dbj|BAF43705.1|  Chlorophyllase 3                                       399   5e-134   
ref|XP_008449319.1|  PREDICTED: chlorophyllase-2, chloroplastic         399   9e-134   
ref|XP_009343942.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophylla...    399   2e-133   
ref|XP_004145391.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    397   4e-133   
ref|XP_007034857.1|  Chlorophyllase isoform 2                           395   1e-132   
ref|XP_010932817.1|  PREDICTED: chlorophyllase-2, chloroplastic         391   8e-131   
gb|KEH41057.1|  chlorophyllase enzyme                                   385   8e-129   
ref|XP_010695290.1|  PREDICTED: chlorophyllase-2, chloroplastic         385   3e-128   
gb|ACJ85964.1|  unknown                                                 381   5e-127   Medicago truncatula
ref|XP_009393050.1|  PREDICTED: chlorophyllase-2, chloroplastic         378   5e-126   
emb|CDY50811.1|  BnaCnng19750D                                          379   8e-126   
ref|XP_009113977.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    377   3e-125   
emb|CDY32929.1|  BnaA09g16640D                                          377   3e-125   
ref|XP_006403171.1|  hypothetical protein EUTSA_v10003248mg             375   1e-124   
gb|KFK31694.1|  hypothetical protein AALP_AA6G147200                    374   2e-124   
ref|XP_002865397.1|  chlorophyll-chlorophyllido hydrolase 2             374   4e-124   
ref|XP_008775648.1|  PREDICTED: chlorophyllase-2, chloroplastic         374   4e-124   
ref|XP_010494369.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    372   4e-123   
ref|NP_199199.1|  chlorophyllase 2                                      371   5e-123   Arabidopsis thaliana [mouse-ear cress]
emb|CDX96924.1|  BnaC02g30620D                                          367   6e-122   
ref|XP_010441975.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    367   1e-121   
ref|XP_010481816.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    367   3e-121   
gb|AAO22714.1|  putative AtCLH2 protein                                 362   5e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282250.1|  hypothetical protein CARUB_v10028524mg             363   7e-120   
ref|XP_009123914.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    362   6e-119   
gb|AAN51934.1|AF337545_1  chlorophyllase 2                              359   3e-118   Brassica oleracea
gb|KEH41056.1|  chlorophyllase                                          356   3e-117   
ref|XP_006838958.1|  hypothetical protein AMTR_s00002p00270990          355   9e-117   
ref|XP_010441977.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    350   1e-114   
ref|XP_010481814.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    349   1e-114   
gb|KCW84161.1|  hypothetical protein EUGRSUZ_B01023                     347   2e-114   
gb|EPS63536.1|  hypothetical protein M569_11246                         345   1e-113   
ref|XP_010495652.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    345   8e-113   
ref|XP_010034577.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    341   3e-111   
gb|ACN40275.1|  unknown                                                 340   1e-110   Picea sitchensis
ref|XP_008390990.1|  PREDICTED: chlorophyllase-2, chloroplastic         335   7e-110   
ref|XP_008344678.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophylla...    328   3e-107   
ref|XP_003571791.2|  PREDICTED: chlorophyllase-2, chloroplastic-like    330   1e-106   
gb|AAP44978.1|  chlorophyllase                                          330   2e-106   Ginkgo biloba [ginkgo]
ref|XP_010034586.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    326   1e-105   
ref|XP_002467217.1|  hypothetical protein SORBIDRAFT_01g021520          326   2e-104   Sorghum bicolor [broomcorn]
ref|XP_004983205.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    323   6e-104   
emb|CDJ26436.1|  unnamed protein product                                322   1e-103   
dbj|BAJ89583.1|  predicted protein                                      321   2e-103   
ref|XP_009123919.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    318   2e-102   
ref|NP_001064620.1|  Os10g0419600                                       304   3e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002271974.1|  PREDICTED: chlorophyllase-1                        296   1e-93    Vitis vinifera
ref|XP_002273926.1|  PREDICTED: chlorophyllase-1                        295   2e-93    Vitis vinifera
gb|ACG44273.1|  chlorophyllase-2                                        295   6e-93    Zea mays [maize]
ref|NP_001130783.1|  chlorophyllase-2                                   294   1e-92    Zea mays [maize]
ref|XP_009795214.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophylla...    289   2e-92    
gb|ABR16879.1|  unknown                                                 291   5e-92    Picea sitchensis
ref|XP_010096444.1|  hypothetical protein L484_002352                   291   1e-91    
ref|XP_004956217.1|  PREDICTED: chlorophyllase-1-like                   281   6e-88    
ref|XP_007200272.1|  hypothetical protein PRUPE_ppa014909mg             279   4e-87    
ref|XP_008235366.1|  PREDICTED: chlorophyllase-1                        278   2e-86    
ref|XP_004290630.1|  PREDICTED: chlorophyllase-1-like                   276   4e-86    
ref|XP_010934773.1|  PREDICTED: chlorophyllase-1-like                   275   1e-85    
ref|XP_003528958.1|  PREDICTED: chlorophyllase-1                        275   2e-85    
gb|EMS51443.1|  Chlorophyllase-2, chloroplastic                         272   6e-85    
gb|ACU24105.1|  unknown                                                 273   8e-85    Glycine max [soybeans]
emb|CBI28741.3|  unnamed protein product                                288   1e-84    
ref|XP_008787534.1|  PREDICTED: chlorophyllase-1                        271   3e-84    
ref|XP_008355440.1|  PREDICTED: chlorophyllase-1-like                   269   4e-83    
ref|XP_001753563.1|  predicted protein                                  269   5e-83    
gb|AHJ14565.1|  chlorophyllase                                          268   1e-82    
gb|EEE50970.1|  hypothetical protein OsJ_31546                          268   3e-82    Oryza sativa Japonica Group [Japonica rice]
gb|AEO19902.1|  chlorophyllase 1                                        266   3e-82    
gb|AAP92160.2|  chlorophyllase                                          266   3e-82    Piper betle
ref|XP_009370779.1|  PREDICTED: chlorophyllase-1-like                   265   1e-81    
gb|EMT19932.1|  Chlorophyllase-1                                        265   1e-81    
ref|XP_010256231.1|  PREDICTED: chlorophyllase-1-like                   267   5e-81    
ref|XP_003576870.1|  PREDICTED: chlorophyllase-1-like                   261   3e-80    
gb|ABE01079.1|  chlorophyllase                                          261   3e-80    Piper betle
ref|XP_008652459.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    261   5e-80    
ref|XP_003565235.1|  PREDICTED: chlorophyllase-1-like                   260   1e-79    
ref|XP_003534159.1|  PREDICTED: chlorophyllase-1-like                   259   2e-79    
gb|KFK44086.1|  hypothetical protein AALP_AA1G214200                    259   4e-79    
gb|AAN51933.1|AF337544_1  chlorophyllase 1                              259   4e-79    Brassica oleracea
emb|CDY38340.1|  BnaA02g18330D                                          258   4e-79    
ref|XP_009149451.1|  PREDICTED: chlorophyllase-1                        258   4e-79    
ref|XP_010042520.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    255   7e-79    
ref|XP_006416475.1|  hypothetical protein EUTSA_v10008201mg             257   1e-78    
emb|CDP03668.1|  unnamed protein product                                256   2e-78    
emb|CDY29413.1|  BnaA06g13830D                                          256   4e-78    
emb|CBI28744.3|  unnamed protein product                                262   3e-77    
ref|XP_008386540.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophylla...    255   3e-77    
gb|ACO50428.1|  chlorophyllase 1                                        254   4e-77    Pachira macrocarpa
gb|EYU46277.1|  hypothetical protein MIMGU_mgv1a022687mg                252   8e-77    
ref|XP_002893060.1|  coronatine-induced protein 1                       253   9e-77    
gb|KHN44574.1|  Chlorophyllase-1                                        251   2e-76    
ref|XP_010477190.1|  PREDICTED: chlorophyllase-1-like                   251   3e-76    
ref|XP_010523688.1|  PREDICTED: chlorophyllase-1                        250   7e-76    
ref|XP_010498391.1|  PREDICTED: chlorophyllase-1-like                   249   1e-75    
ref|XP_010459642.1|  PREDICTED: chlorophyllase-1-like                   249   2e-75    
ref|NP_564094.1|  chlorophyllase 1                                      249   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|KDP21408.1|  hypothetical protein JCGZ_21879                         249   3e-75    
gb|ACO50429.1|  chlorophyllase 2                                        248   5e-75    Pachira macrocarpa
ref|XP_007152724.1|  hypothetical protein PHAVU_004G154100g             248   6e-75    
ref|XP_002963743.1|  hypothetical protein SELMODRAFT_66990              244   2e-74    
gb|EMS62705.1|  Chlorophyllase-1                                        244   6e-74    
ref|XP_002974826.1|  hypothetical protein SELMODRAFT_57004              242   8e-74    
ref|XP_002459848.1|  hypothetical protein SORBIDRAFT_02g012300          244   1e-73    Sorghum bicolor [broomcorn]
ref|XP_006304020.1|  hypothetical protein CARUB_v10009755mg             243   3e-73    
ref|XP_011090376.1|  PREDICTED: chlorophyllase-1-like                   243   7e-73    
gb|KDP21409.1|  hypothetical protein JCGZ_21880                         242   2e-72    
ref|XP_003528959.1|  PREDICTED: chlorophyllase-1-like                   237   7e-71    
ref|XP_004512891.1|  PREDICTED: chlorophyllase-1-like                   236   3e-70    
ref|XP_003620408.1|  Chlorophyllase-1                                   234   1e-69    
gb|EMS58425.1|  Chlorophyllase-2, chloroplastic                         233   3e-69    
ref|XP_008449344.1|  PREDICTED: chlorophyllase-1-like                   232   6e-69    
ref|XP_002271936.2|  PREDICTED: chlorophyllase-1                        229   7e-68    Vitis vinifera
ref|XP_003632330.1|  PREDICTED: chlorophyllase-1-like                   229   1e-67    
ref|XP_008465739.1|  PREDICTED: chlorophyllase-1-like                   228   2e-67    
gb|EYU43828.1|  hypothetical protein MIMGU_mgv1a009904mg                228   2e-67    
ref|XP_009760775.1|  PREDICTED: chlorophyllase-1-like                   226   5e-67    
ref|XP_009777295.1|  PREDICTED: chlorophyllase-1-like isoform X1        226   7e-67    
ref|XP_002273956.1|  PREDICTED: chlorophyllase-1-like                   226   2e-66    Vitis vinifera
emb|CAN82816.1|  hypothetical protein VITISV_044164                     224   7e-66    Vitis vinifera
ref|XP_002520934.1|  Chlorophyllase-1, putative                         221   2e-65    Ricinus communis
emb|CBI28739.3|  unnamed protein product                                222   6e-65    
ref|XP_002444588.1|  hypothetical protein SORBIDRAFT_07g024090          221   1e-64    Sorghum bicolor [broomcorn]
gb|ACN32030.1|  unknown                                                 221   1e-64    Zea mays [maize]
ref|XP_002306793.2|  hypothetical protein POPTR_0005s23590g             222   2e-64    Populus trichocarpa [western balsam poplar]
gb|EEC66959.1|  hypothetical protein OsI_33606                          220   4e-64    Oryza sativa Indica Group [Indian rice]
ref|XP_011032645.1|  PREDICTED: chlorophyllase-1, chloroplastic-like    220   1e-63    
gb|ABK26334.1|  unknown                                                 219   1e-63    Picea sitchensis
ref|XP_003572503.1|  PREDICTED: chlorophyllase type 0-like              217   2e-63    
ref|XP_006388207.1|  hypothetical protein POPTR_0284s00200g             219   3e-63    
gb|ACI06105.1|  chlorophyllase                                          216   1e-62    Citrus limon [lemon]
ref|XP_004143780.1|  PREDICTED: chlorophyllase-1-like                   215   2e-62    
sp|Q94LX1.1|CLH1_CITUN  RecName: Full=Chlorophyllase-1, chloropla...    215   2e-62    Citrus unshiu [satsuma mandarin]
ref|XP_010669257.1|  PREDICTED: chlorophyllase type 0-like isofor...    216   3e-62    
ref|XP_006441463.1|  hypothetical protein CICLE_v10021095mg             215   4e-62    
ref|XP_006478133.1|  PREDICTED: chlorophyllase-1, chloroplastic-like    214   6e-62    
ref|XP_006443995.1|  hypothetical protein CICLE_v10021103mg             214   1e-61    
ref|NP_001275819.1|  chlorophyllase-1, chloroplastic                    212   4e-61    
ref|XP_009791851.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    211   8e-61    
ref|XP_009588380.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    209   5e-60    
ref|XP_009376014.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    201   2e-59    
ref|XP_004247197.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    206   6e-59    
ref|XP_010326402.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    204   2e-58    
gb|KDP21407.1|  hypothetical protein JCGZ_21878                         207   3e-58    
ref|XP_006349715.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    201   2e-57    
ref|XP_008345193.1|  PREDICTED: chlorophyllase-1-like                   197   6e-56    
ref|XP_002520936.1|  Chlorophyllase-1, putative                         192   6e-55    Ricinus communis
sp|Q9LE89.1|CLH0_CHEAL  RecName: Full=Chlorophyllase type 0; AltN...    194   4e-54    Chenopodium album [lamb's-quarters]
ref|XP_010669258.1|  PREDICTED: chlorophyllase type 0-like isofor...    193   8e-54    
gb|AEK97328.1|  chromoplast chlorophyllase                              183   6e-52    
gb|AFK44490.1|  unknown                                                 179   3e-51    
ref|XP_009777296.1|  PREDICTED: chlorophyllase-1-like isoform X2        178   5e-49    
gb|KDO37483.1|  hypothetical protein CISIN_1g043492mg                   177   1e-48    
ref|XP_006838962.1|  hypothetical protein AMTR_s00002p00271040          174   7e-48    
ref|XP_004251483.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    177   8e-48    
ref|XP_006363512.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    175   3e-47    
gb|AAN51935.1|AF337546_1  chlorophyllase 3                              171   9e-47    Brassica oleracea
ref|XP_002978190.1|  hypothetical protein SELMODRAFT_176680             173   1e-46    
ref|XP_002966376.1|  hypothetical protein SELMODRAFT_85435              163   3e-43    
ref|NP_001169192.1|  uncharacterized protein LOC100383045               163   6e-43    Zea mays [maize]
ref|XP_010096443.1|  Chlorophyllase-1                                   160   1e-41    
ref|XP_002966378.1|  hypothetical protein SELMODRAFT_86398              158   2e-41    
gb|EMT11146.1|  Chlorophyllase-2, chloroplastic                         156   3e-41    
ref|XP_011080324.1|  PREDICTED: chlorophyllase-1, chloroplastic-like    159   4e-41    
gb|AFR54123.1|  chlorophyllase                                          152   3e-40    
ref|XP_006494924.1|  PREDICTED: chlorophyllase-1, chloroplastic-like    155   1e-39    
gb|AFK36235.1|  unknown                                                 150   5e-39    
ref|XP_010326403.1|  PREDICTED: chlorophyllase-1 isoform X3             152   6e-39    
emb|CDY68841.1|  BnaAnng28520D                                          145   7e-38    
ref|XP_010326404.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    147   9e-38    
gb|KDP21405.1|  hypothetical protein JCGZ_21876                         146   2e-37    
ref|XP_002978187.1|  hypothetical protein SELMODRAFT_107983             147   6e-37    
ref|XP_004964134.1|  PREDICTED: chlorophyllase-1-like                   143   8e-37    
ref|XP_011032785.1|  PREDICTED: chlorophyllase type 0-like              139   2e-35    
dbj|BAO47884.1|  chlorophyllase                                         129   9e-33    
gb|AFX87198.1|  chlorophyllase 1                                        130   1e-32    
gb|AFX87318.1|  chlorophyllase 1                                        130   1e-32    
gb|AFX87349.1|  chlorophyllase 1                                        129   4e-32    
gb|AFX87076.1|  chlorophyllase 1                                        129   4e-32    
gb|AFX87231.1|  chlorophyllase 1                                        129   4e-32    
gb|AFX87353.1|  chlorophyllase 1                                        129   4e-32    
gb|AFX87074.1|  chlorophyllase 1                                        129   5e-32    
gb|AFX87080.1|  chlorophyllase 1                                        129   5e-32    
gb|AFX87140.1|  chlorophyllase 1                                        128   1e-31    
gb|AFX87357.1|  chlorophyllase 1                                        128   1e-31    
gb|AFX87077.1|  chlorophyllase 1                                        128   1e-31    
gb|AFX87079.1|  chlorophyllase 1                                        127   2e-31    
gb|AFX87110.1|  chlorophyllase 1                                        127   2e-31    
ref|XP_002459847.1|  hypothetical protein SORBIDRAFT_02g012201          130   2e-31    Sorghum bicolor [broomcorn]
gb|AFX87374.1|  chlorophyllase 1                                        126   3e-31    
gb|AFX87361.1|  chlorophyllase 1                                        127   4e-31    
ref|XP_009594424.1|  PREDICTED: chlorophyllase-1-like                   115   3e-27    
ref|XP_006443996.1|  hypothetical protein CICLE_v10024279mg             118   3e-27    
ref|XP_006662361.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    115   1e-26    
gb|KGN61685.1|  hypothetical protein Csa_2G224250                       115   2e-26    
gb|KHN00266.1|  Chlorophyllase-2, chloroplastic                         106   2e-24    
ref|XP_008355464.1|  PREDICTED: chlorophyllase-1-like                   102   4e-23    
dbj|BAG55223.1|  chlorophyllase                                         102   7e-23    Sesbania rostrata
ref|XP_004345599.1|  predicted protein                                97.8    2e-19    
ref|XP_009371949.1|  PREDICTED: chlorophyllase-2, chloroplastic-like  93.2    3e-19    
gb|EYU31293.1|  hypothetical protein MIMGU_mgv1a023411mg              90.9    1e-18    
tpg|DAA48625.1|  TPA: hypothetical protein ZEAMMB73_996983            89.0    3e-17    
ref|XP_002311639.1|  Chlorophyllase 1 family protein                  85.9    8e-17    Populus trichocarpa [western balsam poplar]
emb|CDP11312.1|  unnamed protein product                              83.2    4e-16    
ref|XP_006838964.1|  hypothetical protein AMTR_s00002p00271070        82.4    2e-15    
ref|XP_010522518.1|  PREDICTED: uncharacterized protein LOC104801...  83.6    6e-14    
ref|XP_010522517.1|  PREDICTED: uncharacterized protein LOC104801...  83.6    6e-14    
dbj|BAD21503.1|  hypothetical protein                                 76.3    4e-13    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ22614.1|  hypothetical protein OsJ_06283                        75.5    8e-13    Oryza sativa Japonica Group [Japonica rice]
ref|WP_015746913.1|  chlorophyllase                                   76.6    2e-12    
gb|EFX74151.1|  hypothetical protein DAPPUDRAFT_307488                75.1    1e-11    
gb|KHN44572.1|  Chlorophyllase-1                                      70.1    9e-11    
ref|XP_002520935.1|  chlorophyllase, putative                         69.3    9e-11    Ricinus communis
ref|XP_006583435.1|  PREDICTED: chlorophyllase-1, chloroplastic-like  67.8    2e-10    
ref|WP_007193344.1|  amidohydrolase 2                                 71.6    4e-10    
gb|EFX74152.1|  hypothetical protein DAPPUDRAFT_109234                68.2    3e-09    
gb|KCW84158.1|  hypothetical protein EUGRSUZ_B01020                   63.2    5e-09    
ref|XP_005111178.1|  PREDICTED: uncharacterized protein LOC101859053  65.5    2e-08    
ref|XP_009400593.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophylla...  62.0    4e-08    
ref|XP_005650113.1|  alpha/beta-hydrolase                             63.5    1e-07    
dbj|BAC83397.1|  hypothetical protein                                 60.5    2e-07    Oryza sativa Japonica Group [Japonica rice]
gb|KHN44570.1|  Chlorophyllase-1                                      57.8    5e-07    
ref|XP_003387645.1|  PREDICTED: chlorophyllase-1-like                 60.5    5e-07    
ref|XP_005761530.1|  hypothetical protein EMIHUDRAFT_216964           57.8    5e-06    
ref|XP_009057763.1|  hypothetical protein LOTGIDRAFT_163441           56.6    1e-05    
ref|WP_036253270.1|  hypothetical protein                             55.1    4e-05    
ref|XP_002306792.1|  hypothetical protein POPTR_0005s23580g           52.0    8e-05    Populus trichocarpa [western balsam poplar]
ref|WP_020158868.1|  hypothetical protein                             54.3    8e-05    
ref|WP_036296023.1|  hypothetical protein                             54.3    8e-05    
ref|XP_002953564.1|  hypothetical protein VOLCADRAFT_94311            54.7    1e-04    
ref|XP_002506361.1|  predicted protein                                52.8    3e-04    Micromonas commoda
ref|XP_003083597.1|  putative submergence induced protein 2 (ISS)     52.4    5e-04    
ref|WP_017747180.1|  hypothetical protein                             51.6    5e-04    
ref|XP_005851983.1|  hypothetical protein CHLNCDRAFT_153950           51.6    7e-04    
ref|WP_038091422.1|  hypothetical protein                             51.2    0.001    



>ref|XP_006350651.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Solanum tuberosum]
Length=315

 Score =   444 bits (1143),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 219/302 (73%), Positives = 243/302 (80%), Gaps = 7/302 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSH-PPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            FD+G Y  +L+ +EP  CT H  PPK LLI TPSEA  G FP+ +FLHGYL YNSFYSQL
Sbjct  15   FDIGNYKTKLLKIEPQTCTKHNSPPKALLIGTPSEA--GNFPVLIFLHGYLLYNSFYSQL  72

Query  278  IQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALG  457
            IQH++SHGFIVVAPQLY V GADATE+IK TA+ITNWL EGL ++LPP V PN +K+ L 
Sbjct  73   IQHLSSHGFIVVAPQLYLVEGADATEDIKSTAEITNWLAEGLQHYLPPEVEPNLKKLGLA  132

Query  458  GHSRGGKVAFGLALGKIAR--TDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFD-LG  628
            GHSRGGKVAF LALG++A   TDLK SALIGVDPVDGMDKGKQTPP VLTY+P+SF+ L 
Sbjct  133  GHSRGGKVAFSLALGRLANISTDLKFSALIGVDPVDGMDKGKQTPPSVLTYVPRSFNNLD  192

Query  629  MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGG  808
            M VMVIGSGLGEVK+NPLFP CAPKGVNHRDFY EC  PACYFVAKDYGH DMLDDET G
Sbjct  193  MPVMVIGSGLGEVKKNPLFPACAPKGVNHRDFYNECCKPACYFVAKDYGHNDMLDDETKG  252

Query  809  VRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTV  988
            +RGKATYCLCK GK R  MR FVGG +VAFL  YLEG+ S L AIRD H  + PVELQ  
Sbjct  253  IRGKATYCLCKKGKSREPMRRFVGGVLVAFLEAYLEGNSSDLIAIRDGHVTL-PVELQDT  311

Query  989  AF  994
             F
Sbjct  312  DF  313



>gb|ABY19383.1| putative chlorophyllase [Nicotiana tabacum]
Length=318

 Score =   442 bits (1136),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/301 (73%), Positives = 240/301 (80%), Gaps = 6/301 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHP-PPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            FD+G Y   LV +EP  C S P PPK LLIATPSEA  G +P+ +FLHGYL YNSFYSQL
Sbjct  19   FDIGNYKTRLVKIEPQTCNSDPSPPKALLIATPSEA--GNYPVLIFLHGYLLYNSFYSQL  76

Query  278  IQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALG  457
            IQH++SHGFIVVAPQLY V GADATE+IK TA+ITNWL EGLH++LP  V PN +K+ L 
Sbjct  77   IQHVSSHGFIVVAPQLYLVEGADATEDIKSTAEITNWLAEGLHHYLPSGVEPNLKKLGLA  136

Query  458  GHSRGGKVAFGLALGKIAR--TDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGM  631
            GHSRGGKVAF LALGKIA   T+LK SALIGVDPVDGMDKGKQTPP VLTY P SF+L M
Sbjct  137  GHSRGGKVAFALALGKIANISTNLKFSALIGVDPVDGMDKGKQTPPAVLTYTPHSFNLDM  196

Query  632  AVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGV  811
            AVMVIGSGLGEVK+NPLFP CAP GVNH DFY EC  PACYFVAKDYGH DMLDDET G+
Sbjct  197  AVMVIGSGLGEVKKNPLFPACAPNGVNHCDFYSECCKPACYFVAKDYGHNDMLDDETKGI  256

Query  812  RGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVA  991
            RGKATYCLCK GK R  MR FVGG +VAFL  YLEG  S L AIRD +  + PVELQ + 
Sbjct  257  RGKATYCLCKKGKSREPMRRFVGGILVAFLEAYLEGKSSELMAIRDGNVTL-PVELQDID  315

Query  992  F  994
            F
Sbjct  316  F  316



>ref|XP_009597039.1| PREDICTED: chlorophyllase-2, chloroplastic [Nicotiana tomentosiformis]
Length=318

 Score =   440 bits (1132),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 218/301 (72%), Positives = 240/301 (80%), Gaps = 6/301 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHP-PPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            FD+G Y   LV +EP  C S P PPK LLIATPSEA  G +P+ +FLHGYL YNSFYSQL
Sbjct  19   FDIGNYKTRLVKIEPQTCNSDPSPPKALLIATPSEA--GNYPVLIFLHGYLLYNSFYSQL  76

Query  278  IQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALG  457
            IQH++SHGFIVVAPQLY V GADATE+IK TA+ITNWL EGLH++LP  V PN +K+ L 
Sbjct  77   IQHVSSHGFIVVAPQLYLVEGADATEDIKSTAEITNWLAEGLHHYLPSGVEPNLKKLGLA  136

Query  458  GHSRGGKVAFGLALGKIAR--TDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGM  631
            GHSRGGKVAF LALGKIA   T+LK SALIGVDPVDGMDKGKQTPP VLTY P SF+L M
Sbjct  137  GHSRGGKVAFALALGKIANISTNLKFSALIGVDPVDGMDKGKQTPPAVLTYTPHSFNLDM  196

Query  632  AVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGV  811
            +VMVIGSGLGEVK+N LFP CAP GVNHRDFY EC  PACYFVAKDYGH DMLDDET G+
Sbjct  197  SVMVIGSGLGEVKKNLLFPACAPNGVNHRDFYSECCKPACYFVAKDYGHNDMLDDETKGI  256

Query  812  RGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVA  991
            RGKATYCLCK GK R  MR FVGG +VAFL  YLEG  S L AIRD +  + PVELQ + 
Sbjct  257  RGKATYCLCKKGKSREPMRRFVGGFLVAFLEAYLEGKSSELMAIRDGNFTL-PVELQDID  315

Query  992  F  994
            F
Sbjct  316  F  316



>ref|XP_009800026.1| PREDICTED: chlorophyllase-2, chloroplastic [Nicotiana sylvestris]
Length=319

 Score =   439 bits (1128),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/302 (73%), Positives = 242/302 (80%), Gaps = 7/302 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCT-SHP-PPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            FDVG Y  + V +EP  C+ SHP PPK LLIATPS  SAG++P+ +FLHGYL YNSFYSQ
Sbjct  19   FDVGNYKTKFVKIEPQTCSNSHPSPPKALLIATPS--SAGSYPVLIFLHGYLLYNSFYSQ  76

Query  275  LIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
            LIQH++SHGFIVVAPQLY V GADATE+IK TA+ITNWL E LH++LP  V PN +K+ L
Sbjct  77   LIQHVSSHGFIVVAPQLYLVEGADATEDIKFTAEITNWLAEALHHYLPSGVEPNLKKLGL  136

Query  455  GGHSRGGKVAFGLALGKIAR--TDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLG  628
             GHSRGGKVAF LALGKIA   T+LK SALIGVDPVDGMDKGKQTPP VLTY   SF+L 
Sbjct  137  AGHSRGGKVAFALALGKIANISTNLKFSALIGVDPVDGMDKGKQTPPAVLTYTRHSFNLD  196

Query  629  MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGG  808
            MAVMVIGSGLGEVK+NPLFP CAP GVNHRDFY EC  PACYFVAKDYGH DMLDDET G
Sbjct  197  MAVMVIGSGLGEVKKNPLFPACAPNGVNHRDFYSECCKPACYFVAKDYGHNDMLDDETKG  256

Query  809  VRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTV  988
            +RGKATYCLCK GK R  MR FVGG +VAFL  YLEG  S L AIRD +  + PVELQ +
Sbjct  257  IRGKATYCLCKKGKSREPMRRFVGGILVAFLEAYLEGKSSELMAIRDGNVTL-PVELQDI  315

Query  989  AF  994
             F
Sbjct  316  DF  317



>gb|ADZ24715.1| chlorophyllase [Solanum pennellii]
Length=315

 Score =   436 bits (1120),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 216/303 (71%), Positives = 242/303 (80%), Gaps = 7/303 (2%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSH-PPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            IFD+G Y  +L+ +EP  CT H  PPK LLI TPSEA  G FP+ +FLHGYL YNSFYSQ
Sbjct  14   IFDIGNYKTKLLKIEPQTCTKHNSPPKALLIGTPSEA--GNFPVLIFLHGYLLYNSFYSQ  71

Query  275  LIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
            LIQH++SHGFIVVAPQLY V GADATE+IK TA++TNWL EGL + LPP V PN +K+ L
Sbjct  72   LIQHLSSHGFIVVAPQLYLVEGADATEDIKSTAEVTNWLSEGLQHHLPPDVEPNLKKLGL  131

Query  455  GGHSRGGKVAFGLALGKIA--RTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSF-DL  625
             GHSRGGK AF LALG++A   TDLK SALIGVDPVDGM+KGKQTPP VLTY+P+SF +L
Sbjct  132  AGHSRGGKAAFSLALGRLATISTDLKFSALIGVDPVDGMEKGKQTPPSVLTYVPRSFINL  191

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETG  805
             M VMVIGSGLGEVK+NPLFP CAPKGVNHRDFY EC  PACYFVAKDYGH DMLDDET 
Sbjct  192  DMPVMVIGSGLGEVKKNPLFPACAPKGVNHRDFYNECCKPACYFVAKDYGHNDMLDDETE  251

Query  806  GVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQT  985
            G+RGKATYCLCK GK R  MR FVGG +VAFL  YLEG+ S L AIR  H  + PVELQ 
Sbjct  252  GIRGKATYCLCKKGKSREPMRRFVGGVLVAFLEAYLEGNSSHLIAIRYGHVAL-PVELQD  310

Query  986  VAF  994
            + F
Sbjct  311  IDF  313



>ref|XP_004241041.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Solanum lycopersicum]
Length=312

 Score =   432 bits (1111),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 213/300 (71%), Positives = 242/300 (81%), Gaps = 6/300 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSH-PPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            FD+G Y  +L+ +EP  C+ H  PPK LLI TPSEA  G FP+ +FLHGYL YNSFYSQL
Sbjct  15   FDIGNYKTKLLKIEPQTCSKHNSPPKSLLIGTPSEA--GNFPVLIFLHGYLLYNSFYSQL  72

Query  278  IQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALG  457
            IQH++SHGFIVVAPQLY V GADATE+IK TA++T+WL EGL + LPP V PN  K+ L 
Sbjct  73   IQHLSSHGFIVVAPQLYLVEGADATEDIKSTAEVTHWLSEGLQHHLPPDVEPNLTKLGLA  132

Query  458  GHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSF-DLGMA  634
            GHSRGGKVAF LALG++A +DLK SALIGVDPVDGM+KGKQTPP VLTY+P+SF +L M 
Sbjct  133  GHSRGGKVAFSLALGRLA-SDLKFSALIGVDPVDGMEKGKQTPPSVLTYVPRSFINLDMP  191

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            VMVIGSGLGEVK+NPLFP CAPKGVNHRDFY EC  PACYFVAKDYGH DMLD+ET G+R
Sbjct  192  VMVIGSGLGEVKKNPLFPACAPKGVNHRDFYNECCKPACYFVAKDYGHNDMLDEETKGIR  251

Query  815  GKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
            GKATYCLCK GK R  MR FVGG +VAFL  YLEG+ S L AIRD H  + PVELQ + F
Sbjct  252  GKATYCLCKKGKSREPMRRFVGGVLVAFLEAYLEGNSSHLIAIRDGHVAL-PVELQDIDF  310



>gb|AHZ35334.1| chlorophyllase [Picrorhiza kurrooa]
Length=315

 Score =   432 bits (1111),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 208/309 (67%), Positives = 242/309 (78%), Gaps = 8/309 (3%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCT----SHPPPKPLLIATPSEASAGAFPIFLFLHGYLFY  256
             +++F++G  T++L+  E  KC+    S  PP+PLLI+TPSE   G +P+ LFLHGYL Y
Sbjct  8    TSSVFELGNQTIQLIKCEAQKCSRRSDSTDPPRPLLISTPSET--GIYPVLLFLHGYLLY  65

Query  257  NSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPN  436
            NSFYSQLIQHIASHGFIVVAPQLYSVAG D  EEIK TAQITNWL +GL  FLPPHV PN
Sbjct  66   NSFYSQLIQHIASHGFIVVAPQLYSVAGPDTNEEIKITAQITNWLSQGLSRFLPPHVKPN  125

Query  437  TQKIALGGHSRGGKVAFGLALGKIARTD-LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQ  613
               + L GHSRGGKVAF LAL K   T  LK SALIG+DPVDGMDKGKQTPPPVLTY+P 
Sbjct  126  LSTLVLAGHSRGGKVAFALALNKSHTTSPLKFSALIGIDPVDGMDKGKQTPPPVLTYVPH  185

Query  614  SFDL-GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDML  790
            SF+L G  V+VIGSGLGEVK+NPLFPPCAPKGVNH DFY EC  PA YF+AKDYGH+D+L
Sbjct  186  SFNLDGTPVLVIGSGLGEVKKNPLFPPCAPKGVNHEDFYNECCKPAYYFLAKDYGHLDVL  245

Query  791  DDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAP  970
            DD+T G+RGK+TYC+CKNG+ R  MR FV G VVAF++ YL+GD S L AIR+   E+ P
Sbjct  246  DDDTKGIRGKSTYCVCKNGESREPMRKFVAGVVVAFMKAYLDGDSSDLLAIREGTHEMVP  305

Query  971  VELQTVAFQ  997
            +ELQ   FQ
Sbjct  306  LELQRTEFQ  314



>ref|XP_007145911.1| hypothetical protein PHAVU_007G278100g [Phaseolus vulgaris]
 gb|ESW17905.1| hypothetical protein PHAVU_007G278100g [Phaseolus vulgaris]
Length=313

 Score =   429 bits (1104),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 206/302 (68%), Positives = 240/302 (79%), Gaps = 6/302 (2%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSH--PPPKPLLIATPSEASAGAFPIFLFLHGYLFYN  259
            ++T++FD GKYT E++ VE    T +  PPPKPLLIATP EA  G F + +FLHGYL YN
Sbjct  10   SSTSVFDTGKYTTEILRVESESYTQNNVPPPKPLLIATPHEA--GEFSVLIFLHGYLLYN  67

Query  260  SFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNT  439
            SFYSQLIQH+ASHGFIV+APQLY+VAG D ++EI   A ITNWL EGL  FLPP+V PN 
Sbjct  68   SFYSQLIQHVASHGFIVIAPQLYTVAGPDTSDEIHSAAAITNWLSEGLCKFLPPNVIPNL  127

Query  440  QKIALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQS  616
             K+AL GHSRGGK AF L+L ++   TD+K SALIGVDPVDGMDKGKQ PPPVLTY+P S
Sbjct  128  NKVALSGHSRGGKTAFALSLRRLNISTDIKFSALIGVDPVDGMDKGKQIPPPVLTYVPHS  187

Query  617  FDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDD  796
            FDL M VMVIGSGLGEVKRNPLFPPCAPKGVNH +F++EC+ PA YFVAKDYGH DMLDD
Sbjct  188  FDLDMPVMVIGSGLGEVKRNPLFPPCAPKGVNHENFFKECKKPAWYFVAKDYGHSDMLDD  247

Query  797  ETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
            +T G+RGKATYCLCKNG  R  MR FVGG +VAFL+ YL+ D+  L AIRD H  + P+E
Sbjct  248  DTKGIRGKATYCLCKNGDSRKPMRRFVGGVIVAFLKAYLQDDYGDLLAIRDMHVSL-PLE  306

Query  977  LQ  982
             +
Sbjct  307  FK  308



>gb|KDP40227.1| hypothetical protein JCGZ_02225 [Jatropha curcas]
Length=320

 Score =   428 bits (1101),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/305 (68%), Positives = 235/305 (77%), Gaps = 10/305 (3%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSH-----PPPKPLLIATPSEASAGAFPIFLFLHGYLFYN  259
             +F++GKYT  L  VE   C S      PPPKPLLIA PSEA  G FP+ +FLHGYL YN
Sbjct  19   KVFEIGKYTTVLQKVESGTCISKSSVAVPPPKPLLIAMPSEA--GQFPVIIFLHGYLLYN  76

Query  260  SFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNT  439
            SFYSQLIQH++SHGFI +APQLY+VAGAD+++EIK  A +TNWL +GL   LPPHV P  
Sbjct  77   SFYSQLIQHVSSHGFIAIAPQLYTVAGADSSDEIKAAAAVTNWLSKGLQEVLPPHVQPKL  136

Query  440  QKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSF  619
             K+ + GHSRGGK AF LAL K A T LK SA+IGVDPVDGMDKGKQTPPPVLTY+P SF
Sbjct  137  SKLCIAGHSRGGKAAFALALRKTATT-LKFSAIIGVDPVDGMDKGKQTPPPVLTYVPHSF  195

Query  620  DLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE  799
            DL MA MVIGSGLGE+KRNP+FPPCAPKGVNH DFY+EC  PACYFV KDYGH+DMLDD+
Sbjct  196  DLDMAAMVIGSGLGELKRNPMFPPCAPKGVNHEDFYKECEKPACYFVVKDYGHLDMLDDD  255

Query  800  TGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVEL  979
            T G+RGK+TYCLC NGK R  MR F+GG +VAFLR YLE D S L AI +   +  PVEL
Sbjct  256  TKGIRGKSTYCLCVNGKSREPMRRFIGGVIVAFLRAYLEDDGSDLMAIGN--GQTGPVEL  313

Query  980  QTVAF  994
            Q   F
Sbjct  314  QRSEF  318



>emb|CDO99104.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   426 bits (1094),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 245/319 (77%), Gaps = 10/319 (3%)
 Frame = +2

Query  56   MAVTFsssssTATNIFDVGKYTVELVSVEPHKC------TSHPPPKPLLIATPSEASAGA  217
            MA   S + ST+TN+F+ G +T +L+ VE   C       + PPPKPLLI TPSEA  G 
Sbjct  1    MASVSSPAISTSTNVFEYGNFTTDLIKVEQGPCWRKAAEQTLPPPKPLLIGTPSEA--GV  58

Query  218  FPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPE  397
            FP+ LFLHGYLF NSFYS+L+QHIASHGFIVVAPQLY VAG D+T+EI+  A ITNW  E
Sbjct  59   FPVLLFLHGYLFLNSFYSELVQHIASHGFIVVAPQLYCVAGPDSTKEIESAAAITNWFSE  118

Query  398  GLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGK  577
            GL   LP HV PN  K+AL GHSRGGKVAF +ALGK A T LK SAL+GVDPVDGMDKGK
Sbjct  119  GLQACLPSHVRPNLSKLALSGHSRGGKVAFAVALGK-AITSLKFSALVGVDPVDGMDKGK  177

Query  578  QTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYF  757
            QTPPP+LTYIP SF++ MAV+VIGSGLGEVKRNPLFPPCAPKGVNH DF+ EC+ PA +F
Sbjct  178  QTPPPILTYIPHSFNIDMAVLVIGSGLGEVKRNPLFPPCAPKGVNHEDFFNECQKPAYHF  237

Query  758  VAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLA  937
            VAKDYGHVDML+D+T G+RGK TYCLCKNG  R  MR FV G  VAFLR YLE + + L 
Sbjct  238  VAKDYGHVDMLNDDTTGIRGKTTYCLCKNGVSREPMRRFVAGISVAFLRAYLEDNSNDLE  297

Query  938  AIRDRHEEIAPVELQTVAF  994
            AI+D H  +APV LQ   F
Sbjct  298  AIKDGH-LVAPVVLQKADF  315



>ref|XP_010092435.1| Chlorophyllase-2 [Morus notabilis]
 gb|EXB51153.1| Chlorophyllase-2 [Morus notabilis]
Length=418

 Score =   429 bits (1104),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 204/302 (68%), Positives = 235/302 (78%), Gaps = 8/302 (3%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            +N+++ GKY+  +  VE       PPPKPLLIA PSE   G FP+ +F HGYL YNSFYS
Sbjct  122  SNVYESGKYSTVIQKVEAETRIPVPPPKPLLIAMPSEG--GEFPLLVFSHGYLLYNSFYS  179

Query  272  QLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIA  451
            QL+QH+ASHGFI     LY+VAG D+++EIK TAQ+TNWL +GL   LP  V PN  K+A
Sbjct  180  QLLQHVASHGFI-----LYTVAGPDSSDEIKSTAQVTNWLSKGLQYLLPQQVKPNLSKVA  234

Query  452  LGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGM  631
            L GHSRGGK +F LAL K   T LK SALIG+DPVDGMDKGKQTPPPVLTY+P SFDLGM
Sbjct  235  LAGHSRGGKTSFALALSKETITTLKFSALIGIDPVDGMDKGKQTPPPVLTYVPHSFDLGM  294

Query  632  AVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGV  811
             VMV+GSGLGEVKRNPLFPPCAPKGVNH DF++ECR PACYFV KDYGHVDMLDDET G+
Sbjct  295  PVMVVGSGLGEVKRNPLFPPCAPKGVNHEDFFKECREPACYFVVKDYGHVDMLDDETKGI  354

Query  812  RGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEE-IAPVELQTV  988
            RGK TYCLCKNGK R  MR FVGG V+AF++ YLEGD  SL AIR+R  +   PVEL+T+
Sbjct  355  RGKTTYCLCKNGKTREPMRKFVGGVVIAFMKAYLEGDKRSLMAIRERSSDGDLPVELKTI  414

Query  989  AF  994
             F
Sbjct  415  EF  416



>ref|XP_008224250.1| PREDICTED: chlorophyllase-2, chloroplastic [Prunus mume]
Length=329

 Score =   426 bits (1094),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 216/307 (70%), Positives = 238/307 (78%), Gaps = 9/307 (3%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSH-------PPPKPLLIATPSEASAGAFPIFLFLHGYLFY  256
            +F++GKY V L   EP    S        PPPKPLLI  P EA  G FP+ L LHGYL  
Sbjct  24   VFEIGKYKVVLQRAEPETTCSTKSSNIPVPPPKPLLIGMPCEA--GEFPLLLLLHGYLLS  81

Query  257  NSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPN  436
            NSFYSQLIQHIASHGFIVVAPQLY++AG D+T EIK TA ITNWL EGL   LPPHV  N
Sbjct  82   NSFYSQLIQHIASHGFIVVAPQLYTIAGPDSTGEIKSTAAITNWLSEGLQFLLPPHVQAN  141

Query  437  TQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQS  616
              K+AL GHSRGGKV+F LA G+   T+ K SALIG+DPVDGMDKGKQTPPPVLTY+P S
Sbjct  142  LSKLALAGHSRGGKVSFALAFGQEGNTNRKFSALIGIDPVDGMDKGKQTPPPVLTYVPHS  201

Query  617  FDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDD  796
            FDL MAVMVIGSGLGEVKRNPLFPPCAPKGVNH DF+ EC+ PACYFVAKDYGH+DMLDD
Sbjct  202  FDLDMAVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFNECQKPACYFVAKDYGHLDMLDD  261

Query  797  ETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
            ET G+RGK+TYC+CKNGK R  MR FVGG VVAFL+ YLEGD S L AI+D  +E  PVE
Sbjct  262  ETKGIRGKSTYCVCKNGKSREPMRKFVGGVVVAFLQAYLEGDSSHLTAIKDGLDETVPVE  321

Query  977  LQTVAFQ  997
            LQ V F 
Sbjct  322  LQIVKFN  328



>ref|XP_006363484.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Solanum tuberosum]
Length=318

 Score =   425 bits (1092),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 213/306 (70%), Positives = 243/306 (79%), Gaps = 9/306 (3%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHP----PPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            IFD+G Y+ +L++VEP  C +      PPKPLLI+TP +   G FP+ LFLHGYL +N F
Sbjct  15   IFDIGNYSTKLLNVEPQSCINSSFPPPPPKPLLISTPLQG--GNFPVILFLHGYLLFNYF  72

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            YSQLIQHI+SHGFIVVAPQLY V GAD T+EIK TA+ITNWLP+GLH++LP  V PN +K
Sbjct  73   YSQLIQHISSHGFIVVAPQLYLVEGADTTKEIKSTAEITNWLPDGLHHYLPSQVEPNLKK  132

Query  446  IALGGHSRGGKVAFGLALGKIAR--TDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSF  619
            + L GHSRGGK AF LALGK+A   T+LK SALIG+DPVDG+DKG QT PPVLTYIPQSF
Sbjct  133  LVLAGHSRGGKAAFALALGKVANVTTNLKFSALIGIDPVDGVDKGIQTTPPVLTYIPQSF  192

Query  620  DLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE  799
            +L MAV+VIGSGLGEVKRNPLFP CAP GVNHRDFY EC  P CY VAKDYGHVDMLDDE
Sbjct  193  NLDMAVLVIGSGLGEVKRNPLFPACAPNGVNHRDFYNECCRPVCYVVAKDYGHVDMLDDE  252

Query  800  TGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVEL  979
            T GVRGKATYCLCKNGK R  MR FVGG VVAFL  YL+G+ S L AI+D +  + PVEL
Sbjct  253  TKGVRGKATYCLCKNGKSREPMRRFVGGIVVAFLEDYLKGNSSDLMAIKDGYITL-PVEL  311

Query  980  QTVAFQ  997
            Q   F+
Sbjct  312  QDADFR  317



>gb|KDO74483.1| hypothetical protein CISIN_1g020950mg [Citrus sinensis]
Length=319

 Score =   422 bits (1085),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 235/312 (75%), Gaps = 10/312 (3%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPH---KCTSHPPPKPLL-----IATPSEASAGAFPIFLFLHG  244
            ATN+FD G Y+  L+ VE      C S             I  PS+ + G FP+ + LHG
Sbjct  10   ATNVFDTGNYSTSLLRVESATVASCNSTSSTPLPPPKPLLIGMPSDDAGGEFPVLILLHG  69

Query  245  YLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPH  424
            Y+  NSFYSQLI H+ASHGFIV+APQLY+VAG DAT EI   A ITNWL EGL +FLPPH
Sbjct  70   YVLLNSFYSQLILHVASHGFIVIAPQLYNVAGPDATAEITSAAAITNWLSEGLGHFLPPH  129

Query  425  VHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTY  604
            V PN  K+AL GHSRGGK AF LAL K A T LK SALIGVDPVDGMDKGKQTPPPVLTY
Sbjct  130  VRPNLSKLALAGHSRGGKAAFALALKKGATT-LKYSALIGVDPVDGMDKGKQTPPPVLTY  188

Query  605  IPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVD  784
            IP SFDLGM VMVIGSGLGE+K+NPLFPPCAPKGVNH+DF+ ECR PAC+FV KDYGH+D
Sbjct  189  IPHSFDLGMPVMVIGSGLGEIKKNPLFPPCAPKGVNHKDFFNECRTPACHFVVKDYGHLD  248

Query  785  MLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
            MLDD+T G+RGKATYCLCKNGK R  MR  +GG +VAF++ YL+GD + L AIR + +E 
Sbjct  249  MLDDDTKGIRGKATYCLCKNGKSREPMRRSIGGIIVAFMKAYLDGDITDLMAIR-KEQET  307

Query  965  APVELQTVAFQE  1000
            AP E +TV F E
Sbjct  308  APAEFETVEFLE  319



>ref|XP_010034594.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Eucalyptus grandis]
Length=321

 Score =   422 bits (1084),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 242/313 (77%), Gaps = 12/313 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHK---------CTSHPPPKPLLIATPSEASAGAFPIFLFL  238
            TA+++F++GKY  EL  VE             T+  PPKPLLIA P++A  G FP+ +FL
Sbjct  9    TASDVFEIGKYKAELRRVEASATSPAATASCATADRPPKPLLIAFPADAP-GEFPVLVFL  67

Query  239  HGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLP  418
            HGYL YNSFYSQLI+H++SHGF+VVAPQLY+VAG D T+EI   A  TNWLP GL   LP
Sbjct  68   HGYLLYNSFYSQLIRHVSSHGFVVVAPQLYTVAGPDTTDEINSAAATTNWLPRGLAGLLP  127

Query  419  PHVHPNTQKIALGGHSRGGKVAFGLALGKIAR-TDLKLSALIGVDPVDGMDKGKQTPPPV  595
            P V PN  K+A+ GHSRGGK AF LALGK A    L  SAL+G+DPVDGMDKGKQTPPPV
Sbjct  128  PQVRPNLAKLAVAGHSRGGKAAFALALGKSATPLALPFSALLGIDPVDGMDKGKQTPPPV  187

Query  596  LTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYG  775
            LTY P+SFDLGM V+V+GSGLGEV++NPLFP CAP+GVNH DF+ ECR PACYFVA+ YG
Sbjct  188  LTYAPRSFDLGMPVVVVGSGLGEVRKNPLFPACAPRGVNHADFFAECRPPACYFVAEKYG  247

Query  776  HVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRH  955
            H+DMLDDET G+RGKATYCLCKNG+ R  MR FVGG VVAFLR YLEGD ++L  +RD H
Sbjct  248  HLDMLDDETEGLRGKATYCLCKNGRAREPMRRFVGGVVVAFLRAYLEGDDAALMGLRDGH  307

Query  956  EEIAPVELQTVAF  994
             E+APVELQ V F
Sbjct  308  -EVAPVELQKVEF  319



>ref|XP_006489443.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Citrus sinensis]
Length=319

 Score =   421 bits (1083),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 235/312 (75%), Gaps = 10/312 (3%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPH---KCTSHPPPKPLL-----IATPSEASAGAFPIFLFLHG  244
            ATN+FD G Y+  L+ VE      C S             I  PS+ + G FP+ + LHG
Sbjct  10   ATNVFDTGNYSTSLLRVESATVASCNSTSSTPLPPPKPLLIGMPSDDAGGEFPVLILLHG  69

Query  245  YLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPH  424
            Y+  NSFYSQLI H+ASHGFIV+APQLY+VAG DAT EI   A ITNWL EGL +FLPPH
Sbjct  70   YVLLNSFYSQLILHVASHGFIVIAPQLYNVAGPDATAEITSAAAITNWLSEGLGHFLPPH  129

Query  425  VHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTY  604
            V PN  K+AL GHSRGGK AF LAL K A T LK SALIGVDPVDGMDKGKQTPPPVLTY
Sbjct  130  VRPNLSKLALAGHSRGGKAAFALALKKGATT-LKYSALIGVDPVDGMDKGKQTPPPVLTY  188

Query  605  IPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVD  784
            IP SFDLGM VMVIGSGLGE+K+NPLFPPCAPKGVNH+DF+ ECR PAC+FV KDYGH+D
Sbjct  189  IPHSFDLGMPVMVIGSGLGEIKKNPLFPPCAPKGVNHKDFFNECRTPACHFVVKDYGHLD  248

Query  785  MLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
            MLDD+T G+RGKATYCLCKNGK R  MR  +GG +VAF++ YL+GD + L AIR + +E 
Sbjct  249  MLDDDTKGIRGKATYCLCKNGKSREPMRRSIGGIIVAFMKAYLDGDITDLMAIR-KGQET  307

Query  965  APVELQTVAFQE  1000
            AP E +TV F E
Sbjct  308  APAEFETVEFLE  319



>ref|XP_006420011.1| hypothetical protein CICLE_v10005453mg [Citrus clementina]
 gb|ESR33251.1| hypothetical protein CICLE_v10005453mg [Citrus clementina]
Length=319

 Score =   421 bits (1083),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 241/312 (77%), Gaps = 10/312 (3%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEP--------HKCTSHPPPKPLLIATPSEASAGAFPIFLFLHG  244
            ATN+FD G Y+  L+ VE            T  PPPKPLLI  PS+ + G FP+ + LHG
Sbjct  10   ATNVFDTGNYSTSLLRVESATVASCNSTNSTPLPPPKPLLIGMPSDDAGGEFPVLILLHG  69

Query  245  YLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPH  424
            Y+  NSFYSQLI H+ASHGFIV+APQLY+VAG DAT EI   A ITNWL EGL +FLPPH
Sbjct  70   YVLLNSFYSQLILHVASHGFIVIAPQLYNVAGPDATAEITSAAAITNWLSEGLGHFLPPH  129

Query  425  VHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTY  604
            V PN  K+AL GHSRGGK AF LAL K A T LK SALIGVDPVDGMDKGKQTPPPVLTY
Sbjct  130  VRPNLSKLALAGHSRGGKAAFALALKKGATT-LKYSALIGVDPVDGMDKGKQTPPPVLTY  188

Query  605  IPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVD  784
            IP SFDLGM VMVIGSGLGE+K+NPLFPPCAPKGVNH+DF+ ECR PAC+FV KDYGH+D
Sbjct  189  IPHSFDLGMPVMVIGSGLGEIKKNPLFPPCAPKGVNHKDFFNECRTPACHFVVKDYGHLD  248

Query  785  MLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
            MLDD+T G+RGKATYCLCKNGK R  MR  +GG +VAF++ YL+GD + L AIR + +E 
Sbjct  249  MLDDDTKGIRGKATYCLCKNGKSREPMRRSIGGIIVAFMKAYLDGDITDLMAIR-KGQET  307

Query  965  APVELQTVAFQE  1000
            AP E +TV F E
Sbjct  308  APAEFETVEFLE  319



>ref|XP_004296571.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   419 bits (1076),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 212/317 (67%), Positives = 245/317 (77%), Gaps = 16/317 (5%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSH------------PPPKPLLIATPSEASAGAFPIF  229
            + +N+F++GKY VE  +V+  + +S              PPK LLI  P EA  G FP+ 
Sbjct  5    SCSNVFELGKYRVEFQTVDAAETSSGCCSTKSSSTVSLRPPKQLLIGLPCEA--GEFPVL  62

Query  230  LFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHN  409
            L LHG+L  NSFYSQLIQHIASHGFIV++PQLY++AG+D ++EIK TA ITNWL EGL +
Sbjct  63   LLLHGFLLSNSFYSQLIQHIASHGFIVISPQLYTIAGSDTSDEIKSTAAITNWLSEGLQS  122

Query  410  FLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTP  586
             LPPHVH N  K+AL GHSRGGKV+F LALGK    T LK SALIG+DPVDGMDKGKQTP
Sbjct  123  LLPPHVHANLNKLALAGHSRGGKVSFALALGKEGITTSLKFSALIGIDPVDGMDKGKQTP  182

Query  587  PPVLTYIPQSFDL-GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVA  763
            PPVLTY+P SFDL GMAVMVIG+GLGEVKRNPLFP CAPKGVNH DF+ ECR PACYFVA
Sbjct  183  PPVLTYVPHSFDLEGMAVMVIGTGLGEVKRNPLFPACAPKGVNHEDFFNECRKPACYFVA  242

Query  764  KDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAI  943
            KDYGH+DMLDDET GVRGKATYCLCKNGK R  MR FVGG VVAF++ YL GD + L AI
Sbjct  243  KDYGHLDMLDDETKGVRGKATYCLCKNGKSREPMRKFVGGVVVAFIKAYLGGDSNELMAI  302

Query  944  RDRHEEIAPVELQTVAF  994
             +   + AP+ELQ+V F
Sbjct  303  SEAGYDAAPIELQSVEF  319



>ref|XP_002279285.1| PREDICTED: chlorophyllase-2, chloroplastic [Vitis vinifera]
 emb|CBI26305.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   418 bits (1075),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/305 (70%), Positives = 241/305 (79%), Gaps = 9/305 (3%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLL-----IATPSEASAGAFPIFLFLHGYLFYN  259
            N+F++GK+   L+  EP  CT+             IATPSEA  G FP+ L LHGYL YN
Sbjct  20   NVFEIGKHITVLLRAEPGTCTTKSSLPVPPPLQLLIATPSEA--GEFPLLLLLHGYLLYN  77

Query  260  SFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNT  439
            SFYSQLIQHIASHGFIV+APQLY+VAG D++EEI   A +TNWL +GLH+ LPPHV PN 
Sbjct  78   SFYSQLIQHIASHGFIVLAPQLYTVAGPDSSEEINSAAAVTNWLSKGLHDLLPPHVRPNL  137

Query  440  QKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSF  619
             K+ L GHSRGGK AF LAL K A T LK SALIG+DPVDGMDKGKQTPPPVLTY+P SF
Sbjct  138  SKLGLAGHSRGGKTAFALALRK-ASTSLKFSALIGIDPVDGMDKGKQTPPPVLTYVPHSF  196

Query  620  DLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE  799
            DL MAVMVIGSGLGEVKRNPLFPPCAPKGVNH DF++ECR PACYF+AKDYGH+DMLDDE
Sbjct  197  DLDMAVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFKECREPACYFLAKDYGHLDMLDDE  256

Query  800  TGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVEL  979
            T G+RGKAT+CLC+NGK R  MR FVGG V+AF++ YLEGD SSL +IRD H   APVEL
Sbjct  257  TNGIRGKATHCLCRNGKSREPMRRFVGGIVIAFMKAYLEGDNSSLISIRDGH-ATAPVEL  315

Query  980  QTVAF  994
            Q V F
Sbjct  316  QNVEF  320



>ref|XP_011090675.1| PREDICTED: chlorophyllase-2, chloroplastic [Sesamum indicum]
Length=315

 Score =   416 bits (1070),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 209/309 (68%), Positives = 241/309 (78%), Gaps = 13/309 (4%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSH-----PPPKPLLIATPSEASAGAFPIFLFLHGYLF  253
            +TN+FD+G YT  L+ VE   C  +      P +PLLI +PSE   G+FP+ LFLHGYL 
Sbjct  13   STNVFDIGNYTTTLIKVEARVCDRNGCNPPRPIRPLLICSPSET--GSFPVLLFLHGYLL  70

Query  254  YNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHP  433
            YNSFYSQLI+HIASHGFIVVAPQLYSVAGADAT+EIK TA+I++WL +GL  FLPPHV P
Sbjct  71   YNSFYSQLIRHIASHGFIVVAPQLYSVAGADATQEIKITAEISSWLSQGLAQFLPPHVEP  130

Query  434  NTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQ  613
            N  K+ L GHSRGGKVAF LAL K     LKLSALIG+DPVDGMD GKQTPPPVLTY P 
Sbjct  131  NLSKLGLAGHSRGGKVAFALALTK----SLKLSALIGIDPVDGMDIGKQTPPPVLTYTPH  186

Query  614  SFDL-GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDML  790
            SF+L G+ V++IGSGLGEVKRN LFP CAPKGVNH DFY+EC  PA YFV KDYGH+D+L
Sbjct  187  SFNLDGVGVLIIGSGLGEVKRNALFPACAPKGVNHEDFYKECCSPAYYFVVKDYGHLDVL  246

Query  791  DDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAP  970
            DD+T G+RGKATYCLCKNG+ R  MR FVGGA+VAFL+ YL G+   LA IR+ H  + P
Sbjct  247  DDDTKGIRGKATYCLCKNGECREPMRRFVGGALVAFLKAYLGGNSRDLADIREGHGML-P  305

Query  971  VELQTVAFQ  997
            VELQ V F 
Sbjct  306  VELQRVEFH  314



>ref|XP_010326690.1| PREDICTED: LOW QUALITY PROTEIN: chlorophyllase-2, chloroplastic 
[Solanum lycopersicum]
Length=314

 Score =   416 bits (1070),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 207/305 (68%), Positives = 237/305 (78%), Gaps = 11/305 (4%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKC--TSHP-PPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            IFD+G Y+ +L+++EP  C  +S P PPKPLLI+TPS+   G FP+ LFLHGYL +N FY
Sbjct  15   IFDIGNYSTKLLNIEPQSCINSSFPSPPKPLLISTPSQG--GNFPVILFLHGYLLFNYFY  72

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
            SQLIQHI+SHGFIVVAPQLY V G D T +IK TA+ITNWLP+GLH +LP HV PN +K+
Sbjct  73   SQLIQHISSHGFIVVAPQLYLVEGTDTTTDIKSTAEITNWLPDGLHRYLPSHVGPNLKKL  132

Query  449  ALGGHSRGGKVAFGLALGKIAR--TDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFD  622
             L GHSRGGK AF L LGK+    TDLK     G+DPVDG+  GKQT PPVLTYIPQSF+
Sbjct  133  GLAGHSRGGKAAFALTLGKVTNVTTDLKFX---GIDPVDGLGNGKQTTPPVLTYIPQSFN  189

Query  623  LGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDET  802
            L MAVMVIGS LGEVKRNPLFP CAPKGVNHRDFY EC  PACY VAKDYGHVDMLDDET
Sbjct  190  LDMAVMVIGSSLGEVKRNPLFPACAPKGVNHRDFYNECVRPACYVVAKDYGHVDMLDDET  249

Query  803  GGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
             GVRGKATY LCKNGK R  MR FVGG V+AFL  YL+G+ S L  I+D +  + PVEL+
Sbjct  250  KGVRGKATYGLCKNGKSREPMRRFVGGIVIAFLDDYLKGNSSDLMPIKDGYVTL-PVELR  308

Query  983  TVAFQ  997
             V F+
Sbjct  309  DVDFR  313



>ref|XP_002315752.2| Chlorophyllase 1 family protein [Populus trichocarpa]
 gb|EEF01923.2| Chlorophyllase 1 family protein [Populus trichocarpa]
Length=334

 Score =   416 bits (1069),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 214/335 (64%), Positives = 247/335 (74%), Gaps = 17/335 (5%)
 Frame = +2

Query  26   TLDLDSHQLAMAVTFsssssTAT---NIFDVGKYTVELVSVEPHK--CTSHPPPKPLL--  184
            TL+     L   VT SSSS+ AT    +F+ GKYT  L  VE     CT+   P   +  
Sbjct  3    TLERTRKSLINTVTMSSSSAIATVTTTVFEAGKYTTVLQKVESRTTCCTAKTSPPLPVPP  62

Query  185  -----IATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADA  349
                 I  P EA  G FP+ +FLHGYL YNSFYSQL+QHIASHGFIV+APQLY VAG D+
Sbjct  63   PKPLLIVMPCEA--GEFPLLVFLHGYLLYNSFYSQLLQHIASHGFIVIAPQLYLVAGQDS  120

Query  350  TEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKL  529
            ++EIK  A  TNWL EGLH+ LPPHV PN  K+ L GHSRGGK AF LAL K A T LK 
Sbjct  121  SDEIKSVAATTNWLSEGLHHLLPPHVKPNLSKLGLAGHSRGGKTAFALALEKAAAT-LKF  179

Query  530  SALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGV  709
            SALIGVDPVDGMDKGKQTPPPVLTY+P SFDL MA+MVIGSGLGE+K+NPLFPPCAP+GV
Sbjct  180  SALIGVDPVDGMDKGKQTPPPVLTYVPHSFDLDMAIMVIGSGLGELKKNPLFPPCAPEGV  239

Query  710  NHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAV  889
            NH+DF++EC+GPA YFV KDYGH+DMLDD+T G+RGK TYCLCKNGK R  MR F+GG V
Sbjct  240  NHKDFFKECKGPASYFVVKDYGHLDMLDDDTEGIRGKTTYCLCKNGKSREPMRKFIGGVV  299

Query  890  VAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
            VAF++ YL GD S L AI+    +  PVELQTV +
Sbjct  300  VAFMKAYLGGDSSDLMAIKGG--QTGPVELQTVEY  332



>ref|XP_011030633.1| PREDICTED: chlorophyllase-2, chloroplastic [Populus euphratica]
Length=334

 Score =   414 bits (1063),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 213/335 (64%), Positives = 248/335 (74%), Gaps = 17/335 (5%)
 Frame = +2

Query  26   TLDLDSHQLAMAVTFsssssTAT---NIFDVGKYTVELVSVEPHK--CTSHPPPKPLL--  184
            TL+     L   VT SSSS+ AT    +F+VGK+T  L  VE     CT+   P   +  
Sbjct  3    TLERTRKSLTNTVTMSSSSAIATVTTTVFEVGKHTTVLQKVESRTTCCTAKASPPLPVPP  62

Query  185  -----IATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADA  349
                 I  P EA  G FP+ +F+HGYL YNSFYSQL+QHIASHGFIV+APQLY VAG D+
Sbjct  63   PKPLLIVMPCEA--GEFPLLVFVHGYLLYNSFYSQLLQHIASHGFIVIAPQLYLVAGQDS  120

Query  350  TEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKL  529
            ++EIK  A  TNWL EGLH+ LPP+V PN  K+ L GHSRGGK AF LAL K A T LK 
Sbjct  121  SDEIKSVAATTNWLSEGLHHLLPPYVKPNLSKLGLAGHSRGGKTAFALALEKAATT-LKF  179

Query  530  SALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGV  709
            SALIGVDPVDGMDKGKQTPPPVLTY+P SFDL MA MVIGSGLGE+K+NPLFPPCAP+GV
Sbjct  180  SALIGVDPVDGMDKGKQTPPPVLTYVPHSFDLDMATMVIGSGLGELKKNPLFPPCAPEGV  239

Query  710  NHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAV  889
            NH+DF++EC+GPA YFV KDYGH+DMLDD+T G+RGKATYCLCKNGK R  MR F+GG V
Sbjct  240  NHKDFFKECKGPASYFVVKDYGHLDMLDDDTEGIRGKATYCLCKNGKSREPMRKFIGGVV  299

Query  890  VAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
            VAF++ YL GD S L AI+    +  PVELQTV +
Sbjct  300  VAFMKAYLGGDSSDLMAIKGG--QTGPVELQTVEY  332



>ref|XP_002517075.1| Chlorophyllase-2, chloroplast precursor, putative [Ricinus communis]
 gb|EEF45238.1| Chlorophyllase-2, chloroplast precursor, putative [Ricinus communis]
Length=313

 Score =   412 bits (1060),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/305 (68%), Positives = 231/305 (76%), Gaps = 10/305 (3%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLL-----IATPSEASAGAFPIFLFLHGYL  250
            T TN+++ GKYT  +  +E   C     P PL      IA PSEA  G FP+ +FLHGYL
Sbjct  7    TVTNVYENGKYTTVVAKIESGSCARSSLPLPLPPKPLLIAMPSEA--GEFPVLIFLHGYL  64

Query  251  FYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVH  430
             YNSFYS LIQH+ASHGFIV+APQLY+VAGAD+ +EIKCTA ITNWL +GLH+ LPPHV 
Sbjct  65   LYNSFYSLLIQHVASHGFIVIAPQLYTVAGADSADEIKCTAAITNWLSKGLHHVLPPHVQ  124

Query  431  PNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPVLTYI  607
            P   K+ L GHSRGGK AF LAL K    T LK SALIGVDPVDGMDKGKQTPPPVLTY 
Sbjct  125  PKLSKLGLAGHSRGGKAAFALALQKAGISTALKFSALIGVDPVDGMDKGKQTPPPVLTYT  184

Query  608  PQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDM  787
            P SFDL MA MVIGSGLGEVKRNP+FPPCAPKGVNH DF++EC+ PA YFV KDYGH+DM
Sbjct  185  PHSFDLDMAAMVIGSGLGEVKRNPMFPPCAPKGVNHEDFFKECKKPAYYFVVKDYGHLDM  244

Query  788  LDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIA  967
            LDD+T G+RGKATYCLC NGK R  MR FVGG +VAFL+ YL GD S L  I D   +  
Sbjct  245  LDDDTNGIRGKATYCLCVNGKSREPMRRFVGGVLVAFLKAYLGGDSSDLMTITDG--QTG  302

Query  968  PVELQ  982
            PVELQ
Sbjct  303  PVELQ  307



>ref|XP_010256173.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X3 [Nelumbo 
nucifera]
Length=317

 Score =   412 bits (1059),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 237/313 (76%), Gaps = 13/313 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEP-----HKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYL  250
            ++ ++F++GKY   L+ +EP      +  S  PPKPLLIATPS  +AG FPI +FLHGYL
Sbjct  6    SSRSVFEIGKYMASLLRIEPGISSSTRSPSVAPPKPLLIATPS--AAGEFPILVFLHGYL  63

Query  251  FYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVH  430
             YNSFYSQ I HIASHGFIVVAPQLY+ AG D +EEIK  A IT+WL +GL + LP HV 
Sbjct  64   LYNSFYSQFILHIASHGFIVVAPQLYTAAGPDTSEEIKAAAAITDWLADGLQSVLPEHVQ  123

Query  431  PNTQKIALGGHSRGGKVAFGLALGKIA-----RTDLKLSALIGVDPVDGMDKGKQTPPPV  595
            P   K+ L GHSRGGK AF LALG +       + LK SAL+G+DPVDGM KGKQTPPPV
Sbjct  124  PCLSKLGLAGHSRGGKAAFALALGLVTGGTSTSSSLKFSALMGIDPVDGMGKGKQTPPPV  183

Query  596  LTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYG  775
            LTY+P+SF+L M V+V+GSGLG+VKRNPLFPPCAPKGVNH DF+ ECR PA YFV KDYG
Sbjct  184  LTYVPRSFNLDMGVLVVGSGLGQVKRNPLFPPCAPKGVNHEDFFNECRPPAFYFVVKDYG  243

Query  776  HVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRH  955
            H DMLDD+T G+RGKATYCLCKNGK R  MR FV G VVAF+R YLEG+ + L AI D  
Sbjct  244  HADMLDDDTKGIRGKATYCLCKNGKSREPMRRFVAGIVVAFMRAYLEGNAADLTAIGD-G  302

Query  956  EEIAPVELQTVAF  994
             ++ PV+LQT+ F
Sbjct  303  SQVPPVQLQTIDF  315



>ref|XP_010256171.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X2 [Nelumbo 
nucifera]
 ref|XP_010256172.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=333

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 200/310 (65%), Positives = 235/310 (76%), Gaps = 13/310 (4%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEP-----HKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYN  259
            ++F++GKY   L+ +EP      +  S  PPKPLLIATPS  +AG FPI +FLHGYL YN
Sbjct  25   SVFEIGKYMASLLRIEPGISSSTRSPSVAPPKPLLIATPS--AAGEFPILVFLHGYLLYN  82

Query  260  SFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNT  439
            SFYSQ I HIASHGFIVVAPQLY+ AG D +EEIK  A IT+WL +GL + LP HV P  
Sbjct  83   SFYSQFILHIASHGFIVVAPQLYTAAGPDTSEEIKAAAAITDWLADGLQSVLPEHVQPCL  142

Query  440  QKIALGGHSRGGKVAFGLALGKIA-----RTDLKLSALIGVDPVDGMDKGKQTPPPVLTY  604
             K+ L GHSRGGK AF LALG +       + LK SAL+G+DPVDGM KGKQTPPPVLTY
Sbjct  143  SKLGLAGHSRGGKAAFALALGLVTGGTSTSSSLKFSALMGIDPVDGMGKGKQTPPPVLTY  202

Query  605  IPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVD  784
            +P+SF+L M V+V+GSGLG+VKRNPLFPPCAPKGVNH DF+ ECR PA YFV KDYGH D
Sbjct  203  VPRSFNLDMGVLVVGSGLGQVKRNPLFPPCAPKGVNHEDFFNECRPPAFYFVVKDYGHAD  262

Query  785  MLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
            MLDD+T G+RGKATYCLCKNGK R  MR FV G VVAF+R YLEG+ + L AI D   ++
Sbjct  263  MLDDDTKGIRGKATYCLCKNGKSREPMRRFVAGIVVAFMRAYLEGNAADLTAIGD-GSQV  321

Query  965  APVELQTVAF  994
             PV+LQT+ F
Sbjct  322  PPVQLQTIDF  331



>dbj|BAF43703.1| Chlorophyllase 1 [Glycine max]
Length=326

 Score =   410 bits (1054),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 215/326 (66%), Positives = 247/326 (76%), Gaps = 13/326 (4%)
 Frame = +2

Query  38   DSHQLAMAVTFsssssTATNIFDVGKYTVELVSVEP------HKCTSHPPPKPLLIATPS  199
            +SHQL++  +   S S+  N+FD GKYT +L+ VE       H     PPPK LLIATP 
Sbjct  6    ESHQLSVMCS---SYSSNVNVFDTGKYTAKLLRVESESESYTHNNNVPPPPKSLLIATPL  62

Query  200  EASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQI  379
            E   G FP+ LFLHGYL YNSFYSQLIQH+ASHGFIV+APQLY+VAG D ++EI   A I
Sbjct  63   EG--GDFPLLLFLHGYLLYNSFYSQLIQHVASHGFIVIAPQLYTVAGPDTSDEIHSAAAI  120

Query  380  TNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPV  556
            TNWL +GL  FLPP+V PN  K+AL GHSRGGK AF LAL K+   T+LK SALIGVDPV
Sbjct  121  TNWLSDGLCKFLPPNVRPNLSKLALAGHSRGGKTAFALALRKLNITTNLKFSALIGVDPV  180

Query  557  DGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQEC  736
            DGMDKGKQTPPPVLTY+P SFD  MAVMVIGSGLGEVKRNPLFPPCAPKGVNH +F+ EC
Sbjct  181  DGMDKGKQTPPPVLTYVPNSFDFDMAVMVIGSGLGEVKRNPLFPPCAPKGVNHENFFNEC  240

Query  737  RGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLE  916
            + PA YFVAKDYGH DMLDD+T G+RGKAT CLCKNG+ R  MR FVGG +VAFL+ YL 
Sbjct  241  KKPAWYFVAKDYGHSDMLDDDTKGIRGKATNCLCKNGESRKPMRRFVGGVIVAFLKAYLH  300

Query  917  GDFSSLAAIRDRHEEIAPVELQTVAF  994
             D   L  IRDRH  + PVE++  +F
Sbjct  301  DDNEDLLTIRDRHVSL-PVEIKFDSF  325



>ref|XP_003537121.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Glycine max]
 gb|KHN10078.1| Chlorophyllase-2, chloroplastic [Glycine soja]
Length=326

 Score =   409 bits (1052),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 215/326 (66%), Positives = 247/326 (76%), Gaps = 13/326 (4%)
 Frame = +2

Query  38   DSHQLAMAVTFsssssTATNIFDVGKYTVELVSVEP------HKCTSHPPPKPLLIATPS  199
            +SHQL++  +   S S+  ++FD GKYT +L+ VE       H     PPPK LLIATP 
Sbjct  6    ESHQLSVMCS---SYSSNVDVFDTGKYTAKLLRVESESESYTHNNNFPPPPKSLLIATPL  62

Query  200  EASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQI  379
            E   G FP+ LFLHGYL YNSFYSQLIQH+ASHGFIV+APQLY+VAG D ++EI   A I
Sbjct  63   EG--GDFPLLLFLHGYLLYNSFYSQLIQHVASHGFIVIAPQLYTVAGPDTSDEIHSAAAI  120

Query  380  TNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPV  556
            TNWL EGL  FLPP+V PN  K+AL GHSRGGK AF LAL K+   T+LK SALIGVDPV
Sbjct  121  TNWLSEGLCKFLPPNVRPNLSKLALAGHSRGGKTAFALALRKLNITTNLKFSALIGVDPV  180

Query  557  DGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQEC  736
            DGMDKGKQTPPPVLTY+P SFD  MAVMVIGSGLGEVKRNPLFPPCAPKGVNH +F+ EC
Sbjct  181  DGMDKGKQTPPPVLTYVPNSFDFDMAVMVIGSGLGEVKRNPLFPPCAPKGVNHENFFNEC  240

Query  737  RGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLE  916
            + PA YFVAKDYGH DMLDD+T G+RGKAT CLCKNG+ R  MR FVGG +VAFL+ YL 
Sbjct  241  KKPAWYFVAKDYGHSDMLDDDTKGIRGKATNCLCKNGESRKPMRRFVGGVIVAFLKAYLH  300

Query  917  GDFSSLAAIRDRHEEIAPVELQTVAF  994
             D   L  IRDRH  + PVE++  +F
Sbjct  301  DDNEDLLTIRDRHVSL-PVEIKFDSF  325



>ref|XP_010256170.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=360

 Score =   410 bits (1053),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 200/310 (65%), Positives = 235/310 (76%), Gaps = 13/310 (4%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEP-----HKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYN  259
            ++F++GKY   L+ +EP      +  S  PPKPLLIATPS  +AG FPI +FLHGYL YN
Sbjct  52   SVFEIGKYMASLLRIEPGISSSTRSPSVAPPKPLLIATPS--AAGEFPILVFLHGYLLYN  109

Query  260  SFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNT  439
            SFYSQ I HIASHGFIVVAPQLY+ AG D +EEIK  A IT+WL +GL + LP HV P  
Sbjct  110  SFYSQFILHIASHGFIVVAPQLYTAAGPDTSEEIKAAAAITDWLADGLQSVLPEHVQPCL  169

Query  440  QKIALGGHSRGGKVAFGLALGKIA-----RTDLKLSALIGVDPVDGMDKGKQTPPPVLTY  604
             K+ L GHSRGGK AF LALG +       + LK SAL+G+DPVDGM KGKQTPPPVLTY
Sbjct  170  SKLGLAGHSRGGKAAFALALGLVTGGTSTSSSLKFSALMGIDPVDGMGKGKQTPPPVLTY  229

Query  605  IPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVD  784
            +P+SF+L M V+V+GSGLG+VKRNPLFPPCAPKGVNH DF+ ECR PA YFV KDYGH D
Sbjct  230  VPRSFNLDMGVLVVGSGLGQVKRNPLFPPCAPKGVNHEDFFNECRPPAFYFVVKDYGHAD  289

Query  785  MLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
            MLDD+T G+RGKATYCLCKNGK R  MR FV G VVAF+R YLEG+ + L AI D   ++
Sbjct  290  MLDDDTKGIRGKATYCLCKNGKSREPMRRFVAGIVVAFMRAYLEGNAADLTAIGD-GSQV  348

Query  965  APVELQTVAF  994
             PV+LQT+ F
Sbjct  349  PPVQLQTIDF  358



>ref|XP_007222997.1| hypothetical protein PRUPE_ppa010004mg [Prunus persica]
 gb|EMJ24196.1| hypothetical protein PRUPE_ppa010004mg [Prunus persica]
Length=268

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/264 (76%), Positives = 216/264 (82%), Gaps = 0/264 (0%)
 Frame = +2

Query  206  SAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITN  385
             AG FP+ L LHGYL  NSFYSQLIQHIASHGFIVVAPQLY++AG D T EIK TA ITN
Sbjct  4    EAGEFPLLLLLHGYLLSNSFYSQLIQHIASHGFIVVAPQLYTIAGPDTTGEIKSTAAITN  63

Query  386  WLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGM  565
            WL EGL   LPPHV  N  K+AL GHSRGGKV+F LALGK   T+ K SALIG+DPVDGM
Sbjct  64   WLSEGLQFLLPPHVQANLSKLALAGHSRGGKVSFALALGKEGNTNRKFSALIGIDPVDGM  123

Query  566  DKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGP  745
            DKGKQTPPPVLTY+P SFDL MAVMVIGSGLGEVKRNPLFPPCAPKGVNH DF+ EC+ P
Sbjct  124  DKGKQTPPPVLTYVPHSFDLDMAVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFNECQKP  183

Query  746  ACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDF  925
            ACYFVAKDYGH+DMLDDET G+RGK+TYCLCKNGK R  MR FVGG VVAFL+ YLEGD 
Sbjct  184  ACYFVAKDYGHLDMLDDETKGIRGKSTYCLCKNGKSREPMRKFVGGVVVAFLQAYLEGDN  243

Query  926  SSLAAIRDRHEEIAPVELQTVAFQ  997
            S L AIRD  +E  PVELQ V F 
Sbjct  244  SHLMAIRDGLDETVPVELQIVKFN  267



>gb|EYU41443.1| hypothetical protein MIMGU_mgv1a010077mg [Erythranthe guttata]
Length=323

 Score =   405 bits (1041),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 231/312 (74%), Gaps = 11/312 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKP-----LLIATPSEASAGAFPIFLFLHGYL  250
            +++N+FD+G +T +L+ +E   C  +          LLI  PSE   G +P+ +FLHG+L
Sbjct  14   SSSNVFDIGNHTTKLIKIEADNCRKNASSSSPPPKPLLICAPSEE--GVYPVLVFLHGFL  71

Query  251  FYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVH  430
             YNSFYSQL+QH+ASHGFIVVAPQLYS+ G DA EEIK T++ITNWL  GL  FLPP+V 
Sbjct  72   LYNSFYSQLLQHVASHGFIVVAPQLYSITGPDAKEEIKVTSEITNWLSNGLSRFLPPNVE  131

Query  431  PNTQKIALGGHSRGGKVAFGLALGKIAR--TDLKLSALIGVDPVDGMDKGKQTPPPVLTY  604
            PN  K+AL GHSRGGKVAF  AL    +  T LK SALIGVDPVDG  KG+Q P PV TY
Sbjct  132  PNLTKLALAGHSRGGKVAFASALNNKQKSPTSLKFSALIGVDPVDGTGKGEQHPLPVFTY  191

Query  605  IPQSFDL-GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHV  781
             P SFDL GM V+++GSGLGEVKRNPLFPPCAPKGVNH DFY EC  P  YFVAKDYGH+
Sbjct  192  TPHSFDLDGMGVLIVGSGLGEVKRNPLFPPCAPKGVNHEDFYNECSKPVHYFVAKDYGHL  251

Query  782  DMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEE  961
            DMLDD T G+RGKA+YCLCKNG+ R  MR FVGG  VAFLRGYLEGDF  L AIR+ H  
Sbjct  252  DMLDDGTKGIRGKASYCLCKNGESREPMRRFVGGVSVAFLRGYLEGDFKELVAIREGH-M  310

Query  962  IAPVELQTVAFQ  997
            + P+ELQ V F 
Sbjct  311  VLPLELQRVEFD  322



>emb|CDO99123.1| unnamed protein product [Coffea canephora]
Length=679

 Score =   416 bits (1069),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/306 (67%), Positives = 234/306 (76%), Gaps = 11/306 (4%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHP------PPKPLLIATPSEASAGAFPIFLFLHGYLFY  256
            N+F VGKY  +L+ VE      +       PPKPLLI  PSEA  G FP+ LF+HGYL Y
Sbjct  377  NVFGVGKYISKLLKVEQQTSIGNALLGIARPPKPLLIGIPSEA--GVFPVLLFIHGYLLY  434

Query  257  NSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPN  436
            NSFYSQL+QHIASHGFIV+APQLYS+AG D TEEI  TA+I NWL EGL   LPP V  N
Sbjct  435  NSFYSQLVQHIASHGFIVIAPQLYSMAGPDTTEEINATAEIANWLSEGLQKLLPPKVQAN  494

Query  437  TQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQS  616
              K+AL GHSRGGKVAFG+ALGK A T LK SALIG+DPVDG++KGKQ PP +LTY P S
Sbjct  495  LSKLALAGHSRGGKVAFGVALGK-AVTSLKFSALIGIDPVDGVEKGKQMPP-ILTYNPHS  552

Query  617  FDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDD  796
            F+L MAV +IGSGLGE++ N LFPP APKGVNH+DFY EC+ PACYFVA+DYGH+DMLDD
Sbjct  553  FNLDMAVSIIGSGLGELRSNFLFPPSAPKGVNHKDFYNECQKPACYFVARDYGHLDMLDD  612

Query  797  ETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
            +T G+RGKATYCLCKNG+ R  MR FVGG +VAF+R YLEG+   L AIR  H   APVE
Sbjct  613  DTSGLRGKATYCLCKNGESRDPMRRFVGGIMVAFMRNYLEGNSRDLQAIRHGH-LTAPVE  671

Query  977  LQTVAF  994
            LQ V F
Sbjct  672  LQNVDF  677



>ref|XP_007034856.1| Chlorophyllase isoform 1 [Theobroma cacao]
 gb|EOY05782.1| Chlorophyllase isoform 1 [Theobroma cacao]
Length=310

 Score =   400 bits (1028),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 213/306 (70%), Positives = 243/306 (79%), Gaps = 7/306 (2%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLL--IATPSEASAGAFPIFLFLHGYLFYN  259
            +ATN+F  G +T  L  V+    +S P P P    IATP EA  G FP+ +FLHGYL YN
Sbjct  7    SATNVFGFGSFTTMLQKVDSVTTSSLPVPPPKPLLIATPCEA--GEFPLIIFLHGYLQYN  64

Query  260  SFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLP-EGLHNFLPPHVHPN  436
            +FYSQL+QH+ASHGFIV+APQLY+VAGADAT+EIK TA IT+WL  E L   LPP+V PN
Sbjct  65   TFYSQLLQHVASHGFIVIAPQLYTVAGADATDEIKSTAAITSWLSKEVLQGLLPPYVQPN  124

Query  437  TQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQS  616
              K+ L GHSRGGKVAF LAL K A T LK SALIGVDPVDGMDKGKQTPPPVLTY+P S
Sbjct  125  LSKLGLAGHSRGGKVAFALALEK-AMTTLKFSALIGVDPVDGMDKGKQTPPPVLTYVPYS  183

Query  617  FDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDD  796
            F+L MAVMVIGSGLGEVKRNPLFPPCAPKGVNH DF++ECR PACYFVAKDYGH+DMLDD
Sbjct  184  FNLDMAVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFKECRKPACYFVAKDYGHLDMLDD  243

Query  797  ETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
            +T G+RG+++YCLCKNGK R  MR FVGG VVAF+  YL GD + L AIRD + E APVE
Sbjct  244  DTKGIRGRSSYCLCKNGKAREPMRRFVGGVVVAFVEAYLNGDHTDLIAIRDGY-ETAPVE  302

Query  977  LQTVAF  994
            L+TV F
Sbjct  303  LKTVEF  308



>ref|XP_010256174.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X4 [Nelumbo 
nucifera]
Length=301

 Score =   399 bits (1024),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 196/300 (65%), Positives = 227/300 (76%), Gaps = 13/300 (4%)
 Frame = +2

Query  125  ELVSVEP-----HKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHI  289
             L+ +EP      +  S  PPKPLLIATPS  +AG FPI +FLHGYL YNSFYSQ I HI
Sbjct  3    SLLRIEPGISSSTRSPSVAPPKPLLIATPS--AAGEFPILVFLHGYLLYNSFYSQFILHI  60

Query  290  ASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSR  469
            ASHGFIVVAPQLY+ AG D +EEIK  A IT+WL +GL + LP HV P   K+ L GHSR
Sbjct  61   ASHGFIVVAPQLYTAAGPDTSEEIKAAAAITDWLADGLQSVLPEHVQPCLSKLGLAGHSR  120

Query  470  GGKVAFGLALGKIA-----RTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            GGK AF LALG +       + LK SAL+G+DPVDGM KGKQTPPPVLTY+P+SF+L M 
Sbjct  121  GGKAAFALALGLVTGGTSTSSSLKFSALMGIDPVDGMGKGKQTPPPVLTYVPRSFNLDMG  180

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            V+V+GSGLG+VKRNPLFPPCAPKGVNH DF+ ECR PA YFV KDYGH DMLDD+T G+R
Sbjct  181  VLVVGSGLGQVKRNPLFPPCAPKGVNHEDFFNECRPPAFYFVVKDYGHADMLDDDTKGIR  240

Query  815  GKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
            GKATYCLCKNGK R  MR FV G VVAF+R YLEG+ + L AI D   ++ PV+LQT+ F
Sbjct  241  GKATYCLCKNGKSREPMRRFVAGIVVAFMRAYLEGNAADLTAIGD-GSQVPPVQLQTIDF  299



>dbj|BAF43705.1| Chlorophyllase 3 [Glycine max]
Length=326

 Score =   399 bits (1026),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 210/326 (64%), Positives = 243/326 (75%), Gaps = 13/326 (4%)
 Frame = +2

Query  38   DSHQLAMAVTFsssssTATNIFDVGKYTVELVSVEP------HKCTSHPPPKPLLIATPS  199
            +SHQL++  +   S S+  N+FD GKYT +L+ VE       H     PPPK LLIATP 
Sbjct  6    ESHQLSVMCS---SYSSNVNVFDTGKYTAKLLRVESESESYTHNNNVPPPPKSLLIATP-  61

Query  200  EASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQI  379
                G FP+ LFLHGYL YNSFYSQLIQH+ASHGFIV+APQLY+VAG D ++ I   A I
Sbjct  62   -LGGGDFPLLLFLHGYLLYNSFYSQLIQHVASHGFIVIAPQLYTVAGPDTSDGIHSAAAI  120

Query  380  TNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPV  556
            TNWL +GL   LPP+V PN  K+AL GHSRGGK AF L L K+   T+LK SALIGVDPV
Sbjct  121  TNWLSDGLCKVLPPNVRPNLSKLALAGHSRGGKTAFALTLRKLNITTNLKFSALIGVDPV  180

Query  557  DGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQEC  736
            DGM+KGKQTPPPVLTY+P SFD  MAVMVIGSGLGEVKRNPLFPPCAPKGVNH +F+ EC
Sbjct  181  DGMNKGKQTPPPVLTYVPNSFDFDMAVMVIGSGLGEVKRNPLFPPCAPKGVNHENFFNEC  240

Query  737  RGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLE  916
            + PA YFVAKDYGH DMLDD+T G+RGKAT CLCKNG+ R  MR FVGG +VAFL+ YL 
Sbjct  241  KKPAWYFVAKDYGHSDMLDDDTKGIRGKATNCLCKNGESRKPMRRFVGGVIVAFLKAYLH  300

Query  917  GDFSSLAAIRDRHEEIAPVELQTVAF  994
             D   L  IRDRH  + PVE++  +F
Sbjct  301  DDNEDLLTIRDRHVSL-PVEIKFDSF  325



>ref|XP_008449319.1| PREDICTED: chlorophyllase-2, chloroplastic [Cucumis melo]
Length=319

 Score =   399 bits (1024),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 199/304 (65%), Positives = 231/304 (76%), Gaps = 10/304 (3%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHP---PPKPLLIATPSEASAGAFPIFLFLHGYLFY  256
            T +N+F++GK+   L  VEP  C S     PPKPLLI  PSEA  G FP+ L +HGYL Y
Sbjct  19   TLSNVFEIGKFNAVLEKVEPGGCCSSGRFLPPKPLLIGRPSEA--GEFPVLLLVHGYLLY  76

Query  257  NSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPN  436
            N+FYSQLI HIASHGFIVVAPQLY+VAG DA+EEIK TA + NWLP GL   LPPHV+PN
Sbjct  77   NTFYSQLIHHIASHGFIVVAPQLYTVAGPDASEEIKATAAVINWLPTGLRQHLPPHVNPN  136

Query  437  TQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQS  616
              KIAL GHSRGGK +F LAL K      KLSALIG+DPVDG   GKQT PPVL YIPQS
Sbjct  137  LTKIALAGHSRGGKTSFALALQK----SPKLSALIGLDPVDGTGSGKQTHPPVLKYIPQS  192

Query  617  FDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDD  796
             DLG+ V+VIGSGLGE+K NPLFPPCAPKG+NH +F++ECR PA +FV KDYGH+D+LDD
Sbjct  193  LDLGIPVLVIGSGLGELKMNPLFPPCAPKGINHEEFFKECRNPAYHFVVKDYGHMDLLDD  252

Query  797  ETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
            ETGG+RGK +YCLCKNG+ R  MR FVGGAVVAFL+  L G+   L AI +  + I PV 
Sbjct  253  ETGGIRGKVSYCLCKNGESREPMRRFVGGAVVAFLKSCLNGEEGDLKAI-EGGDLILPVH  311

Query  977  LQTV  988
            LQT+
Sbjct  312  LQTI  315



>ref|XP_009343942.1| PREDICTED: LOW QUALITY PROTEIN: chlorophyllase-2, chloroplastic 
[Pyrus x bretschneideri]
Length=351

 Score =   399 bits (1025),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 216/318 (68%), Positives = 242/318 (76%), Gaps = 19/318 (6%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCT----------------SHPPPKPLLIATPSEASAGAFP  223
            TN+F++GKY V L  VE  + +                + PPPKPLLI  P EA AG FP
Sbjct  34   TNVFEMGKYKVVLQRVEAAERSGCGSKTKSSSSTSPPTNPPPPKPLLIGMPCEA-AGEFP  92

Query  224  IFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGL  403
            + L LHGYL  NSFYSQLI HIASHGFIV+APQLY++AG D T+EIK TA IT+WL  GL
Sbjct  93   VLLLLHGYLLSNSFYSQLINHIASHGFIVIAPQLYTIAGPDTTDEIKSTAAITDWLSNGL  152

Query  404  HNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIAR-TDLKLSALIGVDPVDGMDKGKQ  580
               LPP+VH N  K+AL GHSRGGKV+F LALGK    T LK SALIG+DPVDGMDKGKQ
Sbjct  153  QPLLPPNVHANLSKLALAGHSRGGKVSFALALGKXETGTSLKFSALIGIDPVDGMDKGKQ  212

Query  581  TPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFV  760
            TPPPVLTY+P SFDL MAVMVIGSGLGEVK+NPLFPPCAPKGVNH DF+ ECR  ACYFV
Sbjct  213  TPPPVLTYVPHSFDLDMAVMVIGSGLGEVKKNPLFPPCAPKGVNHEDFFNECRKWACYFV  272

Query  761  AKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAA  940
            AKDYGH+DMLDDET G+RGKATYCLCKNGK R  MR FVGG VVAF++ YLEGD S L A
Sbjct  273  AKDYGHLDMLDDETKGIRGKATYCLCKNGKSREPMRRFVGGVVVAFIKAYLEGDSSHLLA  332

Query  941  IRDRHEEIAPVELQTVAF  994
            IR+  E + P+ELQ V F
Sbjct  333  IREGVETL-PIELQCVKF  349



>ref|XP_004145391.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Cucumis sativus]
 ref|XP_004168544.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Cucumis sativus]
 gb|KGN61666.1| hypothetical protein Csa_2G222090 [Cucumis sativus]
Length=316

 Score =   397 bits (1019),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/302 (65%), Positives = 230/302 (76%), Gaps = 10/302 (3%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHP---PPKPLLIATPSEASAGAFPIFLFLHGYLFYN  259
            ++N+F++GK+   +  VE   C S     PPKPLLI  PS+A  G FP+ L +HGYL YN
Sbjct  17   SSNVFEIGKFNAVIEKVEAGGCCSSGRFLPPKPLLIGRPSDA--GEFPVLLLVHGYLLYN  74

Query  260  SFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNT  439
            +FYSQLI HIASHGFIVVAPQLY+VAG DA+EEI  TA + NWLP  L   LPPHV+PN 
Sbjct  75   TFYSQLIHHIASHGFIVVAPQLYTVAGPDASEEINATAAVMNWLPTALRQHLPPHVNPNL  134

Query  440  QKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSF  619
             KIAL GHSRGGK +F LAL K +    KLSALIG+DPVDG   GKQT PPVL YIPQSF
Sbjct  135  TKIALAGHSRGGKTSFALALQKSS----KLSALIGLDPVDGTGSGKQTHPPVLKYIPQSF  190

Query  620  DLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE  799
            DLG+ V+VIGSGLGE+KRNPLFPPCAPKG+NH +F++ECR PA +FV KDYGH+D+LDDE
Sbjct  191  DLGIPVLVIGSGLGELKRNPLFPPCAPKGINHEEFFKECRSPAYHFVVKDYGHLDLLDDE  250

Query  800  TGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVEL  979
            TGG+RGK +YCLCKNG+ R  MR FVGGAVVAFL+  L G+   L AI D  + I PV L
Sbjct  251  TGGIRGKVSYCLCKNGESREPMRRFVGGAVVAFLKSRLNGEEGDLKAIEDG-DLILPVHL  309

Query  980  QT  985
            QT
Sbjct  310  QT  311



>ref|XP_007034857.1| Chlorophyllase isoform 2 [Theobroma cacao]
 gb|EOY05783.1| Chlorophyllase isoform 2 [Theobroma cacao]
Length=311

 Score =   395 bits (1016),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 213/307 (69%), Positives = 243/307 (79%), Gaps = 8/307 (3%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLL--IATPSEASAGAFPIFLFLHGYLFYN  259
            +ATN+F  G +T  L  V+    +S P P P    IATP EA  G FP+ +FLHGYL YN
Sbjct  7    SATNVFGFGSFTTMLQKVDSVTTSSLPVPPPKPLLIATPCEA--GEFPLIIFLHGYLQYN  64

Query  260  SFYSQLIQHIASHGFIVVAPQ-LYSVAGADATEEIKCTAQITNWLP-EGLHNFLPPHVHP  433
            +FYSQL+QH+ASHGFIV+APQ LY+VAGADAT+EIK TA IT+WL  E L   LPP+V P
Sbjct  65   TFYSQLLQHVASHGFIVIAPQQLYTVAGADATDEIKSTAAITSWLSKEVLQGLLPPYVQP  124

Query  434  NTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQ  613
            N  K+ L GHSRGGKVAF LAL K A T LK SALIGVDPVDGMDKGKQTPPPVLTY+P 
Sbjct  125  NLSKLGLAGHSRGGKVAFALALEK-AMTTLKFSALIGVDPVDGMDKGKQTPPPVLTYVPY  183

Query  614  SFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLD  793
            SF+L MAVMVIGSGLGEVKRNPLFPPCAPKGVNH DF++ECR PACYFVAKDYGH+DMLD
Sbjct  184  SFNLDMAVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFKECRKPACYFVAKDYGHLDMLD  243

Query  794  DETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPV  973
            D+T G+RG+++YCLCKNGK R  MR FVGG VVAF+  YL GD + L AIRD + E APV
Sbjct  244  DDTKGIRGRSSYCLCKNGKAREPMRRFVGGVVVAFVEAYLNGDHTDLIAIRDGY-ETAPV  302

Query  974  ELQTVAF  994
            EL+TV F
Sbjct  303  ELKTVEF  309



>ref|XP_010932817.1| PREDICTED: chlorophyllase-2, chloroplastic [Elaeis guineensis]
Length=316

 Score =   391 bits (1004),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 201/310 (65%), Positives = 240/310 (77%), Gaps = 9/310 (3%)
 Frame = +2

Query  89    ATNIFDVGKYTVELVSVEPHKC-----TSHPPPKPLLIATPSEASAGAFPIFLFLHGYLF  253
             A  +F+ G YT +L+S+EP        +  PPPKPLLIATP E   G +P+ +FLHGYL 
Sbjct  4     AGQVFEHGNYTAKLISLEPEPTGSSLTSPSPPPKPLLIATPCEG--GIYPVLVFLHGYLL  61

Query  254   YNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHP  433
             YNSFYSQL QH+ASHGFIVVAPQLY VAG D+ +EIK TA I +WL  GLH+ LP  V P
Sbjct  62    YNSFYSQLFQHVASHGFIVVAPQLYQVAGPDSEDEIKTTAIIIDWLTTGLHHLLPVQVQP  121

Query  434   NTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQ  613
             N  K+ L GHSRGGKVAF LALG  A+T LK SALIG+DPVDGMDKGKQT PP+LTY+P 
Sbjct  122   NLCKLGLAGHSRGGKVAFALALGH-AKTTLKFSALIGIDPVDGMDKGKQTHPPILTYVPH  180

Query  614   SFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLD  793
             SF+L MAV+VIGSGLGE+KRNP FPPCAPKGV+H++F+ EC  PA +FVAKDYGH+DMLD
Sbjct  181   SFNLNMAVLVIGSGLGELKRNPFFPPCAPKGVSHQEFFDECCPPAYHFVAKDYGHLDMLD  240

Query  794   DETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPV  973
             DET G+RGK+TYCLCKNGK R  MR FVGG +VAF++ YLEG+   L A++D   EIAPV
Sbjct  241   DETKGLRGKSTYCLCKNGKARKPMRMFVGGVMVAFMKAYLEGETQILVALKDN-PEIAPV  299

Query  974   ELQTVAFQEN  1003
             EL  + + +N
Sbjct  300   ELLIITYLDN  309



>gb|KEH41057.1| chlorophyllase enzyme [Medicago truncatula]
Length=306

 Score =   385 bits (990),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 195/301 (65%), Positives = 233/301 (77%), Gaps = 5/301 (2%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEP-HKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNS  262
            + +N+F+ G YT +L+ V+      + PPPK LLIATP E   G FP+ LFLHGYL  NS
Sbjct  4    SVSNVFETGNYTTKLLRVDSCSHAQNVPPPKSLLIATPIEG--GEFPLLLFLHGYLLLNS  61

Query  263  FYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQ  442
            FYSQLIQH+ASHGFIV+APQLY+VAG D TEEI   A ITNWL +GL   LP ++ PN  
Sbjct  62   FYSQLIQHVASHGFIVIAPQLYTVAGPDITEEIYSVAAITNWLSKGLSKILPLNIKPNFH  121

Query  443  KIALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSF  619
            K+ALGGHSRGGK +F +AL K+   TDLK SA+IGVDPVDGMDKGKQT PP+LTY+P SF
Sbjct  122  KLALGGHSRGGKTSFAVALRKLNMTTDLKFSAIIGVDPVDGMDKGKQTSPPILTYVPHSF  181

Query  620  DLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE  799
            D  MA +VIGSGLG+VK+NPLFPPCAPKGVNH DF+ EC  P+ YFVAKDYGHVDMLDD+
Sbjct  182  DYDMATLVIGSGLGDVKKNPLFPPCAPKGVNHEDFFSECEKPSWYFVAKDYGHVDMLDDD  241

Query  800  TGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVEL  979
            T GVRGK +YCLCKNG+ R  MR FVGG +VAFL+ YL GD   L AIRD++  + P+E+
Sbjct  242  TKGVRGKVSYCLCKNGESRKPMRMFVGGVMVAFLKAYLHGDNVDLLAIRDKNLSV-PIEM  300

Query  980  Q  982
            +
Sbjct  301  K  301



>ref|XP_010695290.1| PREDICTED: chlorophyllase-2, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=322

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 226/302 (75%), Gaps = 6/302 (2%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHP----PPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            IFD G Y+  L++++    +S      P KPL+IATPS +  G FP+ L LHGY+ YN F
Sbjct  18   IFDNGTYSTVLLNIKAEDFSSDSKTTSPSKPLIIATPSCSEGGEFPVLLMLHGYILYNHF  77

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            YSQLI+HIASHGF+V+APQLY++AGAD+++EIK TA I +W  + L N LP +V PN  K
Sbjct  78   YSQLIKHIASHGFVVIAPQLYTIAGADSSDEIKDTAAIIDWASKSLKNVLPSNVRPNLDK  137

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            +AL GHSRGGKVAF LAL K+  + LK+SALIG+DPVDGM K  QTPPPVLT++PQSF L
Sbjct  138  LALSGHSRGGKVAFALALKKVTTSPLKISALIGIDPVDGMGKKNQTPPPVLTHLPQSFKL  197

Query  626  -GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDET  802
             GM V+VIGSG G +K+NPLFPPCAP+GVNH +FY E + PA YF+ KDYGH+DMLDD T
Sbjct  198  DGMPVLVIGSGFGAIKKNPLFPPCAPEGVNHENFYNESQNPAWYFLVKDYGHLDMLDDCT  257

Query  803  GGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
             GVRG +TYCLCKNG+ R  MR FVGG +VAFL  YL+ D S L +IRD  E I PV+  
Sbjct  258  KGVRGVSTYCLCKNGQSREPMRKFVGGVIVAFLNAYLKADESMLVSIRDGEETI-PVKFD  316

Query  983  TV  988
             V
Sbjct  317  KV  318



>gb|ACJ85964.1| unknown [Medicago truncatula]
Length=306

 Score =   381 bits (978),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/301 (64%), Positives = 231/301 (77%), Gaps = 5/301 (2%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEP-HKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNS  262
            + +N+F+ G YT +L+ V+      + PPPK LLIATP E   G FP+ LFLHGYL  NS
Sbjct  4    SVSNVFETGNYTTKLLRVDSCSHAQNVPPPKSLLIATPIEG--GEFPLLLFLHGYLLLNS  61

Query  263  FYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQ  442
            FYSQLIQH+ASHGFIV+APQLY+VAG D TEEI   A ITNWL +GL   LP ++ PN  
Sbjct  62   FYSQLIQHVASHGFIVIAPQLYTVAGPDITEEIYSVAAITNWLSKGLSKILPLNIKPNFH  121

Query  443  KIALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSF  619
            K+ALGGHSRGGK +F +AL K+   TDLK SA+IGVDPVDGMDKGKQT PP+ TY+P SF
Sbjct  122  KLALGGHSRGGKTSFAVALRKLNMTTDLKFSAIIGVDPVDGMDKGKQTSPPIFTYVPHSF  181

Query  620  DLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE  799
            D  MA +VIG GLG+VK+NPLFPPCAPKGVNH DF+ EC  P+ YFVAKDYGHVDMLDD+
Sbjct  182  DYDMATLVIGFGLGDVKKNPLFPPCAPKGVNHEDFFSECEKPSWYFVAKDYGHVDMLDDD  241

Query  800  TGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVEL  979
            T GVRGK +YCLCKNG+ R  MR FVGG +VAFL+ YL GD   L AIRD++  + P+E+
Sbjct  242  TKGVRGKVSYCLCKNGESRKPMRMFVGGVMVAFLKAYLHGDNVDLLAIRDKNLSV-PIEM  300

Query  980  Q  982
            +
Sbjct  301  K  301



>ref|XP_009393050.1| PREDICTED: chlorophyllase-2, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=309

 Score =   378 bits (971),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 194/307 (63%), Positives = 235/307 (77%), Gaps = 7/307 (2%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCT---SHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYN  259
            A  +F+ G++ V L+S+EP   T     PPPKPL++A+P+E   G +P  +FLHGYL YN
Sbjct  4    ARQVFEHGEHNVRLLSLEPKAATGSSPSPPPKPLIVASPTEE--GEYPTLVFLHGYLLYN  61

Query  260  SFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNT  439
            SFYSQL++H+ASHGFI+VAPQLYSVAG D   EI+  A +  WL +GL + LP HV  + 
Sbjct  62   SFYSQLLRHVASHGFIIVAPQLYSVAGPDCGAEIQSAAAVVEWLADGLIHVLPEHVRSDL  121

Query  440  QKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSF  619
             K+A+GGHSRGGKVAF LALG  A+T L+ SALIGV PVDGM+KGKQT PP+LTY+P SF
Sbjct  122  SKLAIGGHSRGGKVAFALALGH-AKTTLEFSALIGVGPVDGMEKGKQTRPPILTYVPHSF  180

Query  620  DLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE  799
            DL MA +VIGSGLGE+K++PLFP CAPKGVNH+DF+ ECR PA +FVAK+YGH DMLDDE
Sbjct  181  DLKMAALVIGSGLGELKKSPLFPACAPKGVNHQDFFDECRPPAYHFVAKEYGHQDMLDDE  240

Query  800  TGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVEL  979
            T GVRGKATYCLCK G  R  MRAFVGGA+VAF++ YLEGD   L AI D   +I+PVEL
Sbjct  241  TSGVRGKATYCLCKKGPSRKPMRAFVGGAMVAFMKSYLEGDTQFLTAIVDD-PQISPVEL  299

Query  980  QTVAFQE  1000
             T    E
Sbjct  300  STATSLE  306



>emb|CDY50811.1| BnaCnng19750D [Brassica napus]
Length=333

 Score =   379 bits (972),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 193/312 (62%), Positives = 231/312 (74%), Gaps = 13/312 (4%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKC---------TSHPPPKPLLIATPSEASAGAFPIFLFLHGY  247
            N F+ GKY  +L++V    C         T   PPK LL+ATP E   G +P+ + LHGY
Sbjct  23   NSFEDGKYKTDLLTVGLSSCCWKKPSSSPTPQSPPKRLLVATPVEE--GEYPVVMLLHGY  80

Query  248  LFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHV  427
            L YNSFYSQL+ H++SHGFIV+APQLYS+AG D  +EIK TA+I +WL  GL++FLPP V
Sbjct  81   LLYNSFYSQLMLHVSSHGFIVIAPQLYSIAGPDTMDEIKSTAEIIDWLSVGLNHFLPPQV  140

Query  428  HPNTQKIALGGHSRGGKVAFGLALGKIARTD-LKLSALIGVDPVDGMDKGKQTPPPVLTY  604
             PN  K AL GHSRGGK AF LAL K   +  LK+SALIG+DPVDGM KGKQTPPPVLTY
Sbjct  141  TPNLSKFALSGHSRGGKTAFALALKKFGYSSYLKISALIGIDPVDGMGKGKQTPPPVLTY  200

Query  605  IPQSFDLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHV  781
             P SFDL  M V+VIGSGLGE+  N LFPPCAP GVNHRDFY+EC+GPA +FVAKDYGH+
Sbjct  201  EPNSFDLDKMPVLVIGSGLGEISPNLLFPPCAPPGVNHRDFYRECQGPAWHFVAKDYGHL  260

Query  782  DMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEE  961
            DMLDD+T G+RGK ++ LCKNG+ER  MR FVGG++VAFL  YLEGD S L  I+D+  E
Sbjct  261  DMLDDDTEGIRGKISHYLCKNGEERRPMRRFVGGSIVAFLIAYLEGDDSELVKIKDKSHE  320

Query  962  IAPVELQTVAFQ  997
              PVE+Q   F+
Sbjct  321  GVPVEIQEFEFK  332



>ref|XP_009113977.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Brassica rapa]
Length=333

 Score =   377 bits (969),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 190/307 (62%), Positives = 230/307 (75%), Gaps = 13/307 (4%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKC---------TSHPPPKPLLIATPSEASAGAFPIFLFLHGY  247
            N F+ GK+  +L++V    C         T   PPK LL+ATP E   G +P+ + LHGY
Sbjct  23   NSFEDGKFKTDLLTVGLSSCCWKTPSSSPTPQSPPKRLLVATPVEE--GEYPVVMLLHGY  80

Query  248  LFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHV  427
            L YNSFYSQL+ H++SHGFIV+APQLYS+AG D  +EIK T +I +WL  GL++FLPP V
Sbjct  81   LLYNSFYSQLMLHVSSHGFIVIAPQLYSIAGPDTMDEIKSTVEIIDWLSAGLNHFLPPQV  140

Query  428  HPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPVLTY  604
             PN  K+AL GHSRGGK AF +AL K    +DLK+SALIG+DPVDGM KGKQTPPPVLTY
Sbjct  141  TPNLSKLALSGHSRGGKTAFAVALKKFGYSSDLKISALIGIDPVDGMGKGKQTPPPVLTY  200

Query  605  IPQSFDLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHV  781
             P SFDL  M V+VIGSGLGE+  N LFPPCAP GVNHRDF+QEC+GPA +FVAKDYGH+
Sbjct  201  EPNSFDLDKMPVLVIGSGLGEISPNLLFPPCAPPGVNHRDFFQECQGPAWHFVAKDYGHL  260

Query  782  DMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEE  961
            DMLDD+T G+RGK ++ LCKNG+ER  MR FVGG++VAFL  YLEGD S L  I+D+  E
Sbjct  261  DMLDDDTEGIRGKISHYLCKNGEERRPMRRFVGGSIVAFLMAYLEGDDSELVKIKDKSHE  320

Query  962  IAPVELQ  982
              PVE+Q
Sbjct  321  GVPVEIQ  327



>emb|CDY32929.1| BnaA09g16640D [Brassica napus]
Length=333

 Score =   377 bits (969),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 190/307 (62%), Positives = 229/307 (75%), Gaps = 13/307 (4%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKC---------TSHPPPKPLLIATPSEASAGAFPIFLFLHGY  247
            N F+  KY  +L++V    C         T   PPK LL+ATP E   G +P+ + LHGY
Sbjct  23   NSFEDSKYKTDLLTVGLSSCCWKTPSSSPTPQSPPKRLLVATPVEE--GEYPVVMLLHGY  80

Query  248  LFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHV  427
            L YNSFYSQL+ H++SHGFIV+APQLYS+AG D  +EIK T +I +WL  GL++FLPP V
Sbjct  81   LLYNSFYSQLMLHVSSHGFIVIAPQLYSIAGPDTMDEIKSTVEILDWLSAGLNHFLPPQV  140

Query  428  HPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPVLTY  604
             PN  K+AL GHSRGGK AF +AL K    +DLK+SALIG+DPVDGM KGKQTPPPVLTY
Sbjct  141  TPNLSKLALSGHSRGGKTAFSVALKKFGYSSDLKISALIGIDPVDGMGKGKQTPPPVLTY  200

Query  605  IPQSFDLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHV  781
             P SFDL  M V+VIGSGLGE+  N LFPPCAP GVNHRDF++EC+GPA +FVAKDYGH+
Sbjct  201  EPNSFDLDKMPVLVIGSGLGEISPNLLFPPCAPPGVNHRDFFRECQGPAWHFVAKDYGHL  260

Query  782  DMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEE  961
            DMLDD+T G+RGK +Y LCKNG+ER  MR FVGG++VAFL  YLEGD S L  I+D+  E
Sbjct  261  DMLDDDTEGIRGKISYYLCKNGEERRPMRRFVGGSIVAFLMAYLEGDDSELVKIKDKSHE  320

Query  962  IAPVELQ  982
              PVE+Q
Sbjct  321  GVPVEIQ  327



>ref|XP_006403171.1| hypothetical protein EUTSA_v10003248mg [Eutrema salsugineum]
 dbj|BAJ34423.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ44624.1| hypothetical protein EUTSA_v10003248mg [Eutrema salsugineum]
Length=317

 Score =   375 bits (964),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 188/312 (60%), Positives = 230/312 (74%), Gaps = 18/312 (6%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSH-----------PPPKPLLIATPSEASAGAFPIFL  232
            ++ N F+ GKY  +L++V+    +SH            PPK LLIATP E   G +P+ +
Sbjct  5    SSRNAFEDGKYKTDLLTVD---SSSHCFRTTPSSSSPAPPKGLLIATPVEE--GEYPVVM  59

Query  233  FLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNF  412
             LHGYL YN+FYSQL+ H++SHGFI++APQLYS+AG D  EEIK TA+  +WL  GL++F
Sbjct  60   LLHGYLLYNTFYSQLMLHVSSHGFILIAPQLYSIAGPDTMEEIKSTAETMDWLSVGLNHF  119

Query  413  LPPHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPP  589
            LPP V PN  K AL GHSRGGK AF  AL K    +DLK+S LIG+DPVDGM KGKQTPP
Sbjct  120  LPPQVTPNLTKFALSGHSRGGKTAFAAALKKFGYSSDLKISTLIGIDPVDGMGKGKQTPP  179

Query  590  PVLTYIPQSFDLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAK  766
            PVLTY P SFDL  M ++VIGSGLGE  RNPLFPPCAP GVNHRDF++EC+GPA +FVA+
Sbjct  180  PVLTYEPNSFDLDKMPILVIGSGLGETARNPLFPPCAPPGVNHRDFFRECQGPAWHFVAQ  239

Query  767  DYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIR  946
            DYGH+DMLDD+T G+RGK++YCLCKNG+ R  MR FVGG VVAFL  YLEGD S L  I+
Sbjct  240  DYGHLDMLDDDTKGIRGKSSYCLCKNGEGRRPMRRFVGGIVVAFLMAYLEGDNSELVKIK  299

Query  947  DRHEEIAPVELQ  982
            D   +   +E+Q
Sbjct  300  DGSHDGVSIEIQ  311



>gb|KFK31694.1| hypothetical protein AALP_AA6G147200 [Arabis alpina]
Length=317

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 187/306 (61%), Positives = 227/306 (74%), Gaps = 12/306 (4%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPH-KCTS-------HPPPKPLLIATPSEASAGAFPIFLFLHGYL  250
            N+F+ GKY   L+++    +C           PPK LL+ATP     G +P+ + LHGYL
Sbjct  8    NVFEDGKYKTNLLTINSSSRCCKATPSSPSPSPPKQLLVATP--VKEGEYPVVMLLHGYL  65

Query  251  FYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVH  430
             YNSFYSQL+ H++SHGFI++APQLYS+AG D T+EIK TA+  +WL  GL +FLPP V 
Sbjct  66   LYNSFYSQLMLHVSSHGFILIAPQLYSIAGPDTTDEIKSTAETIDWLAVGLKHFLPPQVI  125

Query  431  PNTQKIALGGHSRGGKVAFGLALGKIART-DLKLSALIGVDPVDGMDKGKQTPPPVLTYI  607
            PN  K+AL GHSRGGK AF +AL K   +  LK+  LIG+DPVDGM KGKQTPPPVLTY 
Sbjct  126  PNLAKLALSGHSRGGKTAFAVALEKFGYSPKLKIKTLIGIDPVDGMAKGKQTPPPVLTYE  185

Query  608  PQSFDLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVD  784
            P SFDL  M V+VIGSGLGE  RNPLFPPCAP GVNHRDF++EC+GPA +FVAKDYGH+D
Sbjct  186  PNSFDLDKMPVLVIGSGLGETARNPLFPPCAPPGVNHRDFFRECQGPAWHFVAKDYGHLD  245

Query  785  MLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
            MLDDET G+RGK++YCLCKNG+ER  MR FVGG VV+FL+ YLEGD   L  I+D   + 
Sbjct  246  MLDDETKGIRGKSSYCLCKNGEERRPMRRFVGGIVVSFLKAYLEGDDCELVKIKDGCHKG  305

Query  965  APVELQ  982
             PVE+Q
Sbjct  306  LPVEIQ  311



>ref|XP_002865397.1| chlorophyll-chlorophyllido hydrolase 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41656.1| chlorophyll-chlorophyllido hydrolase 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=318

 Score =   374 bits (960),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 185/310 (60%), Positives = 230/310 (74%), Gaps = 13/310 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPH-KCTS--------HPPPKPLLIATPSEASAGAFPIFLFL  238
            ++ N F+ GKY   L++++   +C            PPK LL+ATP E   G +P+ + L
Sbjct  5    SSRNAFEDGKYKTNLLTLDSSSRCRKITPSSRASPSPPKQLLVATPVEE--GEYPVVMLL  62

Query  239  HGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLP  418
            HGYL YNSFYSQL+ H++SHGFI++APQLYS+AG D  +EIK TA+I +WL  GL++FLP
Sbjct  63   HGYLLYNSFYSQLMLHVSSHGFILIAPQLYSIAGPDTMDEIKSTAEIMDWLSVGLNHFLP  122

Query  419  PHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPV  595
            P V PN  K  L GHSRGGK AF +AL K    +DLK+S LIG+DPVDG  KGKQTPPPV
Sbjct  123  PQVTPNLSKFVLSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTGKGKQTPPPV  182

Query  596  LTYIPQSFDLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDY  772
            LTY P SFDL  + ++VIGSGLGE  RNPLFPPCAP GVNHR+F++EC+GPA +FVAKDY
Sbjct  183  LTYEPNSFDLDKIPMLVIGSGLGETARNPLFPPCAPPGVNHREFFRECQGPAWHFVAKDY  242

Query  773  GHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDR  952
            GH+DMLDD+T G+RGK++YCLCKNG+ER  MR FVGG VV+FL+ YLEGD   L  I+D 
Sbjct  243  GHLDMLDDDTRGIRGKSSYCLCKNGEERRPMRRFVGGIVVSFLKAYLEGDDRELVKIKDG  302

Query  953  HEEIAPVELQ  982
              E  PVE+Q
Sbjct  303  CHEGVPVEIQ  312



>ref|XP_008775648.1| PREDICTED: chlorophyllase-2, chloroplastic [Phoenix dactylifera]
Length=316

 Score =   374 bits (959),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 191/310 (62%), Positives = 239/310 (77%), Gaps = 9/310 (3%)
 Frame = +2

Query  89    ATNIFDVGKYTVELVSVEPHKC-----TSHPPPKPLLIATPSEASAGAFPIFLFLHGYLF  253
             A ++F+ G YT +L+S+EP        +  PPPKPLLIA+P E   G +P+ +FLHGYL 
Sbjct  4     AGHVFEHGNYTAKLISLEPEPVRSSLTSPSPPPKPLLIASPCEG--GIYPVLVFLHGYLL  61

Query  254   YNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHP  433
             YNSFYSQL QH+ASHGFIVVAPQLY +AG D+ +EI+  A I +WL  GLH+ LP  V P
Sbjct  62    YNSFYSQLFQHVASHGFIVVAPQLYRLAGPDSEDEIQTVAIIVDWLTTGLHHLLPVQVQP  121

Query  434   NTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQ  613
             N  K+ L GHSRGGKVAF LALG  A+T L  SAL+G+DPVDGMDKGKQT PP+LTY P 
Sbjct  122   NLCKLGLAGHSRGGKVAFALALGH-AKTALNFSALMGIDPVDGMDKGKQTHPPILTYAPH  180

Query  614   SFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLD  793
             SF+L MAV+VIGSGLGE+KRN +FPPCAPKGV+H++F+ ECR PA +FVAKDYGH+DMLD
Sbjct  181   SFNLNMAVLVIGSGLGELKRNLVFPPCAPKGVSHQEFFDECRPPAYHFVAKDYGHLDMLD  240

Query  794   DETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPV  973
             DET G+RGKATYCLC +G+ R  MR FVGG +VAF++ YLEG+   L A++D + EI PV
Sbjct  241   DETKGLRGKATYCLCTSGRARKPMRMFVGGVMVAFMKAYLEGETQILVALKD-NPEIPPV  299

Query  974   ELQTVAFQEN  1003
             +L T+ + ++
Sbjct  300   DLLTITYLDD  309



>ref|XP_010494369.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Camelina sativa]
Length=335

 Score =   372 bits (955),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 182/310 (59%), Positives = 226/310 (73%), Gaps = 13/310 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVE---------PHKCTSHPPPKPLLIATPSEASAGAFPIFLFL  238
            ++ N F+ GKY  +L++++         P    S  PPK LL+ATP E   G +P+ + L
Sbjct  22   SSRNAFEDGKYKTDLLTLDSSSRCCKMMPASRASPSPPKQLLVATPVEE--GEYPVVMLL  79

Query  239  HGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLP  418
            HGYL YNSFYSQL+ H++SHGFI++APQLYS+AG D  +EIK T +I +WL  GL++FLP
Sbjct  80   HGYLLYNSFYSQLMLHVSSHGFILIAPQLYSIAGPDTMDEIKSTVEIIDWLSVGLNHFLP  139

Query  419  PHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPV  595
              V PN  K  L GHSRGGK AF +AL K    +DLK+S LIG+DPVDG  KG+QTPPPV
Sbjct  140  AQVIPNLSKFVLSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTWKGQQTPPPV  199

Query  596  LTYIPQSFDLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDY  772
            L Y P SFDL  M V+VIGSGLGE  RNPLFPPCAP  VNHR+F++EC+ PA +FVAKDY
Sbjct  200  LAYEPNSFDLDKMPVLVIGSGLGETARNPLFPPCAPPRVNHREFFRECQSPAWHFVAKDY  259

Query  773  GHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDR  952
            GH+DMLDD+T G+RGK++YCLCKNG+ER  MR FVGG VV+FL+ YLEGD   L  I+D 
Sbjct  260  GHLDMLDDDTKGIRGKSSYCLCKNGEERRPMRRFVGGIVVSFLKAYLEGDDFELVKIKDG  319

Query  953  HEEIAPVELQ  982
              E  PVE+Q
Sbjct  320  CHEGVPVEIQ  329



>ref|NP_199199.1| chlorophyllase 2 [Arabidopsis thaliana]
 sp|Q9M7I7.1|CLH2_ARATH RecName: Full=Chlorophyllase-2, chloroplastic; Short=AtCLH2; 
AltName: Full=Chlorophyll-chlorophyllido hydrolase 2; Short=Chlase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF27046.1|AF134302_1 AtCLH2 [Arabidopsis thaliana]
 dbj|BAB11315.1| AtCLH2 [Arabidopsis thaliana]
 gb|AED95018.1| chlorophyllase 2 [Arabidopsis thaliana]
Length=318

 Score =   371 bits (952),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 229/310 (74%), Gaps = 13/310 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPH-KCTS--------HPPPKPLLIATPSEASAGAFPIFLFL  238
            ++ N F+ GKY   L++++   +C            PPK LL+ATP E   G +P+ + L
Sbjct  5    SSRNAFEDGKYKSNLLTLDSSSRCCKITPSSRASPSPPKQLLVATPVEE--GDYPVVMLL  62

Query  239  HGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLP  418
            HGYL YNSFYSQL+ H++SHGFI++APQLYS+AG D  +EIK TA+I +WL  GL++FLP
Sbjct  63   HGYLLYNSFYSQLMLHVSSHGFILIAPQLYSIAGPDTMDEIKSTAEIMDWLSVGLNHFLP  122

Query  419  PHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPV  595
              V PN  K AL GHSRGGK AF +AL K    ++LK+S LIG+DPVDG  KGKQTPPPV
Sbjct  123  AQVTPNLSKFALSGHSRGGKTAFAVALKKFGYSSNLKISTLIGIDPVDGTGKGKQTPPPV  182

Query  596  LTYIPQSFDLGMA-VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDY  772
            L Y+P SFDL    ++VIGSGLGE  RNPLFPPCAP GVNHR+F++EC+GPA +FVAKDY
Sbjct  183  LAYLPNSFDLDKTPILVIGSGLGETARNPLFPPCAPPGVNHREFFRECQGPAWHFVAKDY  242

Query  773  GHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDR  952
            GH+DMLDD+T G+RGK++YCLCKNG+ER  MR FVGG VV+FL+ YLEGD   L  I+D 
Sbjct  243  GHLDMLDDDTKGIRGKSSYCLCKNGEERRPMRRFVGGLVVSFLKAYLEGDDRELVKIKDG  302

Query  953  HEEIAPVELQ  982
              E  PVE+Q
Sbjct  303  CHEDVPVEIQ  312



>emb|CDX96924.1| BnaC02g30620D [Brassica napus]
Length=296

 Score =   367 bits (943),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 182/301 (60%), Positives = 224/301 (74%), Gaps = 17/301 (6%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            ++ N F  GKY  +L++              LL+ATP E   G +P+ + LHGYL YNSF
Sbjct  5    SSRNAFVDGKYKPDLLT-------------SLLVATPVEE--GEYPVVMLLHGYLLYNSF  49

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            YSQL+ H++S+GFIV+APQLY++AG D  +EIK TA+I +WL  GL++FLPP V PN  K
Sbjct  50   YSQLMLHVSSYGFIVIAPQLYNIAGPDTMDEIKSTAEIIDWLSVGLNHFLPPQVTPNLSK  109

Query  446  IALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFD  622
             AL GHSRGGK AF +AL K    ++LK+SALIGVDPVDG  KGKQTPPPVLTY P SF+
Sbjct  110  FALTGHSRGGKTAFAVALKKFGYSSELKISALIGVDPVDGTGKGKQTPPPVLTYEPNSFN  169

Query  623  L-GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE  799
            L  M V+VIGSGLGE+ RNPLFPPCAP GVNHR+F+QEC+GPA +FVAKDYGH+DMLDD+
Sbjct  170  LEKMPVLVIGSGLGELARNPLFPPCAPTGVNHREFFQECQGPAWHFVAKDYGHLDMLDDD  229

Query  800  TGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVEL  979
            T G+RGK++YCLCKNG+ER  MR F+GG VV+FL  YLE D   L  I+D   E  PVE+
Sbjct  230  TKGLRGKSSYCLCKNGEERKPMRRFIGGIVVSFLMAYLEDDDCELMKIKDGCHEGVPVEI  289

Query  980  Q  982
            Q
Sbjct  290  Q  290



>ref|XP_010441975.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Camelina 
sativa]
 ref|XP_010441976.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X2 [Camelina 
sativa]
Length=318

 Score =   367 bits (943),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/310 (60%), Positives = 228/310 (74%), Gaps = 13/310 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPH-KCTS--------HPPPKPLLIATPSEASAGAFPIFLFL  238
            ++ N F+ GKY  +L++V+   +C            PPK LL+ATP E   G +P+ + L
Sbjct  5    SSRNAFEDGKYKTDLLTVDSSSRCCKTMPSSRASPSPPKQLLVATPVEE--GEYPVVMLL  62

Query  239  HGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLP  418
            HGYL YNSFYSQL+ H++SHGFI++APQLYSVAG D  +EIK TA+I +WL  GL++FLP
Sbjct  63   HGYLLYNSFYSQLMVHVSSHGFILIAPQLYSVAGPDTMDEIKSTAEIIDWLSIGLNHFLP  122

Query  419  PHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPV  595
              V  N  K AL GHSRGGK AF +AL K    +DLK+S LIG+DPVDG  KG+QTPPPV
Sbjct  123  AQVILNLSKFALSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTGKGQQTPPPV  182

Query  596  LTYIPQSFDLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDY  772
            L Y P SFDL  M V+VIGSGLGE  RNPLFPPCAP GVNHR+F++EC+ PA +FVAKDY
Sbjct  183  LAYEPNSFDLDKMPVLVIGSGLGETARNPLFPPCAPPGVNHREFFRECQSPAWHFVAKDY  242

Query  773  GHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDR  952
            GH+DMLDD+T G+RGK++YCLCKNG+ER  MR FVGG VV+FL+ YLEGD   L  I+D 
Sbjct  243  GHLDMLDDDTKGIRGKSSYCLCKNGEERRPMRRFVGGIVVSFLKAYLEGDKFELVKIKDG  302

Query  953  HEEIAPVELQ  982
              E  PVE+Q
Sbjct  303  CHEGVPVEIQ  312



>ref|XP_010481816.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Camelina sativa]
Length=318

 Score =   367 bits (941),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 228/310 (74%), Gaps = 13/310 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPH-KCTS--------HPPPKPLLIATPSEASAGAFPIFLFL  238
            ++ N F+ GKY  +L++++   +C            PPK LL+ATP E   G +P+ + L
Sbjct  5    SSRNAFEDGKYKTDLLTLDSSSRCCKTMPSSRASPSPPKQLLVATPVEE--GEYPVMMLL  62

Query  239  HGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLP  418
            HGYL YNSFYSQL+ H++SHGFI++APQLYSVAG D  +EIK T++I +WL  GL++FLP
Sbjct  63   HGYLLYNSFYSQLMLHVSSHGFILIAPQLYSVAGPDTMDEIKSTSEIIDWLSIGLNHFLP  122

Query  419  PHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPV  595
              V PN  K AL GHSRGGK AF +AL K    +DLK+S LIG+DPVDG  KG+QTPPPV
Sbjct  123  AQVIPNLSKFALSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTGKGQQTPPPV  182

Query  596  LTYIPQSFDLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDY  772
            L Y P SFDL  M V+VIGSGLGE  RN LFPPCAP G+NHR+F++EC+ PA +FVAKDY
Sbjct  183  LAYEPNSFDLDKMPVLVIGSGLGETARNLLFPPCAPPGMNHREFFRECQSPAWHFVAKDY  242

Query  773  GHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDR  952
            GH+DMLDD+T G+RGK++YCLCKNG+ER  MR FVGG VV+FL+ YLEGD   L  IRD 
Sbjct  243  GHLDMLDDDTKGIRGKSSYCLCKNGEERRPMRRFVGGVVVSFLKAYLEGDDFELVKIRDG  302

Query  953  HEEIAPVELQ  982
              E  PVE+Q
Sbjct  303  CHEGVPVEIQ  312



>gb|AAO22714.1| putative AtCLH2 protein [Arabidopsis thaliana]
Length=293

 Score =   362 bits (930),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 173/272 (64%), Positives = 211/272 (78%), Gaps = 4/272 (1%)
 Frame = +2

Query  173  KPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADAT  352
            K LL+ATP E   G + + + LHGYL YNSFYSQL+ H++SHGFI++APQLYS+AG D  
Sbjct  18   KQLLVATPVEE--GDYAVVMLLHGYLLYNSFYSQLMLHVSSHGFILIAPQLYSIAGPDTM  75

Query  353  EEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKL  529
            +EIK TA+I +WL  GL++FLP  V PN  K AL GHSRGGK AF +AL K    ++LK+
Sbjct  76   DEIKSTAEIMDWLSVGLNHFLPAQVTPNLSKFALSGHSRGGKTAFAVALKKFGYSSNLKI  135

Query  530  SALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA-VMVIGSGLGEVKRNPLFPPCAPKG  706
            S LIG+DPVDG  KGKQTPPPVL Y+P SFDL    ++VIGSGLGE  RNPLFPPCAP G
Sbjct  136  STLIGIDPVDGTGKGKQTPPPVLAYLPNSFDLDKTPILVIGSGLGETARNPLFPPCAPPG  195

Query  707  VNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGA  886
            VNHR+F++EC+GPA +FVAKDYGH+DMLDD+T G+RGK++YCLCKNG+ER  MR FVGG 
Sbjct  196  VNHREFFRECQGPAWHFVAKDYGHLDMLDDDTKGIRGKSSYCLCKNGEERRPMRRFVGGL  255

Query  887  VVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            VV+FL+ YLEGD   L  I+D   E  PVE+Q
Sbjct  256  VVSFLKAYLEGDDRELVKIKDGCHEDVPVEIQ  287



>ref|XP_006282250.1| hypothetical protein CARUB_v10028524mg [Capsella rubella]
 gb|EOA15148.1| hypothetical protein CARUB_v10028524mg [Capsella rubella]
Length=319

 Score =   363 bits (932),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 181/313 (58%), Positives = 227/313 (73%), Gaps = 14/313 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPH-KCTS---------HPPPKPLLIATPSEASAGAFPIFLF  235
            ++ N F+ GK+   L++++   +C             PPK LL+ATP E   G +P+ + 
Sbjct  5    SSRNAFEDGKHKTNLLTLDSSSRCCKTTPPSSRASPSPPKQLLVATPVEE--GEYPVVML  62

Query  236  LHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFL  415
            LHGYL YNSFYSQL+ H++SHGFI++APQLYSVAG D  +EIK TA++ +WL  GL +FL
Sbjct  63   LHGYLLYNSFYSQLMLHVSSHGFILIAPQLYSVAGPDTMDEIKSTAEVMDWLSVGLKHFL  122

Query  416  PPHVHPNTQKIALGGHSRGGKVAFGLALGKIAR-TDLKLSALIGVDPVDGMDKGKQTPPP  592
            P  V PN  K AL GHSRGGK AF +AL K    +DLK+S LIG+DPVDG  KGKQTPPP
Sbjct  123  PQQVTPNLSKFALSGHSRGGKTAFAVALKKFGYLSDLKISTLIGIDPVDGTGKGKQTPPP  182

Query  593  VLTYIPQSFDLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKD  769
            VL+Y P SFDL  M V+VIGSGLGE  RNPLFPPCAP GVNHR+F++EC+ PA +FV KD
Sbjct  183  VLSYEPNSFDLDKMPVLVIGSGLGETARNPLFPPCAPPGVNHREFFRECQRPAWHFVVKD  242

Query  770  YGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRD  949
            +GH+DMLDD+T G+RGK++YCLCKNG+ER  MR FV G VV+FL+ YLEGD   L  I+D
Sbjct  243  HGHLDMLDDDTKGIRGKSSYCLCKNGEERRPMRRFVSGMVVSFLKAYLEGDDCELVKIKD  302

Query  950  RHEEIAPVELQTV  988
               E  PVE+Q +
Sbjct  303  GCHEGVPVEIQEL  315



>ref|XP_009123914.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Brassica 
rapa]
 ref|XP_009123915.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Brassica 
rapa]
 ref|XP_009123917.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Brassica 
rapa]
 ref|XP_009123918.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Brassica 
rapa]
Length=339

 Score =   362 bits (928),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/268 (65%), Positives = 211/268 (79%), Gaps = 4/268 (1%)
 Frame = +2

Query  185  IATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIK  364
            +ATP E   G +P+ + LHGYL YNSFYSQL+ H++S+GFIV+APQLY++AG D  +EIK
Sbjct  68   VATPVEE--GEYPVVMLLHGYLLYNSFYSQLMLHVSSYGFIVIAPQLYNIAGPDTMDEIK  125

Query  365  CTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALI  541
             TA+I +WL  GL++FLPP V PN  K AL GHSRGGK AF +AL K    ++LK+SALI
Sbjct  126  STAEIIDWLSVGLNHFLPPQVTPNLSKFALTGHSRGGKTAFAVALKKFGYSSELKISALI  185

Query  542  GVDPVDGMDKGKQTPPPVLTYIPQSFDL-GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHR  718
            GVDPVDG  KGKQTPPPVLTY P SF+L  M V+VIGSGLGE+ RNPLFPPCAP GVNHR
Sbjct  186  GVDPVDGTGKGKQTPPPVLTYEPNSFNLEKMPVLVIGSGLGELARNPLFPPCAPTGVNHR  245

Query  719  DFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAF  898
            +F+QEC+GPA +FVAKDYGH+DMLDD+T G+RGK++YCLCKNG+ER  MR F+GG VV+F
Sbjct  246  EFFQECQGPAWHFVAKDYGHLDMLDDDTKGLRGKSSYCLCKNGEERKPMRRFIGGIVVSF  305

Query  899  LRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            L  YLE D   L  I+D   E  PVE+Q
Sbjct  306  LMAYLEDDDCELMKIKDGCHEGVPVEIQ  333



>gb|AAN51934.1|AF337545_1 chlorophyllase 2 [Brassica oleracea]
Length=321

 Score =   359 bits (921),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 226/313 (72%), Gaps = 16/313 (5%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVE-PHKCTSHPPPKPLL-----------IATPSEASAGAFPIF  229
            ++ N F  GKY  +L++V+   +C  +                  +ATP E   G +P+ 
Sbjct  5    SSRNAFVDGKYKPDLLTVDLASRCRCYKTTPSSSLTPPPPPKSLLVATPVEE--GEYPVV  62

Query  230  LFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHN  409
            + LHGYL YNSFYSQL+ H++S+GFIV+APQLY++AG D  +EIK TA+I +WL  GL++
Sbjct  63   MLLHGYLLYNSFYSQLMLHVSSYGFIVIAPQLYNIAGPDTIDEIKSTAEIIDWLSVGLNH  122

Query  410  FLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTP  586
            FLPP V PN  K AL GHSRGGK AF +AL K    ++LK+SA+IGVDPVDG  KGKQTP
Sbjct  123  FLPPQVTPNLSKFALTGHSRGGKTAFAVALKKFGYSSELKISAIIGVDPVDGTGKGKQTP  182

Query  587  PPVLTYIPQSFDL-GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVA  763
            PPVLTY P SF+L  M V+VIGSGLGE+ RNPLFPPCAP GVNHR+F+QEC+GPA +FVA
Sbjct  183  PPVLTYEPNSFNLEKMPVLVIGSGLGELARNPLFPPCAPTGVNHREFFQECQGPAWHFVA  242

Query  764  KDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAI  943
            KDYGH+DMLDD+T G+RGK++YCLCKNG+ER  MR F+GG VV+FL  YLE D   L  I
Sbjct  243  KDYGHLDMLDDDTKGLRGKSSYCLCKNGEERKPMRRFIGGIVVSFLMAYLEDDDCELVKI  302

Query  944  RDRHEEIAPVELQ  982
            +    E  PVE+Q
Sbjct  303  KAGCHEGVPVEIQ  315



>gb|KEH41056.1| chlorophyllase [Medicago truncatula]
Length=306

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 181/304 (60%), Positives = 223/304 (73%), Gaps = 5/304 (2%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSH-PPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
             TN+F+ GKYT +L  V     T + PPP+ LLIATP E   G FP+ LFLH YL YNSF
Sbjct  5    VTNVFETGKYTTQLQMVGSGSYTQYVPPPRSLLIATPIEG--GEFPLLLFLHAYLLYNSF  62

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            YSQLIQH+ASHGFIV+APQLY V G D  ++I   A IT+WL EGL+ FLPP++ PN  K
Sbjct  63   YSQLIQHVASHGFIVIAPQLYIVTGPDIYDDIYSVAAITSWLSEGLNKFLPPNITPNFNK  122

Query  446  IALGGHSRGGKVAFGLALGKIART-DLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFD  622
            +ALGGHSRGGK +F +AL K+  T DLK SA++G+DPVDG+ +G QT PP+LTY+P SFD
Sbjct  123  LALGGHSRGGKTSFAIALRKLNITIDLKFSAILGIDPVDGLGEGIQTSPPILTYVPHSFD  182

Query  623  LGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDET  802
              M  +VIGS LG+V++N LFPPCAPKG+NH DF+ EC  P+ YF+AKDYGH DMLDD T
Sbjct  183  FDMPTLVIGSSLGDVRKNLLFPPCAPKGINHEDFFSECEKPSWYFLAKDYGHFDMLDDYT  242

Query  803  GGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
             G RGK TYCLCKNG+ R  MR FVGG +VAFL+ YL GD   L AIR+    + P+ ++
Sbjct  243  PGFRGKLTYCLCKNGESRKPMRTFVGGVMVAFLKAYLYGDNVDLLAIREGKVRV-PIAIK  301

Query  983  TVAF  994
            +  F
Sbjct  302  SDDF  305



>ref|XP_006838958.1| hypothetical protein AMTR_s00002p00270990 [Amborella trichopoda]
 gb|ERN01527.1| hypothetical protein AMTR_s00002p00270990 [Amborella trichopoda]
Length=314

 Score =   355 bits (911),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 214/299 (72%), Gaps = 3/299 (1%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            +F+ G Y V+ + +E        PPKPLLI  P+  ++G +P+FLFLHGYL YNSFYS L
Sbjct  16   VFERGIYAVQTLRIESIPSNPVSPPKPLLITAPT--ASGEYPLFLFLHGYLLYNSFYSHL  73

Query  278  IQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALG  457
            + H+ASHGFIV+APQLY+VAGAD T EI   A I+NW P GL N LP ++ P+  K+A+ 
Sbjct  74   LCHLASHGFIVIAPQLYTVAGADCTAEINSVAAISNWFPTGLPNALPKNLTPDLSKLAIS  133

Query  458  GHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAV  637
            GHSRG K AF LALG    T LK SAL+ +DPVDG   G+Q+ PPVLT+ P S    M V
Sbjct  134  GHSRGAKTAFALALGISTTTTLKYSALLAIDPVDGPAPGQQSTPPVLTHEPNSLVTQMPV  193

Query  638  MVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRG  817
            +V+GSGLG +K+NPLFPPCAP GVNH DF++EC+ PA YFV  DYGH+DMLDD+T G+RG
Sbjct  194  LVVGSGLGHLKKNPLFPPCAPNGVNHADFFRECQPPAWYFVPSDYGHLDMLDDQTDGIRG  253

Query  818  KATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
            +ATYCLCKNG  R  MR FVGG +VAF RGYL+G F  L A+ +     +PV+L+   F
Sbjct  254  RATYCLCKNGATRQPMRRFVGGVMVAFARGYLQGHFGDLRALIE-DPGTSPVKLEVAQF  311



>ref|XP_010441977.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Camelina sativa]
Length=313

 Score =   350 bits (897),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/305 (56%), Positives = 222/305 (73%), Gaps = 8/305 (3%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHK--CTSHP-PPKPLLIATPSEASAGAFPIFLFLHGYLFY  256
            ++ N F+ GKY  +L++++     C + P PPK LL+ATP E   G +P+ + LHGYL Y
Sbjct  5    SSRNAFEDGKYKTDLLTLDSSSRCCKTTPSPPKQLLVATPVEE--GEYPVLMLLHGYLIY  62

Query  257  NSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEG-LHNFLPPHVHP  433
            NSFYSQL+ H++SHGFI++APQLYS+AG D  +EIK TA+I +WL  G L++FLP  V P
Sbjct  63   NSFYSQLMSHVSSHGFILIAPQLYSIAGPDIMDEIKSTAEIIHWLSVGSLNHFLPAQVIP  122

Query  434  NTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIP  610
            N  K AL GHSRGGK AF +AL K    +DLK+S LIG+DPVDG  KG+QTPPPVL Y P
Sbjct  123  NLSKFALSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTWKGQQTPPPVLAYEP  182

Query  611  QSFDLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDM  787
             S DL  + V+VIGSGL E  RN LFPPCAP GVNH +F++EC+ P  +FVA+DYGH+DM
Sbjct  183  NSLDLDKIPVLVIGSGLVETSRNSLFPPCAPPGVNHEEFFRECQSPVWHFVAEDYGHLDM  242

Query  788  LDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIA  967
            LDD+T G+RGK  YCLC NG++R  MR FVGG +V+FL+ YLEGD   L  I+D   +  
Sbjct  243  LDDDTKGIRGKILYCLCMNGEKRRPMRRFVGGILVSFLKAYLEGDDFELVKIKDGCHKGL  302

Query  968  PVELQ  982
            P+++Q
Sbjct  303  PIKIQ  307



>ref|XP_010481814.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Camelina sativa]
Length=313

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 223/307 (73%), Gaps = 8/307 (3%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHK--CTSHP-PPKPLLIATPSEASAGAFPIFLFLHGYLFY  256
            ++ N F+ GKY  +L++++     C + P PPK LL+ATP E   G +P+ + LHGYL Y
Sbjct  5    SSRNGFEDGKYKTDLLTLDSSSRCCKTTPSPPKQLLVATPVEE--GEYPVVMLLHGYLLY  62

Query  257  NSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEG-LHNFLPPHVHP  433
            NSFYSQL+ H++SHGFI++APQLYS+ G D T+EIK TA+I +WL  G L++FLP  V P
Sbjct  63   NSFYSQLMSHVSSHGFILIAPQLYSITGPDITDEIKSTAEIIHWLSVGSLNHFLPAQVIP  122

Query  434  NTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIP  610
            N  K AL GHSRGGK AF +AL K    +DLK+S LIG+DPVDG  KG+QTPPPVL Y P
Sbjct  123  NLSKFALSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTWKGQQTPPPVLAYEP  182

Query  611  QSFDLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDM  787
             S DL  M V+VIGSGL E  RN LFPPCA  GVNH +F++EC+ PA +FVA DYGH+DM
Sbjct  183  NSLDLDKMPVLVIGSGLVETARNSLFPPCAHPGVNHEEFFRECQSPAWHFVAGDYGHLDM  242

Query  788  LDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIA  967
            LDD+T G+RG+  YCLCKNG++R  MR FVGG +V+FL+ YLEGD   L  I+D   +  
Sbjct  243  LDDDTKGIRGRILYCLCKNGEKRRPMRRFVGGILVSFLKAYLEGDDFELVKIKDGCHKGL  302

Query  968  PVELQTV  988
            P+++Q +
Sbjct  303  PIKIQEI  309



>gb|KCW84161.1| hypothetical protein EUGRSUZ_B01023 [Eucalyptus grandis]
Length=267

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/257 (66%), Positives = 199/257 (77%), Gaps = 11/257 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHK---------CTSHPPPKPLLIATPSEASAGAFPIFLFL  238
            TA+++F++GKY  EL  VE             T+  PPKPLLIA P++A  G FP+ +FL
Sbjct  9    TASDVFEIGKYKAELRRVEASATSPAATASCATADRPPKPLLIAFPADAP-GEFPVLVFL  67

Query  239  HGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLP  418
            HGYL YNSFYSQLI+H++SHGF+VVAPQLY+VAG D T+EI   A  TNWLP GL   LP
Sbjct  68   HGYLLYNSFYSQLIRHVSSHGFVVVAPQLYTVAGPDTTDEINSAAATTNWLPRGLAGLLP  127

Query  419  PHVHPNTQKIALGGHSRGGKVAFGLALGKIAR-TDLKLSALIGVDPVDGMDKGKQTPPPV  595
            P V PN  K+A+ GHSRGGK AF LALGK A    L  SAL+G+DPVDGMDKGKQTPPPV
Sbjct  128  PQVRPNLAKLAVAGHSRGGKAAFALALGKSATPLALPFSALLGIDPVDGMDKGKQTPPPV  187

Query  596  LTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYG  775
            LTY P+SFDLGM V+V+GSGLGEV++NPLFP CAP+GVNH DF+ ECR PACYFVA+ YG
Sbjct  188  LTYAPRSFDLGMPVVVVGSGLGEVRKNPLFPACAPRGVNHADFFAECRPPACYFVAEKYG  247

Query  776  HVDMLDDETGGVRGKAT  826
            H+DMLDDET G+RGKAT
Sbjct  248  HLDMLDDETEGLRGKAT  264



>gb|EPS63536.1| hypothetical protein M569_11246, partial [Genlisea aurea]
Length=267

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/266 (65%), Positives = 211/266 (79%), Gaps = 8/266 (3%)
 Frame = +2

Query  167  PPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGAD  346
            PP+PLLI TP+++  G FP+ +FLHG+L YNSFYSQL+ H+ASHGFIVVAPQLYS+AG D
Sbjct  2    PPRPLLIFTPTDS--GFFPVLIFLHGFLLYNSFYSQLLHHVASHGFIVVAPQLYSLAGPD  59

Query  347  ATEEIKCTAQITNWLPEG---LHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIART  517
            AT+E++ TA+IT W+      L  +LPP V P+  ++AL GHSRGGKVAF LAL  ++ +
Sbjct  60   ATQEVRLTAEITEWMSSNQQLLSLYLPPGVKPDMARLALSGHSRGGKVAFALALSSLSSS  119

Query  518  DLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL-GMAVMVIGSGLGEVKRNPLFPPC  694
              K SA+IGVDPVDGMDKG QT PPVLTYIP+SF L G AVM+IG+GLGE +RNPLFP C
Sbjct  120  CPKFSAIIGVDPVDGMDKGSQTSPPVLTYIPKSFQLNGTAVMIIGTGLGEERRNPLFPAC  179

Query  695  APKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAF  874
            AP+GVNH DFY+ECR P+ YFV KDYGH+D+LDDET G+RGKA+YCLCKNG+ R  MR F
Sbjct  180  APRGVNHEDFYKECRKPSYYFVGKDYGHMDVLDDETNGIRGKASYCLCKNGESRGPMRRF  239

Query  875  VGGAVVAFLRGYL--EGDFSSLAAIR  946
            VGG +VAFL+ YL  +GD   L  IR
Sbjct  240  VGGVLVAFLKAYLRSDGDDDELVGIR  265



>ref|XP_010495652.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Camelina sativa]
Length=313

 Score =   345 bits (884),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 172/302 (57%), Positives = 219/302 (73%), Gaps = 8/302 (3%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHK--CTSHP-PPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            N F+ GKY  ++++++     C + P PPK LL+ATP E   G +P+ + LHGYL YNSF
Sbjct  8    NAFEDGKYKTDILTLDSSSRCCKTTPSPPKQLLVATPVEE--GEYPVVMLLHGYLLYNSF  65

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEG-LHNFLPPHVHPNTQ  442
            YSQL+ H++SHGFI++APQLYS+AG D T+EIK TA+I +WL  G L++FLP  V PN  
Sbjct  66   YSQLMSHVSSHGFILIAPQLYSIAGPDITDEIKSTAEIIHWLSVGSLNHFLPAQVIPNLS  125

Query  443  KIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSF  619
            K AL GHSRGGK AF +AL K    +DLK+S LIG+DPVDG  KG+QTPPPVL Y P S 
Sbjct  126  KFALSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTGKGQQTPPPVLAYEPNSL  185

Query  620  DLG-MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDD  796
            DL  M V+VIGSGL E   N LFPPCA  GVNH +F++EC+ PA +FVA+DYGH+DMLDD
Sbjct  186  DLDKMPVLVIGSGLVETAWNSLFPPCAHPGVNHEEFFRECQSPAWHFVAEDYGHLDMLDD  245

Query  797  ETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
             T G+RG   YCLCKNG++R  MR FVGG +V+FL+ YLEGD   L  I+D   +  P++
Sbjct  246  NTKGIRGMIFYCLCKNGEKRRPMRRFVGGILVSFLKAYLEGDDFELVKIKDGCHKGLPIK  305

Query  977  LQ  982
            +Q
Sbjct  306  IQ  307



>ref|XP_010034577.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Eucalyptus grandis]
 gb|KCW84159.1| hypothetical protein EUGRSUZ_B01021 [Eucalyptus grandis]
Length=312

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/305 (56%), Positives = 214/305 (70%), Gaps = 7/305 (2%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKC-TSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            T++F  GKY   L+SV+       +PPPKPLLI +P+E  AG FP+ + LHGY+   SFY
Sbjct  8    TDVFLSGKYKTVLISVDTSSSGLVNPPPKPLLIGSPAEV-AGEFPVMVLLHGYMMETSFY  66

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
            SQLIQH++SHG+I+VAPQLY+ A +D+T++I   A  TNWL +GL   LP  V  N  K+
Sbjct  67   SQLIQHVSSHGYIMVAPQLYTCAASDSTDDINAAAATTNWLSQGLAAVLPSQVSANLAKL  126

Query  449  ALGGHSRGGKVAFGLALGKIAR-TDLKLSALIGVDPVDGMDK---GKQTPPPVLTYIPQS  616
             L GHSRGGK AF LALGK +    L  SAL+G+DPVDG        QT PPVLT + QS
Sbjct  127  VLAGHSRGGKGAFALALGKSSTPLALSFSALLGIDPVDGTASCCCKFQTKPPVLTKVAQS  186

Query  617  FDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDD  796
            FDL M VMV+GSGLGE K+  +FP CAPKG+NH  F++ECR PA +FVAKDYGH+DMLDD
Sbjct  187  FDLNMPVMVVGSGLGEDKKYKVFPACAPKGLNHAAFFEECRSPAWHFVAKDYGHMDMLDD  246

Query  797  ETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
            +T G+RG  +YC+C+NG  R  MR FVGGA VAFLR Y+ GD   L A++D   +IAPV+
Sbjct  247  DTKGIRGVVSYCMCENGSSREPMRRFVGGAAVAFLRAYVGGDDGDLMALQDT-PDIAPVQ  305

Query  977  LQTVA  991
            +   A
Sbjct  306  ITVEA  310



>gb|ACN40275.1| unknown [Picea sitchensis]
Length=329

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/300 (55%), Positives = 216/300 (72%), Gaps = 7/300 (2%)
 Frame = +2

Query  95   NIFDVGKYTVELVSV---EPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            ++F  G++ V ++ +     H  T+   PKPLL+A P  A  G +P+ LF HGYL  NSF
Sbjct  11   DVFKPGRFPVRILKIPQRTTHGSTTAAAPKPLLLALP--AQPGEYPVLLFFHGYLLLNSF  68

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            Y+QL+QHIASHG+I +APQ+Y V GADAT EI   A I NWL +GL ++LP  V P+ Q 
Sbjct  69   YTQLLQHIASHGYIAIAPQMYCVTGADATPEIADAAAICNWLLQGLSSYLPDDVRPDFQN  128

Query  446  IALGGHSRGGKVAFGLALGKIART-DLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFD  622
            +A+ GHSRGGKVAFGLAL + ++T +LK SAL+GVDPVDGM +G+QT P +LTY P SFD
Sbjct  129  VAMAGHSRGGKVAFGLALDRTSQTTELKFSALVGVDPVDGMARGRQTQPRILTYKPHSFD  188

Query  623  LGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDET  802
              +  +++GSGLG VKRNPLFPPCAP+GV+HR+F+ EC  PA +FVA DYGH+D LDDET
Sbjct  189  SVIPTLIVGSGLGAVKRNPLFPPCAPEGVSHREFFSECSAPAYHFVASDYGHMDFLDDET  248

Query  803  GGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            GGV+G+++YCLCKNG  R  MR F GG +VAFL   L+ D  +   +   H   APV+L+
Sbjct  249  GGVKGQSSYCLCKNGVAREPMRRFCGGIIVAFLNVCLQNDSGAFNDLL-VHPSHAPVKLE  307



>ref|XP_008390990.1| PREDICTED: chlorophyllase-2, chloroplastic [Malus domestica]
Length=255

 Score =   335 bits (859),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 181/226 (80%), Gaps = 2/226 (1%)
 Frame = +2

Query  320  QLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLAL  499
            +LY++AG D T+EIK TA ITNWL  GL   LPP+V  N  K+ L GHSRGGKV+F LAL
Sbjct  29   KLYTIAGPDTTDEIKSTAAITNWLSNGLQPLLPPNVQANLSKLGLAGHSRGGKVSFALAL  88

Query  500  GKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRN  676
            GK    T LK SALIG+DPVDGMDKGKQTPPPVLTY P SFDL MAVMVIGSGLGEVK+N
Sbjct  89   GKEEIGTSLKFSALIGIDPVDGMDKGKQTPPPVLTYAPHSFDLDMAVMVIGSGLGEVKKN  148

Query  677  PLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKER  856
            PLFP CAPKGVNH DF+ ECR PACYFVAKDYGH+DMLDDET G+RGKATYCLCKNG+ R
Sbjct  149  PLFPXCAPKGVNHEDFFNECRKPACYFVAKDYGHLDMLDDETKGIRGKATYCLCKNGQSR  208

Query  857  AAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
              MR FVGG VVAF++ YLEGD S L AIR+  E + P+ELQ V F
Sbjct  209  EPMRRFVGGVVVAFIKAYLEGDSSHLLAIREGVETL-PIELQXVKF  253



>ref|XP_008344678.1| PREDICTED: LOW QUALITY PROTEIN: chlorophyllase-2, chloroplastic-like 
[Malus domestica]
Length=245

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 185/247 (75%), Gaps = 12/247 (5%)
 Frame = +2

Query  263  FYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQ  442
            FYSQ+I        ++ + QLY++   D+++EIK TA ITNWL EGLH  LPPHV  N  
Sbjct  6    FYSQVI--------VLCSXQLYTIVXPDSSDEIKSTAAITNWLSEGLHPLLPPHVQANLS  57

Query  443  KIALGGHSRGGKVAFGLALGK---IARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQ  613
            K+AL GHSR GKV+F LALGK        LK SALIG+DPVDGMD GKQTPPPVLTY+ Q
Sbjct  58   KLALVGHSRRGKVSFALALGKGKEETSXSLKFSALIGIDPVDGMDTGKQTPPPVLTYVLQ  117

Query  614  SFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLD  793
            SF L M VMVIGSGLGEVKRNPLFPPCAPKGVNH DF+ ECR  ACYFVA DYGH+DMLD
Sbjct  118  SFHLEMPVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFNECRKLACYFVAXDYGHLDMLD  177

Query  794  DETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPV  973
            D+T G+ GKATYCLCKNGK R  MR FVGG VVAF++ YLEGD S L AIR+  E + P+
Sbjct  178  DDTKGITGKATYCLCKNGKSREPMRRFVGGVVVAFIKAYLEGDSSHLLAIREGVETL-PI  236

Query  974  ELQTVAF  994
            ELQ V  
Sbjct  237  ELQIVKL  243



>ref|XP_003571791.2| PREDICTED: chlorophyllase-2, chloroplastic-like [Brachypodium 
distachyon]
Length=337

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 214/315 (68%), Gaps = 13/315 (4%)
 Frame = +2

Query  86    TATNIFDVGKYTVELVSV-EPHKCTSHP-------PPKPLLIATPSEASAGAFPIFLFLH  241
             +A ++F+ G++   L  V E  +C S P       PPKPLLIA P +A  G +P+ LFLH
Sbjct  23    SAGDVFEHGRHGTSLFKVQEAGRCCSPPADGRANDPPKPLLIAAPCDA--GEYPVVLFLH  80

Query  242   GYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNF-LP  418
             GYL  N FYSQL+QH+ASHGFIV+ PQLY+V+G D T EI   A + NWL +GL +  LP
Sbjct  81    GYLCNNYFYSQLLQHVASHGFIVIGPQLYTVSGPDTTGEINSAAAVINWLADGLSSTALP  140

Query  419   PHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVL  598
             P+V PN   + + GHSRGGKVAF LALG  A+T L L+ALI VDPVDGM  GKQTPPP+L
Sbjct  141   PNVRPNLTAVTISGHSRGGKVAFALALGH-AKTSLPLAALIAVDPVDGMAVGKQTPPPIL  199

Query  599   TYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGH  778
             T    S  +    MVIGSGLG   RN LF PCAP GV+H  FY EC G AC+ VA+DYGH
Sbjct  200   TNKRSSLRVPAPAMVIGSGLGSEPRNALFSPCAPLGVSHAAFYDECAGAACHLVARDYGH  259

Query  779   VDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHE  958
              DM+DD T G +G AT  +CK+G+ RA MR FVGGA+VAFL+ ++EG    L  IR+R  
Sbjct  260   TDMMDDVTRGAKGLATRAVCKSGEARAPMRRFVGGAMVAFLKKWVEGRPEWLDGIRER-P  318

Query  959   EIAPVELQTVAFQEN  1003
             E+APV L  V FQ+ 
Sbjct  319   EVAPVFLSVVEFQDE  333



>gb|AAP44978.1| chlorophyllase [Ginkgo biloba]
Length=342

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/276 (59%), Positives = 203/276 (74%), Gaps = 7/276 (3%)
 Frame = +2

Query  167  PPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGAD  346
            PPKPLLIA PS+   G +P+ LF HGY+  NSFYSQL++H+ASHG+I +APQ+YSV G +
Sbjct  46   PPKPLLIALPSQH--GDYPLILFFHGYVLLNSFYSQLLRHVASHGYIAIAPQMYSVIGPN  103

Query  347  ATEEIKCTAQITNWLPEGLHNFLPP----HVHPNTQKIALGGHSRGGKVAFGLALGKIAR  514
             T EI   A IT+WL +GL + LP     HV PN +K  L GHSRGGKVAF LALG++++
Sbjct  104  TTPEIADAAAITDWLRDGLSDNLPQALNNHVRPNFEKFVLAGHSRGGKVAFALALGRVSQ  163

Query  515  TDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPC  694
              LK SAL+G+DPVDGM K +QT  P+L+Y   SFDLGM  +V+GSGLG  KRNPLFPPC
Sbjct  164  PSLKYSALVGLDPVDGMGKDQQTSHPILSYREHSFDLGMPTLVVGSGLGPCKRNPLFPPC  223

Query  695  APKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAF  874
            AP+GVNH DF+ EC  PA +FVA DYGH+D LDD+T G+RGKATYCLCKNG+ R  MR F
Sbjct  224  APQGVNHHDFFYECVAPAYHFVASDYGHLDFLDDDTKGIRGKATYCLCKNGEAREPMRKF  283

Query  875  VGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
             GG VVAFL+ +L  +  +L  I   +   APV+++
Sbjct  284  SGGIVVAFLQAFLGDNRGALNDIM-VYPSHAPVKIE  318



>ref|XP_010034586.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Eucalyptus grandis]
 gb|KCW84160.1| hypothetical protein EUGRSUZ_B01022 [Eucalyptus grandis]
Length=309

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 209/306 (68%), Gaps = 8/306 (3%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            T +++F  GKY   L+        ++PPPKPLLI +P+E  AG FP+ + LHGYL  NSF
Sbjct  6    TTSDVFLSGKYKTVLIDTSSSG-LANPPPKPLLIGSPAEV-AGEFPVMVLLHGYLMENSF  63

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            YSQLIQHI+SHG+I+VAPQLY  AG D+T++I   A+ TNWL +GL   LPP V  N  K
Sbjct  64   YSQLIQHISSHGYIMVAPQLYKCAGCDSTDDINAAAETTNWLSQGLAAALPPQVSANLAK  123

Query  446  IALGGHSRGGKVAFGLALGK-IARTDLKLSALIGVDPVDGMDK---GKQTPPPVLTYIPQ  613
            + L GHSRGGK AF LALGK      L  SAL+G+DPV+G+       QT PPVLT  PQ
Sbjct  124  LVLAGHSRGGKDAFALALGKSWTPLTLSFSALLGIDPVEGLALCCCKFQTKPPVLTEGPQ  183

Query  614  SFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLD  793
            SFDL M VMV+GSGLGE K+  + P CAPKG+NH  FY++CR PA +FVAKDYGH+DM+D
Sbjct  184  SFDLNMPVMVVGSGLGEDKKYNVLPACAPKGLNHVKFYEKCRSPAWHFVAKDYGHMDMVD  243

Query  794  DETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPV  973
            D T G RG    C C++G  R  MR FVGGA VAFLR YL GD   L A++D   +IAPV
Sbjct  244  DVTNG-RGVVLTCTCESGSSREPMRRFVGGAAVAFLRAYLGGDDRDLMALQDT-PDIAPV  301

Query  974  ELQTVA  991
            ++   A
Sbjct  302  QITVEA  307



>ref|XP_002467217.1| hypothetical protein SORBIDRAFT_01g021520 [Sorghum bicolor]
 gb|EER94215.1| hypothetical protein SORBIDRAFT_01g021520 [Sorghum bicolor]
Length=375

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 212/323 (66%), Gaps = 20/323 (6%)
 Frame = +2

Query  86    TATNIFDVGKYTVELVSVE-----PHKCTSHPP---------PKPLLIATPSEASAGAFP  223
              A  +FD G + V L  ++     P +C   PP         PKPLL+A P EA  G +P
Sbjct  27    NAGGVFDQGGHGVSLTRLDEASRAPSRCAVRPPHPSGAASLPPKPLLVAAPREA--GEYP  84

Query  224   IFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGL  403
             + LFLHGYL  NSFYSQL QH+ASHGFIVV PQLY+++G D TEEI   A + +WL  GL
Sbjct  85    VLLFLHGYLAVNSFYSQLFQHVASHGFIVVGPQLYTISGPDTTEEINAAAAVIDWLATGL  144

Query  404   HNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQ  580
              + LPP V  +  K+++ GHSRGGKVAF LALG+  A+  L L AL+ VDPVDGM  GKQ
Sbjct  145   PSTLPPGVRADLTKVSVSGHSRGGKVAFALALGRAKAKLALPLVALVAVDPVDGMGVGKQ  204

Query  581   TPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECR--GPACY  754
             TPPPVLT    S  +G+  MVIG+GLGE+ R PL PPCAP+GV+H  F+ E     PAC+
Sbjct  205   TPPPVLTGRTTSLHVGVPAMVIGTGLGELPRGPLLPPCAPRGVSHAAFFDELDRAAPACH  264

Query  755   FVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSL  934
              VA+DYGH DM+DD+T G RG  T  +C++G  RA MR FV GA VAFL  ++ GD +++
Sbjct  265   LVARDYGHTDMMDDDTPGARGMLTRTVCRSGGARAPMRRFVAGATVAFLNKWVAGDAAAM  324

Query  935   AAIRDRHEEIAPVELQTVAFQEN  1003
               IR R ++ APV L  V F++ 
Sbjct  325   DGIRTRPDQ-APVALSVVEFRDE  346



>ref|XP_004983205.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Setaria italica]
Length=347

 Score =   323 bits (829),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 213/317 (67%), Gaps = 19/317 (6%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVE-PHKC----------TSHPPPKPLLIATPSEASAGAFPIFLF  235
            A  +FD G++ V LV VE P +C             PPPKPLL+A P EA  G +P+ +F
Sbjct  25   AGGVFDHGRHGVSLVRVEAPSRCGGGTPSSPPGADTPPPKPLLVAAPREA--GEYPVLVF  82

Query  236  LHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPE-GLHNF  412
            LHGYL  NSFYSQL+QH+ASHGFIVVAPQLY+++GADATEEI   A +  WL   GL + 
Sbjct  83   LHGYLVVNSFYSQLLQHVASHGFIVVAPQLYTISGADATEEINAAAAVIGWLAAGGLSSA  142

Query  413  LPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPP  592
            LPP V  +  K+++ GHSRGGKVAF LALG  A+  + L+AL+ VDPVDGM  G+QTPPP
Sbjct  143  LPPGVRADATKVSVSGHSRGGKVAFALALGH-AKLAIPLAALVAVDPVDGMGMGRQTPPP  201

Query  593  VLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQE---CRGPACYFVA  763
            +LT    +  +    MVIG+GLGE+ R PL PPCAP+GV+H  F  E       AC+ VA
Sbjct  202  ILTGRSGALRVSAPAMVIGTGLGELPRGPLLPPCAPRGVSHAAFCDEMDPAAASACHLVA  261

Query  764  KDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAI  943
            +DYGH DM+DD+T G RG  T  +C++G  RA MR FVGGA VAFL+ ++ GD ++L  I
Sbjct  262  RDYGHTDMMDDDTPGARGILTRAICRSGGARAPMRRFVGGATVAFLKRWVGGDGAALDGI  321

Query  944  RDRHEEIAPVELQTVAF  994
            R R E+ APV L  V F
Sbjct  322  RARPEQ-APVALSVVEF  337



>emb|CDJ26436.1| unnamed protein product [Triticum aestivum]
Length=312

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/297 (54%), Positives = 203/297 (68%), Gaps = 11/297 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVE-PHKCTS-------HPPPKPLLIATPSEASAGAFPIFLFLH  241
            +A ++FD G++   L  VE    C +         PPKPLL+A P +A  G +P+ LFLH
Sbjct  3    SAGDVFDHGRHGTSLAKVEQATSCCATSRVDAQQSPPKPLLVAAPCDA--GEYPVVLFLH  60

Query  242  GYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPP  421
            GYL  N FYSQL+QH+ASHGFIV+APQLY+V+G D T EI   A + +WL  GL + L P
Sbjct  61   GYLCNNYFYSQLLQHVASHGFIVIAPQLYTVSGPDTTGEINLAAAVIDWLAAGLSSTLAP  120

Query  422  HVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLT  601
             + PN   +++ GHSRGGKVAF L LG  A+T L L+ALI VDPVDG   G QTPPP+L 
Sbjct  121  GIRPNLTAVSISGHSRGGKVAFALGLGH-AKTSLPLAALIAVDPVDGTGMGNQTPPPILV  179

Query  602  YIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHV  781
            Y P +  +   VMVIG+GLGE+ RN LFPPCAP GV+H +FY EC  PAC+ VA+DYGH 
Sbjct  180  YKPNTLRVPAPVMVIGTGLGELPRNALFPPCAPLGVSHAEFYDECSAPACHLVARDYGHT  239

Query  782  DMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDR  952
            DM+DD T G +G AT  LCK+G  RA MR FV GA+VAFL+ ++EG    L A+R++
Sbjct  240  DMMDDVTTGAKGLATRALCKSGGARAPMRRFVAGAMVAFLKKWVEGKPEWLDAMREQ  296



>dbj|BAJ89583.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 166/318 (52%), Positives = 207/318 (65%), Gaps = 16/318 (5%)
 Frame = +2

Query  86    TATNIFDVGKYTVELVSVEPHKCT------------SHPPPKPLLIATPSEASAGAFPIF  229
             +A ++FD G++   L  VE  K T               PPK LLIA P +A  G +P+ 
Sbjct  3     SAGDVFDHGRHGTSLARVEQAKNTRCSAASRVDAEPQQSPPKALLIAAPCDA--GEYPVV  60

Query  230   LFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHN  409
             +FLHGYL  N FYSQLIQH+ASHGFIVV PQLY+V+G D T EI   A + +WL  GL +
Sbjct  61    VFLHGYLCNNYFYSQLIQHVASHGFIVVCPQLYTVSGPDTTGEINSAAAVIDWLAAGLSS  120

Query  410   FLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPP  589
              L P + PN   +++ GHSRGGKVAF L LG  A+T L L+ALI VDPVDG   G QTPP
Sbjct  121   KLAPGIRPNLAAVSISGHSRGGKVAFALGLGH-AKTSLPLAALIAVDPVDGTGMGNQTPP  179

Query  590   PVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKD  769
             P+L Y P +  +   VMVIG+GLGE+ RN LFPPCAP GV+H  FY EC  PAC+ VA+D
Sbjct  180   PILAYKPNAIRVPAPVMVIGTGLGELPRNALFPPCAPLGVSHAAFYDECAAPACHLVARD  239

Query  770   YGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRD  949
             YGH DM+DD T G +G AT  LCK+G  RA MR FV GA+VAFL  +++G    L A+R+
Sbjct  240   YGHTDMMDDVTTGAKGLATRALCKSGGARAPMRRFVAGAMVAFLNKWVQGKPEWLDAVRE  299

Query  950   RHEEIAPVELQTVAFQEN  1003
             +    APV L  V F++ 
Sbjct  300   Q-TVAAPVVLSAVEFRDE  316



>ref|XP_009123919.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X2 [Brassica 
rapa]
Length=315

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/267 (59%), Positives = 192/267 (72%), Gaps = 26/267 (10%)
 Frame = +2

Query  185  IATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIK  364
            +ATP E   G +P+ + LHGYL YNSFYSQL+ H++S+GFIV+APQLY++AG D  +EIK
Sbjct  68   VATPVEE--GEYPVVMLLHGYLLYNSFYSQLMLHVSSYGFIVIAPQLYNIAGPDTMDEIK  125

Query  365  CTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALI  541
             TA+I +WL  GL++FLPP V PN  K AL GHSRGGK AF +AL K    ++LK+SALI
Sbjct  126  STAEIIDWLSVGLNHFLPPQVTPNLSKFALTGHSRGGKTAFAVALKKFGYSSELKISALI  185

Query  542  GVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRD  721
            GVDPVDG  K                       VIGSGLGE+ RNPLFPPCAP GVNHR+
Sbjct  186  GVDPVDGTGK-----------------------VIGSGLGELARNPLFPPCAPTGVNHRE  222

Query  722  FYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFL  901
            F+QEC+GPA +FVAKDYGH+DMLDD+T G+RGK++YCLCKNG+ER  MR F+GG VV+FL
Sbjct  223  FFQECQGPAWHFVAKDYGHLDMLDDDTKGLRGKSSYCLCKNGEERKPMRRFIGGIVVSFL  282

Query  902  RGYLEGDFSSLAAIRDRHEEIAPVELQ  982
              YLE D   L  I+D   E  PVE+Q
Sbjct  283  MAYLEDDDCELMKIKDGCHEGVPVEIQ  309



>ref|NP_001064620.1| Os10g0419600 [Oryza sativa Japonica Group]
 gb|AAP53795.2| Chlorophyllase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26534.1| Os10g0419600 [Oryza sativa Japonica Group]
Length=367

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 167/338 (49%), Positives = 214/338 (63%), Gaps = 31/338 (9%)
 Frame = +2

Query  92    TNIFDVGKYTVELVSVE--PHKCTSHP---------------PPKPLLIATPSEASAGAF  220
             + +FD G + V LV V+  P KC+S                 PPKPLL+A P +A  G +
Sbjct  34    SGVFDHGSHGVTLVKVDEAPRKCSSAAAAKKTDDDTAPAGGAPPKPLLVAAPCDA--GVY  91

Query  221   PIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEG  400
             P+ +FLHGYL YNSFYSQL +H+ASHGF+VV PQLY+++G D T+EI   A + NWL  G
Sbjct  92    PVVVFLHGYLAYNSFYSQLFEHVASHGFVVVGPQLYTMSGPDTTDEINSAAAVINWLAAG  151

Query  401   -LHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSA-------LIGVDPV  556
              L + LPP+V  +  KI++ GHSRGGKVAF LALG  A   L+  A       L+ VDPV
Sbjct  152   GLTSKLPPNVRADATKISISGHSRGGKVAFALALGH-ANVSLRGGAGGATIAALVAVDPV  210

Query  557   DGMDKGKQTPPPVLTYI-PQSFDLGMAVMVIGSGLGEVKRN-PLFPPCAPKGVNHRDFYQ  730
             DG   GKQTPPP+LTY    S  +   VMVIG+GLG + R  PL P CAP GV+H +FY 
Sbjct  211   DGFAAGKQTPPPILTYGGANSLRVPAPVMVIGTGLGGLARAAPLLPACAPPGVSHGEFYG  270

Query  731   ECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGY  910
             EC  PAC+ VA+DYGH DM+DD T G RG AT  +C++G  RA MR F GGA+VAF++ +
Sbjct  271   ECAAPACHLVARDYGHTDMMDDVTPGARGLATRAVCRSGGARAPMRRFFGGAMVAFVKRW  330

Query  911   LEGDFSSLAAIRDRHEEIAPVELQTVAFQEN*TTKHIW  1024
             +EG+   L  +R R  E APV L  V F++     H +
Sbjct  331   VEGEPELLDCVRAR-PETAPVVLSAVEFRDEAIANHSY  367



>ref|XP_002271974.1| PREDICTED: chlorophyllase-1 [Vitis vinifera]
Length=319

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 199/306 (65%), Gaps = 7/306 (2%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            T T++F+ G  +V  + VE     S  PPKPLLI TP+    G +P+ LFLHG+   N+F
Sbjct  19   TTTSVFEPGNLSVSCIRVETSNIAS--PPKPLLIVTPT--IQGTYPVLLFLHGFELRNTF  74

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            Y+QL+Q I+SHGFIVVAPQLY +      +EIK  A +TNWL  GL + LP +V P+  K
Sbjct  75   YTQLLQLISSHGFIVVAPQLYGLLPPSGIQEIKSAAAVTNWLSSGLQSVLPENVKPDLLK  134

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            +AL GHSRGGK AF LALG  A T L  SAL+G+DPV G+ K  QT P +LTY+P SF+L
Sbjct  135  LALSGHSRGGKTAFALALG-YADTSLNFSALLGLDPVGGLSKCCQTVPKILTYVPHSFNL  193

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETG  805
             + V VIG+GLG+  RN L  PCAP GVNH +F+ EC+ P  +FV  +YGH+DMLDD   
Sbjct  194  AIPVCVIGTGLGDEPRNCLTCPCAPDGVNHVEFFSECKPPCSHFVTTEYGHLDMLDDHLS  253

Query  806  GVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G  G  +  +CK+GK  R  MR  VGG  VAFL+ YLEG      AI D   ++APV+L 
Sbjct  254  GCIGAISGYICKSGKGPRDPMRRCVGGLFVAFLKAYLEGQSGDFKAIVDE-PDLAPVKLD  312

Query  983  TVAFQE  1000
             V F E
Sbjct  313  PVEFIE  318



>ref|XP_002273926.1| PREDICTED: chlorophyllase-1 [Vitis vinifera]
Length=319

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 199/306 (65%), Gaps = 7/306 (2%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            T T++F+ G  +V  + VE     S  PPKPLLI TP+    G +P+ LFLHG+   N+F
Sbjct  19   TTTSVFEPGNLSVTCIRVETSNIAS--PPKPLLIVTPT--IQGTYPVLLFLHGFELRNTF  74

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            Y+QL+Q I+SHG+IVVAPQLY +      +EIK  A +TNWL  GL + LP +V P+  K
Sbjct  75   YTQLLQLISSHGYIVVAPQLYGLLPPSGIQEIKSAAAVTNWLSSGLQSVLPENVKPDLLK  134

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            +AL GHSRGGK AF LALG  A T L  SAL+G+DPV G+ K  QT P +LTY+P SF+L
Sbjct  135  LALSGHSRGGKTAFALALG-YADTSLNFSALLGLDPVGGLSKCSQTVPKILTYVPHSFNL  193

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETG  805
             + V VIG+GLG+  RN L  PCAP GVNH +F+ EC+ P  +FV  +YGH+DMLDD   
Sbjct  194  AIPVCVIGTGLGDEPRNCLTCPCAPDGVNHVEFFSECKPPCSHFVTTEYGHLDMLDDHLS  253

Query  806  GVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G  G  +  +CK+GK  R  MR  VGG  VAFL+ YLEG      AI D   ++APV+L 
Sbjct  254  GCIGAISGYICKSGKGPRDPMRRCVGGLFVAFLKAYLEGQTGDFKAIVDE-PDLAPVKLD  312

Query  983  TVAFQE  1000
             V F E
Sbjct  313  PVEFIE  318



>gb|ACG44273.1| chlorophyllase-2 [Zea mays]
Length=346

 Score =   295 bits (755),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 208/320 (65%), Gaps = 18/320 (6%)
 Frame = +2

Query  89    ATNIFDVGKYTVELVSVE----PHKCTSHPPP--------KPLLIATPSEASAGAFPIFL  232
             A  +FD G ++V L  ++    P +C              KPLL+A P E   G +P+ L
Sbjct  26    AGGVFDQGGHSVSLTRLDEARAPPRCAVQSSLSSAASLPPKPLLVAAPRET--GEYPVIL  83

Query  233   FLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNF  412
             FLHGYL  NSFYSQL +H+ASHGFIVV PQLY+++GAD TEEI   A + +WL  GL + 
Sbjct  84    FLHGYLAVNSFYSQLFEHVASHGFIVVGPQLYTISGADTTEEINSAAAVIDWLATGLPST  143

Query  413   LPPHVHPNTQKIALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPP  589
             LP  V  +  K+++ GHSRGGKVAF LALG   A+  + L+A++ VDPVDGM  GKQTPP
Sbjct  144   LPLGVRADLTKVSISGHSRGGKVAFALALGHAKAKLAVPLAAVVAVDPVDGMGVGKQTPP  203

Query  590   PVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRG--PACYFVA  763
             P+LT    S  +G   MVIG+GLGE+ R  L PPCAP+GV+H  FY E  G  PAC+ VA
Sbjct  204   PILTGRHGSLHVGAPTMVIGTGLGELPRGSLLPPCAPRGVSHAAFYDELDGAAPACHLVA  263

Query  764   KDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAI  943
             +DYGH DM+DD+T G RG  T  +C++G  RA MR FV GA VAFL+ ++ GD +++ +I
Sbjct  264   RDYGHTDMMDDDTPGARGMLTRTICRSGGARAPMRRFVAGATVAFLKKWVAGDAAAMDSI  323

Query  944   RDRHEEIAPVELQTVAFQEN  1003
               R ++ AP+ L  V F + 
Sbjct  324   TARPDQ-APIALSVVEFGDE  342



>ref|NP_001130783.1| chlorophyllase-2 [Zea mays]
 gb|ACF79135.1| unknown [Zea mays]
 tpg|DAA49920.1| TPA: chlorophyllase-2 [Zea mays]
Length=346

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 207/318 (65%), Gaps = 18/318 (6%)
 Frame = +2

Query  95    NIFDVGKYTVELVSVE----PHKCTSHPPP--------KPLLIATPSEASAGAFPIFLFL  238
              +FD G ++V L  ++    P +C     P        KPLL+A P E   G +P+ LFL
Sbjct  28    GVFDQGGHSVSLTRLDEARAPPRCAVRSSPSSAASLPPKPLLVAAPRET--GEYPVILFL  85

Query  239   HGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLP  418
             HGYL  NSFYSQL +H+ASHGFIVV PQLY+++GAD TEEI   A + +WL  GL + LP
Sbjct  86    HGYLAVNSFYSQLFEHVASHGFIVVGPQLYTISGADTTEEINSAAAVIDWLATGLPSTLP  145

Query  419   PHVHPNTQKIALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPPPV  595
               V  N  K+++ GHSRGGKVAF LALG   A+  + L+A++ VDPVDGM  GKQTPPP+
Sbjct  146   LGVRANLTKVSISGHSRGGKVAFALALGHAKAKLAVPLAAVVAVDPVDGMGVGKQTPPPI  205

Query  596   LTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRG--PACYFVAKD  769
             LT    S  +G   MVIG+GLGE+ R  L PPCAP+GV+H  FY E  G  PAC+ V +D
Sbjct  206   LTGRHGSLHVGAPAMVIGTGLGELPRGSLLPPCAPRGVSHAAFYDELDGAAPACHLVVRD  265

Query  770   YGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRD  949
             YGH DM+DD+T G RG  T  +C++G  RA MR FV GA VAFL+ ++ GD +++ +I  
Sbjct  266   YGHTDMMDDDTPGARGMLTRTICRSGGARAPMRRFVAGATVAFLKKWVAGDAAAMDSITA  325

Query  950   RHEEIAPVELQTVAFQEN  1003
             R ++ APV L  V F + 
Sbjct  326   RPDQ-APVALSVVEFGDE  342



>ref|XP_009795214.1| PREDICTED: LOW QUALITY PROTEIN: chlorophyllase-2, chloroplastic-like 
[Nicotiana sylvestris]
Length=202

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 157/197 (80%), Gaps = 3/197 (2%)
 Frame = +2

Query  410  FLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIAR--TDLKLSALIGVDPVDGMDKGKQT  583
            +LP  V PN +K+ L GHSRGGKVAF LALGKIA   T+LK SALIGVD VDGMDKGKQT
Sbjct  5    YLPSDVEPNLKKLGLAGHSRGGKVAFALALGKIANISTNLKFSALIGVDLVDGMDKGKQT  64

Query  584  PPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVA  763
            PP VLTY P SF+L MAVMVIGSGLGEVK+NPLFP CAP GVNHR+FY+EC  PACYFVA
Sbjct  65   PPSVLTYTPYSFNLDMAVMVIGSGLGEVKKNPLFPACAPNGVNHRNFYRECCKPACYFVA  124

Query  764  KDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAI  943
            KDYGH DMLDDET G+RGKATYCLCK GK R  MR FVGG +VAFL  YLEG  S L AI
Sbjct  125  KDYGHNDMLDDETKGIRGKATYCLCKKGKSREPMRRFVGGVLVAFLEAYLEGKSSELMAI  184

Query  944  RDRHEEIAPVELQTVAF  994
            RD +  + PVELQ + F
Sbjct  185  RDGNVTL-PVELQDIDF  200



>gb|ABR16879.1| unknown [Picea sitchensis]
Length=314

 Score =   291 bits (746),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/296 (50%), Positives = 200/296 (68%), Gaps = 10/296 (3%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            +F  G++ VE+     H  T+ PPPKPLL+A P+++  G +PI L  HG++  NS Y+Q+
Sbjct  12   VFKPGRFPVEIRDTRNHGSTTAPPPKPLLLAFPNQS--GDYPIVLCFHGFMIPNSSYTQI  69

Query  278  IQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALG  457
            + HIASHG+I +APQ+Y + G ++  EI   A I NWLPEGL  +LP  V P+ + +A+ 
Sbjct  70   LHHIASHGYITIAPQMYCITGENSKPEIDDAAAILNWLPEGLSYYLPSEVRPDLEYVAVA  129

Query  458  GHSRGGKVAFGLALGKIA-RTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            GHSRGGKVAFGLALG  + +T +K+SAL+G+DPVDG  +G QT PP+LTY P SFDL + 
Sbjct  130  GHSRGGKVAFGLALGLASEKTKVKMSALVGIDPVDGRGRGHQTEPPILTYKPHSFDLHIP  189

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
             +VIGSGLGE K N L PPCAP GV+HR+F+ EC  P+ +FVA ++GH+D L+D+TG + 
Sbjct  190  TLVIGSGLGE-KWNLLVPPCAPDGVSHREFFSECSVPSYHFVASEFGHMDFLNDDTGPLT  248

Query  815  GKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
                   CKNG  R  MR F GG +VAFL   L  D  +L  +   H E APV L+
Sbjct  249  -----FFCKNGVAREPMRRFSGGIMVAFLHACLRNDSEALNHLL-LHPEDAPVTLE  298



>ref|XP_010096444.1| hypothetical protein L484_002352 [Morus notabilis]
 gb|EXB64219.1| hypothetical protein L484_002352 [Morus notabilis]
Length=320

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 154/304 (51%), Positives = 202/304 (66%), Gaps = 6/304 (2%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            T+T++F  G +  E+++V+    +S PP   LLIATP+  + G++P+ LF HG+   N F
Sbjct  19   TSTSVFSKGSFPFEVINVDTSSRSSPPPKP-LLIATPT--NKGSYPVILFFHGFYLRNYF  75

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            Y++L+QHI+SHGFI+VAPQLY +     TEEI+  A +TNWL +GL   LP +V P+  K
Sbjct  76   YTELLQHISSHGFILVAPQLYDLIPPSGTEEIESAANVTNWLEQGLQPLLPGNVSPDLTK  135

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            + L GHSRGGK AF LALG  A+T L  SAL+G+DPV G  K   T P +LTY+P SF+ 
Sbjct  136  LTLSGHSRGGKAAFALALG-YAKTSLNFSALLGIDPVAGTGKCCPTEPHILTYVPHSFNF  194

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETG  805
             + V VIG+GLG  K  PL PPCAP+GVNH +FY EC+ P  +FVAK+YGH+DMLDD   
Sbjct  195  SIPVAVIGTGLGPEKWIPLAPPCAPEGVNHDEFYNECKPPCAHFVAKEYGHMDMLDDNLP  254

Query  806  GVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G+ GK + C+CKNG   +  MR  VGG  VAFLR YLE D   L A+      +AP +L 
Sbjct  255  GIIGKLSECICKNGSGPKDKMRRSVGGIAVAFLRAYLESDDEDLKAVV-ADPSLAPAKLD  313

Query  983  TVAF  994
             V F
Sbjct  314  PVEF  317



>ref|XP_004956217.1| PREDICTED: chlorophyllase-1-like [Setaria italica]
Length=315

 Score =   281 bits (719),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 191/287 (67%), Gaps = 11/287 (4%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            AT++F  GK  +E++ V+ H  T+  PP P+LIA+P +A  G +P+ + LHG+   N FY
Sbjct  19   ATSVFQPGKLAIEVIPVD-HD-TNPTPPIPILIASPKDA--GTYPVAMLLHGFCLQNHFY  74

Query  269  SQLIQHIASHGFIVVAPQLY-SVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
             Q+++HIAS GFI+VAPQ + S+     TE+I   A++T+WL +GL + LP  V PN  K
Sbjct  75   KQVLKHIASFGFIMVAPQFHISILAKGDTEDIAAAAEVTDWLAKGLPSILPKGVEPNLSK  134

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            +AL GHSRGG  AF L LG   +T+LK SALIG+DPV G  K  Q  P +LTY P SFD+
Sbjct  135  LALAGHSRGGHTAFSLVLGH-GKTNLKFSALIGLDPVAGTGKSSQISPKILTYEPSSFDI  193

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETG  805
             M V+VIG+GLGE K+N LFPPCAPK VNHR+FY ECR P  YFV KDYGH+DMLDD+  
Sbjct  194  AMPVLVIGTGLGEEKKNILFPPCAPKDVNHREFYHECRPPCYYFVTKDYGHLDMLDDDA-  252

Query  806  GVRGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAI  943
                K   C+CK+GK  +  MR  V G +VAFL+  L  +   L  I
Sbjct  253  ---PKFMTCMCKDGKNCKDLMRRTVAGIMVAFLKAVLNEEDGDLRVI  296



>ref|XP_007200272.1| hypothetical protein PRUPE_ppa014909mg [Prunus persica]
 gb|EMJ01471.1| hypothetical protein PRUPE_ppa014909mg [Prunus persica]
Length=323

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 150/311 (48%), Positives = 201/311 (65%), Gaps = 13/311 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTS----HPPPKPLLIATPSEASAGAFPIFLFLHGYLF  253
             AT++FD G +  + ++ E   C+S      PPKPLLI TP+    G +P+ + LHG+  
Sbjct  15   VATSVFDKGNFPFKCIT-EETPCSSCFDSSAPPKPLLIVTPT--VTGTYPVIVLLHGFYL  71

Query  254  YNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHP  433
             N FY  ++QHIASHG+I VAPQLY    +   EEI   A++ NWL +GL + LP +V P
Sbjct  72   RNYFYQDILQHIASHGYIAVAPQLYGYVPSTGPEEIDSGAKVINWLAKGLQSLLPENVVP  131

Query  434  NTQKIALGGHSRGGKVAFGLALGKIART--DLKLSALIGVDPVDGMDKGKQTPPPVLTYI  607
            +  K AL GHSRGGK AF LALG  A+T   LK S LIG+DPV G ++  +T P +LTY 
Sbjct  132  DFTKFALSGHSRGGKAAFALALGH-AKTALSLKFSVLIGIDPVAGANQHCRTRPHILTYE  190

Query  608  PQSFDLGMAVMVIGSGLGEVKRNP-LFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVD  784
            PQSF+L + V VIG+GLG  K+N  +  PCAP GVNH++F+ EC+ P  +FV KDYGH+D
Sbjct  191  PQSFNLSIPVTVIGTGLGPEKKNACMSQPCAPNGVNHKEFFHECKPPCAHFVVKDYGHMD  250

Query  785  MLDDETGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEE  961
            MLDD+  G+ G  + C+CKNG   +  MR  VGG VVAFL+ YL G+   L AI +    
Sbjct  251  MLDDDPPGLVGALSGCMCKNGTGPKELMRKTVGGIVVAFLKAYLNGEDEDLVAIVED-PA  309

Query  962  IAPVELQTVAF  994
            ++P +L+ V F
Sbjct  310  VSPAKLEPVEF  320



>ref|XP_008235366.1| PREDICTED: chlorophyllase-1 [Prunus mume]
Length=319

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 203/321 (63%), Gaps = 13/321 (4%)
 Frame = +2

Query  56   MAVTFsssssTATNIFDVGKYTVELVSVEPHKCTS----HPPPKPLLIATPSEASAGAFP  223
            MA+  +S  S  T++FD G +  + V+ E   C+S      PPKPLLI TP+    G +P
Sbjct  1    MALVSASQPSLPTSVFDKGNFPFKCVT-EETPCSSCFDSSAPPKPLLIVTPT--VTGTYP  57

Query  224  IFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGL  403
            + + LHG+   N FY  L+QHIASHGFI VAPQLY    +   EEI   A++ NWL +GL
Sbjct  58   VIVLLHGFYLRNYFYQDLLQHIASHGFIAVAPQLYGYVPSTGPEEIDSGAKVINWLAKGL  117

Query  404  HNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIART--DLKLSALIGVDPVDGMDKGK  577
             + LP +V P+  K AL GHSRGGK AF LALG  A+T   LK S LIG+DPV G ++  
Sbjct  118  QSLLPENVVPDFTKFALSGHSRGGKAAFALALGH-AKTALSLKFSVLIGIDPVAGANQHC  176

Query  578  QTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFP-PCAPKGVNHRDFYQECRGPACY  754
               P +LTY PQSF+L + V VIG+GLG  K+N     PCAP GVNH++F+ EC+ P  +
Sbjct  177  TIRPHILTYEPQSFNLSIPVTVIGTGLGPEKKNACISQPCAPNGVNHKEFFYECKPPCAH  236

Query  755  FVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSS  931
            FV KDYGH+DMLDD+  G+ G  + C+CKNG   +  MR  VGG VVAFL+ YL G+   
Sbjct  237  FVVKDYGHMDMLDDDPPGLVGALSGCMCKNGTGPKELMRKTVGGIVVAFLKAYLNGEDED  296

Query  932  LAAIRDRHEEIAPVELQTVAF  994
            L AI +    ++P +L+ V F
Sbjct  297  LVAIVED-PAVSPAKLEPVEF  316



>ref|XP_004290630.1| PREDICTED: chlorophyllase-1-like [Fragaria vesca subsp. vesca]
Length=308

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 150/306 (49%), Positives = 197/306 (64%), Gaps = 9/306 (3%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEP--HKC-TSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            ++FD GK   + ++ E     C  S  PPKPLLIATP+    G +P+ L LHG+   N F
Sbjct  3    SVFDEGKLPFKFITEETPFSSCFDSSAPPKPLLIATPT--VNGTYPVLLLLHGFYLRNYF  60

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            Y  ++QHIASHGFI V PQLYS+  +   EEI+ TA++ NWLP+GL + LP +V  +  K
Sbjct  61   YKGILQHIASHGFIAVGPQLYSLVPSTGPEEIESTAKVVNWLPQGLQSLLPENVVADLTK  120

Query  446  IALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFD  622
            +AL GHSRGGK AF LALG   A   L  S LIG+DPV G ++  +T P +LTY+P SFD
Sbjct  121  VALSGHSRGGKAAFALALGHAKASLSLDFSVLIGIDPVAGANQYCRTNPHILTYVPCSFD  180

Query  623  LGMAVMVIGSGLGEVKRNP-LFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE  799
            L + + VIG+GLG  K+N  +  PCA  GVNH++F+ E + P  +FVAKDYGH+DMLDD+
Sbjct  181  LNIPIAVIGTGLGPEKKNDCMSQPCASDGVNHKEFFNESKPPCAHFVAKDYGHMDMLDDD  240

Query  800  TGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
              G+ G  + CLCKNG   +  MR  VGG VVAFL+ YL G+   L AI      ++P +
Sbjct  241  PPGLVGALSGCLCKNGSGPKDLMRKSVGGIVVAFLKAYLNGEDGDLLAIV-ADPGLSPAK  299

Query  977  LQTVAF  994
            L  V F
Sbjct  300  LDPVKF  305



>ref|XP_010934773.1| PREDICTED: chlorophyllase-1-like [Elaeis guineensis]
Length=307

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 151/308 (49%), Positives = 197/308 (64%), Gaps = 18/308 (6%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            TA ++FD GK  V+ + V+    +S  PPK +L+ +P    AG + + LF+ GYL  N++
Sbjct  12   TAVSVFDYGKLYVDTIPVKQGDESS--PPKDILVVSPK--VAGTYTVVLFIQGYLLSNTY  67

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            Y+QL+QH+ASHGFIVVAPQ   V    + E+I   A +TNWLP GL + LP  V PN  K
Sbjct  68   YTQLLQHVASHGFIVVAPQSI-VLSPYSEEDITSAAAVTNWLPAGLQSVLPTGVEPNLDK  126

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            +AL GHSRGG  AF LALG  A T LK S L+G+DPV G  K  Q PP +LTY P SF+L
Sbjct  127  LALAGHSRGGHAAFSLALGH-AETKLKFSLLMGIDPVAGPSKCCQIPPKILTYKPSSFEL  185

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETG  805
             + V+V+G+GLG  ++N LFPPCAP GVNH++FY EC+ P  + V  DYGH+DML+D   
Sbjct  186  EIPVLVMGTGLGSEQKNILFPPCAPDGVNHKEFYNECKPPCYHIVVTDYGHLDMLND---  242

Query  806  GVRGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGY---LEGDFSSLAAIRDRHEEIAPV  973
                K T C+CKNG   R  MR   GG + AFL+ Y   LEGD   L AI D   + AP 
Sbjct  243  -TAPKITKCVCKNGTNCREIMRKTTGGIMTAFLKAYLLDLEGD---LKAIVD-DPQFAPT  297

Query  974  ELQTVAFQ  997
            +L  V+++
Sbjct  298  KLYPVSYR  305



>ref|XP_003528958.1| PREDICTED: chlorophyllase-1 [Glycine max]
 dbj|BAF43704.1| Chlorophyllase 2 [Glycine max]
 gb|KHN44571.1| Chlorophyllase-1 [Glycine soja]
Length=316

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/308 (49%), Positives = 197/308 (64%), Gaps = 11/308 (4%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
             T++F  G    +  +VE    +S PP KPLLI TP+    G +P+ LF HG+    S+Y
Sbjct  11   TTDVFQKGDIHWKQFNVETSTASSSPP-KPLLIFTPT--VPGLYPVILFCHGFCIRTSYY  67

Query  269  SQLIQHIASHGFIVVAPQLYSV-AGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            S+L+ HI SHGFI+VAPQL+S+       EE+KC  ++ +WL  GL   LP  V    +K
Sbjct  68   SKLLAHIVSHGFILVAPQLFSIGVPMFGPEEVKCEGRVVDWLDNGLQPLLPESVEAKLEK  127

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGK--QTPPPVLTYIPQSF  619
            + L GHS+GGK AF +ALG   +T LK SALIG+DPV G+ K K  ++ P +LT +P+SF
Sbjct  128  LVLVGHSKGGKTAFAVALG-YCKTKLKFSALIGIDPVAGVSKCKPCRSLPDILTGVPRSF  186

Query  620  DLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE  799
            +L + V VIG+GLG  K N LFPPCAP GVNH++F+ EC+ P+ YFVA DYGH+DMLDDE
Sbjct  187  NLNIPVAVIGTGLGPEKANSLFPPCAPNGVNHKEFFSECKPPSAYFVATDYGHMDMLDDE  246

Query  800  TGGVRGK-ATYCLCKNGKE--RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAP  970
            T GV G   + C+CKNGK+  R  MR  VGG VVAFLR  L   +    AI      +AP
Sbjct  247  TPGVIGTMMSKCMCKNGKKGPRDLMRRTVGGLVVAFLRAQLNEQWKDFDAIL-ASPNLAP  305

Query  971  VELQTVAF  994
             +L  V +
Sbjct  306  AKLDDVRY  313



>gb|EMS51443.1| Chlorophyllase-2, chloroplastic [Triticum urartu]
Length=270

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 188/313 (60%), Gaps = 52/313 (17%)
 Frame = +2

Query  86    TATNIFDVGKYTVELVSV-EPHKCT------SHPPPKPLLIATPSEASAGAFPIFLFLHG  244
             +A ++FD G++   L  V +  +C       +  PPKPLL+A P +A  G +P+ LFLHG
Sbjct  3     SAGDVFDHGRHGTSLTKVAQATRCCPTSPVDAQSPPKPLLVAAPCDA--GEYPVLLFLHG  60

Query  245   YLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPH  424
             YL  N FYSQL+QH+ASHGFIVV PQ                                  
Sbjct  61    YLCNNYFYSQLLQHVASHGFIVVGPQ----------------------------------  86

Query  425   VHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTY  604
                    +++ GHSRGGKVAF LALG  A+T L L+ALI VDPVDG   G QTPPP+L Y
Sbjct  87    -------VSISGHSRGGKVAFALALGH-AKTPLPLAALIAVDPVDGTGMGDQTPPPILVY  138

Query  605   IPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVD  784
              P +  +   VMVIG+GLGE+ RN LFPPCAP GV+H +FY EC  PAC+ VA+DYGH D
Sbjct  139   KPNALRVPAPVMVIGTGLGELPRNALFPPCAPLGVSHAEFYDECSAPACHLVARDYGHTD  198

Query  785   MLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
             M+DD T G +G AT  LCK+G  RA MR FV G +VAFL  ++EG    L A+R+R  ++
Sbjct  199   MMDDVTTGAKGLATRALCKSGGARAPMRRFVAGGMVAFLNKWVEGKPEWLDAMRER-TDV  257

Query  965   APVELQTVAFQEN  1003
              PV L  V F++ 
Sbjct  258   TPVVLSVVEFRDE  270



>gb|ACU24105.1| unknown [Glycine max]
Length=316

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 150/308 (49%), Positives = 196/308 (64%), Gaps = 11/308 (4%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
             T++F  G    +  +VE    +S PP KPLLI TP+    G +P+ LF HG+    S+Y
Sbjct  11   TTDVFQKGDIHWKQFNVETSTASSSPP-KPLLIFTPT--VPGLYPVILFCHGFCIRTSYY  67

Query  269  SQLIQHIASHGFIVVAPQLYSV-AGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            S+L+ HI SHGFI+VAPQL+S+       EE+KC  ++ +WL  GL   LP  V    +K
Sbjct  68   SKLLAHIVSHGFILVAPQLFSIGVPMFGPEEVKCEGRVVDWLDNGLQPLLPESVEAKLEK  127

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGK--QTPPPVLTYIPQSF  619
            + L GHS+GGK AF +ALG   +T LK SALIG+DPV G+ K K  ++ P +LT +P+SF
Sbjct  128  LVLVGHSKGGKTAFAVALG-YCKTKLKFSALIGIDPVAGVSKCKPCRSLPDILTGVPRSF  186

Query  620  DLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE  799
            +L + V VIG+GLG  K N LFPPCAP GVNH++F  EC+ P+ YFVA DYGH+DMLDDE
Sbjct  187  NLNIPVAVIGTGLGPEKANSLFPPCAPNGVNHKEFSSECKPPSAYFVATDYGHMDMLDDE  246

Query  800  TGGVRGK-ATYCLCKNGKE--RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAP  970
            T GV G   + C+CKNGK+  R  MR  VGG VVAFLR  L   +    AI      +AP
Sbjct  247  TPGVIGTMMSKCMCKNGKKGPRDLMRRTVGGLVVAFLRAQLNEQWKDFDAIL-ASPNLAP  305

Query  971  VELQTVAF  994
             +L  V +
Sbjct  306  AKLDDVRY  313



>emb|CBI28741.3| unnamed protein product [Vitis vinifera]
Length=881

 Score =   288 bits (736),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 193/296 (65%), Gaps = 7/296 (2%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            T T++F+ G  +V  + VE     S  PPKPLLI TP+    G +P+ LFLHG+   N+F
Sbjct  271  TTTSVFEPGNLSVTCIRVETSNIAS--PPKPLLIVTPT--IQGTYPVLLFLHGFELRNTF  326

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            Y+QL+Q I+SHG+IVVAPQLY +      +EIK  A +TNWL  GL + LP +V P+  K
Sbjct  327  YTQLLQLISSHGYIVVAPQLYGLLPPSGIQEIKSAAAVTNWLSSGLQSVLPENVKPDLLK  386

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            +AL GHSRGGK AF LALG  A T L  SAL+G+DPV G+ K  QT P +LTY+P SF+L
Sbjct  387  LALSGHSRGGKTAFALALG-YADTSLNFSALLGLDPVGGLSKCSQTVPKILTYVPHSFNL  445

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETG  805
             + V VIG+GLG+  RN L  PCAP GVNH +F+ EC+ P  +FV  +YGH+DMLDD   
Sbjct  446  AIPVCVIGTGLGDEPRNCLTCPCAPDGVNHVEFFSECKPPCSHFVTTEYGHLDMLDDHLS  505

Query  806  GVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAP  970
            G  G  +  +CK+GK  R  MR  VGG  VAFL+ YLEG      AI D   ++AP
Sbjct  506  GCIGAISGYICKSGKGPRDPMRRCVGGLFVAFLKAYLEGQTGDFKAIVDE-PDLAP  560


 Score =   224 bits (571),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 180/312 (58%), Gaps = 18/312 (6%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            AT++F  G YT + +       T+   PK L I TP   + G +P+ LFLHGY      Y
Sbjct  579  ATDVFKRGNYTAKPI-------TTCNAPKTLFIVTPD--TEGTYPVLLFLHGYNICPCCY  629

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
            + L++HI+SHG IVVAP+L S+       +I   A++ NWL  GL + LP +V P+  ++
Sbjct  630  TNLLEHISSHGDIVVAPRLLSLCSLYGRPDINSAAEVANWLSSGLQSVLPENVVPDLSRL  689

Query  449  ALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            AL GHSRGG +AF LALG      +LK   LIG+DPV G +K  +  P +LT +P SF L
Sbjct  690  ALAGHSRGGYLAFALALGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFIL  749

Query  626  GMAVMVIGSGLGEVKRNPLFP-PCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE-  799
             + VMVIG+GLG        P  CAP G+N+ +F+ EC+     FV  DYGH+DMLDD+ 
Sbjct  750  DIPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFVIPDYGHMDMLDDDY  809

Query  800  ----TGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
                 G   G     +CK+GK ++ +M   VGG VVA L  +LEG+   L AI D    I
Sbjct  810  CTNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGLVVAMLMAHLEGETGDLDAIVDE-PGI  868

Query  965  APVELQTVAFQE  1000
            APV+L+ +   E
Sbjct  869  APVKLEVMEDSE  880



>ref|XP_008787534.1| PREDICTED: chlorophyllase-1 [Phoenix dactylifera]
Length=307

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/314 (47%), Positives = 198/314 (63%), Gaps = 12/314 (4%)
 Frame = +2

Query  59   AVTFsssssTATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFL  238
            +V  +  S+TA ++FD GK  V+ +  +    +S  PPK +L+  P    AG++ + LF+
Sbjct  3    SVIINKPSATAASVFDYGKLHVDTIPAKQSDESS--PPKDILVVCPK--VAGSYTVVLFI  58

Query  239  HGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLP  418
             GYL  N++Y+QL+QH+ASHGFI++APQ   V    + E+I   A +TNWL +GL + LP
Sbjct  59   QGYLLSNAYYTQLLQHVASHGFILIAPQCI-VVSPYSEEDITSAAAVTNWLSDGLQSVLP  117

Query  419  PHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVL  598
              V  N  K+AL GHSRGG  AF LALG  A T LK S L+G+DPV G  K  Q PP +L
Sbjct  118  TGVEANLDKLALAGHSRGGHAAFALALGH-AETTLKFSLLMGIDPVAGPSKCCQIPPKIL  176

Query  599  TYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGH  778
            TY P SF+L + V+V+G+GLG  ++N LFP CAP GVNH++FY EC+ P  +FV  DYGH
Sbjct  177  TYEPSSFELEIPVLVLGTGLGSEQKNILFPACAPDGVNHKEFYSECKPPCYHFVVTDYGH  236

Query  779  VDMLDDETGGVRGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRH  955
            +DMLDD       K T C+CKNG   R  MR   GG + AFL+ YL      L AI D  
Sbjct  237  LDMLDD----TAPKITKCVCKNGTNCREIMRRTTGGIMTAFLKAYLLDLEEDLKAIAD-D  291

Query  956  EEIAPVELQTVAFQ  997
             +IAP +L  V+++
Sbjct  292  PQIAPTKLDPVSYR  305



>ref|XP_008355440.1| PREDICTED: chlorophyllase-1-like [Malus domestica]
Length=323

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 193/307 (63%), Gaps = 9/307 (3%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEP--HKC-TSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNS  262
            T++F++G    + ++ E     C  S  PPKPL I TP    AG +P+ L  HG+   N 
Sbjct  17   TSVFNLGNCPFKCITEETPLSSCFDSSAPPKPLFIVTP--MVAGTYPLILLHHGFYLRNY  74

Query  263  FYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQ  442
            FY +L+QHIASHGFI VAPQL  V      EE++  A++ NWLP+GL   LP +V  +  
Sbjct  75   FYKELLQHIASHGFIAVAPQLCGVVPPCGPEEVESGAKVINWLPKGLQPLLPENVVADFT  134

Query  443  KIALGGHSRGGKVAFGLALGKIART-DLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSF  619
            K AL GHSRGGK AF +ALG+   +  LK+S LIG+DPV G ++  +T P +LTY PQSF
Sbjct  135  KFALAGHSRGGKTAFAIALGRAKTSLSLKISLLIGIDPVAGANRYCRTRPRILTYSPQSF  194

Query  620  DLGMAVMVIGSGLG-EVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDD  796
            DL + V+VIG+GLG E K   +  PCAP G NH+ F+ EC+ P  +FV KDYGH+DMLDD
Sbjct  195  DLSIPVIVIGAGLGPEGKNXCMXKPCAPDGXNHKXFFYECKPPCAHFVVKDYGHMDMLDD  254

Query  797  ETGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPV  973
            +  G+ G  + C+CKNG   R  MR  VGG VVAFL  YL GD   L AI    +  +P 
Sbjct  255  DPQGMVGAVSGCMCKNGTGPRELMRKTVGGIVVAFLNAYLNGDDRDLVAIVGDPDS-SPA  313

Query  974  ELQTVAF  994
            +L+ V F
Sbjct  314  KLEPVEF  320



>ref|XP_001753563.1| predicted protein [Physcomitrella patens]
 gb|EDQ81786.1| predicted protein [Physcomitrella patens]
Length=341

 Score =   269 bits (688),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 197/316 (62%), Gaps = 20/316 (6%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTS-------------HPPPKPLLIATPSEASAGAFPIFLFL  238
            I++ G + +E+V V+    +S             +  PKPL++A P E   G +P+  F 
Sbjct  12   IYEDGPFKIEIVHVDDASSSSTCLKKSRAAVDRENLSPKPLVVALPKEE--GVYPVIQFH  69

Query  239  HGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLP  418
            HG+   N FYSQ+I HIAS+GFIVVAPQ+Y ++G+DAT EI+   QI NW+P GL   LP
Sbjct  70   HGFTLQNMFYSQIISHIASYGFIVVAPQMYKISGSDATTEIEDAVQILNWMPTGLVAALP  129

Query  419  PHV---HPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPP  589
              +    P+  K+AL GHSRG KV FGLALG +  + L+ SA++G+DPVDGM  G+QT P
Sbjct  130  ETLSKHRPDFSKVALVGHSRGAKVVFGLALG-VRNSILQYSAVVGLDPVDGMGIGQQTNP  188

Query  590  PVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKD  769
            P+L +   S +LG+  ++IG+GLG +++N LFP CAP GV+H  FY +   PA +FVA  
Sbjct  189  PILQFSEGSLNLGVPTLIIGTGLGPLRKNFLFPACAPAGVSHEAFYYDSAAPAFHFVASK  248

Query  770  YGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRD  949
             GH+D L+D+  G  G  +YCLCKNG  R  MR F GG VVAFLR    G+ + L A   
Sbjct  249  QGHMDFLNDDCSGPTGMFSYCLCKNGPTRKPMRRFSGGMVVAFLRAAFFGETAPLVAALA  308

Query  950  RHEEIAPVELQTVAFQ  997
               E+AP+ L    F+
Sbjct  309  T-PELAPIPLDRPEFK  323



>gb|AHJ14565.1| chlorophyllase [Triticum aestivum]
Length=319

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/301 (48%), Positives = 187/301 (62%), Gaps = 12/301 (4%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            T++F  GK  VE + V+ +   +  PP P+LI  P +A  G +P+ + LHG+  +N FY 
Sbjct  24   TSVFQPGKLAVEAIQVDENAAPT--PPIPVLIVAPKDA--GTYPVAMLLHGFFLHNHFYE  79

Query  272  QLIQHIASHGFIVVAPQL-YSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
             L++H+ASHGFI+VAPQ   S+  +   E+I   A++ +WLP+GL + LP  V P   K+
Sbjct  80   HLLRHVASHGFIIVAPQFSISIIPSGDAEDIAAAAKVADWLPDGLPSVLPKGVEPELSKL  139

Query  449  ALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLG  628
            AL GHSRGG  AF LALG  A+T L  SALIG+DPV G  K  Q  P +LTY P SF + 
Sbjct  140  ALAGHSRGGHTAFSLALGH-AKTQLTFSALIGLDPVAGTGKSSQLQPKILTYEPSSFGMA  198

Query  629  MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGG  808
            M V+VIG+GLGE K+N  FPPCAPK VNH +FY+ECR P  Y V KDYGH+DMLDD+   
Sbjct  199  MPVLVIGTGLGEEKKNIFFPPCAPKDVNHAEFYRECRPPCYYLVTKDYGHLDMLDDDA--  256

Query  809  VRGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQT  985
               K   C+CK+G   +  MR  V G +VAFL   L    + L AI  R   +AP  L  
Sbjct  257  --PKFITCVCKDGNGCKGKMRRCVAGIMVAFLNAALGEKDADLEAIL-RDPAVAPTTLDP  313

Query  986  V  988
            V
Sbjct  314  V  314



>gb|EEE50970.1| hypothetical protein OsJ_31546 [Oryza sativa Japonica Group]
Length=356

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 155/348 (45%), Positives = 199/348 (57%), Gaps = 62/348 (18%)
 Frame = +2

Query  92    TNIFDVGKYTVELVSVE--PHKCTSHP---------------PPKPLLIATPSEASAGAF  220
             + +FD G + V LV V+  P KC+S                 PPKPLL+A P +A  G +
Sbjct  34    SGVFDHGSHGVTLVKVDEAPRKCSSAAAAKKTDDDTAPAGGAPPKPLLVAAPCDA--GVY  91

Query  221   PIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQL-----------------YSVAGADA  349
             P+ +FLHGYL YNSFYSQL +H+ASHGF+VV PQL                 Y+++G D 
Sbjct  92    PVVVFLHGYLAYNSFYSQLFEHVASHGFVVVGPQLFLGCELILSNNFDAKMLYTMSGPDT  151

Query  350   TEEIKCTAQITNWLPEG-LHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLK  526
             T+EI   A + NWL  G L + LPP+V  +  KI++ GHSRGGKVAF LALG        
Sbjct  152   TDEINSAAAVINWLAAGGLTSKLPPNVRADATKISISGHSRGGKVAFALALGH-------  204

Query  527   LSALIGVDPVDGMDKGKQTPPPVLTYI-PQSFDLGMAVMVIGSGLGEVKRN-PLFPPCAP  700
                              QTP P+LTY    S  L   VMVIG+GLG + R  PL P CAP
Sbjct  205   ---------------ANQTPRPILTYGGANSLRLPAPVMVIGTGLGGLARAAPLLPACAP  249

Query  701   KGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVG  880
              GV+H +FY EC  PAC+ VA+DYGH DM+DD T G RG AT  +C++G  RA MR F G
Sbjct  250   PGVSHGEFYGECAAPACHLVARDYGHTDMMDDVTPGARGLATRAVCRSGGARAPMRRFFG  309

Query  881   GAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAFQEN*TTKHIW  1024
             GA+VAF++ ++EG+   L  +R R  E APV L  V F++     H +
Sbjct  310   GAMVAFVKRWVEGEPELLDCVRAR-PETAPVVLSAVEFRDEAIANHSY  356



>gb|AEO19902.1| chlorophyllase 1, partial [Pyrus x bretschneideri]
Length=302

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/282 (50%), Positives = 180/282 (64%), Gaps = 6/282 (2%)
 Frame = +2

Query  158  SHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVA  337
            S  PPKPL I TP+   AG +P+ L  HG+   N FY +L+QHI SHGFI VAPQL    
Sbjct  21   SSAPPKPLFIVTPT--VAGTYPVILLHHGFYLRNYFYEELLQHIVSHGFIAVAPQLCGAV  78

Query  338  GADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIART  517
                 EE++  A++ NWLP+GL   LP +V  +  K AL GHSRGGK AF +ALG+   +
Sbjct  79   PPSGPEEVESGAKVINWLPKGLQPLLPENVVADLTKFALSGHSRGGKTAFAIALGRAKTS  138

Query  518  -DLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLG-EVKRNPLFPP  691
              LK+S LIG+DPV G ++  +T P +LTY PQSFDL + V VIG+GLG E K   +  P
Sbjct  139  LSLKISVLIGIDPVAGANRYCRTRPHILTYSPQSFDLSIPVTVIGTGLGPESKNACMSQP  198

Query  692  CAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERAAMR  868
            CAP GVNH++F+ EC+ P  +FV KDYGH+ MLDD+  GV G  + C+CKNG   R  MR
Sbjct  199  CAPDGVNHKEFFYECKPPCAHFVVKDYGHMGMLDDDPQGVVGAVSGCMCKNGTGPREIMR  258

Query  869  AFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
              VGG VVAFL  YL GD   L AI    +  +P +L+ V F
Sbjct  259  KTVGGIVVAFLNAYLNGDDRYLLAIVGDPDS-SPAKLEPVEF  299



>gb|AAP92160.2| chlorophyllase [Piper betle]
Length=306

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 195/308 (63%), Gaps = 15/308 (5%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            A+++F++GK  V + SV  ++  S  PPK LLI+ PS+   G + + LFLHG+L  NSFY
Sbjct  3    ASSVFEMGKLEVHVKSV--NQSNSSSPPKSLLISYPSQK--GDYGVVLFLHGFLISNSFY  58

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
             +LI HI+SHG+IVVAP++      D   EI   AQ+ NWLPEGL   LPP+V PNT K+
Sbjct  59   KELISHISSHGYIVVAPRIIYPCLQD---EINSAAQVANWLPEGLQAALPPNVQPNTSKL  115

Query  449  ALGGHSRGGKVAFGLALGKIAR-TDLKLSALIGVDPVDG-----MDKGKQTPPPVLTYIP  610
             L GHSRGGK AF + LG       ++ S LIGVDPV G     ++   + PP ++T   
Sbjct  116  TLAGHSRGGKAAFCMLLGLAGSPLTVQFSGLIGVDPVAGFQIPGINYKMEIPPKIITNNS  175

Query  611  QSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDML  790
            + FD+ +  ++IG+ LGE  +  L PPCAP G+N+  FY++ + P+  FVAK YGHVDML
Sbjct  176  KPFDINVPTLIIGTELGEEAKGCLAPPCAPAGLNYEQFYEKSKEPSYQFVAKGYGHVDML  235

Query  791  DD-ETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIA  967
            DD     + GK TYC+CKNGKER  MR   GG +VAFL+ + +G    L AI +   E+A
Sbjct  236  DDISKNDLMGKLTYCVCKNGKEREPMRRTAGGLMVAFLKAFSDGQRDDLDAILN-DPELA  294

Query  968  PVELQTVA  991
            P++L   A
Sbjct  295  PIQLDAEA  302



>ref|XP_009370779.1| PREDICTED: chlorophyllase-1-like [Pyrus x bretschneideri]
Length=320

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/307 (48%), Positives = 190/307 (62%), Gaps = 10/307 (3%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEP--HKC-TSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYN  259
             T++F+ G    + ++ E     C  S  PPKPL I TP+   AG +P+ L  HG+   N
Sbjct  16   TTSVFNQGNCPFKCITEETPLSSCFDSSAPPKPLFIVTPT--VAGTYPVILLHHGFYLRN  73

Query  260  SFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNT  439
             FY +L+QHI SHGFI VAPQL  V      EE++  A++ NWLP+GL   LP +V  + 
Sbjct  74   YFYEELLQHIVSHGFIAVAPQLCGVVPPSGPEEVESGAKVINWLPKGLQPLLPENVVADF  133

Query  440  QKIALGGHSRGGKVAFGLALGKIART-DLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQS  616
             K AL GHSRGG  AF +ALG+   +  LK+S LIG+DPV G ++   T P +LTY PQS
Sbjct  134  TKFALSGHSRGGFTAFAIALGRAKTSLSLKISVLIGIDPVAGKNRYCTTRPHILTYSPQS  193

Query  617  FDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDD  796
            FDL + V VIG+GLG   +  +  PCAP GVNH++F+ EC+ P  +FV KDYGH+DMLDD
Sbjct  194  FDLSIPVTVIGTGLGPEIKTCI--PCAPDGVNHKEFFYECKPPCAHFVVKDYGHMDMLDD  251

Query  797  ETGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPV  973
            +  GV G  + C+CKNG   R  MR  VGG VVAFL  YL GD   L AI    +  +P 
Sbjct  252  DPQGVVGAVSGCMCKNGTGPREIMRKTVGGIVVAFLNAYLNGDDRYLLAIVGDPDS-SPA  310

Query  974  ELQTVAF  994
            +L+ V F
Sbjct  311  KLEPVEF  317



>gb|EMT19932.1| Chlorophyllase-1 [Aegilops tauschii]
Length=319

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/301 (48%), Positives = 187/301 (62%), Gaps = 12/301 (4%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            T++F  GK  VE + V+ +   +  PP P+LI  P +A  G +P+ + LHG+  +N FY 
Sbjct  24   TSVFQPGKLAVEAIQVDENAAPT--PPIPVLIVAPKDA--GTYPVAMLLHGFFLHNHFYE  79

Query  272  QLIQHIASHGFIVVAPQL-YSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
             L++H+ASHGFI+VAPQ   S+  +   E+I   A++ +WLP+GL + LP  V P   K+
Sbjct  80   HLLRHVASHGFIIVAPQFSISIIPSGDAEDIAAAAKVADWLPDGLPSVLPKGVEPELSKL  139

Query  449  ALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLG  628
             + GHSRGG  AF LALG  A+T L  SALIG+DPV G  K  Q  P +LTY P SF + 
Sbjct  140  PVPGHSRGGHTAFSLALGH-AKTQLTFSALIGLDPVAGTGKSSQLQPKILTYEPSSFGMA  198

Query  629  MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGG  808
            M V+VIG+GLGE K+N  FPPCAPK VNH +FY+ECR P  YFV KDYGH+DMLDD+   
Sbjct  199  MPVLVIGTGLGEEKKNIFFPPCAPKDVNHAEFYRECRPPCYYFVTKDYGHLDMLDDDA--  256

Query  809  VRGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQT  985
               K   C+CK+G   +  MR  V G +VAFL   L    + L AI  R   +AP  L  
Sbjct  257  --PKFITCVCKDGNGCKGKMRRCVAGIMVAFLNAALGEKDADLEAIL-RDPAVAPTTLDP  313

Query  986  V  988
            V
Sbjct  314  V  314



>ref|XP_010256231.1| PREDICTED: chlorophyllase-1-like [Nelumbo nucifera]
Length=441

 Score =   267 bits (683),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 205/330 (62%), Gaps = 18/330 (5%)
 Frame = +2

Query  14   QTA*TLDLDSHQLAMAVTFsssssTATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIAT  193
            QT  TL  +     + V   ++++T T +F+ GK++V    V+   C+    PKPL I +
Sbjct  128  QTYSTLLREREMALLEVNLPTAAATTTGVFETGKFSV---GVKDTVCS----PKPLRIVS  180

Query  194  PSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTA  373
            P+E+  G +P+ LFLHG    N FY+QL+ HIASHGFI VAPQL         EEI C A
Sbjct  181  PTES--GKYPVLLFLHGTALSNVFYTQLLTHIASHGFICVAPQL------PFGEEICCAA  232

Query  374  QITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDP  553
             +TNW  EGL + +P    PN QK+AL GHSRGGK AF LALG    T L  S LIG+DP
Sbjct  233  LVTNWFSEGLKSVIPGEAQPNLQKLALVGHSRGGKAAFALALGLAP-TSLAFSVLIGLDP  291

Query  554  VDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQE  733
            V G  KG + PP +LTY P+SF+LG+ VMVIG+GLGE ++  LF PCAP  V+H++FY E
Sbjct  292  VAGKCKGCECPPKILTYQPRSFNLGIPVMVIGTGLGEKRKIKLFCPCAPPQVSHQEFYDE  351

Query  734  CRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGY  910
             + P  + V  DYGH+DMLDD   G+ G  +  LCK+G  ++  MR  VGG +VAF+R Y
Sbjct  352  SKHPRYHMVTADYGHMDMLDDNCKGILGTLSSSLCKSGDGDKDLMRRCVGGIIVAFMREY  411

Query  911  LEGDFSSLAAIRDRHEEIAPVELQTVAFQE  1000
            LE     L  I D   EIAPV+L  V + E
Sbjct  412  LEVSTGDLKGILD-APEIAPVKLDPVEYDE  440



>ref|XP_003576870.1| PREDICTED: chlorophyllase-1-like [Brachypodium distachyon]
Length=324

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/280 (49%), Positives = 184/280 (66%), Gaps = 13/280 (5%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            T++F  GK  VE++ V+ +   +  PP P+LI  P +A  G +P+ + LHG+   N +Y 
Sbjct  24   TSVFQPGKLAVEVIQVDHNAVPT--PPIPVLIVAPKDA--GTYPVAMLLHGFFLQNHYYK  79

Query  272  QLIQHIASHGFIVVAPQLY-SVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
            QL++H+ASHGFI+VAPQ + S+     T++I+  A++++WLPEGL + LP  V P   K+
Sbjct  80   QLLRHVASHGFIMVAPQFHLSMIPTGDTKDIEAAAKVSDWLPEGLPSVLPKGVEPELSKL  139

Query  449  ALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL-  625
            AL GHSRGG  AF LALG  A+++L  SALIG+DPV G  K  Q  P +LTY P SF++ 
Sbjct  140  ALAGHSRGGHTAFSLALGH-AKSNLSFSALIGIDPVAGTGKSSQLAPKILTYEPSSFNMS  198

Query  626  -GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDET  802
              M V+VIG+GLGE K+N   PPCAPK VNHR+FY EC+ P  YFV KDYGH+DMLDD+ 
Sbjct  199  AAMPVLVIGTGLGEEKKNIFTPPCAPKDVNHREFYLECKPPCYYFVTKDYGHLDMLDDDA  258

Query  803  GGVRGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEG  919
              V      CLCK+G   +  MR  V G +VAFL   L G
Sbjct  259  PMV----ITCLCKDGGSCKDKMRRCVAGIMVAFLNSALGG  294



>gb|ABE01079.1| chlorophyllase [Piper betle]
 gb|ABI96085.1| chloroplast chlorophyllase [Piper betle]
Length=306

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 194/308 (63%), Gaps = 15/308 (5%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            A+++F++GK  V + SV  ++  S  PPK LLI+ PS+   G + + LFLHG+L  NSFY
Sbjct  3    ASSVFEMGKLEVHVKSV--NQSNSSSPPKSLLISYPSQK--GDYGVVLFLHGFLISNSFY  58

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
             +LI HI+SHG+IVVAP++      D   EI   AQ+ NWLPEGL   LPP+V PNT K+
Sbjct  59   KELISHISSHGYIVVAPRIIYPCLQD---EINSAAQVANWLPEGLQAALPPNVQPNTSKL  115

Query  449  ALGGHSRGGKVAFGLALGKIAR-TDLKLSALIGVDPVDG-----MDKGKQTPPPVLTYIP  610
             L GHSRGGK AF + LG       ++ S LIGVDPV G     ++   + PP ++T   
Sbjct  116  TLAGHSRGGKAAFCMLLGLAGSPLTVQFSGLIGVDPVAGFQIPGINYKMEIPPKIITNNS  175

Query  611  QSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDML  790
            + FD+ +  ++IG+ LGE  +  L PP AP G+N+  FY++ + P+  FVAK YGHVDML
Sbjct  176  KPFDINVPTLIIGTELGEEAKGCLAPPYAPAGLNYEQFYEKSKEPSYQFVAKGYGHVDML  235

Query  791  DD-ETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIA  967
            DD     + GK TYC+CKNGKER  MR   GG +VAFL+ + +G    L AI +   E+A
Sbjct  236  DDISKNDLMGKLTYCVCKNGKEREPMRRTAGGLMVAFLKAFSDGQRDDLDAILN-DPELA  294

Query  968  PVELQTVA  991
            P++L   A
Sbjct  295  PIQLDAGA  302



>ref|XP_008652459.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Zea mays]
 tpg|DAA60721.1| TPA: hypothetical protein ZEAMMB73_331237 [Zea mays]
Length=318

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 191/306 (62%), Gaps = 14/306 (5%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            T++F  GK  VE+++V+ H     PP  P+LIA P +A  G +P+ + LHG+   N +Y 
Sbjct  21   TSVFQPGKLAVEVITVD-HDAQPTPP-IPILIAAPKDA--GTYPVAMLLHGFFLQNRYYE  76

Query  272  QLIQHIASHGFIVVAPQLY-SVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
            QL++H+AS GFI+VAPQ + S+      ++I   A+ T+WLPEGL + LP  V  +  K+
Sbjct  77   QLLKHVASFGFIMVAPQFHTSLISNSDNDDIAAAAKATDWLPEGLPSVLPTGVEADLSKL  136

Query  449  ALGGHSRGGKVAFGLALG--KIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFD  622
             L GHSRGG +AF LALG  KI+ + L  SALIG+DPV G  K  Q PP +LTY P SFD
Sbjct  137  VLAGHSRGGHMAFSLALGYAKISSS-LSFSALIGLDPVAGTGKNSQLPPAILTYAPSSFD  195

Query  623  LGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDET  802
            + M V+VIG+GLG+ + N LFPPCAP  VNH +FY+ECR P  + V K+YGH+DMLDD+ 
Sbjct  196  IAMPVLVIGTGLGDERENVLFPPCAPVDVNHTEFYRECRAPCYHLVTKNYGHLDMLDDDA  255

Query  803  GGVRGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVEL  979
                 K   CLCK G   +  MR  V G +VAFL+  +  +   L AI      +AP  L
Sbjct  256  ----PKLVTCLCKEGNSCKDVMRRTVAGIMVAFLKAVMGEEDGDLKAIL-TDPGLAPTTL  310

Query  980  QTVAFQ  997
              V ++
Sbjct  311  DPVEYR  316



>ref|XP_003565235.1| PREDICTED: chlorophyllase-1-like [Brachypodium distachyon]
Length=324

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/280 (49%), Positives = 182/280 (65%), Gaps = 13/280 (5%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            T++F  GK  VE++  + +   +  PP P+LI  P +A  G +P+ + LHG+   N +Y 
Sbjct  24   TSVFQPGKLAVEVIQADHNAVPT--PPIPVLIVAPKDA--GTYPVAMLLHGFFLQNHYYK  79

Query  272  QLIQHIASHGFIVVAPQLY-SVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
            QL++H+ASHGFI+VAPQ + S+     T++I+  A++ +WLPEGL + LP  V P   K+
Sbjct  80   QLLRHVASHGFIMVAPQFHLSMIPTGDTKDIEAAAKVADWLPEGLPSVLPKGVEPELSKL  139

Query  449  ALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL-  625
            AL GHSRGG  AF LALG  A+++L  SALIG+DPV G  K  Q  P +LTY P SF++ 
Sbjct  140  ALAGHSRGGHTAFSLALGH-AKSNLSFSALIGIDPVAGTGKSSQLAPKILTYEPSSFNMS  198

Query  626  -GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDET  802
              M V+VIG+GLGE K+N   PPCAPK VNHR+FY EC+ P  YFV KDYGH+DMLDD+ 
Sbjct  199  AAMPVLVIGTGLGEEKKNIFTPPCAPKDVNHREFYLECKPPCYYFVTKDYGHLDMLDDDA  258

Query  803  GGVRGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEG  919
              V      CLCK+G   +  MR  V G +VAFL   L G
Sbjct  259  PMV----ITCLCKDGDSCKDKMRRCVAGIMVAFLNSALGG  294



>ref|XP_003534159.1| PREDICTED: chlorophyllase-1-like [Glycine max]
 gb|KHN23755.1| Chlorophyllase-1 [Glycine soja]
Length=315

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/308 (46%), Positives = 199/308 (65%), Gaps = 10/308 (3%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
              T++F +G    +  +++    +S PP KPLLI TP+    G++P+ LF HG+   NS+
Sbjct  10   VTTDVFQMGNIKWKQFNIDTSNASSSPP-KPLLIFTPT--VPGSYPVILFCHGFSLRNSY  66

Query  266  YSQLIQHIASHGFIVVAPQL-YSVAGA-DATEEIKCTAQITNWLPE-GLHNFLPPHVHPN  436
            YS+L+ HIASHGFI+VAPQL +SV    +  +E+K   ++ +WL E GL   LP +V   
Sbjct  67   YSELLGHIASHGFIIVAPQLCWSVRSMLEPGDEVKFAGKVVDWLAEEGLQPLLPENVEAK  126

Query  437  TQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQS  616
              K+ L GHS+GGK  F +ALG  A+T+LK SAL+G+DPV G  K  +T PP+LT + QS
Sbjct  127  LDKLVLSGHSKGGKTVFAVALG-YAKTNLKFSALVGIDPVAGPCKSCETFPPILTGMSQS  185

Query  617  FDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDD  796
            F+L + ++VIG+GLG  K N   PPCAP GVNH++F+ +C+ P  +FVA +YGH+DMLDD
Sbjct  186  FNLNIPIVVIGTGLGPEKANFFIPPCAPDGVNHKEFFNKCKPPCAHFVATEYGHMDMLDD  245

Query  797  ETGGVRGKA-TYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAP  970
             T G+ G   + C+CK+GK  R  MR  VGG VVAFLR  L G +    A+   +  +AP
Sbjct  246  VTPGLIGSILSNCICKDGKGPRDLMRRTVGGLVVAFLRAQLNGLWKDFNAVL-ANPNLAP  304

Query  971  VELQTVAF  994
             +L  V +
Sbjct  305  TKLDDVVY  312



>gb|KFK44086.1| hypothetical protein AALP_AA1G214200 [Arabis alpina]
Length=324

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/297 (46%), Positives = 186/297 (63%), Gaps = 7/297 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F++G     +++V+P    S  PPKP+ I +P  A AG +P+ LF HG+   N FYS ++
Sbjct  19   FEIGSLPTTVITVDPSGNDSTAPPKPVRITSP--AVAGTYPVVLFFHGFYLRNDFYSDIL  76

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGG  460
             H+ASHGFI+VAPQL  +       E+    ++ NW  + L   LP  V+ N +  AL G
Sbjct  77   NHVASHGFILVAPQLCKLLPPGGQVEVDDAGKVINWTLKNLKAHLPNSVNANGKYTALVG  136

Query  461  HSRGGKVAFGLALGKIARTD--LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            HSRGGK AF +ALG  A  D  ++ SALIG+DPV G +K  +T P +LTY P+SFDL + 
Sbjct  137  HSRGGKTAFAVALGHAATLDPSIEFSALIGIDPVAGPNKYLRTDPEILTYKPESFDLDIP  196

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            V V+G+GLG   +N L PPCAP  VNH +FY EC+    +FVA DYGH+DMLDD+  G  
Sbjct  197  VAVVGTGLGPKMKN-LMPPCAPAEVNHVEFYNECKATKAHFVAADYGHMDMLDDDLPGFV  255

Query  815  GKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G    C+CKNGK ++  MR FVGG VVAFL+  L GD S +  I  +   ++PV++ 
Sbjct  256  GFMAGCMCKNGKGKKIEMRRFVGGIVVAFLKYSLWGDKSEIQRIV-KDPSVSPVKID  311



>gb|AAN51933.1|AF337544_1 chlorophyllase 1 [Brassica oleracea]
 emb|CDY39361.1| BnaC05g15260D [Brassica napus]
Length=324

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/297 (46%), Positives = 182/297 (61%), Gaps = 7/297 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F++G     ++  +P       PPKP++I +P+   AG +P+ LF HG+   N FYS +I
Sbjct  19   FELGSLPTTVIPADPSATDLTAPPKPVIITSPT--VAGTYPVVLFFHGFYLRNYFYSDVI  76

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGG  460
             H+ASHG+IVVAPQL  +       E+    ++ NW  + L   LP  V+ N    AL G
Sbjct  77   NHVASHGYIVVAPQLCKILPPGGQVEVDDAGKVINWTSKNLKAHLPSSVNANGNYTALVG  136

Query  461  HSRGGKVAFGLALGKIARTD--LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            HSRGGK AF +ALG  A  D  +K SAL+G+DPV G+ K  +T P +LTY P+SFDL M 
Sbjct  137  HSRGGKTAFAVALGHAATLDPSIKFSALVGIDPVAGISKCIRTDPEILTYKPESFDLDMP  196

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            V VIG+GLG  K N L PPCAP  VNH +FY EC+    +FVA DYGH+DMLDD   G  
Sbjct  197  VAVIGTGLGP-KSNMLMPPCAPAEVNHEEFYIECKATKGHFVAADYGHMDMLDDNLPGFV  255

Query  815  GKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G    C+CKNGK +++ MR+FVGG VVAFL+  + G+ S +  I  +   ++P  L 
Sbjct  256  GFMAGCMCKNGKRKKSEMRSFVGGIVVAFLKYSIWGEMSEIRQIL-KDPSVSPARLD  311



>emb|CDY38340.1| BnaA02g18330D [Brassica napus]
Length=324

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/297 (46%), Positives = 182/297 (61%), Gaps = 7/297 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F++G     ++  +P       PPKP++I +P+   AG +P+ LF HG+   N FYS +I
Sbjct  19   FELGSLPTTVIPADPSATDLTAPPKPVIITSPT--VAGTYPVVLFFHGFYLRNYFYSDVI  76

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGG  460
             H+ASHG+IVVAPQL  +       E+    ++ NW  + L   LP  V+ N    AL G
Sbjct  77   NHVASHGYIVVAPQLCKILPPGGQVEVDDAGKVINWTSKNLKAHLPSSVNANGNYTALVG  136

Query  461  HSRGGKVAFGLALGKIARTD--LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            HSRGGK AF +ALG  A  D  +K SAL+G+DPV G+ K  +T P +LTY P+SFDL M 
Sbjct  137  HSRGGKTAFAVALGHAATLDPSIKFSALVGIDPVAGISKCIRTDPEILTYKPESFDLDMP  196

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            V VIG+GLG  K N L PPCAP  VNH +FY EC+    +FVA DYGH+DMLDD   G  
Sbjct  197  VAVIGTGLGP-KSNMLMPPCAPAEVNHEEFYIECKATKGHFVAADYGHMDMLDDNLPGFV  255

Query  815  GKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G    C+CKNGK +++ MR+FVGG VVAFL+  + G+ S +  I  +   ++P  L 
Sbjct  256  GFMAGCMCKNGKRKKSEMRSFVGGIVVAFLKYSIWGEMSEIRQIL-KDPSVSPARLD  311



>ref|XP_009149451.1| PREDICTED: chlorophyllase-1 [Brassica rapa]
Length=324

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/297 (46%), Positives = 183/297 (62%), Gaps = 7/297 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F++G     ++  +P +     PPKP++I +P+   AG +P+ LF HG+   N FYS +I
Sbjct  19   FELGSLPTTVIPADPSQTDLTAPPKPVIITSPT--VAGTYPVVLFFHGFYLRNYFYSDVI  76

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGG  460
             H+ASHG+IVVAPQL  +       E+    ++ NW  + L   LP  V+ N    AL G
Sbjct  77   NHVASHGYIVVAPQLCKILPPGGQVEVDDAGKVINWTSKNLKAHLPSSVNANGNYTALVG  136

Query  461  HSRGGKVAFGLALGKIARTD--LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            HSRGGK AF +ALG  A  D  +K SAL+G+DPV G+ K  +T P +LTY P+SFDL M 
Sbjct  137  HSRGGKTAFAVALGHAATLDPSIKFSALVGIDPVAGISKCIRTDPEILTYKPESFDLDMP  196

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            + VIG+GLG  K N L PPCAP  VNH +FY EC+    +FVA DYGH+DMLDD   G  
Sbjct  197  IAVIGTGLGP-KSNMLMPPCAPAEVNHEEFYIECKATKGHFVAADYGHMDMLDDNLPGFV  255

Query  815  GKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G    C+CKNGK +++ MR+FVGG VVAFL+  L G+ S +  I  +   ++P  L 
Sbjct  256  GFMAGCMCKNGKRKKSEMRSFVGGIVVAFLKYSLWGEKSEIRQIV-KDPSVSPARLD  311



>ref|XP_010042520.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Eucalyptus grandis]
Length=249

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 158/228 (69%), Gaps = 5/228 (2%)
 Frame = +2

Query  320  QLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLAL  499
            QLY+ A +D+T++I   A  TNWL +GL   LP  V  N  K+ L GHSRGGK AF LAL
Sbjct  21   QLYTCAASDSTDDINSAAATTNWLSQGLAAVLPSQVSANLAKLVLAGHSRGGKGAFALAL  80

Query  500  GKIAR-TDLKLSALIGVDPVDGMDK---GKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEV  667
            GK +    L  SAL+G+DPVDG        QT PPVLT + QSFDL M VMV+GSGLGE 
Sbjct  81   GKSSTPLALSFSALLGIDPVDGAASCCCKFQTKPPVLTKVAQSFDLNMPVMVVGSGLGED  140

Query  668  KRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG  847
            K+  +FP CAPKG+NH  F++ECR PA +FVAKDYGH+DMLDD+T G+RG  +YC+C+NG
Sbjct  141  KKYKVFPACAPKGLNHAAFFEECRSPAWHFVAKDYGHMDMLDDDTKGIRGVVSYCMCENG  200

Query  848  KERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVA  991
              R  MR FVGGA VAFLR Y+ GD   L A++D   +IAPV++   A
Sbjct  201  SSREPMRRFVGGAAVAFLRAYVGGDDGDLMALQDT-PDIAPVQITVEA  247



>ref|XP_006416475.1| hypothetical protein EUTSA_v10008201mg [Eutrema salsugineum]
 gb|ESQ34828.1| hypothetical protein EUTSA_v10008201mg [Eutrema salsugineum]
Length=324

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/297 (46%), Positives = 184/297 (62%), Gaps = 7/297 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F+ G     +++ +P K  S  PPKP+ I +P+   AG++P+ LF HG+   N FYS ++
Sbjct  19   FERGSLPTTVITADPSKTDSTAPPKPVRITSPT--VAGSYPVVLFFHGFYLRNYFYSDVL  76

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGG  460
             H+ASHG+I+VAPQL  +       E+    ++ NW  E L   LP  V+ N +  AL G
Sbjct  77   NHVASHGYILVAPQLCKILPPGGQVEVDDAGKVINWASENLKAHLPNSVNANGKYTALVG  136

Query  461  HSRGGKVAFGLALGKIARTD--LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            HSRGGK AF +ALG  A  D   K SALIG+DPV G+ K  +T P +LTY P+SF++ + 
Sbjct  137  HSRGGKTAFAVALGHAATLDTSFKFSALIGIDPVAGISKCMRTDPEILTYKPESFEIDIP  196

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            V V+G+GLG  K N + PPCAP  VNH +FY+EC+    +FVA DYGH+DMLDD+  G  
Sbjct  197  VAVVGTGLGP-KSNGMMPPCAPAEVNHEEFYKECKATKGHFVAADYGHMDMLDDDLPGFV  255

Query  815  GKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G    C+CKNGK +++ MR FVGG VVAFLR  L G  S +  I  +    +PV L 
Sbjct  256  GFMAGCMCKNGKRKKSEMRRFVGGIVVAFLRYSLWGHKSEIREIL-KDPSASPVTLD  311



>emb|CDP03668.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 189/302 (63%), Gaps = 11/302 (4%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            +++F+ G  +V+   VE    +S    +PLL+ TP+E +   +P+ LF+HG++  N+ Y 
Sbjct  4    SSVFEEGNLSVKSFPVESSAVSSKS--RPLLVFTPTELNT--YPVILFIHGFMCSNTSYR  59

Query  272  QLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIA  451
            QL+QHIA+HGFIVVAPQ      A  ++EI   A++T W+   L   LP +V  N   + 
Sbjct  60   QLLQHIATHGFIVVAPQTNPGIFATVSQEITDAAEVTKWMATELQALLPDNVTANFDNLG  119

Query  452  LGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGM  631
            + GH RGG VAF LALGK A T +   ALIG+DPV G++   ++ P +LTYIP+SFDL +
Sbjct  120  VAGHGRGGYVAFCLALGK-AETTVNFKALIGIDPVAGVNTLWRSKPDILTYIPRSFDLEI  178

Query  632  AVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGV  811
             V VIG+GLG  K+N L PPCAP+GVNH +F+ EC+ P CYF+AK+YGH  MLDD     
Sbjct  179  PVGVIGTGLGSQKKNFLLPPCAPEGVNHAEFFNECKPPCCYFLAKEYGHTGMLDDGA---  235

Query  812  RGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTV  988
              K   C CK G + R  MR  V G VVAF+  YL+ + S L A+ +  +  AP+ L  V
Sbjct  236  -AKLGNCACKKGSQPRYLMRKAVAGIVVAFMESYLKNNESDLLAVINNPKS-APITLDPV  293

Query  989  AF  994
             +
Sbjct  294  IY  295



>emb|CDY29413.1| BnaA06g13830D [Brassica napus]
Length=324

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/297 (46%), Positives = 181/297 (61%), Gaps = 7/297 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F++G     ++  +P       PPKP++I +P+   AG +P+ LF HG+   N FYS +I
Sbjct  19   FELGSLPTTVIPADPSATDLTAPPKPVIITSPT--VAGTYPVVLFFHGFYLRNYFYSDVI  76

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGG  460
             H+ASHG+IVVAPQL  +       E+    ++ NW  + L   LP  V+ N    AL G
Sbjct  77   NHVASHGYIVVAPQLCKILPPGGQVEVDDAGKVINWTSKNLKAHLPSSVNANGNYTALVG  136

Query  461  HSRGGKVAFGLALGKIARTD--LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            HSRGGK AF +ALG  A  D  +K SAL+G+DPV G+ K  +T P +LTY P+SFDL M 
Sbjct  137  HSRGGKTAFAVALGHAATLDPSIKFSALVGIDPVAGISKCIRTDPEILTYKPESFDLDMP  196

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            V VIG+GLG  K N L PPCAP  VNH +FY EC+    +FVA DYGH+DMLDD   G  
Sbjct  197  VAVIGTGLGP-KSNMLMPPCAPAEVNHEEFYIECKATKGHFVAADYGHMDMLDDNLPGFV  255

Query  815  GKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G    C+CKN K +++ MR+FVGG VVAFL+  L G+ S +  I  +   ++P  L 
Sbjct  256  GFMAGCMCKNSKRKKSEMRSFVGGIVVAFLKYSLLGEKSEIRQIV-KDPSVSPARLD  311



>emb|CBI28744.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   262 bits (669),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/283 (50%), Positives = 180/283 (64%), Gaps = 14/283 (5%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            T T++F+ G  +V  + VE     S  PPKPLLI TP+    G +P+ LFLHG+   N+F
Sbjct  19   TTTSVFEPGNLSVSCIRVETSNIAS--PPKPLLIVTPT--IQGTYPVLLFLHGFELRNTF  74

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            Y+QL+Q I+SHGFIVVAPQLY +      +EIK  A +TNWL  GL + LP +V P+  K
Sbjct  75   YTQLLQLISSHGFIVVAPQLYGLLPPSGIQEIKSAAAVTNWLSSGLQSVLPENVKPDLLK  134

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            +AL GHSRGGK AF LALG  A T L  SAL+G+DPV G+ K  QT P +LTY+P SF+L
Sbjct  135  LALSGHSRGGKTAFALALG-YADTSLNFSALLGLDPVGGLSKCCQTVPKILTYVPHSFNL  193

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETG  805
             + V VIG+GLG+  RN L  PCAP GVNH +F+ EC+ P  +FV  +YGH+DMLDD   
Sbjct  194  AIPVCVIGTGLGDEPRNCLTCPCAPDGVNHVEFFSECKPPCSHFVTTEYGHLDMLDDHLS  253

Query  806  GVRGKATYCLCKN-------GKERAAM--RAFVGGAVVAFLRG  907
            G  G  +  LC +       G+E AA+  R     A  AF RG
Sbjct  254  GCIGAISDRLCVSTCRERGRGREMAALEARPAPAAATDAFKRG  296


 Score =   228 bits (581),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 134/312 (43%), Positives = 181/312 (58%), Gaps = 18/312 (6%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            AT+ F  GKYT + +       T+   PK L I TP   + G +P+ LFLHGY      Y
Sbjct  289  ATDAFKRGKYTAKPI-------TTCNAPKTLFIVTPD--TEGTYPVLLFLHGYNICPCCY  339

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
            + L++HI+SHG+IVVAP+L S+       +I   A++ NWL  GL   LP +V P+  ++
Sbjct  340  TNLLEHISSHGYIVVAPRLLSLCSLYGRPDINSAAEVANWLSSGLQPVLPENVVPDLSRL  399

Query  449  ALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            AL GHSRGG +AF LALG      +LK   LIG+DPV G +K  +  P +LT +P SF+L
Sbjct  400  ALAGHSRGGYLAFALALGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFNL  459

Query  626  GMAVMVIGSGLGEVKRNPLFP-PCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE-  799
             + VMVIG+GLG        P  CAP G+N+ +F+ EC+     FV  DYGH+DMLDD+ 
Sbjct  460  DIPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFVIPDYGHMDMLDDDY  519

Query  800  ----TGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
                 G   G     +CK+GK ++ +M   VGG VVA L  +LEG+   L AI D    I
Sbjct  520  CTNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGIVVAMLMAHLEGETGDLDAIVDE-PGI  578

Query  965  APVELQTVAFQE  1000
            APV+L+ V   E
Sbjct  579  APVKLEVVEDSE  590



>ref|XP_008386540.1| PREDICTED: LOW QUALITY PROTEIN: chlorophyllase-1 [Malus domestica]
Length=360

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/282 (49%), Positives = 179/282 (63%), Gaps = 7/282 (2%)
 Frame = +2

Query  158  SHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVA  337
            S  PPKPL I TP+   AG +P+ L  HG+   N FY +L+QHIASHGF+ VAPQL    
Sbjct  80   SSAPPKPLFIVTPT--VAGTYPVILLHHGFYLSNYFYKELLQHIASHGFVAVAPQLCGYV  137

Query  338  GADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIART  517
                 EEI+  A++ NWLP+GL + LP +V  +  K AL G S+GGK AF  ALG    +
Sbjct  138  PPSGPEEIELGAKVINWLPKGLQSLLPENVVADFTKFALAGRSKGGKTAFATALGHAKSS  197

Query  518  -DLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNP-LFPP  691
              LK+S LIG+DPV G D+  +T P +LTY PQSF+L + V+VIG+GL    +N  +  P
Sbjct  198  LSLKISVLIGIDPVAGADQHCRTYPHILTYSPQSFNLSIPVVVIGTGLRPEXQNACMAQP  257

Query  692  CAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERAAMR  868
            CAP G NH++F+ EC+ P  +FV KDYGH+DMLDD+  G+ G    C+CKNGK  R  MR
Sbjct  258  CAPDG-NHKEFFYECKPPCAHFVVKDYGHMDMLDDDPQGIVGALLGCMCKNGKGPRELMR  316

Query  869  AFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
              VG  VVAFL+ YL GD   L AI     +I+P +L  V F
Sbjct  317  KAVGEIVVAFLKAYLNGDDRDLVAIVG-DPDISPAKLDHVEF  357



>gb|ACO50428.1| chlorophyllase 1 [Pachira macrocarpa]
Length=338

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 149/325 (46%), Positives = 202/325 (62%), Gaps = 12/325 (4%)
 Frame = +2

Query  35   LDSHQLAMAVTFsssssTATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAG  214
            + S+ +A  +      ST   +F  GKY     S++P   +   PPKPLLI TPSE   G
Sbjct  11   IKSNSMAQLLETKPVLSTVLPVFLPGKYHPTSKSLDPSNSSPSSPPKPLLIFTPSEK--G  68

Query  215  AFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLP  394
             +P+ LF  G+   N FY+ L+QHI+SHGFI+VAPQLY++     TEE++  A++ +WLP
Sbjct  69   TYPVILFFPGFGLKNYFYTDLLQHISSHGFIIVAPQLYNIIPPSGTEEVEYAAKVADWLP  128

Query  395  EGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKG  574
             GL + L  +V PN  K+ L GHSRGGK AF LALG  A+T    SAL+G+DPV G   G
Sbjct  129  SGLPSVLAANVEPNLAKLTLAGHSRGGKTAFALALG-YAQTTQNFSALVGIDPVAGTRFG  187

Query  575  KQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACY  754
             +T P +LTY P+SFDL + V VIG+GLG   +  L  PCAPK  NH++F+ EC+ P  +
Sbjct  188  -ETSPKILTYTPESFDLSIPVAVIGTGLGSESKGILSCPCAPKKYNHQEFFNECKPPRAH  246

Query  755  FVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLE---GD  922
            F AK+YGH+D+LD++  G+ GK +  +C NGK  R  MR  VGG VVAFL  + E   GD
Sbjct  247  FDAKNYGHMDVLDNDPPGLVGKISDTICVNGKGPRDPMRRCVGGIVVAFLNYFFEAEKGD  306

Query  923  FSSLAAIRDRHEEIAPVELQTVAFQ  997
            F ++     +   +APV+L  V F 
Sbjct  307  FLTIV----KEPYVAPVKLDEVQFD  327



>gb|EYU46277.1| hypothetical protein MIMGU_mgv1a022687mg [Erythranthe guttata]
Length=310

 Score =   252 bits (644),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 137/299 (46%), Positives = 183/299 (61%), Gaps = 11/299 (4%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            ++F  GK   E+ +++  K  ++     LLI TP   + G++P+ LF HGY    ++YS 
Sbjct  17   SVFMAGKIGGEVKTIKVKKSDANG--AELLIVTPK--AQGSYPVLLFCHGYSTQTTWYSH  72

Query  275  LIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
            L+QHI+SHG+IVVAPQ Y       T+EIK  A++TNWLP GL + LP ++ P+  K+A+
Sbjct  73   LLQHISSHGYIVVAPQFYHCLLISLTDEIKIAAKVTNWLPSGLQDSLPDNIKPDLSKLAI  132

Query  455  GGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
             GHSRGGK+AF LALG  A T LK  AL G+DPV G        P +L+Y+P SF L + 
Sbjct  133  MGHSRGGKIAFALALGH-APTSLKFKALFGLDPVSGPTPPTWVEPNILSYVPHSFKLSIP  191

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            + VIG+GL     N +FPP AP G NH +F+ E R P CYF+AKDYGH D L+D   G+ 
Sbjct  192  IGVIGTGLSNRTNNYVFPPLAPNGFNHSEFFNESRPPCCYFLAKDYGHCDFLNDSKTGLA  251

Query  815  GKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTV  988
            G     +C++GK  +  MR  VGG VVAFL  YL G F  L  I     +IAP+ L  V
Sbjct  252  G----LVCRSGKGSKEKMRRGVGGIVVAFLNAYLGGGFEDLENIVAA-PDIAPITLDPV  305



>ref|XP_002893060.1| coronatine-induced protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69319.1| coronatine-induced protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=324

 Score =   253 bits (645),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 132/284 (46%), Positives = 178/284 (63%), Gaps = 6/284 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F+VG      + VEP +  S  PPKP+ I  P+   AG +P+ LF HG+   N FYS ++
Sbjct  19   FEVGSLPTTEIPVEPLENDSAAPPKPVRITCPT--VAGTYPVVLFFHGFYLRNYFYSDVL  76

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGG  460
             H+ASHG+I+VAPQL  +       E+     + NW  E L   LP  V+ N +  +L G
Sbjct  77   NHVASHGYILVAPQLCKLLPPGGQVEVDDAGSVINWASENLKAHLPTSVNANGKYTSLVG  136

Query  461  HSRGGKVAFGLALGKIARTD--LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            HSRGGK AF +ALG  A  D  +  SALIG+DPV G +K  +T P +LTY P+SFDL + 
Sbjct  137  HSRGGKTAFAVALGHAATLDPSITFSALIGIDPVAGTNKFMRTDPHILTYKPESFDLDIP  196

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            V V+G+GLG  K N + PPCAP  +NH +FY+EC+    +FVA DYGH+DMLDD+  G  
Sbjct  197  VAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATKAHFVAADYGHMDMLDDDLPGFV  255

Query  815  GKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDFSSLAAI  943
            G    C+CKNG ++++ MR+FVGG VVAFL+  L G+ S +  I
Sbjct  256  GFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKSEIRLI  299



>gb|KHN44574.1| Chlorophyllase-1 [Glycine soja]
Length=313

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/306 (45%), Positives = 189/306 (62%), Gaps = 9/306 (3%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            AT++F +G    +  +V+     S  PPKPLLI TP+    GA+P+ LF+HG+   N +Y
Sbjct  10   ATDVFQMGNIQWKQFNVD-TSSASFSPPKPLLIFTPT--VPGAYPVILFVHGFFIRNFYY  66

Query  269  SQLIQHIASHGFIVVAPQLYSVA-GADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            S+L+ HI SHGFI+VAPQL+S         E++   ++ +W+ E L + LP +V  N  K
Sbjct  67   SKLLAHIVSHGFIIVAPQLFSNGLPMYGPTEVEYAGKVADWIAEELQHLLPENVEANLDK  126

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            + L GHSRGGK  F +ALG  A+T+LK SAL+G+DPV G  K  +T P +LT  P+SFDL
Sbjct  127  LVLSGHSRGGKTVFAVALGH-AKTNLKFSALVGIDPVAGTSKYCRTRPHILTGKPRSFDL  185

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETG  805
             M V VIG+GLG  K N   PPCAP GVN+++F+ EC+ P   FV   YGH+DML+D+T 
Sbjct  186  KMPVEVIGTGLGPEKLNCCTPPCAPDGVNYKEFFNECKPPCAKFVVAKYGHMDMLNDDTP  245

Query  806  GVRGK-ATYCLCKNGKE--RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
            G+ G   + C+CKNG    R  MR   GG VV+FLR  L   +    AI  +   +AP E
Sbjct  246  GLIGTLVSKCMCKNGTTGPRDLMRRTTGGLVVSFLRAQLNDLWKDFDAIL-KDPNLAPTE  304

Query  977  LQTVAF  994
            +  V +
Sbjct  305  VDGVDY  310



>ref|XP_010477190.1| PREDICTED: chlorophyllase-1-like [Camelina sativa]
Length=326

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 187/297 (63%), Gaps = 7/297 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F++G     +++ +P +     PPKP++I +P+   AG +P+ LF HG+  +N FYS L+
Sbjct  24   FEMGSLPTTVITADPSRNDLTAPPKPVIIISPT--VAGTYPVVLFFHGFYLHNYFYSDLL  81

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGG  460
             H++SHG+I+VAPQL  +       E+     + NW  E L   LP  V+ + +  AL G
Sbjct  82   NHVSSHGYILVAPQLCKLMPPGGQVEVDDAGSVINWTTENLKAHLPSSVNAHGEYTALVG  141

Query  461  HSRGGKVAFGLALGKIARTD--LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            HSRGGK AF +ALG  A  D   K SALIG+DPV G +K  +T P +LTY P SF+L + 
Sbjct  142  HSRGGKTAFAVALGHAATLDPSFKFSALIGIDPVAGSNKFMRTDPHILTYEPDSFELDIP  201

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            V+V+G+GLG  ++N + PPCAP  +NH +FY+EC+    +FVA D+GH+DMLDD+  G  
Sbjct  202  VVVVGTGLGPERKN-VMPPCAPTDLNHEEFYRECKATKSHFVAADFGHMDMLDDDLPGFV  260

Query  815  GKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G    C+CKNGK +++ MR FVGG VVAFL+  L G+ + +  I  +   ++PV L 
Sbjct  261  GFMAGCMCKNGKGKKSEMRKFVGGIVVAFLKYSLWGEKAEIRRIV-KDPLVSPVRLD  316



>ref|XP_010523688.1| PREDICTED: chlorophyllase-1 [Tarenaya hassleriana]
Length=319

 Score =   250 bits (638),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/288 (45%), Positives = 180/288 (63%), Gaps = 6/288 (2%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            ++ F+ G     ++  +P +     PPKP++I  P+   AG +P+  F HG+   N FYS
Sbjct  10   SSAFEPGSLPTTVIKADPSREDPVSPPKPVMIVAPT--VAGTYPVVFFFHGFYLRNYFYS  67

Query  272  QLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIA  451
             ++ H+ASHGFI+VAPQL  +       E+    ++ NW P+ L + LP  V P+ +  +
Sbjct  68   DVLSHVASHGFILVAPQLCKLLPPGGQVEVDDAGKVINWAPKYLKSLLPGSVKPSGEDTS  127

Query  452  LGGHSRGGKVAFGLALGKIARTD--LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            L GHSRGGK AF +ALG  +  D   K SAL+G+DPV G +   +T P +LTY P+SF+L
Sbjct  128  LVGHSRGGKTAFAVALGHASTLDPSTKFSALVGIDPVAGSNVCMRTQPHILTYEPESFEL  187

Query  626  GMAVMVIGSGLGEV-KRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDET  802
             M V V+G+GLG + K  P  PPCAP GVNH++F+ ECR    +FVA DYGH+DMLDD+ 
Sbjct  188  DMPVAVVGTGLGPLWKTKPPSPPCAPDGVNHKEFFNECRPTRAHFVAADYGHMDMLDDDL  247

Query  803  GGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAI  943
             G  G    CLCK GK +++ MR FVGG VVAFL+  + GD S + +I
Sbjct  248  EGAVGYLAGCLCKKGKLDKSGMRRFVGGIVVAFLKYSVFGDKSEINSI  295



>ref|XP_010498391.1| PREDICTED: chlorophyllase-1-like [Camelina sativa]
Length=325

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 184/297 (62%), Gaps = 7/297 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F++G     +++ +P       PPKP++I +P+   AG +P+ LF HG+  +N FYS L+
Sbjct  23   FEIGSLPTTVITADPSGNDLTAPPKPVIIISPT--VAGTYPVVLFFHGFYLHNYFYSNLL  80

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGG  460
             H+ASHG+I++APQL  +       E+     + NW  E L   LP  V+ + +  AL G
Sbjct  81   NHVASHGYILIAPQLCKLMPPGGQVEVDDAGSVINWTSENLKAHLPRSVNAHGEYTALVG  140

Query  461  HSRGGKVAFGLALGKIARTD--LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            HSRGGK AF +ALG  A  D   K SALIG+DPV G +K  +T P +LTY P SF+L + 
Sbjct  141  HSRGGKTAFAVALGHAATLDPSFKFSALIGIDPVAGANKCMRTDPHILTYKPDSFELDIP  200

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            V V+G+GLG  ++N + PPCAP  +NH +FY+EC+    +FVA D+GH+DMLDD+  G  
Sbjct  201  VAVVGTGLGPKRKN-VMPPCAPADLNHEEFYKECKATKSHFVAADFGHMDMLDDDLPGFV  259

Query  815  GKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G    C+CKNGK ++  MR FVGG VVAFL+  L G+ S +  +  +   ++PV L 
Sbjct  260  GFMAGCMCKNGKGKKKEMRKFVGGIVVAFLKYSLWGEKSEIRRVV-KDPLVSPVRLD  315



>ref|XP_010459642.1| PREDICTED: chlorophyllase-1-like [Camelina sativa]
Length=326

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 184/297 (62%), Gaps = 7/297 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F++G     +++ +P       PPKP++I +P+   AG +P+ LF HG+  +N FYS L+
Sbjct  24   FEMGSLPTIVITADPSGNDLTAPPKPVIIISPT--VAGNYPVVLFFHGFYLHNYFYSDLL  81

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGG  460
             H+ASHG+I+VAPQL  +       E+     + NW  E L   LP  V+ + +  AL G
Sbjct  82   NHVASHGYILVAPQLCKLMPPGGQVEVDDAGSVINWTTENLKAHLPSSVNAHGEYTALVG  141

Query  461  HSRGGKVAFGLALGKIART--DLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            HSRGGK AF +ALG  A      K SALIG+DPV G +K  +T P +LTY P SF+L + 
Sbjct  142  HSRGGKTAFAVALGHAATLAPSFKFSALIGIDPVAGANKCMRTDPHILTYEPDSFELDIP  201

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            + V+G+GLG  KRN + PPCAP  +NH +FY+EC+    +FVA D+GH+DMLDD+  G  
Sbjct  202  IAVVGTGLGP-KRNNVMPPCAPADLNHEEFYKECKATKSHFVAADFGHMDMLDDDLPGFV  260

Query  815  GKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G    C+CKNGK +++ MR FVGG VVAFL+  L G+ S +  I  +   ++PV L 
Sbjct  261  GFMAGCMCKNGKGKKSEMRKFVGGIVVAFLKYSLWGEKSEIRRIV-KDPLVSPVRLD  316



>ref|NP_564094.1| chlorophyllase 1 [Arabidopsis thaliana]
 sp|O22527.1|CLH1_ARATH RecName: Full=Chlorophyllase-1; Short=AtCLH1; AltName: Full=Chlorophyll-chlorophyllido 
hydrolase 1; Short=Chlase 1; AltName: 
Full=Coronatine-induced protein 1; Short=CORI1 [Arabidopsis 
thaliana]
 gb|AAG12547.1|AC007797_7 coronatine-induced protein 1 [Arabidopsis thaliana]
 gb|AAC13947.1| coronatine-induced protein 1 [Arabidopsis thaliana]
 gb|AAM20666.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15628.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29881.1| chlorophyllase 1 [Arabidopsis thaliana]
Length=324

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 184/297 (62%), Gaps = 7/297 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F++G      + V+P +  S  PPKP+ I  P+   AG +P+ LF HG+   N FYS ++
Sbjct  19   FEIGSLPTTEIPVDPVENDSTAPPKPVRITCPT--VAGTYPVVLFFHGFYLRNYFYSDVL  76

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGG  460
             HIASHG+I+VAPQL  +       E+     + NW  E L   LP  V+ N +  +L G
Sbjct  77   NHIASHGYILVAPQLCKLLPPGGQVEVDDAGSVINWASENLKAHLPTSVNANGKYTSLVG  136

Query  461  HSRGGKVAFGLALGKIARTD--LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            HSRGGK AF +ALG  A  D  +  SALIG+DPV G +K  +T P +LTY P+SF+L + 
Sbjct  137  HSRGGKTAFAVALGHAATLDPSITFSALIGIDPVAGTNKYIRTDPHILTYKPESFELDIP  196

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            V V+G+GLG  K N + PPCAP  +NH +FY+EC+    +FVA DYGH+DMLDD+  G  
Sbjct  197  VAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATKAHFVAADYGHMDMLDDDLPGFV  255

Query  815  GKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G    C+CKNG ++++ MR+FVGG VVAFL+  L G+ + +  I  +   ++P +L 
Sbjct  256  GFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKAEIRLIV-KDPSVSPAKLD  311



>gb|KDP21408.1| hypothetical protein JCGZ_21879 [Jatropha curcas]
Length=340

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 184/315 (58%), Gaps = 17/315 (5%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            +F  GK +     VE    ++  PPKPLLI TP       +P+F+FLHG    N FY+ +
Sbjct  28   VFGTGKLSTTYYQVEESDQSAASPPKPLLIVTPINVE-DTYPVFVFLHGTCLSNYFYTDI  86

Query  278  IQHIASHGFIVVAPQLYS--------VAGADATEEIKCTAQITNWLPE--GLHNFLPPHV  427
            ++HI+SHG+IVVAPQLYS        +       E++  A++ NWLP   GL + LP ++
Sbjct  87   LEHISSHGYIVVAPQLYSCLINRVIPMLPISGPRELEFAAEVMNWLPSASGLQSVLPENI  146

Query  428  HPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLS--ALIGVDPVDGMDKGKQTPPPVLT  601
              +  K+++GGHSRGGK AF LALG  A   LKL   AL  +DPV+GM K   T P   T
Sbjct  147  KADLNKLSVGGHSRGGKTAFALALG-YANIPLKLKILALAALDPVEGMSKNNPTLPKTFT  205

Query  602  YIPQSFDLGMAVMVIGSGLGEVKRNPLF-PPCAPKGVNHRDFYQECRGPACYFVAKDYGH  778
            Y+PQS DL + V VIG+GLG      L  P CAP  VNH +F+ ECR P  +FVA +YGH
Sbjct  206  YLPQSLDLSIPVTVIGTGLGNQPICWLVCPACAPNEVNHEEFFNECRAPTTHFVAAEYGH  265

Query  779  VDMLDDETGGVRGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRH  955
            +DML++    + G+ T  LCK+ +  +  MR  VGG VVAFL+ Y EG       I  + 
Sbjct  266  MDMLNENIKDLVGRLTNSLCKSSQSPKEPMRKTVGGIVVAFLKAYFEGQSGDYLTIV-QE  324

Query  956  EEIAPVELQTVAFQE  1000
              +APV+L  V F E
Sbjct  325  PSVAPVKLDPVQFTE  339



>gb|ACO50429.1| chlorophyllase 2 [Pachira macrocarpa]
Length=313

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 142/305 (47%), Positives = 189/305 (62%), Gaps = 6/305 (2%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            T   +F  GKY    VSV+P   +   PPKPLLI TPSE   G +P+ LF HG+   N+F
Sbjct  13   TVVPVFVTGKYHPTSVSVDPSNSSPSSPPKPLLIFTPSEQ--GTYPVILFFHGFYLRNNF  70

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            Y+ L+ HI+SHGFI+VAPQL ++     TEE++  A++ +WLP GL + LP +V  N  K
Sbjct  71   YTGLLLHISSHGFIIVAPQLSNIIPPSGTEEVEHAAKVADWLPSGLPSVLPGNVEANLAK  130

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            +AL GHSRGGK AF LALG+ A+T    SAL+G+DPV G ++  +T P +LTY P SFDL
Sbjct  131  LALVGHSRGGKTAFALALGR-AKTAQNFSALVGIDPVAG-NRFGETSPKILTYTPGSFDL  188

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETG  805
             + V V+G+GLG   +  +  PCAP   NH +F+ EC+ P  +F AK+YGH+D LDD   
Sbjct  189  SIPVAVVGTGLGPESKGCMPCPCAPTQYNHEEFFNECKPPRVHFDAKNYGHMDTLDDNPS  248

Query  806  GVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G  GK +  +C NG+  R  MR  VGG VVAFL  + E +      I +    +APV L 
Sbjct  249  GFIGKLSDTICVNGEGPRDPMRRCVGGIVVAFLNYFFEAEKEDFMTIMNE-PYVAPVTLD  307

Query  983  TVAFQ  997
             V F 
Sbjct  308  QVQFN  312



>ref|XP_007152724.1| hypothetical protein PHAVU_004G154100g [Phaseolus vulgaris]
 gb|ESW24718.1| hypothetical protein PHAVU_004G154100g [Phaseolus vulgaris]
Length=315

 Score =   248 bits (632),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 139/282 (49%), Positives = 180/282 (64%), Gaps = 15/282 (5%)
 Frame = +2

Query  173  KPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYS----VAG  340
            KPLLI TP+    GA+P+ +F HG+  +NS+YS+L+ HIASHGFI+VAPQL+     + G
Sbjct  38   KPLLIFTPT--VPGAYPVMVFYHGFCIHNSYYSELLGHIASHGFILVAPQLFCKGFPIFG  95

Query  341  ADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTD  520
            +D   EIK   ++ +W+ EGL   LP  V    +K+ L GHS+GGK AF +A G  A+T 
Sbjct  96   SD---EIKFAGKVVDWVAEGLQPLLPEKVEAKLEKVVLSGHSKGGKTAFCVAQG-YAKTI  151

Query  521  LKLSALIGVDPVDGMDKGK--QTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPC  694
            L  SALIG+DPV G  K K  +T P +LT +P+S +L + V VIG+GLG    N LFPPC
Sbjct  152  LGFSALIGIDPVGGTSKCKVSKTVPEILTGVPRSLNLNIPVAVIGTGLGPESANVLFPPC  211

Query  695  APKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGK-ATYCLCKNGK-ERAAMR  868
            AP G NH+DF+ E + P  +FVA +YGH+DMLDDET G  G   + C+CKNGK  R  MR
Sbjct  212  APDGENHKDFFNESKPPCAHFVATEYGHMDMLDDETPGPLGTIMSKCMCKNGKGHRDLMR  271

Query  869  AFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
              VGG VVAFLR  L+  F    AI      +AP  L  V +
Sbjct  272  KTVGGLVVAFLRAQLDEKFKDFDAILG-DPNLAPARLDDVVY  312



>ref|XP_002963743.1| hypothetical protein SELMODRAFT_66990, partial [Selaginella moellendorffii]
 gb|EFJ35614.1| hypothetical protein SELMODRAFT_66990, partial [Selaginella moellendorffii]
Length=250

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 161/249 (65%), Gaps = 3/249 (1%)
 Frame = +2

Query  167  PPKPLLIATPSE-ASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGA  343
            PPKPLL+A PS  A A  FP+ +  HG+   N FY QL++HIASHGFIVVAPQ+Y  AG 
Sbjct  1    PPKPLLVAAPSNPAPADGFPVLILFHGFCLSNLFYRQLMRHIASHGFIVVAPQMYRFAGP  60

Query  344  DATEEIKCTAQITNWLPEGLHNFLPPH-VHPNTQKIALGGHSRGGKVAFGLALGKIART-  517
            DA+ EI+  A I +W+P  LH FLP   V  +  K+A+ GHSRGGKVAF LALG   R+ 
Sbjct  61   DASPEIEDAAAIISWIPGNLHRFLPADGVRADATKLAIAGHSRGGKVAFSLALGFSKRSL  120

Query  518  DLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCA  697
              ++SALI +DPVDG     QT PPVL Y   S      V++I +G G  K+N LFP CA
Sbjct  121  PSRVSALIALDPVDGTSSASQTNPPVLRYRKDSLQPNCPVLIIAAGYGGEKKNFLFPACA  180

Query  698  PKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFV  877
            P+GV  + F+++C  PA    A ++GH D LDD T G++G  T  + KNGK R  MR F 
Sbjct  181  PRGVGPQAFFRDCCAPAFLLSAPEHGHFDFLDDATSGLKGGLTSLVGKNGKARKPMRIFT  240

Query  878  GGAVVAFLR  904
             GA+VAFL+
Sbjct  241  AGAIVAFLQ  249



>gb|EMS62705.1| Chlorophyllase-1 [Triticum urartu]
Length=303

 Score =   244 bits (624),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 178/300 (59%), Gaps = 22/300 (7%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            T++F  GK  VE + V+ +   +  PP P+LI  P +A  G +P+ + LHG+  +N FY 
Sbjct  20   TSVFQPGKLAVEAIQVDENAAPT--PPIPVLIVAPKDA--GTYPVAMLLHGFFLHNHFYE  75

Query  272  QLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIA  451
             L++H+ASHGFI+VAPQ+            +    + N  P GL + LP  V P   K+A
Sbjct  76   HLLRHVASHGFIIVAPQVD-----------RYHLHMYNGPPAGLPSVLPKGVEPELSKLA  124

Query  452  LGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGM  631
            L GHSRGG  AF LALG  A+T L  SALIG+DPV G  K  Q  P +LT+ P SF + M
Sbjct  125  LAGHSRGGHTAFSLALGH-AKTQLTFSALIGLDPVAGTGKSSQLQPKILTHEPSSFGMAM  183

Query  632  AVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGV  811
             V+V+G+GLGE K+N  FPPCAP+ VNH +FY+ECR P  YFV KDYGH+DMLDD     
Sbjct  184  PVLVVGTGLGEEKKNIFFPPCAPRDVNHAEFYRECRPPCYYFVTKDYGHLDMLDDGA---  240

Query  812  RGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTV  988
              K   C+CK+G   +  MR  V G +VAFL   L G    L AI  R   +AP  L  V
Sbjct  241  -PKFITCVCKDGNGCKGKMRRCVAGIMVAFLNAALGGKDGDLEAIL-RDPAVAPTTLDPV  298



>ref|XP_002974826.1| hypothetical protein SELMODRAFT_57004, partial [Selaginella moellendorffii]
 gb|EFJ24346.1| hypothetical protein SELMODRAFT_57004, partial [Selaginella moellendorffii]
Length=250

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 160/249 (64%), Gaps = 3/249 (1%)
 Frame = +2

Query  167  PPKPLLIATPSE-ASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGA  343
            PPKPLL+A PS  A A  FP+ +  HG+   N FY QL++HIASHGFIVVAPQ+Y  AG 
Sbjct  1    PPKPLLVAAPSNPAPADGFPVLILFHGFCLSNLFYRQLMRHIASHGFIVVAPQMYRFAGP  60

Query  344  DATEEIKCTAQITNWLPEGLHNFLPPH-VHPNTQKIALGGHSRGGKVAFGLALGKIART-  517
            DA+ EI+  A I +W+P  LH FLP   V  +  K+A+ GHSRGGKVAF LALG   R+ 
Sbjct  61   DASPEIEDAAAIISWVPGNLHRFLPADGVRADATKLAIAGHSRGGKVAFSLALGFSKRSL  120

Query  518  DLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCA  697
              ++SALI +DPVDG     QT PPVL Y   S      V++I +G G  K+N LFP CA
Sbjct  121  PSRVSALIALDPVDGTSSASQTNPPVLRYRKDSLQPNCPVLIIAAGYGGEKKNFLFPACA  180

Query  698  PKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFV  877
            P+GV    F+++C  PA    A ++GH D LDD T G++G  T  + KNGK R  MR F 
Sbjct  181  PRGVGPLAFFRDCCAPAFLLSAPEHGHFDFLDDATSGLKGGLTSLVGKNGKARKPMRIFT  240

Query  878  GGAVVAFLR  904
             GA+VAFL+
Sbjct  241  AGAIVAFLQ  249



>ref|XP_002459848.1| hypothetical protein SORBIDRAFT_02g012300 [Sorghum bicolor]
 gb|EER96369.1| hypothetical protein SORBIDRAFT_02g012300 [Sorghum bicolor]
Length=318

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/309 (46%), Positives = 190/309 (61%), Gaps = 16/309 (5%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            T++F  GK  VE++SVE     +     P+ I   +   AG +P+ + LHG+   N +Y 
Sbjct  17   TSVFQPGKLAVEVISVEHDARPTP---PPIPILIAAPKDAGTYPVAILLHGFFLQNRYYE  73

Query  272  QLIQHIASHGFIVVAPQLY-SVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
            QL++H+AS GFI+VAPQ + S+      ++I   A++T+WLPEGL   LP  V  +  K+
Sbjct  74   QLLKHVASFGFIMVAPQFHTSLISNSDADDIAAAAKVTDWLPEGLPTVLPTGVEADLSKL  133

Query  449  ALGGHSRGGKVAFGLALGKIARTD----LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQS  616
            AL GHSRGG  AF LALG  A+T+    LK SALIG+DPV G  K  Q PP +LTY P S
Sbjct  134  ALAGHSRGGHTAFSLALG-YAKTNTSSLLKFSALIGLDPVAGTGKNSQLPPAILTYEPSS  192

Query  617  FDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDD  796
            FD+ + V+VIG+GLG+ + N LFPPCAP  VNH +FY+ECR P  + V KDYGH+DMLDD
Sbjct  193  FDIAVPVLVIGTGLGDERENALFPPCAPVEVNHAEFYRECRAPCYHLVTKDYGHLDMLDD  252

Query  797  ETGGVRGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYL-EGDFSSLAAIRDRHEEIAP  970
            +      K   CLCK G   +  MR  V G +VAFL+  + E +   L AI  +H  +AP
Sbjct  253  DA----PKLVTCLCKEGNTCKDVMRRTVAGIMVAFLKAVMGEDEDGDLKAIL-QHPGLAP  307

Query  971  VELQTVAFQ  997
              L  V ++
Sbjct  308  TILDPVEYR  316



>ref|XP_006304020.1| hypothetical protein CARUB_v10009755mg [Capsella rubella]
 gb|EOA36918.1| hypothetical protein CARUB_v10009755mg [Capsella rubella]
Length=322

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/297 (42%), Positives = 181/297 (61%), Gaps = 6/297 (2%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            FD+G     +++ +P +     PPKP++I +P+  +AG +P+  F HG+   N +YS ++
Sbjct  19   FDIGSLPTTVLTADPSENDLTAPPKPVIITSPT--AAGTYPVVFFFHGFYLRNVYYSDVL  76

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGG  460
             HIASHG+I+VAPQL  +       E+     + NW  + L   LP  V+ + +  AL G
Sbjct  77   NHIASHGYILVAPQLCELIPPGGQVEVDDAGSVINWTLQNLKAHLPSSVNTHGEYTALVG  136

Query  461  HSRGGKVAFGLALGKIARTD--LKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
            HSRGGK AF +ALG  A  D   K SAL+ +DPV G+ K  +T P +LTY P+SF+L + 
Sbjct  137  HSRGGKTAFAVALGHAATLDPSFKFSALVAIDPVAGLSKCIRTDPHILTYKPESFELDIP  196

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
            V V+G+GLG  + + + PPCAP  +NH +FY+EC+    +FVA D+GH+DMLDD+  G  
Sbjct  197  VAVVGTGLGPERNHVVMPPCAPTDLNHDEFYKECKATKAHFVAADHGHMDMLDDDLPGFF  256

Query  815  GKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            G    C CKNGK  ++ MR FVGG VVAFL+  L  + S +  I  +   ++PV L 
Sbjct  257  GYVAGCTCKNGKGNKSEMRRFVGGIVVAFLKYSLWAEKSEIRRIV-KDPFVSPVRLD  312



>ref|XP_011090376.1| PREDICTED: chlorophyllase-1-like [Sesamum indicum]
Length=331

 Score =   243 bits (619),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 178/321 (55%), Gaps = 30/321 (9%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            ++F+ GK+ V  ++V+    +   PP  L I  P E   G +P+ LF HG+LF N++YS 
Sbjct  17   DVFETGKFVVTTITVKTSDASR--PPTELFIVAPLEK--GTYPLLLFCHGFLFGNNWYSN  72

Query  275  LIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
            L+ HIASHG+IVVAPQ Y        EE++  AQ+T WL  GL   LP  V+P+   +AL
Sbjct  73   LLGHIASHGYIVVAPQFYGFIPISMAEEVRRAAQVTEWLTTGLPLVLPEKVNPDIDNLAL  132

Query  455  GGHSRGGKVAFGLALGKIARTDL--------------------KLSALIGVDPVDGMDKG  574
             GHSRGGK AF LALG+  +                       K  A+IGVDPV G    
Sbjct  133  AGHSRGGKTAFALALGRTEQKSRKKKAQSIRDVVIDVDVSQPSKFKAVIGVDPVAGSSPS  192

Query  575  KQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACY  754
             + PP +L YIP+ F++ + V VIG+G G      L PPCAP GVNH +F+ E + P CY
Sbjct  193  DRPPPQILEYIPRCFNMSIPVAVIGTGYGNQSVGILRPPCAPDGVNHSEFFNESKPPVCY  252

Query  755  FVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSS  931
            F+AKDYGH DMLDD    +       +CK+GK  +  MR  +GG VVA L+ YL G   +
Sbjct  253  FLAKDYGHCDMLDDWYANMMSY----VCKSGKGPKDLMRKSIGGIVVAVLKSYLGGSDDA  308

Query  932  LAAIRDRHEEIAPVELQTVAF  994
            L AI       AP  L  V +
Sbjct  309  LNAIV-HDPTTAPTTLDPVIY  328



>gb|KDP21409.1| hypothetical protein JCGZ_21880 [Jatropha curcas]
Length=353

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 190/316 (60%), Gaps = 29/316 (9%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            ++F+ G  +  L +V+        PPKPLLIA P+   AG +PI +FLHG    N FYS 
Sbjct  43   SVFEPGTLSTVLDNVQSS------PPKPLLIARPT--VAGTYPILIFLHGTCLENYFYSD  94

Query  275  LIQHIASHGFIVVAPQLYS----------VAGADATEEIKCTAQITNWLPEGLHNFLPPH  424
            ++QHIASHG+IVVAPQLYS          ++G D   E+   A++ NWL  GL N LP +
Sbjct  95   ILQHIASHGYIVVAPQLYSCLRWLINILPISGPD---ELNFAAEVANWLISGLENVLPEN  151

Query  425  VHPNTQKIALGGHSRGGKVAFGLALGKIARTDL--KLSALIGVDPVDGMDKGKQTPPPVL  598
            +  +  K+A+ GHSRGGK+AF LALG  A+T L   +SALIG+DPV+G +      P VL
Sbjct  152  ITGDINKLAIAGHSRGGKMAFALALG-YAKTPLTVTISALIGLDPVEGTEN-IVVDPKVL  209

Query  599  TYIPQSFDLGMAVMVIGSGLGEVKRNPLF-PPCAPKGVNHRDFYQECRGPACYFVAKDYG  775
            TYIP SF+L + V VIGSGLG      L  P CAP G+NH ++Y EC+ P  +FV  DYG
Sbjct  210  TYIPNSFNLSVPVAVIGSGLGNESNCWLVCPACAPNGMNHVEYYSECKNPVSHFVTTDYG  269

Query  776  HVDMLDD-ETGGVRGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRD  949
            H+D++DD     + G     +CKN K+ R  MR  VGG  VAFL+ YL G+      I  
Sbjct  270  HMDVIDDGLKDKLLGIMANVMCKNSKDSRDPMRRTVGGIFVAFLKAYLFGESGDYMTIL-  328

Query  950  RHEEIAPVELQTVAFQ  997
            +   +APV L  V F+
Sbjct  329  QDPSVAPVTLDPVQFK  344



>ref|XP_003528959.1| PREDICTED: chlorophyllase-1-like [Glycine max]
Length=307

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 134/306 (44%), Positives = 184/306 (60%), Gaps = 15/306 (5%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            AT++F +G    +  +V+     S  PPKPLLI TP+    GA+P+ LF+HG+   N +Y
Sbjct  10   ATDVFQMGNIQWKQFNVD-TSSASFSPPKPLLIFTPT--VPGAYPVILFVHGFFIRNFYY  66

Query  269  SQLIQHIASHGFIVVAPQLYSVA-GADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQK  445
            S+L+ HI SHGFI+VAPQL+S         E++   ++ +W+ E L + LP +V  N  K
Sbjct  67   SKLLAHIVSHGFIIVAPQLFSNGLPMYGPTEVEYAGKVADWIAEELQHLLPENVEANLDK  126

Query  446  IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            + L GHSRGGK  F +ALG  A+T+LK SAL+G        K  +T P +LT  P+SFDL
Sbjct  127  LVLSGHSRGGKTVFAVALGH-AKTNLKFSALVGTS------KYCRTRPHILTGKPRSFDL  179

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETG  805
             M V VIG+GLG  K N   PPCAP GVN+++F+ EC+ P   FV   YGH+DML+D+T 
Sbjct  180  KMPVEVIGTGLGPEKLNCCTPPCAPDGVNYKEFFNECKPPCAKFVVAKYGHMDMLNDDTP  239

Query  806  GVRGK-ATYCLCKNGKE--RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
            G+ G   + C+CKNG    R  MR   GG VV+FLR  L   +    AI  +   +AP E
Sbjct  240  GLIGTLVSKCMCKNGTTGPRDLMRRTTGGLVVSFLRAQLNDLWKDFDAIL-KDPNLAPTE  298

Query  977  LQTVAF  994
            +  V +
Sbjct  299  VDGVDY  304



>ref|XP_004512891.1| PREDICTED: chlorophyllase-1-like [Cicer arietinum]
Length=323

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/308 (44%), Positives = 187/308 (61%), Gaps = 18/308 (6%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            TN+F  G    +  +V+    ++   PKPLL+ TP+    G +PI LF HG+   NSFYS
Sbjct  16   TNVFQSGNIHWKQFNVDT---SNRNCPKPLLVFTPT--VEGTYPIILFCHGFGVCNSFYS  70

Query  272  QLIQHIASHGFIVVAPQLYSVAGADATE-EIKCTAQITNWLPEGLHNFLPPHVHPNTQK-  445
             L+ HI SHGFIVVAPQL++V      + E+    ++ NW+  GL   +  ++    +  
Sbjct  71   NLLGHITSHGFIVVAPQLFTVGLPMPGQCEVNFAGKVVNWISNGLQPIINENIEEKVEAK  130

Query  446  ----IALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGK--QTPPPVLTYI  607
                +  G HS+GGK AF +ALG  A+T+LK SALIG+DPV G  K K  +TPP +LT  
Sbjct  131  LDTLVLAGHHSKGGKTAFAIALGH-AKTNLKFSALIGIDPVAGPSKCKICRTPPHILTGQ  189

Query  608  PQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDM  787
             QSF+L + V+VIG+GLG  K N    PCAP+GVNH+ F+ EC+ P  +FV KDYGH+DM
Sbjct  190  AQSFNLNIPVVVIGTGLGPEKSNCFSIPCAPEGVNHKQFFYECKPPCAHFVTKDYGHMDM  249

Query  788  LDD--ETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHE  958
            LDD  +T G+R     C+CK+G   +  MR  +GG VVAFL+ +L   +    AI D   
Sbjct  250  LDDDSQTQGLRESVLKCICKSGIGSKDFMRRTLGGLVVAFLKAHLNNQWKDFQAILDD-P  308

Query  959  EIAPVELQ  982
             +AP +L+
Sbjct  309  NLAPAKLE  316



>ref|XP_003620408.1| Chlorophyllase-1 [Medicago truncatula]
 gb|AES76626.1| chlorophyllase enzyme [Medicago truncatula]
Length=314

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 184/309 (60%), Gaps = 19/309 (6%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            T++F+ G    +  +V+    TS   PKPLL+ TP+    G +P+ LF HG+  +NS+Y 
Sbjct  15   TDVFESGNIKWKQFNVD----TS---PKPLLVFTPT--VEGTYPVILFYHGFAIWNSYYH  65

Query  272  QLIQHIASHGFIVVAPQLYSVA-GADATEEIKCTAQITNWLPEGLHNFLPPHVHPNT---  439
            +L+ HI SHGFIVVAPQL+++        E+K   ++ NW+ +GL   L  +   N    
Sbjct  66   KLLGHITSHGFIVVAPQLFTIGLPMPGPCEVKFAGKVANWITKGLQPKLKENTKENVVAK  125

Query  440  -QKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGK--QTPPPVLTYIP  610
               + L GHS+GGK AF +ALG  A T+LK SALIG+DPV G  K K  +T P +LT   
Sbjct  126  LDNLVLAGHSKGGKTAFAVALGH-AETNLKFSALIGIDPVAGPSKCKITRTLPHILTGQA  184

Query  611  QSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDML  790
            QSFDL M V+VIG+GLG    N    PCAP GVNH +F+ EC+ P  +FV KDYGH+DML
Sbjct  185  QSFDLNMPVIVIGTGLGPEPSNCSPLPCAPDGVNHEEFFYECKPPCAHFVVKDYGHMDML  244

Query  791  DDETGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIA  967
            DDET  +RG    CLCKNG   +  M   +GG VV+FL+ YL         I +    +A
Sbjct  245  DDETHDIRGSLLKCLCKNGTGPKDLMIRTLGGLVVSFLKAYLYNQPEDFEVILED-PNLA  303

Query  968  PVELQTVAF  994
            P +L+   F
Sbjct  304  PAKLEEPVF  312



>gb|EMS58425.1| Chlorophyllase-2, chloroplastic [Triticum urartu]
Length=320

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 181/313 (58%), Gaps = 23/313 (7%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            AT +F  G   V++  V+  K       +PL++  P E   GA+P+ +FLHG+   NS+Y
Sbjct  2    ATTVFQAGPMEVDVKHVD--KSMIPNLARPLMVVAPKET--GAYPVIVFLHGWNMLNSWY  57

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPE---GLHNFLP-----PH  424
             QL+ H+ASHGFI VAPQLY +      ++I  T +ITNWL +   GL + L       H
Sbjct  58   EQLLTHVASHGFIAVAPQLYWMVSEPDADDIDATKRITNWLADHDKGLAHVLKDVLKLEH  117

Query  425  VHPNTQKIALGGHSRGGKVAFGLALG---KIARTDLKLSALIGVDPVDGMDKGKQTPPPV  595
            V P+  K+AL GHSRGG+ AF +ALG      + +LK SALIGVDPV G+ + +Q  P V
Sbjct  118  VEPDLSKLALAGHSRGGQTAFAVALGLGDAKTKLELKFSALIGVDPVAGVSRAQQLEPKV  177

Query  596  LTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYG  775
            LT+ P   D+GM V+V+G+GLG         PCAP GVNH +FY+EC  P  + V KDYG
Sbjct  178  LTFEPDCLDVGMPVLVMGTGLGPKHIGGF--PCAPVGVNHAEFYKECAPPRYHLVVKDYG  235

Query  776  HVDMLDDETGGVRGKATYCLCKNGKE--RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRD  949
            H+DMLDD    +      C+C   +   +   R  +GGA+VAFLR  L  D   L  I  
Sbjct  236  HLDMLDDNVPYIINN---CMCMRNQHDTKDLARRTMGGAMVAFLRAKLRIDVRDLITIY-  291

Query  950  RHEEIAPVELQTV  988
            R+ EIAP  L  V
Sbjct  292  RNPEIAPAVLDQV  304



>ref|XP_008449344.1| PREDICTED: chlorophyllase-1-like [Cucumis melo]
Length=322

 Score =   232 bits (592),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 130/296 (44%), Positives = 178/296 (60%), Gaps = 9/296 (3%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            +F+ GK+ V  ++ +    +S    KPL I TP+  + G++P+ LF HG+    SFYS  
Sbjct  24   VFEKGKFEVSSITTKSGIFSSL---KPLFIFTPT--TPGSYPVILFFHGFSCVGSFYSDF  78

Query  278  IQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALG  457
            +  IASHG+++ APQLY +   +  +EIK   ++  WLP GL+  LP +V  +  K++L 
Sbjct  79   LNLIASHGYVIAAPQLYVMPTTNQMQEIKSATEVIKWLPSGLNPLLPTNVEGDISKLSLV  138

Query  458  GHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAV  637
            GHSRGGK AF LALG I+R  L  SA+IG+DPV G  K  Q  P +LT + + F +   +
Sbjct  139  GHSRGGKTAFSLALG-ISRPSLPFSAVIGIDPVAGT-KCFQPQPHILTPLSEPFKISAPI  196

Query  638  MVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRG  817
             VIG+GLG    +P+  PCAP G NH  F+++CR    +FVA DYGH+D+L+D   G+ G
Sbjct  197  TVIGTGLGPKSASPITCPCAPDGFNHVAFFKKCRPTCAHFVAVDYGHMDILNDNPPGITG  256

Query  818  KATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
              T   CKNGK  R  MR    G VVA L+ YLE D S L AI      IAPV+L 
Sbjct  257  LLTNIACKNGKGPRKLMRECCSGLVVASLKAYLENDESFLKAIY-VDPSIAPVDLN  311



>ref|XP_002271936.2| PREDICTED: chlorophyllase-1 [Vitis vinifera]
Length=315

 Score =   229 bits (584),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 134/312 (43%), Positives = 181/312 (58%), Gaps = 18/312 (6%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            AT+ F  GKYT + +       T+   PK L I TP   + G +P+ LFLHGY      Y
Sbjct  13   ATDAFKRGKYTAKPI-------TTCNAPKTLFIVTPD--TEGTYPVLLFLHGYNICPCCY  63

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
            + L++HI+SHG+IVVAP+L S+       +I   A++ NWL  GL   LP +V P+  ++
Sbjct  64   TNLLEHISSHGYIVVAPRLLSLCSLYGRPDINSAAEVANWLSSGLQPVLPENVVPDLSRL  123

Query  449  ALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            AL GHSRGG +AF LALG      +LK   LIG+DPV G +K  +  P +LT +P SF+L
Sbjct  124  ALAGHSRGGYLAFALALGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFNL  183

Query  626  GMAVMVIGSGLGEVKRNPLFP-PCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE-  799
             + VMVIG+GLG        P  CAP G+N+ +F+ EC+     FV  DYGH+DMLDD+ 
Sbjct  184  DIPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFVIPDYGHMDMLDDDY  243

Query  800  ----TGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
                 G   G     +CK+GK ++ +M   VGG VVA L  +LEG+   L AI D    I
Sbjct  244  CTNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGIVVAMLMAHLEGETGDLDAIVDE-PGI  302

Query  965  APVELQTVAFQE  1000
            APV+L+ V   E
Sbjct  303  APVKLEVVEDSE  314



>ref|XP_003632330.1| PREDICTED: chlorophyllase-1-like [Vitis vinifera]
Length=315

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/312 (43%), Positives = 181/312 (58%), Gaps = 18/312 (6%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            AT++F  GKY  + +       T+   PK L I TP   + G +P+ LFLHGY      Y
Sbjct  13   ATDVFKRGKYAAKPI-------TTCNAPKTLFIVTPD--TEGTYPVLLFLHGYNICPCCY  63

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
              L++HI+SHG+IVVAP+L S+       +I   A++TNWL  GL   LP +V P+  ++
Sbjct  64   MNLLEHISSHGYIVVAPRLLSLCSLYGRPDINSAAEVTNWLSSGLQPVLPENVVPDLSRL  123

Query  449  ALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            AL GHSRGG +AF LALG      +LK   LIG+DPV G +K  +  P +LT +P SF+L
Sbjct  124  ALAGHSRGGYLAFALALGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFNL  183

Query  626  GMAVMVIGSGLGEVKRNPLFP-PCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE-  799
             + VMVIG+GLG        P  CAP G+N+ +F+ EC+     FV  DYGH+DMLDD+ 
Sbjct  184  DIPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFVIPDYGHMDMLDDDY  243

Query  800  ----TGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
                 G   G     +CK+GK ++ +M   VGG VVA L  +LEG+   L AI D    I
Sbjct  244  CTNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGLVVAMLMAHLEGETGDLDAIVDE-PGI  302

Query  965  APVELQTVAFQE  1000
            APV+L+ +   E
Sbjct  303  APVKLEVMEDSE  314



>ref|XP_008465739.1| PREDICTED: chlorophyllase-1-like [Cucumis melo]
Length=326

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 174/298 (58%), Gaps = 9/298 (3%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            +F+ GK+ V L++ +    +S    KPLL+ TP+  SAG++P+ LF HG+    SFYS  
Sbjct  28   VFEKGKFEVSLITEKSGIFSSS---KPLLVFTPT--SAGSYPVILFFHGFSCLGSFYSDF  82

Query  278  IQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALG  457
            +  IASHG+++ APQLY +       EIK   ++  WL  GL   LP +V  +  K++L 
Sbjct  83   LNLIASHGYVIAAPQLYVMPTTSEMNEIKSAVEVITWLSSGLDPLLPTNVKGDISKLSLV  142

Query  458  GHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAV  637
            GHSRGGK AF LALG      L  SA+IG+DPV G  K  Q  P +L  I Q F +   V
Sbjct  143  GHSRGGKTAFSLALG-WGSPSLPFSAIIGIDPVAGT-KYFQPEPHILNPISQPFKISSPV  200

Query  638  MVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRG  817
             VIG+GLG  K  P+  PCAP G NH  F+++C+    +FVA DYGH+D+L+D   G+ G
Sbjct  201  TVIGTGLGPEKATPVTCPCAPNGFNHVAFFKKCKPTCAHFVAVDYGHMDILNDNPPGMTG  260

Query  818  KATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTV  988
              T   CKNGK  R  MR    G VVA L+ YL+ D S L AI      IAP+EL  V
Sbjct  261  FFTNIACKNGKGPRELMRKCCSGLVVASLKAYLDNDVSFLNAIY-VDPSIAPIELNPV  317



>gb|EYU43828.1| hypothetical protein MIMGU_mgv1a009904mg [Erythranthe guttata]
Length=328

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/328 (40%), Positives = 185/328 (56%), Gaps = 13/328 (4%)
 Frame = +2

Query  56    MAVTFsssssTATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLF  235
             M  + +  ++ ++++F+ G Y V  ++V     T   PP  L I +P   + G +P+ LF
Sbjct  1     MTTSAAEIATASSDVFETGNYEVTDINVGSGDATK--PPTDLFIVSP--VTKGTYPVLLF  56

Query  236   LHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFL  415
              HG+   N+ Y+ L+ HIASHG+IVVAP+ Y +      + +   + +T WL  GL + L
Sbjct  57    CHGFYIPNTCYTTLLHHIASHGYIVVAPKFYGLIIISIAKGVNKASLVTEWLSTGLSSVL  116

Query  416   PPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPV  595
             P +V+ + + +AL GHSRGGK AF LAL   A    K  A+IG+DPV G     ++ P +
Sbjct  117   PENVNGDLENLALSGHSRGGKTAFALALASTAPPQ-KFKAVIGIDPVAGSGPSMRSAPKI  175

Query  596   LTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYG  775
             L YIP+SF +   V V+G+G G  +R  L PP AP GVNH +F+ E + P CYF+AKDYG
Sbjct  176   LEYIPRSFGITTPVAVVGTGYGN-QRLGLIPPFAPNGVNHSEFFNESKPPVCYFLAKDYG  234

Query  776   HVDMLDDETGGVRGKATYCLCKN-GKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDR  952
             H DMLDD       K    +CK+ G +R  MR  VGG VVAFLR YL GD      + D 
Sbjct  235   HCDMLDDWI----AKLASFVCKSGGGDRDLMRRGVGGIVVAFLRCYLGGDGDLNGIVGD-  289

Query  953   HEEIAPVELQTVAFQEN*TTKHIWLVAY  1036
                +AP+    V + +    K I +  Y
Sbjct  290   -PSVAPITFDPVIYVKEQKKKKITIWCY  316



>ref|XP_009760775.1| PREDICTED: chlorophyllase-1-like [Nicotiana sylvestris]
Length=304

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/303 (41%), Positives = 176/303 (58%), Gaps = 20/303 (7%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSH--PPPKPLLIATPSEASAGAFPIFLFLHGYLFYNS  262
            + ++F +G   V++  V+     +    PP  LL+ +P     G +P+ LF HG++    
Sbjct  15   SLSVFRLGDLAVKITKVKKGSLNNDNLSPPTSLLVVSP--IIPGTYPVLLFFHGFVLKPI  72

Query  263  FYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQ  442
            +Y  L+QHI+SHG+IVVAPQ+        +EE+K  A++T WL + L + LP  V P+  
Sbjct  73   WYKSLLQHISSHGYIVVAPQV------SQSEEVKKAAKVTEWLSKALESVLPEKVQPDLL  126

Query  443  KIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFD  622
            ++A+ GHSRGGK+AF LALG      +K  AL+G+DPV G     ++ P +L YIP+ FD
Sbjct  127  QLAVSGHSRGGKIAFALALG----YGIKFQALLGIDPVAGFSPSNRSAPKILKYIPRIFD  182

Query  623  LGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDET  802
              + V VIG+GL     N +FPP AP GVNH +F+ E + P CYF+AK+YGH DMLDD  
Sbjct  183  QTVPVAVIGAGLSNQSANCIFPPFAPNGVNHSEFFNESKPPCCYFLAKNYGHTDMLDDRI  242

Query  803  GGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVEL  979
              +       + K+GK  +  MR  VGG VVAFL   L     +L AI  +   +AP+ L
Sbjct  243  AAIAS----WISKSGKGPKDLMRKAVGGIVVAFLEAKLGEKVDNLNAIV-QEPSLAPIIL  297

Query  980  QTV  988
              V
Sbjct  298  DPV  300



>ref|XP_009777295.1| PREDICTED: chlorophyllase-1-like isoform X1 [Nicotiana sylvestris]
Length=318

 Score =   226 bits (577),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 127/309 (41%), Positives = 179/309 (58%), Gaps = 18/309 (6%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSH--PPPKPLLIATPSEASAGAFPIFLFLHGYLFYNS  262
            + ++F  G   V++  V+     +    PP  LL+ +P     G +P+ LF HG++    
Sbjct  15   SLSVFREGDVAVKITKVKNGSLNNDNLSPPTSLLVVSP--IIPGTYPVLLFFHGFVLKPI  72

Query  263  FYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEG-LHNFLPPHVHPNT  439
            +Y  L+QHI+SHG+IVVAPQ   VA     +E+K  A++T W+  G L + LP  V P+ 
Sbjct  73   WYKSLLQHISSHGYIVVAPQFSPVA--SEIQEVKKAAKVTEWVSNGALESVLPEKVQPDL  130

Query  440  QKIALGGHSRGGKVAFGLALG-----KIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTY  604
             K+A+ GHSRGGK AF LALG         T +K  AL+G+DPV G     Q+ P +L Y
Sbjct  131  LKLAVSGHSRGGKTAFSLALGYGDLSSSTPTPIKFQALLGIDPVAGSSPSSQSAPKILQY  190

Query  605  IPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVD  784
            IP++FD  + V VIG+GL   + + +FPP AP GVNH +F+ EC+ P  YF+AKDYGH D
Sbjct  191  IPRNFDQTVPVAVIGAGLSNQRAHYIFPPFAPNGVNHSEFFNECKPPCYYFLAKDYGHTD  250

Query  785  MLDDETGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEE  961
            +LDD+   +       + K+GK  +  MR  VGG VVAFL   L G   +L AI  +   
Sbjct  251  ILDDKIAAIAS----LVAKSGKGSKDLMRKAVGGIVVAFLEAKLGGKVDNLNAIV-QEPS  305

Query  962  IAPVELQTV  988
            +AP+ L  V
Sbjct  306  LAPITLDPV  314



>ref|XP_002273956.1| PREDICTED: chlorophyllase-1-like [Vitis vinifera]
Length=315

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 180/312 (58%), Gaps = 18/312 (6%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            AT++F  G YT + +       T+   PK L I TP   + G +P+ LFLHGY      Y
Sbjct  13   ATDVFKRGNYTAKPI-------TTCNAPKTLFIVTPD--TEGTYPVLLFLHGYNICPCCY  63

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
            + L++HI+SHG IVVAP+L S+       +I   A++ NWL  GL + LP +V P+  ++
Sbjct  64   TNLLEHISSHGDIVVAPRLLSLCSLYGRPDINSAAEVANWLSSGLQSVLPENVVPDLSRL  123

Query  449  ALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            AL GHSRGG +AF LALG      +LK   LIG+DPV G +K  +  P +LT +P SF L
Sbjct  124  ALAGHSRGGYLAFALALGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFIL  183

Query  626  GMAVMVIGSGLGEVKRNPLFP-PCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE-  799
             + VMVIG+GLG        P  CAP G+N+ +F+ EC+     FV  DYGH+DMLDD+ 
Sbjct  184  DIPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFVIPDYGHMDMLDDDY  243

Query  800  ----TGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
                 G   G     +CK+GK ++ +M   VGG VVA L  +LEG+   L AI D    I
Sbjct  244  CTNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGLVVAMLMAHLEGETGDLDAIVDE-PGI  302

Query  965  APVELQTVAFQE  1000
            APV+L+ +   E
Sbjct  303  APVKLEVMEDSE  314



>emb|CAN82816.1| hypothetical protein VITISV_044164 [Vitis vinifera]
Length=315

 Score =   224 bits (570),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 131/312 (42%), Positives = 179/312 (57%), Gaps = 18/312 (6%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            AT++F  GKYT + +       T+   PK L I TP   + G +P+ LFLHGY      Y
Sbjct  13   ATDVFKRGKYTAKPI-------TTCNAPKTLFIVTPD--TEGTYPVLLFLHGYNICPCCY  63

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
            + L++HI+SHG+IVVAP+L S+       +I   A++ NWL  GL   LP +V P+  ++
Sbjct  64   TNLLEHISSHGYIVVAPRLLSLCSLYGRPDINSAAEVANWLSSGLQPVLPENVVPDLSRL  123

Query  449  ALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            AL GHSRGG +AF LA G      +LK   LIG+DPV G +K  +  P +LT +P SF+L
Sbjct  124  ALAGHSRGGYLAFALAXGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFNL  183

Query  626  GMAVMVIGSGLGEVKRNPLFP-PCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE-  799
             + VMVIG+GLG        P  CAP G+N+ +F+ EC+     F   DYGH+DMLD + 
Sbjct  184  DIPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFXIPDYGHMDMLDXDY  243

Query  800  ----TGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEI  964
                 G   G     +CK+GK ++ +M   VGG VVA L  +LEG+   L AI D    I
Sbjct  244  CTNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGLVVAMLMAHLEGETGDLDAIVDE-PGI  302

Query  965  APVELQTVAFQE  1000
            APV+L+ V   E
Sbjct  303  APVKLEVVEDSE  314



>ref|XP_002520934.1| Chlorophyllase-1, putative [Ricinus communis]
 gb|EEF41351.1| Chlorophyllase-1, putative [Ricinus communis]
Length=275

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 155/246 (63%), Gaps = 13/246 (5%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            A ++F+ G +  EL +V   +  S  PPKPLLIA P+   AG +P  LF+HG    NSFY
Sbjct  24   APSVFETGYFPTELNNVNESEFASGSPPKPLLIARPT--VAGKYPAILFIHGTCLVNSFY  81

Query  269  SQLIQHIASHGFIVVAPQLYS--VAGA------DATEEIKCTAQITNWLPEGLHNFLPPH  424
              L+ H+ASHGFIVVAPQ+Y+  V GA      D  +E+  + ++ NWLP GL + L   
Sbjct  82   GDLLDHVASHGFIVVAPQIYTCTVFGAIPVMPIDGQKEVDLSTEVANWLPSGLKSVLNGG  141

Query  425  VHPNTQKIALGGHSRGGKVAFGLALG-KIARTDLKLSALIGVDPVDGMDKGKQTPPPVLT  601
            V  N  K+A+ GHSRGGK AF +  G        K SAL+G+DPV G  K  +T P VLT
Sbjct  142  VQANLDKLAISGHSRGGKTAFAIQFGYSTDALTTKFSALVGLDPVAGHSKESRTDPKVLT  201

Query  602  YIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHV  781
            Y P SF+L + V VIG+GLG   +  LF  CAP GVNH +FY ECR PA +FVA DYGH+
Sbjct  202  YAPHSFNLSIPVSVIGTGLGSQPQT-LFA-CAPDGVNHAEFYNECRPPANHFVATDYGHM  259

Query  782  DMLDDE  799
            DML+D+
Sbjct  260  DMLNDD  265



>emb|CBI28739.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 172/296 (58%), Gaps = 17/296 (6%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            AT++F  GKY  + +       T+   PK L I TP   + G +P+ LFLHGY      Y
Sbjct  13   ATDVFKRGKYAAKPI-------TTCNAPKTLFIVTPD--TEGTYPVLLFLHGYNICPCCY  63

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
              L++HI+SHG+IVVAP+L S+       +I   A++TNWL  GL   LP +V P+  ++
Sbjct  64   MNLLEHISSHGYIVVAPRLLSLCSLYGRPDINSAAEVTNWLSSGLQPVLPENVVPDLSRL  123

Query  449  ALGGHSRGGKVAFGLALGKI-ARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL  625
            AL GHSRGG +AF LALG      +LK   LIG+DPV G +K  +  P +LT +P SF+L
Sbjct  124  ALAGHSRGGYLAFALALGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFNL  183

Query  626  GMAVMVIGSGLGEVKRNPLFP-PCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDE-  799
             + VMVIG+GLG        P  CAP G+N+ +F+ EC+     FV  DYGH+DMLDD+ 
Sbjct  184  DIPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFVIPDYGHMDMLDDDY  243

Query  800  ----TGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDR  952
                 G   G     +CK+GK ++ +M   VGG VVA L  +LEG+   L AI D 
Sbjct  244  CTNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGLVVAMLMAHLEGETGDLDAIVDE  299



>ref|XP_002444588.1| hypothetical protein SORBIDRAFT_07g024090 [Sorghum bicolor]
 gb|EES14083.1| hypothetical protein SORBIDRAFT_07g024090 [Sorghum bicolor]
Length=338

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 133/323 (41%), Positives = 185/323 (57%), Gaps = 28/323 (9%)
 Frame = +2

Query  86    TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
             + T +F  G++ V+   V+  +      PKPL++ TP++A  G +P+ +FLHG   YNS+
Sbjct  8     STTAVFKRGRHPVDTKHVDHSQVPG--VPKPLMVVTPTDA--GVYPVAVFLHGCSMYNSW  63

Query  266   YSQLIQHIASHGFIVVAPQLYSV---AGADATEEIKCTAQITNWLPEGLHNFLPPHVH--  430
             Y  L+ H+ASHGFI VAPQL  +         ++I  T ++T WL + L + L   +H  
Sbjct  64    YQTLLSHVASHGFIAVAPQLGGILPPLDMKDLKDIDATRKVTAWLADNLAHVLTNILHLH  123

Query  431   ---PNTQKIALGGHSRGGKVAFGLALG------KIARTDLKLSALIGVDPVDGMDKGKQT  583
                P+  ++AL GHSRGG  AF +ALG          T LK SALIGVDPV G+ K  Q 
Sbjct  124   GVTPDLSRLALAGHSRGGDTAFAVALGLGSSSSSSDTTPLKFSALIGVDPVAGLSKELQL  183

Query  584   PPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVA  763
              P VLT+ P+S D GM  +V+G+GLG         PCAP GV+H +FY EC  P  + V 
Sbjct  184   EPKVLTFEPRSLDPGMPALVVGTGLGPKG----LLPCAPAGVSHGEFYDECAPPRYHVVV  239

Query  764   KDYGHVDMLDDETGGVRGKATYCLCK---NGKERAAMRAFVGGAVVAFLRGYLEGDFSSL  934
             +DYGH+DMLDD+  GV    + C+CK   N  +  A RA +GGA+VAFLR  LE D   L
Sbjct  240   RDYGHLDMLDDD--GVPYVISNCMCKRNTNTTKDLARRA-IGGAMVAFLRAKLEDDDEDL  296

Query  935   AAIRDRHEEIAPVELQTVAFQEN  1003
              A+      ++P  L  V + ++
Sbjct  297   RAVLQNSPGLSPAVLDPVEYDDD  319



>gb|ACN32030.1| unknown [Zea mays]
 tpg|DAA48626.1| TPA: hypothetical protein ZEAMMB73_996983 [Zea mays]
Length=333

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 138/327 (42%), Positives = 182/327 (56%), Gaps = 36/327 (11%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            T +F  G   VE   V+  +  S P  KPL++  P++A  G +P+ +FLHG    NS+Y 
Sbjct  10   TAVFQRGPLRVEARHVDYSQVPSVP--KPLMVVAPTDA--GVYPVAVFLHGCNTVNSWYE  65

Query  272  QLIQHIASHGFIVVAPQLYSVA-GADATEEIKCTAQITNWLPEG-------LHNFLPPH-  424
             L+ H+ASHGFI VAPQLY V    +  ++I  T Q+T WL +        L N L  H 
Sbjct  66   SLLSHVASHGFIAVAPQLYCVTLNMNDLKDIDATRQVTAWLADKQQGLAHVLANILQLHG  125

Query  425  VHPNTQKIALGGHSRGGKVAFGLALG-----------------KIARTDLKLSALIGVDP  553
            V P+  ++AL GHSRGG  AF +ALG                   A   LK SALIGVDP
Sbjct  126  VRPDLSRLALAGHSRGGDTAFAVALGLGPAASDDDDNNADAGTSPAALPLKFSALIGVDP  185

Query  554  VDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQE  733
            V G+ K  Q  P VLT+ P+S D GM  +V+G+GLG   ++   PPCAP GVNH +FY E
Sbjct  186  VAGLSKQAQVEPKVLTFRPRSLDPGMPALVVGTGLG--PKHVGGPPCAPAGVNHAEFYDE  243

Query  734  CRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLC-KNGKERAAM-RAFVGGAVVAFLRG  907
            C  P  + V +DYGH+DMLDD+  GV      C+C +N K+   + R  +GGAVVAFLR 
Sbjct  244  CAPPRYHVVLRDYGHMDMLDDD--GVPYVINNCMCMRNTKDTKDLARRAIGGAVVAFLRA  301

Query  908  YLEGDFSSLAAIRDRHEEIAPVELQTV  988
             LE D   L  + +    ++P  L  V
Sbjct  302  TLEDDDEDLKVVLENRPGLSPAVLDPV  328



>ref|XP_002306793.2| hypothetical protein POPTR_0005s23590g [Populus trichocarpa]
 gb|EEE93789.2| hypothetical protein POPTR_0005s23590g [Populus trichocarpa]
Length=362

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 172/310 (55%), Gaps = 10/310 (3%)
 Frame = +2

Query  98    IFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
             +F+ G +    +  +    +S  PP+ LLI  P E   G +P+ LF HG    NS+Y+ +
Sbjct  46    VFETGNF--HPIQSDVGTASSCSPPRSLLIFRPEEK--GTYPVILFHHGTGCQNSWYTDV  101

Query  278   IQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALG  457
              + I+SHG+IVVAPQLY +      +E+   A++ NWLP GL   LP  +  +   +AL 
Sbjct  102   FKFISSHGYIVVAPQLYGLKPPSGQDELDSAAEVANWLPSGLRCVLPEDIEGDIHNLALA  161

Query  458   GHSRGGKVAFGLALG-KIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
             GHSRGG +AF LALG      D+  SALIGVDPV G  K  Q  P +L Y   SF+  + 
Sbjct  162   GHSRGGYIAFALALGLADVSLDVDFSALIGVDPVAGTSKTNQMEPKILNYESCSFNFSIP  221

Query  635   VMVIGSGLGEVKRNPLFP-PCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGV  811
             V +IG+GLG     P+ P  CAP GV+H + + EC+ P  +FV  DYGH+D+LDD+ G +
Sbjct  222   VAIIGTGLGNKPAFPILPQTCAPDGVSHTEIFNECKPPCSHFVTTDYGHMDVLDDDIGLI  281

Query  812   RGKATYCLCKN---GKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
              G+    +CK    G  R  MR  VGG  VAFL  + +G+++    I  +    AP  L 
Sbjct  282   -GEGARAMCKGSRWGVSRDPMRRTVGGVSVAFLEAFFKGNYTDYNKILQKPNYFAPATLD  340

Query  983   TVAFQEN*TT  1012
              V  +   T+
Sbjct  341   PVQNKSEGTS  350



>gb|EEC66959.1| hypothetical protein OsI_33606 [Oryza sativa Indica Group]
Length=337

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 165/277 (60%), Gaps = 41/277 (15%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVE--PHKCTSHP---------------PPKPLLIATPSEASAGAF  220
            + +FD G + V LV V+  P KC+S                 PPKPLL+A P +A  G +
Sbjct  34   SGVFDHGSHGVTLVKVDEAPRKCSSAAAAKKTDDDTAPAGGAPPKPLLVAAPCDA--GVY  91

Query  221  PIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKC-----------  367
            P+ +FLHGYL YNSFYSQL +H+ASHGF+VV PQ+           I+C           
Sbjct  92   PVVVFLHGYLAYNSFYSQLFEHVASHGFVVVGPQVNQSILIYYFSYIRCLDRIPPTRSTR  151

Query  368  TAQITNWLPE-GLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLK------  526
             A + NWL   GL + LPP+V  +  KI++ GHSRGGKVAF LALG  A   L+      
Sbjct  152  RAAVINWLAAGGLTSKLPPNVRADATKISISGHSRGGKVAFALALGH-ANVSLRGGAGGA  210

Query  527  -LSALIGVDPVDGMDKGKQTPPPVLTY-IPQSFDLGMAVMVIGSGLGEVKR-NPLFPPCA  697
             ++AL+ VDPVDG   GKQTPPP+LTY    S  +   VMVIG+GLG + R  PL P CA
Sbjct  211  TIAALVAVDPVDGFATGKQTPPPILTYGGANSLRVPAPVMVIGTGLGGLARAAPLLPACA  270

Query  698  PKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGG  808
            P GV+H +FY EC  PAC+ VA+DYGH DM+ D T G
Sbjct  271  PPGVSHGEFYGECAAPACHLVARDYGHTDMVVDVTPG  307



>ref|XP_011032645.1| PREDICTED: chlorophyllase-1, chloroplastic-like [Populus euphratica]
Length=362

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/303 (40%), Positives = 168/303 (55%), Gaps = 10/303 (3%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            ++F+ G +    +  +    +S  PP+ LLI  P E   G +P+ LF HG   +NS Y+ 
Sbjct  45   SVFETGNF--HPIQSDVGTASSCSPPRSLLIFRPEEK--GTYPVILFHHGTGCHNSLYTD  100

Query  275  LIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
            + + I+SHG+IVVAPQLY +       E+   A++ NWLP GL   LP  +      +AL
Sbjct  101  VFKFISSHGYIVVAPQLYGLMPPSGQVELDLAAEVANWLPSGLRCVLPEDIEGEMHNLAL  160

Query  455  GGHSRGGKVAFGLALG-KIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGM  631
             GHSRGG +AF LALG      D+ +SALIGVDPV G  K  Q  P +L Y   SF+  +
Sbjct  161  AGHSRGGYIAFALALGLADVSLDINISALIGVDPVVGTSKNNQMEPKILNYESCSFNFSI  220

Query  632  AVMVIGSGLGEVKRNPLFP-PCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGG  808
             V +IG+GLG     P+ P  CAP GV+H + + EC+ P  +FV  DYGH+D+LDD+ G 
Sbjct  221  PVTIIGTGLGNEPAFPILPQTCAPDGVSHTEIFNECKPPCSHFVTTDYGHMDVLDDDIGL  280

Query  809  VRGKATYCLCKN---GKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVEL  979
            + G+    +CK    G  R  MR  VGG  VAFL  + +G+++    I       +P  L
Sbjct  281  I-GEGARAICKGSWWGVSRDPMRRTVGGVSVAFLEAFFKGNYTDYNKILQNPNYFSPATL  339

Query  980  QTV  988
              V
Sbjct  340  DPV  342



>gb|ABK26334.1| unknown [Picea sitchensis]
Length=346

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/307 (42%), Positives = 184/307 (60%), Gaps = 17/307 (6%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYL-FYNSF  265
            +  +F  G Y+V  + + P       P KPLL+A P+  + G +P+ +FLH Y    N F
Sbjct  38   SIEVFKEGPYSVGRLDIPPW---GEDPLKPLLVAVPT--AKGVYPVVMFLHAYFPVKNYF  92

Query  266  YSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPP---HVHPN  436
            Y Q+++H+ASHG+IVVAPQ+Y + G + T+E+   A I +WLPEGL NF PP    V P+
Sbjct  93   YWQMLEHVASHGYIVVAPQMYDITGWNTTDEMLDVASIRSWLPEGLTNFFPPDLAEVKPD  152

Query  437  TQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQS  616
             Q++A+ GHSRGGKVAFG A+G  +      SAL  +DPVDG   G  T PP+LT    S
Sbjct  153  FQRVAIAGHSRGGKVAFGAAMGLFSPP--SFSALAALDPVDGA-TGHPTSPPLLTNSQNS  209

Query  617  FDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDD  796
             +L +  +V+G+GLG  +   +FP CAP+G++H +F++E  G A +FVA D GH D+L+D
Sbjct  210  LNLKVPTLVVGTGLGPAEHW-MFPTCAPEGLDHVEFFRETAGSAYHFVAVDQGHQDILND  268

Query  797  ETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
            +   V   A + LCK     A MR F  G +VAFL   + G+ +       R+  +APV 
Sbjct  269  D---VDFLACF-LCKCKAPLAPMRRFGAGILVAFLDATVGGNGAGALNDVIRNPHLAPVR  324

Query  977  LQTVAFQ  997
            L+   F+
Sbjct  325  LEKPEFK  331



>ref|XP_003572503.1| PREDICTED: chlorophyllase type 0-like [Brachypodium distachyon]
Length=306

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 177/307 (58%), Gaps = 24/307 (8%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            +F  G++ VE+  V+  +   H  PKP+++  PSEA  G++P+ LFLHG+L     Y +L
Sbjct  10   VFKAGRFQVEVRHVKQRR--DHELPKPVMVLAPSEA--GSYPVLLFLHGFLVLGGCYQKL  65

Query  278  IQHIASHGFIVVAPQLYSVA-GADATEEIKCTAQITNWLPEG-----LHN-FLPPHVHPN  436
            + H+ASHGFI VAPQLY +    +  ++I+ T+QI NW+  G     L + F    V P+
Sbjct  66   LTHVASHGFIAVAPQLYGIMFDVNDMKDIESTSQIINWIAGGGLAHVLKDIFRLKDVKPD  125

Query  437  TQKIALGGHSRGGKVAFGLALG---KIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYI  607
              K+AL GHSRGG  AF +ALG      +  LKLSALIG++PV G  K  Q  P VLT+ 
Sbjct  126  LSKVALAGHSRGGDTAFSVALGLGDAKTKLALKLSALIGIEPVAGASKDHQMEPKVLTFK  185

Query  608  PQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDM  787
            PQS D+GM VMV+G+G           PCAP  VNH +FY EC+ P  + V KDYGH+DM
Sbjct  186  PQSLDVGMPVMVLGTGKT--------CPCAPDHVNHAEFYDECKPPRYHLVVKDYGHLDM  237

Query  788  LDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIA  967
            +DD           C   +      +R  +GGA+VAF+R  ++     L AI    +++A
Sbjct  238  VDDHVLMFFHNLA-CQANSDDTNGLVRRTMGGAMVAFMRATMDHKDEDLNAIL-ADKQLA  295

Query  968  PVELQTV  988
            P  L+ V
Sbjct  296  PATLEPV  302



>ref|XP_006388207.1| hypothetical protein POPTR_0284s00200g [Populus trichocarpa]
 gb|ERP47121.1| hypothetical protein POPTR_0284s00200g [Populus trichocarpa]
Length=370

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/303 (40%), Positives = 168/303 (55%), Gaps = 10/303 (3%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            ++F+ G +    +  +    +S  PP  LLI  P E   G +P+ LF HG    NS+Y+ 
Sbjct  45   SVFETGNF--HPIQSDVGTASSCSPPGSLLIFRPEEK--GTYPVILFHHGTGCQNSWYTD  100

Query  275  LIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
            + + I+SHG+IVVAPQLY +      +E+   A++ NWLP GL   LP  +  +   +AL
Sbjct  101  VFKFISSHGYIVVAPQLYGLMPPSGQDELDLAAEVANWLPSGLRCVLPEDIEGDIHNLAL  160

Query  455  GGHSRGGKVAFGLALG-KIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGM  631
             GHSRGG +AF LALG      D+  SALIGVDPV G  K  Q  P +L Y   SF+  +
Sbjct  161  AGHSRGGYIAFALALGLADVSLDVDFSALIGVDPVAGTSKTNQMEPKILNYESCSFNFSI  220

Query  632  AVMVIGSGLGEVKRNPLF-PPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGG  808
             V +IG+GLG     P+    CAP GV+H + + EC+ P  +FV  DYGH+D+LDD+ G 
Sbjct  221  PVAIIGTGLGNKPACPIIRQTCAPDGVSHTEIFNECKPPCSHFVTTDYGHMDVLDDDIGL  280

Query  809  VRGKATYCLCK---NGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVEL  979
            + G+    +CK    G  R  MR  VGG  VAFL  + +G+++    I  +    AP  L
Sbjct  281  I-GEGARAMCKGSRRGVSRDPMRRTVGGVSVAFLEAFFKGNYTDYNKILQKSNYFAPTTL  339

Query  980  QTV  988
              V
Sbjct  340  DPV  342



>gb|ACI06105.1| chlorophyllase [Citrus limon]
Length=329

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/305 (42%), Positives = 177/305 (58%), Gaps = 17/305 (6%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            +F  G Y+ + +++E    +S PPPKPL+I TP+E   G F + LFLHG    N  YS++
Sbjct  26   VFTRGIYSTKRITLETSSPSSPPPPKPLIIVTPAEK--GTFNVILFLHGTSLSNKSYSKI  83

Query  278  IQHIASHGFIVVAPQLY-SVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
              HIASHGFIVVAPQLY S+    AT E+   A++  WLP+GL   LP +   N   +A+
Sbjct  84   FDHIASHGFIVVAPQLYTSIPPPSATNELNSAAEVAEWLPQGLQQNLPENTEANVSLVAV  143

Query  455  GGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
             GHSRGG+ AF L+L           A+IG+DPV G  K     P +L++   SFD  + 
Sbjct  144  MGHSRGGQTAFALSL------RYGFGAVIGLDPVAGTSKTTGLDPSILSF--DSFDFSIP  195

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA-CYFVAKDYGHVDMLDDETGGV  811
            V VIG+GLG V R      CAP+G NH +F+  C+  +  +FVA DYGH+D+LDD    V
Sbjct  196  VTVIGTGLGGVAR--CITACAPEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNPSDV  253

Query  812  RGKA-TYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQT  985
            +  A +   CKNG E R  MR  V G VVAFL+ + +GD      I  +    AP++L +
Sbjct  254  KSWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFDGDAEDFRQIL-KDPSFAPIKLDS  312

Query  986  VAFQE  1000
            V + +
Sbjct  313  VEYMD  317



>ref|XP_004143780.1| PREDICTED: chlorophyllase-1-like [Cucumis sativus]
 ref|XP_004170816.1| PREDICTED: chlorophyllase-1-like [Cucumis sativus]
 gb|KGN51166.1| hypothetical protein Csa_5G470560 [Cucumis sativus]
Length=329

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/298 (42%), Positives = 170/298 (57%), Gaps = 9/298 (3%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            +F+ GK+ V +++      ++    KPLL+ TP   + G +P  LF HG+  Y SFY+  
Sbjct  31   VFEKGKFEVGVITKTTDIFSTS---KPLLVFTPK--TPGLYPAILFFHGFSCYGSFYTDF  85

Query  278  IQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALG  457
            +  IASHG+++ APQLY +      +EIK    +  WL  GL   LP +V  +  K++L 
Sbjct  86   LTLIASHGYVIAAPQLYVMPTTSEMDEIKSAVDVIKWLSSGLDPLLPTNVKGDLSKLSLL  145

Query  458  GHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAV  637
            GHSRGGK AF LALG      L  SA+IG+DPV G  K  +  P +L    Q F + + +
Sbjct  146  GHSRGGKTAFSLALG-WGSPSLPFSAIIGIDPVAG-SKFFRPEPQILDPPSQPFKISLPI  203

Query  638  MVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRG  817
             V+G+GLG  K  P+   CAP G+NH  F+++C+    +FVA +YGH+D+LDD   G+ G
Sbjct  204  TVVGTGLGPQKATPVTCACAPDGLNHIAFFKKCKPTCAHFVAVNYGHMDILDDNPPGMTG  263

Query  818  KATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTV  988
              T   CKNGK  R  MR    G VVA L+ YL+ D S L AI D    IAP EL  V
Sbjct  264  YFTNIACKNGKGPRDLMRKCCSGLVVASLKAYLDNDVSILNAIYD-DPSIAPTELNPV  320



>sp|Q94LX1.1|CLH1_CITUN RecName: Full=Chlorophyllase-1, chloroplastic; AltName: Full=Chlorophyll-chlorophyllido 
hydrolase 1; Short=Chlase 1; Flags: 
Precursor [Citrus unshiu]
 dbj|BAB47176.1| chlorophyllase [Citrus unshiu]
Length=329

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/303 (43%), Positives = 176/303 (58%), Gaps = 17/303 (6%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            +F  G Y+ + +++E    +S PPPKPL+I TP+E   G F + LFLHG    N  YS++
Sbjct  26   VFTRGIYSTKRITLETSSPSSPPPPKPLIIVTPAEK--GTFNVILFLHGTSLSNKSYSKI  83

Query  278  IQHIASHGFIVVAPQLY-SVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
              HIASHGFIVVAPQLY S+    AT E+   A++  WLP+GL   LP +   N   +A+
Sbjct  84   FDHIASHGFIVVAPQLYTSIPPPSATNELNSAAEVAEWLPQGLQQNLPENTEANVSLVAV  143

Query  455  GGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
             GHSRGG+ AF L+L           A+IG+DPV G  K     P +L++   SFD  + 
Sbjct  144  MGHSRGGQTAFALSL------RYGFGAVIGLDPVAGTSKTTGLDPSILSF--DSFDFSIP  195

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA-CYFVAKDYGHVDMLDDETGGV  811
            V VIG+GLG V R      CAP+G NH +F+  C+  +  +FVA DYGH+D+LDD    V
Sbjct  196  VTVIGTGLGGVAR--CITACAPEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNPSDV  253

Query  812  RGKA-TYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQT  985
            +  A +   CKNG E R  MR  V G VVAFL+ + +GD      I  +    AP++L +
Sbjct  254  KSWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFDGDAEDFRQIL-KDPSFAPIKLDS  312

Query  986  VAF  994
            V +
Sbjct  313  VEY  315



>ref|XP_010669257.1| PREDICTED: chlorophyllase type 0-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 126/289 (44%), Positives = 170/289 (59%), Gaps = 23/289 (8%)
 Frame = +2

Query  95   NIFDVGKYTVE---LVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
             +F+ GK+ V    LV     + + +  P+PLLI +P EA  G++P+  F+HG L  N  
Sbjct  51   TVFETGKHQVTNPILV-----RKSQYSTPEPLLIISPKEA--GSYPVLFFIHGTLISNQD  103

Query  266  YSQLIQHIASHGFIVVAPQLYS---VAGADATEEIKCTAQITNWLPEGLHNFLPPHVHP-  433
            YS L +H+ASHGFIVVAP L+    +      +EI+  A + NWLP  LH  L   V+  
Sbjct  104  YSHLFKHVASHGFIVVAPLLFRPLVIFPPSQADEIEMAASMINWLPSKLHEVLRDRVNAK  163

Query  434  ---NTQKIALGGHSRGGKVAFGLALGKIARTDLK--LSALIGVDPVDGMDKGKQTPPPVL  598
               + QK+A+ GHSRGGK AF LALG +++T L   +SALIGVDPV G D   QT P VL
Sbjct  164  VSADLQKVAISGHSRGGKSAFALALG-MSKTKLNFNISALIGVDPVAGPDNHSQTEPHVL  222

Query  599  TYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGH  778
            TYI  SFDL +   VIG+GLG  KRN L PPCAP  V+H+ F+ E +    +FV + YGH
Sbjct  223  TYIDNSFDLSIPCTVIGTGLGS-KRNRLIPPCAPSNVSHQQFFNELKQ-GSHFVIEKYGH  280

Query  779  VDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGD  922
            + ML+D        +   +C +G   +  MR  +GG +VAFL  Y   +
Sbjct  281  MQMLNDFLTDPVAVSMSVMCTSGFGPKTTMRRTLGGIMVAFLDAYFRDE  329



>ref|XP_006441463.1| hypothetical protein CICLE_v10021095mg [Citrus clementina]
 gb|ESR54703.1| hypothetical protein CICLE_v10021095mg [Citrus clementina]
Length=329

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 127/306 (42%), Positives = 172/306 (56%), Gaps = 14/306 (5%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            ++F  G Y+ +L +V      S PP KPL I  P E   G + + LF HG    N+ YS 
Sbjct  24   SVFSSGPYSPKLKTVNKPWFNSFPP-KPLNIVYPEEK--GTYEVILFFHGTALSNTSYSN  80

Query  275  LIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
            L+ H+ASHG+IVVAPQLY         E+   A + NWL  GL + LP +V  N   +AL
Sbjct  81   LLDHLASHGYIVVAPQLYDFLPPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVAL  140

Query  455  GGHSRGGKVAFGLALGKIAR--TDLKLSALIGVDPVDGMDK-GKQTPPPVLTYIPQSFDL  625
             GHSRGG +AFGLALG        +K+SAL+G+DPV G+     +  PP+L++   SF+ 
Sbjct  141  MGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSH--DSFEF  198

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECR-GPACYFVAKDYGHVDMLDDET  802
             + V VIG+GLG V +     PCAP+  NH  F++ C      +F AKDYGH+D+LDD  
Sbjct  199  SIPVTVIGTGLGGVTK--CMQPCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDNP  256

Query  803  GGVRGKA-TYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
             G +  A +  LC NGK+ R  MR  V G   AFL+ Y +GD      +  +   +AP+E
Sbjct  257  QGPKNWAISKLLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTML-KDPSLAPIE  315

Query  977  LQTVAF  994
            L  V F
Sbjct  316  LDEVEF  321



>ref|XP_006478133.1| PREDICTED: chlorophyllase-1, chloroplastic-like [Citrus sinensis]
 gb|KDO40785.1| hypothetical protein CISIN_1g020188mg [Citrus sinensis]
Length=329

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 127/306 (42%), Positives = 172/306 (56%), Gaps = 14/306 (5%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            ++F  G Y+ +L +V      S PP KPL I  P E   G + + LF HG    N+ YS 
Sbjct  24   SVFSSGPYSPKLKTVNKPWFNSFPP-KPLNIVYPEEK--GTYEVILFFHGTALSNTSYSN  80

Query  275  LIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
            L+ H+ASHG+IVVAPQLY         E+   A + NWL  GL + LP +V  N   +AL
Sbjct  81   LLDHLASHGYIVVAPQLYDFLPPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVAL  140

Query  455  GGHSRGGKVAFGLALGKIAR--TDLKLSALIGVDPVDGMDK-GKQTPPPVLTYIPQSFDL  625
             GHSRGG +AFGLALG        +K+SAL+G+DPV G+     +  PP+L++   SF+ 
Sbjct  141  MGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSH--DSFEF  198

Query  626  GMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECR-GPACYFVAKDYGHVDMLDDET  802
             + V VIG+GLG V +     PCAP+  NH  F++ C      +F AKDYGH+D+LDD  
Sbjct  199  SIPVTVIGTGLGGVTK--CMQPCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDNP  256

Query  803  GGVRGKA-TYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVE  976
             G +  A +  LC NGK+ R  MR  V G   AFL+ Y +GD      +  +   +AP+E
Sbjct  257  QGPKNWAISKFLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTML-KDPSLAPIE  315

Query  977  LQTVAF  994
            L  V F
Sbjct  316  LDEVEF  321



>ref|XP_006443995.1| hypothetical protein CICLE_v10021103mg [Citrus clementina]
 gb|ESR57235.1| hypothetical protein CICLE_v10021103mg [Citrus clementina]
Length=329

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 129/303 (43%), Positives = 175/303 (58%), Gaps = 17/303 (6%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            +F  G Y+ + +++E    +S PPPKPL+I TP+E   G F + LFLHG    N  YS++
Sbjct  26   VFTRGIYSTKRITLETSSPSSPPPPKPLIIVTPAEK--GTFNVILFLHGTSLSNKSYSKI  83

Query  278  IQHIASHGFIVVAPQLY-SVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
              HIASHGFIVVAPQLY S+    AT E+   A++  WLP+GL   LP +   N   +A+
Sbjct  84   FDHIASHGFIVVAPQLYTSIPPPSATNELNSAAEVAEWLPQGLQQNLPENTEANVSLVAV  143

Query  455  GGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
             GHSRGG+ AF L+L           A+IG+DPV G  K     P +L++   SFD  + 
Sbjct  144  MGHSRGGQTAFALSL------RYGFGAVIGLDPVAGTSKTTGLDPSILSF--DSFDFSIP  195

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA-CYFVAKDYGHVDMLDDETGGV  811
            V VIG+GLG V R      CAP+G NH +F+  C+  +  +FVA DYGH+D+LDD    V
Sbjct  196  VTVIGTGLGGVAR--CITACAPEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNPSDV  253

Query  812  RGKA-TYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQT  985
            +  A +   CKNG E R  MR  V G VVAFL+ +  GD      I  +    AP++L +
Sbjct  254  KSWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFYGDAEDFRQIL-KDPSFAPIKLDS  312

Query  986  VAF  994
            V +
Sbjct  313  VEY  315



>ref|NP_001275819.1| chlorophyllase-1, chloroplastic [Citrus sinensis]
 sp|Q9MV14.1|CLH1_CITSI RecName: Full=Chlorophyllase-1, chloroplastic; AltName: Full=Chlorophyll-chlorophyllido 
hydrolase 1; Short=Chlase 1; Flags: 
Precursor [Citrus sinensis]
 gb|AAF59834.1|AF160869_1 chloroplast chlorophyllase [Citrus sinensis]
 gb|KDO68641.1| hypothetical protein CISIN_1g020199mg [Citrus sinensis]
Length=329

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 129/303 (43%), Positives = 174/303 (57%), Gaps = 17/303 (6%)
 Frame = +2

Query  98   IFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQL  277
            +F  G Y+ + +++E    +S PPPKPL+I TP  A  G F + LFLHG    N  YS++
Sbjct  26   VFTRGIYSTKRITLETSSPSSPPPPKPLIIVTP--AGKGTFNVILFLHGTSLSNKSYSKI  83

Query  278  IQHIASHGFIVVAPQLY-SVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
              HIASHGFIVVAPQLY S+    AT E+   A++  WLP+GL   LP +   N   +A+
Sbjct  84   FDHIASHGFIVVAPQLYTSIPPPSATNELNSAAEVAEWLPQGLQQNLPENTEANVSLVAV  143

Query  455  GGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
             GHSRGG+ AF L+L           A+IG+DPV G  K     P +L++   SFD  + 
Sbjct  144  MGHSRGGQTAFALSL------RYGFGAVIGLDPVAGTSKTTGLDPSILSF--DSFDFSIP  195

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA-CYFVAKDYGHVDMLDDETGGV  811
            V VIG+GLG V R      CAP+G NH +F+  C+  +  +FVA DYGH+D+LDD    V
Sbjct  196  VTVIGTGLGGVAR--CITACAPEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNPSDV  253

Query  812  RGKA-TYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQT  985
            +  A +   CKNG E R  MR  V G VVAFL+ +  GD      I  +    AP++L +
Sbjct  254  KSWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFYGDAEDFRQIL-KDPSFAPIKLDS  312

Query  986  VAF  994
            V +
Sbjct  313  VEY  315



>ref|XP_009791851.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Nicotiana sylvestris]
Length=327

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 174/307 (57%), Gaps = 20/307 (7%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F VG   VE+++V+         P PLL+ +P+  + G++P+ LF HG++   + Y  L+
Sbjct  25   FQVGDEAVEIINVK-RSFLFDVLPCPLLVFSPT--TQGSYPVLLFFHGFMLQPNCYKSLL  81

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLP-EGLHNFLPPHVHPNTQKIALG  457
             HI+SH +I+VAPQ   +A    ++E+K   +I  WL    L   LP  V P+ QK+A+ 
Sbjct  82   LHISSHQYIIVAPQFSPMA--TQSQEVKNAKKIVEWLSTNNLDAVLPEKVLPDLQKVAVS  139

Query  458  GHSRGGKVAFGLALGKIARTD---------LKLSALIGVDPVDGMDKGKQTPPPVLTYIP  610
            GHSRGGK AF LALG    +          LK+SAL+G+DPV G        P +L +IP
Sbjct  140  GHSRGGKTAFALALGHGGSSTSNATQLEPPLKISALLGIDPVAGSSLSCLCSPNILQFIP  199

Query  611  QSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDML  790
             SFD  + V VIGSGL   +   + PP AP GVNH +F+ E + P  YF+AKDYGH+DML
Sbjct  200  YSFDQSIPVAVIGSGLSNQRAFGVCPPGAPNGVNHAEFFNESKPPCYYFLAKDYGHLDML  259

Query  791  DDETGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIA  967
            DD T  +    T    K+GK  +  MR  VGG  VAFL+ YL+G    L  I +  +  A
Sbjct  260  DDGTAALISWMT----KSGKASKDTMRRTVGGLFVAFLKAYLDGQADDLINIVESPKIRA  315

Query  968  PVELQTV  988
            P+ L  V
Sbjct  316  PITLDPV  322



>ref|XP_009588380.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Nicotiana tomentosiformis]
Length=316

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 124/307 (40%), Positives = 171/307 (56%), Gaps = 20/307 (7%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F VG   VE+++V+         P PLL+ +P+  + G++P+ LF HG++   + Y  L+
Sbjct  14   FQVGDEAVEIINVK-RSFLFDLLPCPLLVFSPT--TQGSYPVLLFFHGFMLQPNSYKSLL  70

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLP-EGLHNFLPPHVHPNTQKIALG  457
             HI+SH +I+VAPQ   +A    + E+K   +I  WL    L + LP  V P+ QK+A+ 
Sbjct  71   LHISSHQYIIVAPQFSPMASQ--SREVKNARKIVEWLSTNNLDSVLPEKVFPDLQKVAVS  128

Query  458  GHSRGGKVAFGLALGKIARTD---------LKLSALIGVDPVDGMDKGKQTPPPVLTYIP  610
            GHS GGK AF LALG    +          LK+SAL+G+DPV G        P +L +IP
Sbjct  129  GHSSGGKTAFALALGYGGSSTSNATQLEPGLKISALLGIDPVAGSSTSCLCSPNILQFIP  188

Query  611  QSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDML  790
             SFD  + V VIG GL   +   + PP AP GVNH +F+ E + P  YF+AKDYGH+DML
Sbjct  189  YSFDQSIPVAVIGGGLSNQRALGMCPPGAPNGVNHAEFFNESKPPCYYFLAKDYGHLDML  248

Query  791  DDETGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIA  967
            DD T  +    +  + K+GK     MR  VGG  VAFL+ YLEG    L  I +     A
Sbjct  249  DDGTASL----SRWMMKSGKGSTDTMRRTVGGLFVAFLKAYLEGQADDLINIVESPNIRA  304

Query  968  PVELQTV  988
            P+ L  V
Sbjct  305  PITLDPV  311



>ref|XP_009376014.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Pyrus x bretschneideri]
Length=124

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  563  MDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRG  742
            MD GKQTPPP+LTY+PQSFDL M VMVIGS LGEVKRN LFPPCAPKGVNH DF+ EC  
Sbjct  1    MDTGKQTPPPMLTYVPQSFDLEMPVMVIGSRLGEVKRNILFPPCAPKGVNHEDFFNECWK  60

Query  743  PACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGD  922
             ACYFVAKDYGH+DM DD T G+ GKATYCLCKNGK R  MR FVGG +VAF++ YLEGD
Sbjct  61   LACYFVAKDYGHLDMRDDHTKGITGKATYCLCKNGKSRQPMRRFVGGVMVAFIKAYLEGD  120

Query  923  FSSL  934
             S L
Sbjct  121  NSWL  124



>ref|XP_004247197.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=307

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 172/300 (57%), Gaps = 17/300 (6%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            ++IF+VG  T++ ++V+            LL+ +P++ +   +P+ LF HG++   S+Y 
Sbjct  19   SSIFEVGNETIDTINVKSSSSLP----CSLLVFSPTKKAP--YPVLLFFHGFMLQPSWYK  72

Query  272  QLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIA  451
             L+QHI+SH +I+VAPQ   +      +E+K   +I  WL   L + LP  V P+ +K+A
Sbjct  73   SLLQHISSHRYIIVAPQFPLM-----NQEVKTVQKIAEWLINNLKSVLPEKVQPDLEKVA  127

Query  452  LGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGM  631
            + GHS+GG  AF +AL   +   LK SAL+G+DPV G       PP VL YIP+ F+  +
Sbjct  128  ISGHSKGGNTAFAVALD--SSMPLKFSALLGIDPVAGCSPSCLRPPYVLEYIPRIFNQSI  185

Query  632  AVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGV  811
             V VIG+GL       L P  AP GVNH +F+ E + P  YF+AKDYGH DML  +  G+
Sbjct  186  PVAVIGAGLSNQSTCCLLPSGAPNGVNHAEFFNESKPPCYYFLAKDYGHADML--QADGI  243

Query  812  RGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTV  988
                   + K+GK  + +MR  VGG VVAFL+ YLEG    L  I  +   +AP+ L  V
Sbjct  244  MAILIRIMMKSGKGSKKSMRRAVGGIVVAFLKAYLEGQIDDLNEIV-KSPNLAPIILDPV  302



>ref|XP_010326402.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X2 [Solanum 
lycopersicum]
Length=301

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 170/300 (57%), Gaps = 23/300 (8%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            ++IF+VG  T++ ++V+            LL+ +P++ +   +P+ LF HG++   S+Y 
Sbjct  19   SSIFEVGNETIDTINVKSSSSLP----CSLLVFSPTKKAP--YPVLLFFHGFMLQPSWYK  72

Query  272  QLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIA  451
             L+QHI+SH +I+VAPQ           E+K   +I  WL   L + LP  V P+ +K+A
Sbjct  73   SLLQHISSHRYIIVAPQ-----------EVKTVQKIAEWLINNLKSVLPEKVQPDLEKVA  121

Query  452  LGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGM  631
            + GHS+GG  AF +AL   +   LK SAL+G+DPV G       PP VL YIP+ F+  +
Sbjct  122  ISGHSKGGNTAFAVALD--SSMPLKFSALLGIDPVAGCSPSCLRPPYVLEYIPRIFNQSI  179

Query  632  AVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGV  811
             V VIG+GL       L P  AP GVNH +F+ E + P  YF+AKDYGH DML  +  G+
Sbjct  180  PVAVIGAGLSNQSTCCLLPSGAPNGVNHAEFFNESKPPCYYFLAKDYGHADML--QADGI  237

Query  812  RGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTV  988
                   + K+GK  + +MR  VGG VVAFL+ YLEG    L  I  +   +AP+ L  V
Sbjct  238  MAILIRIMMKSGKGSKKSMRRAVGGIVVAFLKAYLEGQIDDLNEIV-KSPNLAPIILDPV  296



>gb|KDP21407.1| hypothetical protein JCGZ_21878 [Jatropha curcas]
Length=407

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 129/327 (39%), Positives = 180/327 (55%), Gaps = 34/327 (10%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            ++F+ G  +     V   +     PPKPLLI  P E   G +P+ LFLHG    NS+Y+Q
Sbjct  24   SVFETGNLSTVCCHVNQSQLGDDSPPKPLLIVRPVED--GTYPVILFLHGTCLQNSYYTQ  81

Query  275  LIQHIASHGFIVVAPQLYSVAG----------------ADATEEIKCTAQITNWLPEGLH  406
            L +HIASHG+I+VAPQLY                         E++  AQ+  WL  GL 
Sbjct  82   LFEHIASHGYILVAPQLYGCTEKLHIIFPWELDIPKLPVCGDTELEWAAQVAKWLYSGLQ  141

Query  407  NFLPPHVHPNTQ-KIALGGHSRGGKVAFGLALGKIARTDLK---LSALIGVDPVDGMDKG  574
            + LP  V  + Q K+AL GHSRGGK+AF LALGK A+T L+   +SAL+GVDPV G+  G
Sbjct  142  SVLPGSVKGDLQNKLALAGHSRGGKIAFALALGK-AKTSLQEVNISALLGVDPVAGL--G  198

Query  575  KQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLF---PPCAPKGVNHRDFYQECRGP  745
            K+   P++     +FDL + V +IG+GLG+  ++P F   P CAP  +NH++F+ + + P
Sbjct  199  KECSEPIILR-DGTFDLSVPVTIIGTGLGDQPKHPHFPFWPACAPDNLNHKEFFSKSKPP  257

Query  746  ACYFVAKDYGHVDMLDDETGG---VRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLE  916
              +FV  +YG +DML+D+      V+     C        A MR  VGG  VAFL    +
Sbjct  258  KGHFVITEYGLLDMLNDDLTSDFVVQFFNDLCTANGSGSNAPMRRGVGGITVAFLEYNFQ  317

Query  917  GDFSS-LAAIRDRHEEIAPVELQTVAF  994
            G     L  +RDR   ++PV+L  V F
Sbjct  318  GKTKDYLTIVRDR-SAVSPVKLDDVEF  343



>ref|XP_006349715.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Solanum tuberosum]
Length=293

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/301 (38%), Positives = 167/301 (55%), Gaps = 16/301 (5%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
            A++IF++G  T+  ++V+              +   S  + G++P+ LF HG++   S+Y
Sbjct  3    ASSIFEIGNETINTINVKSSSSLPC------SLLVFSPTTKGSYPVLLFFHGFMLQPSWY  56

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
              L+QHI+SH +I+VAPQ   +      +E+K   +I  WL   L + +P  V P+ +K+
Sbjct  57   KSLLQHISSHRYIIVAPQFPLIN----LQEMKNVRKIAEWLINNLKSVVPEKVQPDLEKV  112

Query  449  ALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLG  628
            A+ GHS+GG  AF +A    +   LK SAL+G++PV G       PP VL YIP+ F+  
Sbjct  113  AISGHSKGGNTAFAVAFD--SSMPLKFSALLGIEPVAGTSTSCLCPPYVLEYIPRIFNQS  170

Query  629  MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGG  808
            + V V+G+GL       L    AP GVNH +F+ E + P  YF+AKDYGH DML+ E  G
Sbjct  171  IPVAVLGAGLSNQSTCCLLQSVAPNGVNHAEFFNESKPPCYYFMAKDYGHADMLEAE--G  228

Query  809  VRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQT  985
            +       L K+GK  + +M   VGG VVAFL+ YLEG    L  I  +   +AP+ L  
Sbjct  229  IMAILIRILMKSGKGSKDSMIRAVGGIVVAFLKAYLEGQIDDLNDIV-KSPNLAPITLDP  287

Query  986  V  988
            V
Sbjct  288  V  288



>ref|XP_008345193.1| PREDICTED: chlorophyllase-1-like [Malus domestica]
Length=272

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 134/215 (62%), Gaps = 9/215 (4%)
 Frame = +2

Query  356  EIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIART-DLKLS  532
            E++  A++ NWLP+GL   LP +V  +  K AL GHS G   AF +ALG+   +  LK+S
Sbjct  62   EVEWGAKVINWLPKGLQPLLPENVVADFTKFALSGHSXGRNTAFAIALGRAKTSLSLKIS  121

Query  533  ALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVN  712
             LIG+DPV G  +       +LTY PQSFDL + V VIG+GLG   +NP  PPCA  G N
Sbjct  122  VLIGIDPVAGATRN------ILTYSPQSFDLSIPVTVIGTGLGPESKNPCMPPCAXXGAN  175

Query  713  HRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERAAMRAFVGGAV  889
            H++F+ EC+ P  +FV KDYGH+DMLDD+  G+ G  + C+CKNG   R  MR  VGG V
Sbjct  176  HKEFFYECKPPCAHFVVKDYGHMDMLDDDPQGMVGAVSGCMCKNGTGPRELMRKTVGGIV  235

Query  890  VAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
            VAFL  YL GD   L AI    +  +P +L+ V F
Sbjct  236  VAFLNAYLNGDDKDLVAIVGDPDS-SPAKLEPVEF  269



>ref|XP_002520936.1| Chlorophyllase-1, putative [Ricinus communis]
 gb|EEF41353.1| Chlorophyllase-1, putative [Ricinus communis]
Length=226

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 137/219 (63%), Gaps = 6/219 (3%)
 Frame = +2

Query  356  EIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLK--L  529
            E++  AQ+ NWLP GL + LP +V  +  K+++GGHSRGGK AF LALG  A+T LK  +
Sbjct  9    ELEFAAQVANWLPSGLQSVLPENVKGDLDKLSIGGHSRGGKTAFALALG-YAKTPLKVKI  67

Query  530  SALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLF-PPCAPKG  706
            SAL GVDPV+G  K   T P +LTYIPQS +L + V VIG+GLG      L  P CAP  
Sbjct  68   SALAGVDPVEGTSKNSPTQPKILTYIPQSLNLSIPVAVIGTGLGNQPVCWLVCPACAPDE  127

Query  707  VNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKE-RAAMRAFVGG  883
            +NH++F+ EC+ PA +FVA +YGH+DML+D    + G  T  LCK+ +  R  MR   GG
Sbjct  128  MNHQEFFSECKAPAGHFVATEYGHMDMLNDNMTDIVGTLTNSLCKSSQNPRKPMRRTTGG  187

Query  884  AVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAFQE  1000
             +VAFL+ Y +G+      I  +    AP +L  V F E
Sbjct  188  IIVAFLKAYFKGEIEDYITIV-QEPSAAPAKLDPVQFTE  225



>sp|Q9LE89.1|CLH0_CHEAL RecName: Full=Chlorophyllase type 0; AltName: Full=CaCLH0; AltName: 
Full=Chlorophyll-chlorophyllido hydrolase 0; Short=Chlase 
0; Flags: Precursor [Chenopodium album]
 gb|AAF27045.1|AF134301_1 CaCLH [Chenopodium album]
 dbj|BAA93635.1| chlorophyllase [Chenopodium album]
Length=347

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 171/306 (56%), Gaps = 21/306 (7%)
 Frame = +2

Query  92   TNIFDVGKYTVEL--VSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            T++F  G + V    + V+ ++ ++   P+PL+I +P EA  G +P+ LF+HG +  N  
Sbjct  35   TDVFHKGNFQVTNNPIRVKRYEFSA---PEPLIIISPKEA--GVYPVLLFIHGTMLSNED  89

Query  266  YSQLIQHIASHGFIVVAPQLYSV---AGADATEEIKCTAQITNWLPEGLHNFLPPHV---  427
            YS    +IASHGFIVVAP+L+ +         +EI   A + NW+P  L   L  +V   
Sbjct  90   YSLFFNYIASHGFIVVAPKLFRLFPPKLPSQQDEIDMAASVANWMPLYLQVVLQRYVTGV  149

Query  428  HPNTQKIALGGHSRGGKVAFGLALG-KIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTY  604
              + +K+A+ GHSRGGK AF LALG    + D+  SALIGVDPV G     +T P VLTY
Sbjct  150  EGDLEKLAISGHSRGGKSAFALALGFSNIKLDVTFSALIGVDPVAGRSVDDRTLPHVLTY  209

Query  605  IPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVD  784
             P SF+L + V VIGSGLG    +     CAP  V+H+ FY EC+  + +FV   YGH+D
Sbjct  210  KPNSFNLSIPVTVIGSGLGNHTIS-----CAPNHVSHQQFYDECKENSSHFVITKYGHMD  264

Query  785  MLDDETGGVRGKATYCLC-KNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEE  961
            ML++            +C ++ + +A MR  +GG +VAFL  Y   D     AI   +  
Sbjct  265  MLNEFRLSPIAVTMSLMCAQSFRPKATMRRTLGGIMVAFLNAYFRDDGRQYYAI-IANRS  323

Query  962  IAPVEL  979
            +AP  L
Sbjct  324  LAPTNL  329



>ref|XP_010669258.1| PREDICTED: chlorophyllase type 0-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=337

 Score =   193 bits (490),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 157/288 (55%), Gaps = 49/288 (17%)
 Frame = +2

Query  95   NIFDVGKYTVE---LVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
             +F+ GK+ V    LV     + + +  P+PLLI +P EA  G++P+  F+HG L  N  
Sbjct  51   TVFETGKHQVTNPILV-----RKSQYSTPEPLLIISPKEA--GSYPVLFFIHGTLISNQD  103

Query  266  YSQLIQHIASHGFIVVAPQLYS---VAGADATEEIKCTAQITNWLPEGLHNFLPPHVHP-  433
            YS L +H+ASHGFIVVAP L+    +      +EI+  A + NWLP  LH  L   V+  
Sbjct  104  YSHLFKHVASHGFIVVAPLLFRPLVIFPPSQADEIEMAASMINWLPSKLHEVLRDRVNAK  163

Query  434  ---NTQKIALGGHSRGGKVAFGLALGKIARTDLK--LSALIGVDPVDGMDKGKQTPPPVL  598
               + QK+A+ GHSRGGK AF LALG +++T L   +SALIGVDPV G D   QT P VL
Sbjct  164  VSADLQKVAISGHSRGGKSAFALALG-MSKTKLNFNISALIGVDPVAGPDNHSQTEPHVL  222

Query  599  TYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGH  778
            TYI  SFDL +   VIG+GLG  KRN L PPCAP  V+H+ F+ E +   C         
Sbjct  223  TYIDNSFDLSIPCTVIGTGLGS-KRNRLIPPCAPSNVSHQQFFNELKQVMC---------  272

Query  779  VDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGD  922
                   T G   K T            MR  +GG +VAFL  Y   +
Sbjct  273  -------TSGFGPKTT------------MRRTLGGIMVAFLDAYFRDE  301



>gb|AEK97328.1| chromoplast chlorophyllase [Brassica rapa var. parachinensis]
Length=188

 Score =   183 bits (465),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 121/185 (65%), Gaps = 4/185 (2%)
 Frame = +2

Query  356  EIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTD--LKL  529
            E+    ++ NW  + L   LP  V+ N +  AL GHSRGGK AF +ALG  A  D  +K 
Sbjct  5    EVDDAGKVINWSSKNLKAHLPSSVNANGKSTALVGHSRGGKTAFAVALGHAATLDPSIKF  64

Query  530  SALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGV  709
            SAL+G+DPV G+ K  +T P +LTY P+SFDL M V VIG+GLG  K N L PPCAP  V
Sbjct  65   SALVGIDPVAGISKCIRTDPEILTYKPESFDLDMPVAVIGTGLGP-KSNMLMPPCAPAEV  123

Query  710  NHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERAAMRAFVGGA  886
            NH +FY EC+    +FVA DYGH++MLDD   G  G    C+CKN K +++ MR+FVGG 
Sbjct  124  NHEEFYIECKATKGHFVAADYGHMNMLDDNLPGFVGFMAGCMCKNSKRKKSEMRSFVGGI  183

Query  887  VVAFL  901
            VVAFL
Sbjct  184  VVAFL  188



>gb|AFK44490.1| unknown [Lotus japonicus]
Length=122

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 95/118 (81%), Gaps = 1/118 (1%)
 Frame = +2

Query  629  MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGG  808
            M  MVIGSGLG+VKRNPLFPPCAPK VNH DF+ EC  PA YFVAKDYGHVDMLDD+T G
Sbjct  1    MPAMVIGSGLGDVKRNPLFPPCAPKTVNHEDFFNECNKPAWYFVAKDYGHVDMLDDDTNG  60

Query  809  VRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            + GKATYCLCKNG+ R  MR FVGG VVAFL+ Y++GD   L AI+D+H   APVEL+
Sbjct  61   IIGKATYCLCKNGESRKPMRTFVGGLVVAFLKAYMQGDNRDLLAIKDKHLR-APVELK  117



>ref|XP_009777296.1| PREDICTED: chlorophyllase-1-like isoform X2 [Nicotiana sylvestris]
Length=256

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 132/223 (59%), Gaps = 12/223 (5%)
 Frame = +2

Query  341  ADATEEIKCTAQITNWLPEG-LHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALG-----  502
            A   +E+K  A++T W+  G L + LP  V P+  K+A+ GHSRGGK AF LALG     
Sbjct  35   ASEIQEVKKAAKVTEWVSNGALESVLPEKVQPDLLKLAVSGHSRGGKTAFSLALGYGDLS  94

Query  503  KIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPL  682
                T +K  AL+G+DPV G     Q+ P +L YIP++FD  + V VIG+GL   + + +
Sbjct  95   SSTPTPIKFQALLGIDPVAGSSPSSQSAPKILQYIPRNFDQTVPVAVIGAGLSNQRAHYI  154

Query  683  FPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERA  859
            FPP AP GVNH +F+ EC+ P  YF+AKDYGH D+LDD+   +       + K+GK  + 
Sbjct  155  FPPFAPNGVNHSEFFNECKPPCYYFLAKDYGHTDILDDKIAAIAS----LVAKSGKGSKD  210

Query  860  AMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTV  988
             MR  VGG VVAFL   L G   +L AI  +   +AP+ L  V
Sbjct  211  LMRKAVGGIVVAFLEAKLGGKVDNLNAIV-QEPSLAPITLDPV  252



>gb|KDO37483.1| hypothetical protein CISIN_1g043492mg, partial [Citrus sinensis]
Length=278

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/282 (40%), Positives = 156/282 (55%), Gaps = 19/282 (7%)
 Frame = +2

Query  176  PLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATE  355
            PL I  P   + G + + LF  G    N+ YS+L  H+ASHG+IVV+PQLY++      +
Sbjct  1    PLFIVFPD--NQGKYEVILFFPGTSVSNTSYSKLFDHLASHGYIVVSPQLYNLMPPKGNK  58

Query  356  EIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIAR--TDLKL  529
            E+   A+  NWLP+GL + LP +V  +    AL GHSRGG  AF LA G        LK 
Sbjct  59   EVDAAAEEINWLPKGLQSHLPENVVADLNYSALMGHSRGGLTAFALAQGYATNPPLGLKF  118

Query  530  SALIGVDPVDGMDK-GKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKG  706
            SAL+GVDPV G+     +  PP+L Y  +SF+  + V VIG+GLG + +  +  PCAP+ 
Sbjct  119  SALVGVDPVAGIPYFHSELDPPILDY--ESFNFSIPVTVIGTGLGGLAKCVV--PCAPEK  174

Query  707  VNHRDFYQECRGP-ACYFVAKDYGHVDMLDDETGGVRGKA-TYCLCKNGK-ERAAMRAFV  877
             NH+ F+  C      +F A  YGH+D+LDD    ++  A + C+C NG   R  MR  V
Sbjct  175  ENHQQFFNRCTSSDRAHFDATYYGHMDVLDDCPPDLKSLAISKCMCTNGTLPRQPMRQCV  234

Query  878  GGAVVAFLRGYLEG---DFSSLAAIRDRHEEIAPVELQTVAF  994
             G  VAFL+ Y +    DF ++ A       +AP+ L  V F
Sbjct  235  SGIAVAFLKAYFDSEGDDFKTILA----DPSVAPITLGQVEF  272



>ref|XP_006838962.1| hypothetical protein AMTR_s00002p00271040 [Amborella trichopoda]
 gb|ERN01531.1| hypothetical protein AMTR_s00002p00271040 [Amborella trichopoda]
Length=248

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 143/258 (55%), Gaps = 20/258 (8%)
 Frame = +2

Query  56   MAVTFsssssTATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLF  235
            MA T +  +  AT+   VG YTV++V  +P  CTS  PPKPL+I    ++     P F  
Sbjct  1    MAHTVAKPARNATH--SVGIYTVQIVHSQPSDCTS--PPKPLMIVEKGDSLPLWLPPFSP  56

Query  236  LHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFL  415
              G         +++   AS       PQLY++A  DAT EI     +T WL  GL   L
Sbjct  57   SSGRAQIVGIRLEVLSLQAS-------PQLYTIARFDATGEIDSVVAVTEWLCTGLPKAL  109

Query  416  PPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPV  595
            P  +  +  K+++ GHSRGGK+AF LAL       L  SAL+ +DPV+G      T P +
Sbjct  110  PNSIAGDLTKLSIAGHSRGGKIAFALALD---LKTLTYSALLTIDPVEG------TSPHI  160

Query  596  LTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYG  775
            LT +  S   GM V+V+GSGLG+VK+  +   CAP G N  DF++EC+ PACYF+  DYG
Sbjct  161  LTNMHNSLSTGMPVLVVGSGLGQVKKCLICLACAPVGSNRTDFFEECQSPACYFLPSDYG  220

Query  776  HVDMLDDETGGVRGKATY  829
            H+DM +DET G R    Y
Sbjct  221  HIDMFNDETEGGRNPVVY  238



>ref|XP_004251483.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Solanum lycopersicum]
Length=319

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 116/318 (36%), Positives = 170/318 (53%), Gaps = 38/318 (12%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F+VG   V++++V+     S   P PLL+ +P+  + G++PI LF HG+      Y  L+
Sbjct  13   FEVGDEVVKIINVK-----SSSLPCPLLVFSPT--TEGSYPILLFFHGFRLQPDSYKSLL  65

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLP-EGLHNFLPPHVHPNTQKIALG  457
             HI+SH +I VAP+ +S+  +    E+K   ++  WL  + L++ LP  V P+ QK+A+ 
Sbjct  66   LHISSHQYIAVAPK-FSLMTSRC--EVKTAKKVAEWLSAKKLNSVLPEKVFPDIQKVAVS  122

Query  458  GHSRGGKVAFGLAL---------------GKIARTD----LKLSALIGVDPVDGMDKGKQ  580
            GHSRGGK AF LAL               G+  R      LK+SAL+G+DPV    KG  
Sbjct  123  GHSRGGKTAFALALAYGSGDSKGESIVTSGRATRKQKQPPLKISALLGIDPVA---KGSS  179

Query  581  T--PPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACY  754
                  +L YIP SF+  + V VIG+GL   +   + PP AP GVNH +F+ E + P  Y
Sbjct  180  CFCSSNILQYIPYSFNHSVPVAVIGTGLSNRRAYGVCPPDAPNGVNHAEFFNESKPPCYY  239

Query  755  FVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSL  934
            F+AK+YGH DMLD+   G +           + +  +R  +GG  VAF + YLEG    L
Sbjct  240  FLAKNYGHTDMLDE---GEKIMGIMKKKGKKETKHDLRRTIGGLFVAFFKAYLEGQADDL  296

Query  935  AAIRDRHEEIAPVELQTV  988
              I +      P++L  V
Sbjct  297  INIIESPGIRCPIKLDPV  314



>ref|XP_006363512.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Solanum tuberosum]
Length=323

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 113/316 (36%), Positives = 166/316 (53%), Gaps = 33/316 (10%)
 Frame = +2

Query  101  FDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLI  280
            F+VG   V++++V+     S   P PLL+ +P+  + G++PI LF HG+      Y  L+
Sbjct  16   FEVGDEVVKIINVK-----SSSLPCPLLVFSPT--TEGSYPILLFFHGFGLQPDCYKSLL  68

Query  281  QHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLP-EGLHNFLPPHVHPNTQKIALG  457
             HI+SH +I +AP+ +S+  +    E++   ++  WL  + L++ LP  V P+  K+A+ 
Sbjct  69   LHISSHKYIAIAPK-FSLMTSRC--EVRKARKVAEWLSAKKLNSVLPEKVLPDLHKVAVS  125

Query  458  GHSRGGKVAFGLAL-------------GKIARTD----LKLSALIGVDPVDGMDKGKQT-  583
            GHSRGGK AF LAL             GK  R      LK+SAL+G+DPV    KG    
Sbjct  126  GHSRGGKTAFALALAYGSGSKGESITSGKATRKQKQPPLKISALLGIDPVA---KGSSCL  182

Query  584  -PPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFV  760
                +L +IP SF+  + V VIG+GL   +   + PP AP GVNH +F+ E + P  YF+
Sbjct  183  CSSNILQFIPYSFNHSIPVAVIGTGLSNKRAYGVCPPDAPNGVNHAEFFNESKPPCYYFL  242

Query  761  AKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAA  940
            AK+YGH DMLDD                   +  +R  +GG  VAF + YLEG    L  
Sbjct  243  AKNYGHADMLDDGNKMTTLMGMMKKSGKKGSKEDLRRTIGGLFVAFFKAYLEGQADDLIN  302

Query  941  IRDRHEEIAPVELQTV  988
            I +      P++L  V
Sbjct  303  IIESPSIRCPIKLDPV  318



>gb|AAN51935.1|AF337546_1 chlorophyllase 3 [Brassica oleracea]
Length=213

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 112/162 (69%), Gaps = 12/162 (7%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKC---------TSHPPPKPLLIATPSEASAGAFPIFLFLHGY  247
            N F+ GKY  +L++V    C         T   PPK LL+ATP E   G +P+ + LHGY
Sbjct  23   NSFEDGKYKTDLLTVGLSSCCWKKPSSSPTPQSPPKRLLVATPVEE--GEYPVVMLLHGY  80

Query  248  LFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHV  427
            L YNSFYSQL+ H++SHGFIV+APQLYS+AG D  +EIK TA+I +WL  GL++FLPP V
Sbjct  81   LLYNSFYSQLMLHVSSHGFIVIAPQLYSIAGPDTMDEIKSTAEIIDWLSVGLNHFLPPQV  140

Query  428  HPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSALIGVD  550
             PN  K AL GHSRGGK AF LAL K    +DLK+SALIG+D
Sbjct  141  TPNLSKFALSGHSRGGKTAFALALKKFGYSSDLKISALIGID  182



>ref|XP_002978190.1| hypothetical protein SELMODRAFT_176680 [Selaginella moellendorffii]
 gb|EFJ20847.1| hypothetical protein SELMODRAFT_176680 [Selaginella moellendorffii]
Length=316

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/298 (37%), Positives = 152/298 (51%), Gaps = 23/298 (8%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            +I+D G + V + ++   +        PL + TPS  S G FP+ +F HG       Y+ 
Sbjct  34   SIYDTGSFNVSVFTINQRRLL------PLRVFTPS--SNGTFPLIVFHHGAFLETRIYTD  85

Query  275  LIQHIASHGFIVVAPQLYS-VAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIA  451
            ++ HIASHG+++VAPQ        +AT +IK  A++  WL      FLP  V  N  K+ 
Sbjct  86   ILTHIASHGYVIVAPQRSDRFWDTNATRDIKDAARVIEWLLGNFAAFLPAGVSVNIGKLV  145

Query  452  LGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGM  631
              GHS+GGK+AF LAL   A   +  + L+G+DP+DG   G QT P VL   P  F    
Sbjct  146  NIGHSKGGKIAFALALNIKANVSVPFATLVGLDPMDGTRLG-QTQPRVLYNAPIVFQ--Y  202

Query  632  AVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGV  811
              ++IG+GLG          C+P   NH  F+ + R      +   YGH+D +DD  G V
Sbjct  203  PSLIIGTGLGGA--------CSPAKYNHASFFNQTRSMVVDLIPAKYGHMDFVDD-LGAV  253

Query  812  RGKATYCL-CKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
             G+  + L CK    R  MR F  GAVVAFLR  L  D  + A I  ++   APV LQ
Sbjct  254  DGQRVFLLACKRKSPRKPMRDFTAGAVVAFLRAALYDDTDAFANIV-KNPSSAPVLLQ  310



>ref|XP_002966376.1| hypothetical protein SELMODRAFT_85435, partial [Selaginella moellendorffii]
 gb|EFJ32403.1| hypothetical protein SELMODRAFT_85435, partial [Selaginella moellendorffii]
Length=262

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 103/271 (38%), Positives = 139/271 (51%), Gaps = 17/271 (6%)
 Frame = +2

Query  176  PLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYS-VAGADAT  352
            PL + TPS  S G FP+ +F HG       Y+ ++ HI+SHG+++VAPQ        +AT
Sbjct  1    PLRVFTPS--SNGTFPLIVFHHGAFLETRIYTDILTHISSHGYVIVAPQRSDRFWDTNAT  58

Query  353  EEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLS  532
             +IK  A++  WL      FLP  V  N  K+   GHS+GGK+AF LAL   A   +  +
Sbjct  59   RDIKDAARVIEWLVGNFAAFLPAGVSVNIGKLVNMGHSKGGKIAFALALNIKANVSVPFA  118

Query  533  ALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVN  712
             L+G+DP+DG   G QT P VL   P  F      ++IG+GLG          C+P   N
Sbjct  119  TLVGLDPMDGTKIG-QTQPRVLYDAPIVFQ--YPSLIIGTGLGGA--------CSPAKYN  167

Query  713  HRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCL-CKNGKERAAMRAFVGGAV  889
            H  F+ +        +   YGH+D +DD  G   G+  + L CK    R  MR F  GAV
Sbjct  168  HASFFNQTSSMVVDLIPAKYGHMDFVDD-LGAFDGQRVFLLACKRKSPRKPMRDFTAGAV  226

Query  890  VAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            VAFLR  L  D  + A I  ++   APV LQ
Sbjct  227  VAFLRAALYDDTDAFANIV-KNPSSAPVLLQ  256



>ref|NP_001169192.1| uncharacterized protein LOC100383045 [Zea mays]
 gb|ACN31905.1| unknown [Zea mays]
Length=299

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 105/251 (42%), Positives = 136/251 (54%), Gaps = 32/251 (13%)
 Frame = +2

Query  320  QLYSVA-GADATEEIKCTAQITNWLPEG-------LHNFLPPH-VHPNTQKIALGGHSRG  472
            QLY V    +  ++I  T Q+T WL +        L N L  H V P+  ++AL GHSRG
Sbjct  48   QLYCVTLNMNDLKDIDATRQVTAWLADKQQGLAHVLANILQLHGVRPDLSRLALAGHSRG  107

Query  473  GKVAFGLALG-----------------KIARTDLKLSALIGVDPVDGMDKGKQTPPPVLT  601
            G  AF +ALG                   A   LK SALIGVDPV G+ K  Q  P VLT
Sbjct  108  GDTAFAVALGLGPAASDDDDNNADAGTSPAALPLKFSALIGVDPVAGLSKQAQVEPKVLT  167

Query  602  YIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHV  781
            + P+S D GM  +V+G+GLG   ++   PPCAP GVNH +FY EC  P  + V +DYGH+
Sbjct  168  FRPRSLDPGMPALVVGTGLG--PKHVGGPPCAPAGVNHAEFYDECAPPRYHVVLRDYGHM  225

Query  782  DMLDDETGGVRGKATYCLC-KNGKERAAM-RAFVGGAVVAFLRGYLEGDFSSLAAIRDRH  955
            DMLDD+  GV      C+C +N K+   + R  +GGAVVAFLR  LE D   L  + +  
Sbjct  226  DMLDDD--GVPYVINNCMCMRNTKDTKDLARRAIGGAVVAFLRATLEDDDEDLKVVLENR  283

Query  956  EEIAPVELQTV  988
              ++P  L  V
Sbjct  284  PGLSPAVLDPV  294



>ref|XP_010096443.1| Chlorophyllase-1 [Morus notabilis]
 gb|EXB64218.1| Chlorophyllase-1 [Morus notabilis]
Length=349

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 113/291 (39%), Positives = 147/291 (51%), Gaps = 43/291 (15%)
 Frame = +2

Query  203  ASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQIT  382
            A +G +P+ LF HG     SFYSQL +HI+SHGFIVVAPQLY +    A  E+     + 
Sbjct  62   AKSGRYPVLLFFHGTSIKTSFYSQLFKHISSHGFIVVAPQLYRLLIPPACMELNSAEAVA  121

Query  383  NWLPE-GLHNFLPPHVHPNTQK-IALGGHSRGGKVAFGLALGKIART-------------  517
            +WL + GL   LP  + P+ +  +AL GHSRGG+ +F LA  + A +             
Sbjct  122  DWLLKYGLEGHLPAGITPDFESGLALAGHSRGGRTSFALADKRTAESAKTNSEVHSSALL  181

Query  518  -----DLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPL  682
                 DL LS LIGVDPV        T P V     Q F   +   VIG+GLG       
Sbjct  182  PRSGKDLNLSVLIGVDPV-AATMCCATMPDVHPET-QCFKFDVPAAVIGTGLGG------  233

Query  683  FPPCAPKGVNHRDFYQECRGPA-CYFVAKDYGHVDMLDDETGG-------VRGKATYCLC  838
               CAP+  N+  F++ C+ P    F+A  YGH+D+LDD   G       V    T C+C
Sbjct  234  --SCAPESGNYAQFFKRCKPPKRAEFLAPQYGHMDVLDDNPPGNGSCFSCVSALMTKCMC  291

Query  839  KNGK--ERAAMRAFVGGAVVAFLRGYLEG--DFSSLAAIRDRHEEIAPVEL  979
            KN K   R  M   VGG VVAF + Y     D S L AI++ +  +AP EL
Sbjct  292  KNAKGLSRECMSRTVGGIVVAFFKAYNNKYPDPSDLNAIQN-NPGLAPAEL  341



>ref|XP_002966378.1| hypothetical protein SELMODRAFT_86398 [Selaginella moellendorffii]
 gb|EFJ32405.1| hypothetical protein SELMODRAFT_86398 [Selaginella moellendorffii]
Length=273

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/271 (38%), Positives = 139/271 (51%), Gaps = 17/271 (6%)
 Frame = +2

Query  176  PLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLY-SVAGADAT  352
            PL + TPS  S G FP+ +F HG       Y+ ++ HIAS+G++VVAPQ   S    +AT
Sbjct  11   PLRVFTPS--SNGTFPLIVFHHGTFLKTRIYTGILTHIASYGYVVVAPQRSDSFWDTNAT  68

Query  353  EEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLS  532
             +I+  A++  WL      FLP  V  N  K+   GHS+GGK+AF LAL   A   +  +
Sbjct  69   RDIEDAARVIEWLLGNFAAFLPAGVSVNVGKLVNMGHSKGGKIAFALALNIKANISVPFA  128

Query  533  ALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVN  712
             L+G+DP+DG   G QT P VL   P  F      ++IG+GL           C+P   N
Sbjct  129  TLVGLDPMDGTKLG-QTQPRVLYDAPIVFQ--YPSLIIGTGLSGA--------CSPARYN  177

Query  713  HRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCL-CKNGKERAAMRAFVGGAV  889
            H  F+ + R      +  +YGH+D +DD  G   G+  + L CK    R  MR F  GAV
Sbjct  178  HGGFFNQTRSMVVDLIPSEYGHMDFVDD-LGTFDGQRVFLLACKRKSPRKPMRDFTAGAV  236

Query  890  VAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            VAFLR  L     +   I  R+   APV LQ
Sbjct  237  VAFLRAVLYNVTDAFVNIV-RNPSSAPVLLQ  266



>gb|EMT11146.1| Chlorophyllase-2, chloroplastic [Aegilops tauschii]
Length=226

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +2

Query  578  QTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYF  757
            QTPPP+L Y P +  +   VMVIG+GLGE+ RN LFPPCAP GV+H +FY EC  PAC+ 
Sbjct  86   QTPPPILAYKPNALRVPAPVMVIGTGLGELPRNALFPPCAPLGVSHAEFYDECAAPACHL  145

Query  758  VAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLA  937
            VA+DYGH DM+DD T G +G AT  LCK+G  RA MR FV GA+VAFL+ +++G    L 
Sbjct  146  VARDYGHTDMMDDVTTGAKGLATRALCKSGGARAPMRRFVAGAMVAFLKKWVQGKPEWLD  205

Query  938  AIRDR  952
            AIR++
Sbjct  206  AIREQ  210


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 57/86 (66%), Gaps = 9/86 (10%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVE--PHKCTSHP-----PPKPLLIATPSEASAGAFPIFLFLHG  244
            +A N+FD G++   L  VE     C + P     PPKPLL+A P +A  G +P+ LFLHG
Sbjct  3    SAGNVFDHGRHGTSLAKVEQATRCCATSPVDAQSPPKPLLVAAPCDA--GEYPVVLFLHG  60

Query  245  YLFYNSFYSQLIQHIASHGFIVVAPQ  322
            YL  N FYSQL+ H+ASHGFIV+APQ
Sbjct  61   YLCNNYFYSQLLHHVASHGFIVIAPQ  86



>ref|XP_011080324.1| PREDICTED: chlorophyllase-1, chloroplastic-like [Sesamum indicum]
Length=333

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 115/355 (32%), Positives = 159/355 (45%), Gaps = 91/355 (26%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYL----FYN  259
            T++F+ G  +VE+ + +  K  +  PP  LLI +P   + G +P+ LF HGY     +Y+
Sbjct  9    TSVFEPG--SVEVKTSKLKKTDASSPPAELLIVSPE--AEGNYPVLLFCHGYCTKSGWYS  64

Query  260  SFYSQLIQH--------------------------------------------------I  289
                 +  H                                                  +
Sbjct  65   ELLQHVSSHGYIVVAPQVGCLKPVTSMLTSDSKAMILVDNYEPTKFRSILPPSSKYKPIL  124

Query  290  ASHGFI-VVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHS  466
             +H  I  +  Q Y        +EIK  A++TNWLP GL   LP +V P+  ++AL GHS
Sbjct  125  ETHCIIWYLNAQFYQCLLISLNDEIKIAAKVTNWLPAGLAVSLPENVKPDLSRVALMGHS  184

Query  467  RGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVI  646
            RGGKVAF LALG  A T L   AL+G+DPV  + +                         
Sbjct  185  RGGKVAFALALG-YATTSLNFKALLGLDPVCRLSQP------------------------  219

Query  647  GSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKAT  826
            G+GL    +  + PP AP G NH +F+ E + P CYF+ KDYGH DML+D    +     
Sbjct  220  GTGLSNQTKG-IIPPLAPDGFNHSEFFNESKPPCCYFLTKDYGHCDMLNDPNVALAS---  275

Query  827  YCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTV  988
              +CK+GK  +  MR  VGG VVAFL+ YLEG+   L  I      IAP+ L  V
Sbjct  276  -LVCKSGKGSKEEMRRGVGGIVVAFLKAYLEGECEDLENIVAT-PTIAPISLNPV  328



>gb|AFR54123.1| chlorophyllase, partial [Populus deltoides x Populus tremuloides]
Length=188

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 107/185 (58%), Gaps = 6/185 (3%)
 Frame = +2

Query  353  EEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALG-KIARTDLKL  529
            +E+   A++ NWLP GL   LP  +  +   +AL GHSRGG +AF LALG      D+  
Sbjct  5    DELYLAAEVANWLPSGLRCVLPEDIEGDMHNLALAGHSRGGYIAFALALGLADVSLDVDF  64

Query  530  SALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFP-PCAPKG  706
            SALIGVDPV G  K  Q  P +L Y   SF+  + V +IG+GLG     P+ P  CAP G
Sbjct  65   SALIGVDPVAGTSKTNQMEPKILNYESCSFNFSIPVAIIGTGLGNKSAFPILPQTCAPDG  124

Query  707  VNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCK---NGKERAAMRAFV  877
            V+H + + EC+ P  +FV  DYGH+D+LDD+ G + G+    +CK    G  R  MR  V
Sbjct  125  VSHTEIFNECKPPCSHFVTSDYGHMDVLDDDIGPI-GELARAMCKGSRRGVSRDPMRRTV  183

Query  878  GGAVV  892
            GG  V
Sbjct  184  GGVSV  188



>ref|XP_006494924.1| PREDICTED: chlorophyllase-1, chloroplastic-like [Citrus sinensis]
Length=344

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 125/219 (57%), Gaps = 11/219 (5%)
 Frame = +2

Query  356  EIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIAR--TDLKL  529
            E+   A + NWL  GL + LP +V  N   +AL GHSRGG +AFGLALG        +K+
Sbjct  123  EVNDAANVLNWLSTGLQSELPENVEANLNYVALMGHSRGGLIAFGLALGYATNPPVSIKI  182

Query  530  SALIGVDPVDGMDK-GKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKG  706
            SAL+G+DPV G+     +  PP+L++   SF+  + V VIG+GLG V +     PCAP+ 
Sbjct  183  SALVGIDPVAGLASVHSELEPPILSH--DSFEFSIPVTVIGTGLGGVTK--CMQPCAPEN  238

Query  707  VNHRDFYQECR-GPACYFVAKDYGHVDMLDDETGGVRGKA-TYCLCKNGKE-RAAMRAFV  877
             NH  F++ C      +F AKDYGH+D+LDD   G +  A +  LC NGK+ R  MR  V
Sbjct  239  KNHEQFFKRCTYSDHAHFDAKDYGHMDILDDNPQGPKNWAISKFLCTNGKKPRDPMRRCV  298

Query  878  GGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
             G   AFL+ Y +GD      +  +   +AP+EL  V F
Sbjct  299  AGIAAAFLKAYFDGDCEDFRTML-KDPSLAPIELDEVEF  336



>gb|AFK36235.1| unknown [Medicago truncatula]
Length=219

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 127/212 (60%), Gaps = 17/212 (8%)
 Frame = +2

Query  92   TNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYS  271
            T++F+ G    +  +V+    TS   PKPLL+ TP+    G +P+ LF HG+  +NS+Y 
Sbjct  15   TDVFESGNIKWKQFNVD----TS---PKPLLVFTPT--VEGTYPVILFYHGFAIWNSYYH  65

Query  272  QLIQHIASHGFIVVAPQLYSVA-GADATEEIKCTAQITNWLPEGLHNFLPPHVHPNT---  439
            +L+ HI SHGFIVVAPQL+++        E+K   ++ NW+ +GL   L  +   N    
Sbjct  66   KLLGHITSHGFIVVAPQLFTIGLPMPGPCEVKFAGKVANWITKGLQPKLKENTKENVVAK  125

Query  440  -QKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGK--QTPPPVLTYIP  610
               + L GHS+GGK AF +ALG  A T+LK SALIG+DPV G  K K  +T P +LT   
Sbjct  126  LDNLVLAGHSKGGKTAFAVALGH-AETNLKFSALIGIDPVAGPSKCKITRTLPHILTGQA  184

Query  611  QSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKG  706
            QSFDL M V+VIG+GLG    N    PCAP G
Sbjct  185  QSFDLNMPVIVIGTGLGPEPSNCSPLPCAPDG  216



>ref|XP_010326403.1| PREDICTED: chlorophyllase-1 isoform X3 [Solanum lycopersicum]
Length=277

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 101/301 (34%), Positives = 151/301 (50%), Gaps = 47/301 (16%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
             ++IF+VG  T++ ++V+            LL+ +P++ +   +P+ LF HG++   S+Y
Sbjct  18   VSSIFEVGNETIDTINVKSSSSLP----CSLLVFSPTKKAP--YPVLLFFHGFMLQPSWY  71

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
              L+QHI+SH +I+VAPQ   +      +E+K   +I  WL   L + LP  V P+ +K+
Sbjct  72   KSLLQHISSHRYIIVAPQFPLM-----NQEVKTVQKIAEWLINNLKSVLPEKVQPDLEKV  126

Query  449  ALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLG  628
            A+ GHS+GG  AF +AL   +   LK SAL+G+DPV G       PP VL YIP+ F+  
Sbjct  127  AISGHSKGGNTAFAVALD--SSMPLKFSALLGIDPVAGCSPSCLRPPYVLEYIPRIFNQS  184

Query  629  MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGG  808
            + V VIG+GL       L P                               DML  +  G
Sbjct  185  IPVAVIGAGLSNQSTCCLLPS------------------------------DML--QADG  212

Query  809  VRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQT  985
            +       + K+GK  + +MR  VGG VVAFL+ YLEG    L  I  +   +AP+ L  
Sbjct  213  IMAILIRIMMKSGKGSKKSMRRAVGGIVVAFLKAYLEGQIDDLNEIV-KSPNLAPIILDP  271

Query  986  V  988
            V
Sbjct  272  V  272



>emb|CDY68841.1| BnaAnng28520D, partial [Brassica napus]
Length=165

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 105/163 (64%), Gaps = 15/163 (9%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVE-PHKCTSHPPPKPLL-----------IATPSEASAGAFPIF  229
            ++ N F  GKY  +L++V+   +C  +                  +ATP E   G +P+ 
Sbjct  5    SSRNAFVDGKYKPDLLTVDLASRCRCYKTTPSSSLTPPPPPKSLLVATPVEE--GEYPVV  62

Query  230  LFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHN  409
            + LHGYL YNSFYSQL+ H++S+GFIV+APQLY++AG D  +EIK TA+I +WL  GL++
Sbjct  63   MLLHGYLLYNSFYSQLMLHVSSYGFIVIAPQLYNIAGPDTMDEIKSTAEIIDWLSVGLNH  122

Query  410  FLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIA-RTDLKLSA  535
            FLPP V PN  K AL GHSRGGK AF +AL K    ++LK+SA
Sbjct  123  FLPPQVTPNLSKFALTGHSRGGKTAFAVALKKFGYSSELKISA  165



>ref|XP_010326404.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X4 [Solanum 
lycopersicum]
Length=221

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 123/215 (57%), Gaps = 13/215 (6%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFY  268
             ++IF+VG  T++ ++V+            LL+ +P++ +   +P+ LF HG++   S+Y
Sbjct  18   VSSIFEVGNETIDTINVKSSSSLP----CSLLVFSPTKKAP--YPVLLFFHGFMLQPSWY  71

Query  269  SQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKI  448
              L+QHI+SH +I+VAPQ          +E+K   +I  WL   L + LP  V P+ +K+
Sbjct  72   KSLLQHISSHRYIIVAPQF-----PLMNQEVKTVQKIAEWLINNLKSVLPEKVQPDLEKV  126

Query  449  ALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLG  628
            A+ GHS+GG  AF +AL   +   LK SAL+G+DPV G       PP VL YIP+ F+  
Sbjct  127  AISGHSKGGNTAFAVALD--SSMPLKFSALLGIDPVAGCSPSCLRPPYVLEYIPRIFNQS  184

Query  629  MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQE  733
            + V VIG+GL       L P  AP GVNH +F+ E
Sbjct  185  IPVAVIGAGLSNQSTCCLLPSGAPNGVNHAEFFNE  219



>gb|KDP21405.1| hypothetical protein JCGZ_21876 [Jatropha curcas]
Length=229

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 138/255 (54%), Gaps = 48/255 (19%)
 Frame = +2

Query  167  PPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGAD  346
            PPKPLLI        G  P+ LFLHG    NS+Y+QL +HIASHG+++VAPQ++      
Sbjct  14   PPKPLLIV-----EDGTHPVILFLHGTCLQNSYYAQLFEHIASHGYMLVAPQVF------  62

Query  347  ATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLK  526
                              L +F       +   + L GHSRGGK AF LALGK A+T L+
Sbjct  63   ------------------LFHF------QSYMCMNLFGHSRGGKTAFALALGK-AKTSLQ  97

Query  527  ---LSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNP---LFP  688
               +SAL+GVDPV G+  GK+   P++     +FDL + V +IG+GLG+  + P    +P
Sbjct  98   EVNISALLGVDPVAGL--GKECSEPIILR-DGTFDLSIPVTIIGTGLGDHPKYPHVPFWP  154

Query  689  PCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGG---VRGKATYCLCKNGKERA  859
             CAP  +NH++F+ + + P  +FV  +YG + ML+D+      V+     C       +A
Sbjct  155  ACAPDSLNHKEFFSKSKPPKGHFVFTEYGLLGMLNDDLTSEFVVQFFNDLCTANGSGSKA  214

Query  860  AMRAFVGGAVVAFLR  904
             MR+ VGG  VA L 
Sbjct  215  PMRSGVGGITVALLE  229



>ref|XP_002978187.1| hypothetical protein SELMODRAFT_107983, partial [Selaginella 
moellendorffii]
 gb|EFJ20844.1| hypothetical protein SELMODRAFT_107983, partial [Selaginella 
moellendorffii]
Length=309

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 130/266 (49%), Gaps = 19/266 (7%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            +I+D G + V + ++   +        PL + T   +S G FP+ +F HG       Y+ 
Sbjct  1    SIYDTGSFNVSMFTINQRRLL------PLRVFT--RSSNGTFPLIVFHHGTFLKTRIYTG  52

Query  275  LIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIAL  454
            ++ HIAS+G++VVAPQ+    G      I+  A++  WL      FLP  V  N  K+  
Sbjct  53   ILTHIASYGYVVVAPQVSYFLGHKCHTSIEDAARVIEWLLGNFAAFLPAGVSVNIGKLVN  112

Query  455  GGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMA  634
             GHS+GGK+AF LAL   A   +  + L+G+DP+DG   G QT P VL   P  F     
Sbjct  113  MGHSKGGKIAFALALNIKANISVPFATLVGLDPMDGTKIG-QTQPRVLYDAPIVFQ--YP  169

Query  635  VMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVR  814
             ++IG+GL           C+P   NH  F+ + R      +  +YGH+D +DD     R
Sbjct  170  SLIIGTGLSGA--------CSPAKYNHGGFFNQTRSMVVDLIPSEYGHMDFVDDLGAVDR  221

Query  815  GKATYCLCKNGKERAAMRAFVGGAVV  892
             +     CK  + R  MR F  GAVV
Sbjct  222  QRVFLLACKRKRPRKPMRDFTAGAVV  247



>ref|XP_004964134.1| PREDICTED: chlorophyllase-1-like [Setaria italica]
Length=190

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 105/177 (59%), Gaps = 10/177 (6%)
 Frame = +2

Query  476  KVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSG  655
            K+A G    K   T LK+S LIG+DPV G DK  Q  P +LTY   S D+ M V+VIG+G
Sbjct  19   KIALGYGRTK---TSLKISGLIGIDPVAGQDKSSQVSPKILTYERSSLDIAMPVLVIGTG  75

Query  656  LGEVKRNPLFP--PCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATY  829
            L E KR+ L P   CAPK VNHR+FY+EC+ P  +FV +DYGH+DMLDDE      +   
Sbjct  76   LSEQKRHELLPGSACAPKDVNHREFYRECKPPCYHFVTRDYGHLDMLDDEYAAALFRY--  133

Query  830  CLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAFQ  997
              CK GK  +  MR  V G +VAFL+  L G+   L  I  +   +AP +L  V ++
Sbjct  134  -FCKEGKNCKEIMRRSVAGIMVAFLKAVLSGEDGDLRVIV-KDPGLAPAKLNPVEYR  188



>ref|XP_011032785.1| PREDICTED: chlorophyllase type 0-like [Populus euphratica]
Length=166

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 91/152 (60%), Gaps = 2/152 (1%)
 Frame = +2

Query  356  EIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALG-KIARTDLKLS  532
            E+   A++ NWLP GL   LP  +      +AL GHSRGG +AF LALG      D+ +S
Sbjct  8    ELDLAAEVANWLPSGLRCVLPEDIEGEMHNLALAGHSRGGYIAFALALGLADVSLDINIS  67

Query  533  ALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFP-PCAPKGV  709
            ALIGVDPV G  K  Q  P +L Y   SF+  + V +IG+GLG     P+ P  CAP GV
Sbjct  68   ALIGVDPVVGTSKNNQMEPKILNYESCSFNFSIPVTIIGTGLGNEPAFPILPQTCAPDGV  127

Query  710  NHRDFYQECRGPACYFVAKDYGHVDMLDDETG  805
            +H + + EC+ P  +FV   YGH+D+LDD+ G
Sbjct  128  SHTEIFNECKPPCSHFVTTYYGHLDVLDDDRG  159



>dbj|BAO47884.1| chlorophyllase, partial [Dianthus caryophyllus]
Length=91

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +2

Query  497  LGKIARTDLKLSALIGVDPVDGMDKGKQTPPPVLTYIPQSFDL-GMAVMVIGSGLGEVKR  673
            L K+  + L +SALIG+DPVDGMDKGKQTPP VL+YIP+SFDL G+  +VIGSGLGEVKR
Sbjct  1    LKKLIPSPLTISALIGIDPVDGMDKGKQTPPAVLSYIPRSFDLDGIPTLVIGSGLGEVKR  60

Query  674  NPLFPPCAPKGVNHRDFYQECRGPACYFVAK  766
            N  FP CAPKGVNH +FY ECR  + YF+ K
Sbjct  61   NAFFPACAPKGVNHENFYDECRDQSWYFLVK  91



>gb|AFX87198.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87212.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87230.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87248.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87322.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87326.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87328.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87340.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87346.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87348.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 87/126 (69%), Gaps = 2/126 (2%)
 Frame = +2

Query  569  KGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA  748
            K  +T P +LTY PQSFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+   
Sbjct  1    KFMRTDPHILTYKPQSFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATK  59

Query  749  CYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDF  925
             +FVA DYGH+DMLDD+  G  G    C+CKNG ++++ MR+FVGG VVAFL+  L G+ 
Sbjct  60   AHFVAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEK  119

Query  926  SSLAAI  943
            S +  I
Sbjct  120  SEIRLI  125



>gb|AFX87318.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87330.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = +2

Query  569  KGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA  748
            K  +T P +LTY PQSFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+   
Sbjct  1    KFMRTDPHILTYKPQSFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATK  59

Query  749  CYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDF  925
             +FVA DYGH+DMLDD+  G  G    C+CKNG + ++ MR+FVGG VVAFL+  L G+ 
Sbjct  60   AHFVAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRNKSEMRSFVGGIVVAFLKYSLWGEK  119

Query  926  SSLAAI  943
            S +  I
Sbjct  120  SEIRLI  125



>gb|AFX87349.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87350.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 87/126 (69%), Gaps = 2/126 (2%)
 Frame = +2

Query  569  KGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA  748
            K  +T P +LTY P+SFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+   
Sbjct  1    KFMRTDPHILTYKPESFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATK  59

Query  749  CYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDF  925
             +FVA DYGH+DMLDD+  G  G    C+CKNG ++++ MR+FVGG VVAFL+  L G+ 
Sbjct  60   THFVAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEK  119

Query  926  SSLAAI  943
            S +  I
Sbjct  120  SEIRLI  125



>gb|AFX87076.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87084.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87086.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87087.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87088.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87092.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87093.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87096.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87097.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87101.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87104.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87105.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87106.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87107.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87108.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87109.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87113.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87114.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87116.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87120.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87122.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87124.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87125.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87128.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87129.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87130.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87132.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87136.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87137.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87138.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87139.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87144.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87145.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87146.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87147.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87150.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87154.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87155.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87158.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87159.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87160.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87161.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87162.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87163.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87164.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87165.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87166.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87167.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87168.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87170.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87171.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87172.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87173.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87175.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87176.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87177.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87178.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87180.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87182.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87184.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87188.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87189.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87190.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87191.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87192.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87193.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87194.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87195.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87196.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87197.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87199.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87200.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87201.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87202.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87203.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87204.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87205.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87206.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87207.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87208.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87209.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87211.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87213.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87214.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87215.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87217.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87218.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87219.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87220.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87221.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87222.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87223.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87225.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87226.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87227.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87228.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87229.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87233.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87234.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87235.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87236.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87237.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87238.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87239.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87240.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87241.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87242.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87243.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87244.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87245.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87246.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87249.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87250.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87251.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87252.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87253.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87254.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87255.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87256.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87257.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87258.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87259.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87260.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87261.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87262.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87263.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87264.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87265.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87266.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87267.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87268.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87269.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87270.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87271.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87272.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87273.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87274.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87275.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87276.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87277.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87278.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87279.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87280.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87281.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87282.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87283.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87284.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87285.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87286.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87287.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87288.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87289.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87290.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87291.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87292.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87293.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87294.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87295.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87296.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87297.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87298.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87299.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87300.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87301.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87302.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87303.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87304.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87305.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87306.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87307.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87308.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87309.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87310.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87311.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87312.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87313.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87314.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87315.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87316.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87317.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87319.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87320.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87321.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87323.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87324.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87325.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87331.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87332.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87333.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87334.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87335.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87336.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87337.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87338.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87339.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87341.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87342.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87343.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87344.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87345.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87347.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87351.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87352.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87355.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87356.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87359.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87360.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 87/126 (69%), Gaps = 2/126 (2%)
 Frame = +2

Query  569  KGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA  748
            K  +T P +LTY P+SFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+   
Sbjct  1    KFMRTDPHILTYKPESFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATK  59

Query  749  CYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDF  925
             +FVA DYGH+DMLDD+  G  G    C+CKNG ++++ MR+FVGG VVAFL+  L G+ 
Sbjct  60   AHFVAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEK  119

Query  926  SSLAAI  943
            S +  I
Sbjct  120  SEIRLI  125



>gb|AFX87231.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87232.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 87/126 (69%), Gaps = 2/126 (2%)
 Frame = +2

Query  569  KGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA  748
            K  +T P +LTY P+SFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+   
Sbjct  1    KFMRTDPHILTYKPESFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATK  59

Query  749  CYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDF  925
             +FVA DYGH+DMLDD+  G  G    C+CKNG ++++ MR+FVGG VVAFL+  L G+ 
Sbjct  60   AHFVAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEK  119

Query  926  SSLAAI  943
            S +  I
Sbjct  120  SEIRLI  125



>gb|AFX87353.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87354.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=147

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 86/123 (70%), Gaps = 2/123 (2%)
 Frame = +2

Query  578  QTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYF  757
            +T P +LTY P+SFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+    +F
Sbjct  4    RTDPHILTYKPESFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATKAHF  62

Query  758  VAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDFSSL  934
            VA DYGH+DMLDD+  G  G    C+CKNG ++++ MR+FVGG VVAFL+  L G+ S +
Sbjct  63   VAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKSEI  122

Query  935  AAI  943
              I
Sbjct  123  RLI  125



>gb|AFX87074.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87075.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87078.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87082.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87083.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87089.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87090.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87091.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87094.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87095.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87098.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87099.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87100.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87102.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87103.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87115.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87117.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87118.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87119.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87121.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87123.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87126.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87127.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87131.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87134.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87135.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87179.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87181.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87183.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87185.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87186.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87187.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87210.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87216.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87224.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87247.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87327.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87329.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = +2

Query  569  KGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA  748
            K  +T P +LTY P+SFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+   
Sbjct  1    KFMRTDPHILTYKPESFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATK  59

Query  749  CYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDF  925
             +FVA DYGH+DMLDD+  G  G    C+CKNG + ++ MR+FVGG VVAFL+  L G+ 
Sbjct  60   AHFVAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRNKSEMRSFVGGIVVAFLKYSLWGEK  119

Query  926  SSLAAI  943
            S +  I
Sbjct  120  SEIRLI  125



>gb|AFX87080.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87081.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = +2

Query  569  KGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA  748
            K  +T P +LTY P+SFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+   
Sbjct  1    KFMRTDPHILTYKPESFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATK  59

Query  749  CYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDF  925
             +FVA DYGH+DMLDD+  G  G    C+CKNG + ++ MR+FVGG VVAFL+  L G+ 
Sbjct  60   AHFVAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRNKSEMRSFVGGIVVAFLKYSLWGEK  119

Query  926  SSLAAI  943
            S +  I
Sbjct  120  SEIRLI  125



>gb|AFX87140.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87141.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87142.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87143.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87148.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87149.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87151.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87152.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87153.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87156.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87157.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87169.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = +2

Query  569  KGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA  748
            K  +T P +LTY P+SFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+   
Sbjct  1    KFMRTDPHILTYKPESFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATK  59

Query  749  CYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDF  925
              FVA DYGH+DMLDD+  G  G    C+CKNG ++++ MR+FVGG VVAFL+  L G+ 
Sbjct  60   ANFVAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEK  119

Query  926  SSLAAI  943
            S +  I
Sbjct  120  SEIRLI  125



>gb|AFX87357.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87358.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = +2

Query  569  KGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA  748
            K  +T P +LTY P+SFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+   
Sbjct  1    KFMRTDPHILTYKPESFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATK  59

Query  749  CYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDF  925
             +FV  DYGH+DMLDD+  G  G    C+CKNG ++++ MR+FVGG VVAFL+  L G+ 
Sbjct  60   AHFVTADYGHMDMLDDDLPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEK  119

Query  926  SSLAAI  943
            S +  I
Sbjct  120  SEIRLI  125



>gb|AFX87077.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87174.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = +2

Query  569  KGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA  748
            K  +T P +LTY P+SFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+   
Sbjct  1    KFMRTDPHILTYKPESFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATK  59

Query  749  CYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDF  925
             +FVA DYGH+DMLDD+  G  G    C+CKNG ++++ MR+FVGG VVAF +  L G+ 
Sbjct  60   AHFVAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFFKYSLWGEK  119

Query  926  SSLAAI  943
            S +  I
Sbjct  120  SEIRLI  125



>gb|AFX87079.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87085.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87112.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87133.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 85/126 (67%), Gaps = 2/126 (2%)
 Frame = +2

Query  569  KGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA  748
            K  +T P +LTY P+SFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+   
Sbjct  1    KFMRTDPHILTYKPESFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATK  59

Query  749  CYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDF  925
             +FVA DYGH+DMLDD+  G  G    C+CKNG + ++ MR+FVGG VVAF +  L G+ 
Sbjct  60   AHFVAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRNKSEMRSFVGGIVVAFFKYSLWGEK  119

Query  926  SSLAAI  943
            S +  I
Sbjct  120  SEIRLI  125



>gb|AFX87110.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87111.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = +2

Query  569  KGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA  748
            K  +T P +LTY P+SFDL + V V+G+GLG  K N + PPCAP  +NH +FY+EC+   
Sbjct  1    KFMRTDPHILTYKPESFDLDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATK  59

Query  749  CYFVAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDF  925
             +FVA DYGH+DMLDD+  G  G    C+CKNG ++++ MR+FVGG V AFL+  L G+ 
Sbjct  60   AHFVAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVXAFLKYSLWGEK  119

Query  926  SSLAAI  943
            S +  I
Sbjct  120  SEIRLI  125



>ref|XP_002459847.1| hypothetical protein SORBIDRAFT_02g012201 [Sorghum bicolor]
 gb|EER96368.1| hypothetical protein SORBIDRAFT_02g012201 [Sorghum bicolor]
Length=235

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = +2

Query  587  PPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAK  766
            P +LTY   SF++ M V+VIG+GLGE KRN LFPPCAPK VNH++FY EC  P  YFV K
Sbjct  91   PQILTYESSSFNIAMPVLVIGTGLGEEKRNILFPPCAPKDVNHKEFYLECMPPCYYFVTK  150

Query  767  DYGHVDMLDDETGGVRGKATYCLCKNGKE-RAAMRAFVGGAVVAFLRGYLEGD  922
            DYGH+DMLDD+      K   C+CK+GK  +  MR  V G +VAFL+  L G+
Sbjct  151  DYGHLDMLDDDA----PKFMTCMCKDGKNCKDMMRRSVAGIMVAFLKAVLSGE  199


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 56/82 (68%), Gaps = 4/82 (5%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            T T++F  GK  VEL+SV+ +  T   PP P+LIA P ++  G +P+ + LHG+   N F
Sbjct  18   TVTSVFQPGKLAVELISVDHN--TDPTPPIPVLIAAPKDS--GTYPVAMLLHGFCLQNHF  73

Query  266  YSQLIQHIASHGFIVVAPQLYS  331
            Y Q+++HIAS GFI+VAPQ+ +
Sbjct  74   YEQVLKHIASFGFIMVAPQILT  95



>gb|AFX87374.1| chlorophyllase 1, partial [Arabidopsis thaliana]
Length=143

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 92/136 (68%), Gaps = 3/136 (2%)
 Frame = +2

Query  578  QTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYF  757
            +T P +LTY P+SF+L + V V+G+GLG  K N + PPCAP  +NH +FY+EC+    +F
Sbjct  4    RTDPHILTYKPESFELDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATKAHF  62

Query  758  VAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDFSSL  934
            VA DYGH+DMLDD+  G  G    C+CKNG ++++ MR+FVGG VVAFL+  L G+ + +
Sbjct  63   VAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKAEI  122

Query  935  AAIRDRHEEIAPVELQ  982
              I  +   ++P +L 
Sbjct  123  RLIV-KDPSVSPAKLD  137



>gb|AFX87361.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87362.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87363.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87364.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87365.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87366.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87367.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87368.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87369.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87370.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87371.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87372.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87373.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87375.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87376.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87377.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87378.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87379.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87380.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87381.1| chlorophyllase 1, partial [Arabidopsis thaliana]
Length=150

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 92/136 (68%), Gaps = 3/136 (2%)
 Frame = +2

Query  578  QTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYF  757
            +T P +LTY P+SF+L + V V+G+GLG  K N + PPCAP  +NH +FY+EC+    +F
Sbjct  4    RTDPHILTYKPESFELDIPVAVVGTGLGP-KWNNVMPPCAPTDLNHEEFYKECKATKAHF  62

Query  758  VAKDYGHVDMLDDETGGVRGKATYCLCKNG-KERAAMRAFVGGAVVAFLRGYLEGDFSSL  934
            VA DYGH+DMLDD+  G  G    C+CKNG ++++ MR+FVGG VVAFL+  L G+ + +
Sbjct  63   VAADYGHMDMLDDDLPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKAEI  122

Query  935  AAIRDRHEEIAPVELQ  982
              I  +   ++P +L 
Sbjct  123  RLIV-KDPSVSPAKLD  137



>ref|XP_009594424.1| PREDICTED: chlorophyllase-1-like, partial [Nicotiana tomentosiformis]
Length=145

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 85/144 (59%), Gaps = 7/144 (5%)
 Frame = +2

Query  560  GMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECR  739
            G     ++ P +L YIP++FD  + V VIG+GL   +R  +FPP AP GVNH +F+ EC+
Sbjct  4    GFSPSNRSAPKILQYIPRNFDQTIPVAVIGAGLSN-QRVCIFPPFAPNGVNHSEFFNECK  62

Query  740  GPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERAAMRAFVGGAVVAFLRGYLE  916
             P CYF+AK+YGH DMLDDE   +       + K+GK  +  MR  VGG VVAFL   L 
Sbjct  63   PPCCYFLAKNYGHTDMLDDEIAAI----ASLISKSGKGPKDLMRKAVGGIVVAFLEAKLG  118

Query  917  GDFSSLAAIRDRHEEIAPVELQTV  988
            G   +L  I  +   +AP+ L  V
Sbjct  119  GKVDNLNPIV-QEPSLAPITLDPV  141



>ref|XP_006443996.1| hypothetical protein CICLE_v10024279mg [Citrus clementina]
 gb|ESR57236.1| hypothetical protein CICLE_v10024279mg [Citrus clementina]
Length=224

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 110/220 (50%), Gaps = 36/220 (16%)
 Frame = +2

Query  410  FLPPHV---HPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGKQ  580
            F+ P V     N   +A  GHSR G++ F L+L           A+IG+DPV G  K   
Sbjct  2    FIHPSVKNTEANVSLVAAMGHSRRGQIVFALSL------HYGFHAVIGLDPVAGTSKSTG  55

Query  581  TPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPA-CYF  757
              P +L++  +SFD  + V +IG+GLG V R     PCAP+G NH +F+  C+  +  +F
Sbjct  56   LDPSILSF--ESFDFSIPVTMIGTGLGGVAR--CITPCAPEGANHEEFFNRCKSSSRAHF  111

Query  758  VAKDYGHVDMLDDETGGVRGKA-TYCLCKNGKE--------------------RAAMRAF  874
            VA DYGH+D+LDD    V+  A +   CKNG +                    R +MR  
Sbjct  112  VATDYGHMDILDDNPSDVKSWALSKYFCKNGNQSRDPMGEMQVMQPIGDVYLFRLSMRRC  171

Query  875  VGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
            V G VVAF + + +GD      I  +    AP++L +V +
Sbjct  172  VSGIVVAFPKDFFDGDAEDFRQIL-KDPSFAPIKLDSVEY  210



>ref|XP_006662361.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Oryza brachyantha]
Length=201

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 80/122 (66%), Gaps = 15/122 (12%)
 Frame = +2

Query  62   VTFsssssTATNIFDVGKYTVELVSVE--PHKCTSH-----------PPPKPLLIATPSE  202
            +T ++++ + T +FD G Y V LV V+  P KC++             PPKPLL+A P E
Sbjct  22   LTMAAAAPSITGVFDHGSYGVALVKVDEAPRKCSAARKSAAPTGGGGAPPKPLLVAAPRE  81

Query  203  ASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQIT  382
            A  G +P+ LFLHGYL  NSFYSQL++H+ASHGF+VV PQLY+++G   T+EI   A + 
Sbjct  82   A--GEYPVVLFLHGYLANNSFYSQLLEHVASHGFVVVGPQLYAISGPGTTDEINSAAAVI  139

Query  383  NW  388
            NW
Sbjct  140  NW  141



>gb|KGN61685.1| hypothetical protein Csa_2G224250 [Cucumis sativus]
Length=191

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 102/211 (48%), Gaps = 39/211 (18%)
 Frame = +2

Query  353  EEIKCTAQITNWLPEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLS  532
            +E+K   ++  WL  GL+  LP +V  +  K++L GHSRGGK AF LALG I R  L  S
Sbjct  8    QEVKSATEVIKWLASGLNPLLPTNVEGDISKLSLVGHSRGGKTAFSLALG-ICRPSLPFS  66

Query  533  ALIGVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVN  712
            A+IG+DPV G  K  Q  P +L  + + F +   + VIG+GLG    +P+  PCAP G N
Sbjct  67   AVIGIDPVAGT-KCFQPQPHILPPLSEPFKISAPITVIGTGLGPKSASPITCPCAPDGFN  125

Query  713  HRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERAAMRAFVGGAV  889
            H  F+ +                                    NGK  R  MR    G V
Sbjct  126  HVAFFSK-----------------------------------NNGKGSRKLMRECCSGLV  150

Query  890  VAFLRGYLEGDFSSLAAIRDRHEEIAPVELQ  982
            VA L+ YL+ D S L AI      IAPV+L 
Sbjct  151  VASLKAYLDNDESFLNAIY-VDPSIAPVDLN  180



>gb|KHN00266.1| Chlorophyllase-2, chloroplastic [Glycine soja]
Length=84

 Score =   106 bits (264),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  629  MAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDET  802
            MAVMVIGS LGEVKRNPLFPPCAPKGV++ +F++EC+ PA YF+AKDYGH DM DD+T
Sbjct  1    MAVMVIGSDLGEVKRNPLFPPCAPKGVSYENFFKECKKPAWYFLAKDYGHCDMQDDDT  58



>ref|XP_008355464.1| PREDICTED: chlorophyllase-1-like [Malus domestica]
Length=107

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = +2

Query  683  FPPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERA  859
             PPCA  G NH++F+ EC+ P  +FV KDYGH+DMLDD+  G+ G  + C+CKNG   R 
Sbjct  1    MPPCAXXGANHKEFFYECKPPCAHFVVKDYGHMDMLDDDPQGMVGAVSGCMCKNGTGPRE  60

Query  860  AMRAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
             MR  VGG VVAFL  YL GD   L AI    +  +P +L+ V F
Sbjct  61   LMRKTVGGIVVAFLNAYLNGDDXXLVAIVGDPDS-SPAKLEPVEF  104



>dbj|BAG55223.1| chlorophyllase [Sesbania rostrata]
Length=106

 Score =   102 bits (254),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 52/103 (50%), Positives = 63/103 (61%), Gaps = 2/103 (2%)
 Frame = +2

Query  689  PCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGK-ERAAM  865
            PCA  GVNH++FY EC+ P  +FV  DYGH+DMLDD+T G+ G    C+CKNG      M
Sbjct  2    PCASDGVNHKEFYNECKPPRAHFVTTDYGHMDMLDDDTPGIMGNMMKCMCKNGTGPMDFM  61

Query  866  RAFVGGAVVAFLRGYLEGDFSSLAAIRDRHEEIAPVELQTVAF  994
            R  VGG VVAFLR YL   +  L AI      IAP +L  V +
Sbjct  62   RRTVGGLVVAFLRAYLNDQWKDLNAIL-ADPSIAPAKLDPVEY  103



>ref|XP_004345599.1| predicted protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW40877.1| hypothetical protein CAOG_06009 [Capsaspora owczarzaki ATCC 30864]
Length=359

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 87/309 (28%), Positives = 137/309 (44%), Gaps = 34/309 (11%)
 Frame = +2

Query  89   ATNIFDVGKYTVELVSVEPHKCTSHP--PPKPLLIATPSEASAGAFPIFLFLHGYL--FY  256
            A N F  G      + V+ +K  S+P  P + L +  PS  SAG++ + +FL G      
Sbjct  32   AINPFQPGSLATAHLHVDSNKTNSNPTLPVEGLDLYFPS--SAGSYDVVVFLGGLAGDVP  89

Query  257  NSFYSQLIQHIASHGFIVVAPQLYSVAGAD--ATEEIKCTAQITNWLPEGLHNFLPPHVH  430
             S YS +++ +A+HG IVV    Y +  AD  AT+ +     +  W+ + ++  +   ++
Sbjct  90   VSMYSDMLRRVAAHGVIVVGVSTYQLPLADMLATKMLL----VIGWVHQNMNQLM---IN  142

Query  431  PNT---------QKIALGGHSRGGKVAFGLALGKIARTDLKL-SALIGVDPVDGMDKGKQ  580
              T         + I L GHS GGK+     + +       L  AL+ V+PVDG D    
Sbjct  143  STTYAGVQADFSRGIVLSGHSAGGKI-----VTRFLEVQCSLVRALVLVNPVDGEDPWGI  197

Query  581  TPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPACYFV  760
             P  V+ + P   +  + ++V+G GLG V   P FP CAP G N   FY   R       
Sbjct  198  LPGFVI-HPPYPVNFTLPLLVLGEGLGPVVAQPGFPACAPAGRNFPRFYNGARPCKWMIN  256

Query  761  AKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAM---RAFVGGAVVAFLRGYLEGDFSS  931
            A D+GH D+LD            C        A     R F+ G +V+  RG ++    +
Sbjct  257  ATDFGHADLLDAVYVEFVQATKLCASNMNASLAQFSTYRQFIAGTIVSMTRGAIDSQCDA  316

Query  932  LAAIRDRHE  958
               I+ + +
Sbjct  317  YNYIQSQSQ  325



>ref|XP_009371949.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009375977.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Pyrus x bretschneideri]
Length=136

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 80/122 (66%), Gaps = 17/122 (14%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTS----------------HPPPKPLLIATPSEASAGA  217
            + TN+F++GKY V L  VE  + ++                 PPPKPLLI  P EA+ G 
Sbjct  16   SGTNVFEIGKYNVVLQIVEVAERSACSSKTKSSSSIPPPKNPPPPKPLLIGMPCEAT-GK  74

Query  218  FPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNWLPE  397
             P+ L LHGYL  NSFYSQLI HIASHGFIV+APQ Y++ G ++++EIK TA+I NWL E
Sbjct  75   LPMLLLLHGYLLSNSFYSQLINHIASHGFIVIAPQFYTIVGPNSSDEIKSTAEIINWLSE  134

Query  398  GL  403
            GL
Sbjct  135  GL  136



>gb|EYU31293.1| hypothetical protein MIMGU_mgv1a023411mg, partial [Erythranthe 
guttata]
Length=111

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 7/84 (8%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKP-----LLIATPSEASAGAFPIFLFLHGYL  250
            +++N+FD+G +T +L+ +E   C  +          LLI  PSE   G +P+ +FLHG+L
Sbjct  14   SSSNVFDIGNHTTKLIKIEADNCRKNASSSSPPPKPLLICAPSEE--GVYPVLVFLHGFL  71

Query  251  FYNSFYSQLIQHIASHGFIVVAPQ  322
             YNSFYSQL+QH+ASHGFIVVAPQ
Sbjct  72   LYNSFYSQLLQHVASHGFIVVAPQ  95



>tpg|DAA48625.1| TPA: hypothetical protein ZEAMMB73_996983, partial [Zea mays]
Length=187

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 73/140 (52%), Gaps = 26/140 (19%)
 Frame = +2

Query  320  QLYSVA-GADATEEIKCTAQITNWLPEG-------LHNFLPPH-VHPNTQKIALGGHSRG  472
            QLY V    +  ++I  T Q+T WL +        L N L  H V P+  ++AL GHSRG
Sbjct  48   QLYCVTLNMNDLKDIDATRQVTAWLADKQQGLAHVLANILQLHGVRPDLSRLALAGHSRG  107

Query  473  GKVAFGLALG-----------------KIARTDLKLSALIGVDPVDGMDKGKQTPPPVLT  601
            G  AF +ALG                   A   LK SALIGVDPV G+ K  Q  P VLT
Sbjct  108  GDTAFAVALGLGPAASDDDDNNADAGTSPAALPLKFSALIGVDPVAGLSKQAQVEPKVLT  167

Query  602  YIPQSFDLGMAVMVIGSGLG  661
            + P+S D GM  +V+G+GLG
Sbjct  168  FRPRSLDPGMPALVVGTGLG  187



>ref|XP_002311639.1| Chlorophyllase 1 family protein [Populus trichocarpa]
 gb|EEE89006.1| Chlorophyllase 1 family protein [Populus trichocarpa]
Length=104

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  551  PVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFP  688
            PV+G DKGKQTPPPVL Y+P+SFDL +AVMVIGSGLGE+KRNPLFP
Sbjct  31   PVNGKDKGKQTPPPVLAYVPRSFDLDVAVMVIGSGLGELKRNPLFP  76



>emb|CDP11312.1| unnamed protein product [Coffea canephora]
Length=87

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query  761  AKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYLEGDFSSLAA  940
            AK+YG +DM+DD+   +RGK  YCL KNG+ R  M  FVGG   AF R YL G+   L A
Sbjct  9    AKEYGLLDMVDDDISWIRGKVAYCLHKNGESRDPMWRFVGGITFAFTRNYLAGNSRDLQA  68

Query  941  IRDRHEEIAPVELQTVAF  994
            IRD H   AP+ELQ V F
Sbjct  69   IRDGH-LTAPIELQNVDF  85



>ref|XP_006838964.1| hypothetical protein AMTR_s00002p00271070 [Amborella trichopoda]
 gb|ERN01533.1| hypothetical protein AMTR_s00002p00271070 [Amborella trichopoda]
Length=110

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 57/80 (71%), Gaps = 3/80 (4%)
 Frame = +2

Query  86   TATNIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSF  265
            +  ++FD+G+Y V+ + VE  +  + PP +PL+I  P+E   G +P+ +F HG++  NS+
Sbjct  22   SWNSVFDMGRYPVKRIDVEESRNRASPP-RPLMIVAPTEE--GEYPVIIFFHGFILCNSY  78

Query  266  YSQLIQHIASHGFIVVAPQL  325
            Y+QL+ H+ASHGFI VAPQ+
Sbjct  79   YNQLLSHVASHGFIAVAPQV  98



>ref|XP_010522518.1| PREDICTED: uncharacterized protein LOC104801112 isoform X2 [Tarenaya 
hassleriana]
Length=561

 Score = 83.6 bits (205),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -2

Query  922  ISFQITSQESHHSAPNKRPHRRPLLPILAQTISSLPANPSSLIIKHVNMPIVFSHKVTSR  743
            I  QI+ Q+SH+ + +K PHR P + +LAQTI  LP NP  L+IKHV M I  SH++ SR
Sbjct  465  IPIQISLQKSHNDSTDKSPHRFPTVTVLAQTIRGLPPNPPRLVIKHVQMAIALSHQMPSR  524

Query  742  STTLLVEIPVVHPLGGARRE*RVPLHLPEA*PDHHH  635
            STT   ++ VVHP   A R+  +P    E+ PD+ +
Sbjct  525  STTFSEKLTVVHPGRRAGRKQWIPRDFTESRPDYQN  560



>ref|XP_010522517.1| PREDICTED: uncharacterized protein LOC104801112 isoform X1 [Tarenaya 
hassleriana]
Length=562

 Score = 83.6 bits (205),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -2

Query  922  ISFQITSQESHHSAPNKRPHRRPLLPILAQTISSLPANPSSLIIKHVNMPIVFSHKVTSR  743
            I  QI+ Q+SH+ + +K PHR P + +LAQTI  LP NP  L+IKHV M I  SH++ SR
Sbjct  466  IPIQISLQKSHNDSTDKSPHRFPTVTVLAQTIRGLPPNPPRLVIKHVQMAIALSHQMPSR  525

Query  742  STTLLVEIPVVHPLGGARRE*RVPLHLPEA*PDHHH  635
            STT   ++ VVHP   A R+  +P    E+ PD+ +
Sbjct  526  STTFSEKLTVVHPGRRAGRKQWIPRDFTESRPDYQN  561



>dbj|BAD21503.1| hypothetical protein [Oryza sativa Japonica Group]
Length=140

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 58/108 (54%), Gaps = 7/108 (6%)
 Frame = +2

Query  686  PPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKN--GKERA  859
            PPCAP GVNH +FY EC  P  +FV +D GH+DMLDD   GV      C+C    G  + 
Sbjct  34   PPCAPAGVNHCEFYDECAPPRYHFVLRDNGHLDMLDD---GVPYAINNCMCMRNLGDTKE  90

Query  860  AMRAFVGGAVVAFLRGYLEGDFSSLAAIRD--RHEEIAPVELQTVAFQ  997
              R  +GG +VAFLR  LE     L  +     +  +AP  ++ VA+ 
Sbjct  91   VARRTIGGLMVAFLRDALEDQHDDLKLVLKVGVNPGLAPAVIKPVAYD  138



>gb|EAZ22614.1| hypothetical protein OsJ_06283 [Oryza sativa Japonica Group]
Length=135

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 49/88 (56%), Gaps = 5/88 (6%)
 Frame = +2

Query  686  PPCAPKGVNHRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKN--GKERA  859
            PPCAP GVNH +FY EC  P  +FV +D GH+DMLDD   GV      C+C    G  + 
Sbjct  29   PPCAPAGVNHCEFYDECAPPRYHFVLRDNGHLDMLDD---GVPYAINNCMCMRNLGDTKE  85

Query  860  AMRAFVGGAVVAFLRGYLEGDFSSLAAI  943
              R  +GG +VAFLR  LE     L  +
Sbjct  86   VARRTIGGLMVAFLRDALEDQHDDLKLV  113



>ref|WP_015746913.1| chlorophyllase [Nakamurella multipartita]
 ref|YP_003200998.1| chlorophyllase [Nakamurella multipartita DSM 44233]
 gb|ACV78009.1| Chlorophyllase [Nakamurella multipartita DSM 44233]
Length=239

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 110/233 (47%), Gaps = 35/233 (15%)
 Frame = +2

Query  224  IFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQITNW--LPE  397
            + + L G++   + Y+ L Q +A  G  V+ PQLY       T  +    +      L  
Sbjct  18   VLILLPGFMIAAASYTVLAQAVAGSGSTVIVPQLYRRGLGALTGRVPVATEAAAAADLVR  77

Query  398  GLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIGVDPVDGMDKGK  577
             +    P        +I LGGHSRGG+ A+  A G++ R D + ++++ +DPVDG  +G+
Sbjct  78   SVAADRP------GARIHLGGHSRGGQAAW-RAAGQL-RDDDRPASVVLLDPVDG--QGR  127

Query  578  QTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRDFYQECRGPAC-Y  754
            +   P  T    +F   +  +++G+G+G          CAP+G+NHR F +    PA  +
Sbjct  128  RPSGPTATAQEAAFT--VPALIVGAGVGGR--------CAPEGINHRQFARAT--PAARH  175

Query  755  FVAKDYGHVDMLDDETGGVRGKAT-YCLCKNGKE----RAAMRAFVGGAVVAF  898
             +    GH D+LD      RG+     LC  G +    R+A+ A +G  + A 
Sbjct  176  MLVPGLGHADLLDG-----RGRDLGRRLCGGGPDPDAARSAIAALIGAWITAV  223



>gb|EFX74151.1| hypothetical protein DAPPUDRAFT_307488 [Daphnia pulex]
Length=356

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 115/272 (42%), Gaps = 23/272 (8%)
 Frame = +2

Query  206  SAGAFPIFLFLHGY--LFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEEIKCTAQI  379
            + G FP+F F  G+  +     +SQL   IASHG ++VA  ++ +   + + +       
Sbjct  68   ATGNFPVFYFTTGFGGIIPAEAHSQLFSQIASHGVVLVA--VWKIGSPENSFDPAWLQAT  125

Query  380  TNWLPEGLHNFLPPH------VHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALI  541
             +++ + L N L          H +     +GGHS G  VA    + ++ +  L    LI
Sbjct  126  VDFVEKRLENSLHNQEGYVSDFHVDYLNSFIGGHSAGNHVA----VAQLQKDCLHYKGLI  181

Query  542  GVDPVDGMDKGKQTPPPVLTYIP---QSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVN  712
             VD VDG       P  V  Y+    Q  +  +  + I +GL  +   P    CAP+ + 
Sbjct  182  LVDAVDG---NNPIPENVTMYVITPGQKVNFTIPTLEIVTGLDPIP-GPYGLACAPEELA  237

Query  713  HRDFYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVV  892
             R F+    GP  Y  A  YGH D++D     +   A +C       +     F+ G +V
Sbjct  238  GRRFFDAMTGPTWYVNATAYGHADLMDPVYVELNELAQFCPNDPNAPKPEYIQFLTGEIV  297

Query  893  AFLRGYLEGDFSSLAAIRDRHEEIAPVELQTV  988
            +F+   L  D     A+ D  EE   V + T+
Sbjct  298  SFINAVL--DPVGNCALFDNLEESGFVGINTL  327



>gb|KHN44572.1| Chlorophyllase-1 [Glycine soja]
Length=149

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 3/88 (3%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            ++F  G +  +  +VE    +S   PKPLLI TP     G++P+ LF HG+  +NSFYS+
Sbjct  13   DVFQKGDFHWKQFNVETSSASS-STPKPLLIFTP--IVPGSYPVILFCHGFFIHNSFYSE  69

Query  275  LIQHIASHGFIVVAPQLYSVAGADATEE  358
             + HIA HGFI+VAPQL  +   D+   
Sbjct  70   FLGHIALHGFILVAPQLDGIGPRDSMRR  97



>ref|XP_002520935.1| chlorophyllase, putative [Ricinus communis]
 gb|EEF41352.1| chlorophyllase, putative [Ricinus communis]
Length=122

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +2

Query  167  PPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQLIQHIASHGFIVVAPQL  325
            PPKPLL+ TP+    G +P+ LFLHG    NS YS L QHI+SHG+IVVAPQ+
Sbjct  56   PPKPLLVVTPT--VDGIYPVILFLHGTCLINSLYSDLFQHISSHGYIVVAPQI  106



>ref|XP_006583435.1| PREDICTED: chlorophyllase-1, chloroplastic-like [Glycine max]
Length=87

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +2

Query  95   NIFDVGKYTVELVSVEPHKCTSHPPPKPLLIATPSEASAGAFPIFLFLHGYLFYNSFYSQ  274
            ++F  G +  +  +VE    +S   PKPLLI TP     G++P+ LF HG+  +NSFYS+
Sbjct  13   DVFQKGDFHWKQFNVETSSASS-STPKPLLIFTP--IVPGSYPVILFCHGFFIHNSFYSE  69

Query  275  LIQHIASHGFIVVAPQL  325
             + HIA HGFI+VAPQL
Sbjct  70   FLGHIALHGFILVAPQL  86



>ref|WP_007193344.1| amidohydrolase 2 [Thiocapsa marina]
 gb|EGV18485.1| amidohydrolase 2 [Thiocapsa marina 5811]
Length=713

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 89/205 (43%), Gaps = 16/205 (8%)
 Frame = +2

Query  200  EASAGA--FPIFLFLHGYLFYNSFYSQLIQHIASHGF--IVVAPQLYSVAGADATEEIKC  367
            EA+ GA   P+ L   G+      Y+    H+AS G+  +V       ++ A  T  ++ 
Sbjct  447  EAADGAAPVPVILVSPGFQLDRDLYASYPIHLASWGYAALVTEKLQLGISHAAMTRRLR-  505

Query  368  TAQITNWL-PEGLHNFLPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALIG  544
               + +WL  E      P H   +  KI L GHS GGK++F L +  I   D ++ A+  
Sbjct  506  --DVLSWLVDEESRPESPLHGRLDLSKIGLAGHSLGGKISFMLGIDLIEDDDERVQAIFA  563

Query  545  VDPVDGMDKGKQTPPPVLTYIPQSF-DLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRD  721
            +DPV   D GK +P    +  P+    + M  + +G  L    ++     CAP+  N   
Sbjct  564  IDPV---DDGKGSP----SVTPEQMAKVDMPFIALGETLDSTPKHDSLMACAPEASNFEK  616

Query  722  FYQECRGPACYFVAKDYGHVDMLDD  796
            F+   R PA         H+  LD+
Sbjct  617  FFDGARSPAAKIDVLGASHMSFLDN  641



>gb|EFX74152.1| hypothetical protein DAPPUDRAFT_109234 [Daphnia pulex]
Length=352

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 103/244 (42%), Gaps = 15/244 (6%)
 Frame = +2

Query  206  SAGAFPIFLFLHGY--LFYNSFYSQLIQHIASHGFIVVAPQLYSVAGADATEE---IKCT  370
            S G FP+F F+ G+  +     ++ L+  IASHG +VVA  ++ +   + + +    + T
Sbjct  67   STGNFPVFYFITGFGGIVPAEAHTLLLSQIASHGIVVVA--VWKLGSPETSFDPAWFETT  124

Query  371  AQ-ITNWLPEGLHNF--LPPHVHPNTQKIALGGHSRGGKVAFGLALGKIARTDLKLSALI  541
               + N L   LHN        H +     +GGHS G  VA    + +     L    LI
Sbjct  125  VDFVENRLENSLHNQEGYISDFHVDYLHSFIGGHSGGSHVA----VAQFQTNCLNYQGLI  180

Query  542  GVDPVDGMDKGKQTPPPVLTYIPQSFDLGMAVMVIGSGLGEVKRNPLFPPCAPKGVNHRD  721
             +D VDG     +     +    Q  +  +  + I +GL  V   P     AP+ ++ R 
Sbjct  181  LIDAVDGNSPIPENITMFVITPGQKVNFTVPTLQIVTGLDPVI-GPYGLAFAPEELSGRR  239

Query  722  FYQECRGPACYFVAKDYGHVDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFL  901
            F+    GP  Y  A  YGH D++D     +     +C       +     F+ G +++F+
Sbjct  240  FFDAMTGPTWYVNATAYGHADLMDPVYVELNEITQFCPSDPSAPKEEYIQFLTGEIISFI  299

Query  902  RGYL  913
             G L
Sbjct  300  NGVL  303



>gb|KCW84158.1| hypothetical protein EUGRSUZ_B01020 [Eucalyptus grandis]
Length=79

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  779  VDMLDDETGGVRGKATYCLCKNGKERAAMRAFVGGAVVAFLRGYL  913
            +D LDD+T G++G ATYC+ KNG  R  MR  VGGAVVAFLR +L
Sbjct  1    MDKLDDDTEGLKGAATYCMRKNGSSREPMRTLVGGAVVAFLRAFL  45



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3073151727104