BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c405_g1_i1 len=708 path=[41:0-707]

Length=708
                                                                      Score     E

ref|XP_009604804.1|  PREDICTED: anther-specific protein LAT52           174   8e-51   
ref|XP_004248244.1|  PREDICTED: anther-specific protein LAT52           173   3e-50   
gb|AFB73931.1|  LAT52-like protein                                      170   4e-49   
ref|XP_009794171.1|  PREDICTED: anther-specific protein LAT52           169   6e-49   
gb|AFB73932.1|  LAT52-like protein                                      169   9e-49   
ref|XP_006360048.1|  PREDICTED: anther-specific protein LAT52-like      168   1e-48   
ref|XP_009602640.1|  PREDICTED: anther-specific protein LAT52-like      163   2e-46   
ref|XP_009778120.1|  PREDICTED: anther-specific protein LAT52-like      160   1e-45   
ref|XP_009761932.1|  PREDICTED: anther-specific protein LAT52-like      157   2e-44   
ref|XP_009598969.1|  PREDICTED: anther-specific protein LAT52-like      156   8e-44   
ref|XP_004251892.1|  PREDICTED: anther-specific protein LAT52-like      155   3e-43   
ref|XP_006358942.1|  PREDICTED: anther-specific protein LAT52-like      154   8e-43   
gb|EYU26327.1|  hypothetical protein MIMGU_mgv1a015422mg                144   2e-39   
ref|XP_006348395.1|  PREDICTED: anther-specific protein LAT52-like      144   3e-39   
ref|XP_004244268.1|  PREDICTED: anther-specific protein LAT52-like      143   9e-39   
ref|XP_011070069.1|  PREDICTED: anther-specific protein LAT52-like      142   2e-38   
gb|KHG10520.1|  Olee1-like protein                                      142   2e-38   
ref|XP_011098227.1|  PREDICTED: anther-specific protein LAT52-like      141   7e-38   
emb|CDP16229.1|  unnamed protein product                                140   1e-37   
ref|XP_002523378.1|  Anther-specific protein LAT52 precursor, put...    140   1e-37   Ricinus communis
emb|CDP16230.1|  unnamed protein product                                137   1e-36   
emb|CDP06002.1|  unnamed protein product                                137   2e-36   
gb|KDP32532.1|  hypothetical protein JCGZ_14735                         137   2e-36   
ref|XP_008371469.1|  PREDICTED: olee1-like protein                      133   6e-35   
ref|XP_007021723.1|  Pollen Ole e 1 allergen and extensin family ...    132   1e-34   
ref|XP_011029563.1|  PREDICTED: olee1-like protein                      132   2e-34   
ref|XP_009348994.1|  PREDICTED: olee1-like protein                      131   4e-34   
sp|O49813.1|OLEE1_BETPN  RecName: Full=Olee1-like protein; Flags:...    130   7e-34   Betula pendula [white birch]
ref|XP_010277041.1|  PREDICTED: anther-specific protein LAT52           130   1e-33   
ref|XP_002316866.1|  pollen Ole e 1 allergen and extensin family ...    127   7e-33   Populus trichocarpa [western balsam poplar]
gb|KHG25858.1|  Olee1-like protein                                      127   8e-33   
ref|XP_007212169.1|  hypothetical protein PRUPE_ppa012463mg             127   8e-33   
ref|XP_008383629.1|  PREDICTED: olee1-like protein                      128   9e-33   
ref|XP_008450951.1|  PREDICTED: olee1-like protein                      127   2e-32   
ref|XP_009352776.1|  PREDICTED: olee1-like protein                      127   2e-32   
ref|XP_009421183.1|  PREDICTED: pollen-specific protein C13-like        123   3e-31   
ref|XP_009617824.1|  PREDICTED: olee1-like protein                      123   5e-31   
ref|XP_003541705.1|  PREDICTED: olee1-like protein-like                 123   7e-31   
ref|XP_004144129.1|  PREDICTED: olee1-like protein-like                 122   7e-31   
ref|XP_007148052.1|  hypothetical protein PHAVU_006G176500g             122   1e-30   
ref|XP_003546028.1|  PREDICTED: olee1-like protein-like                 122   1e-30   
ref|XP_007025385.1|  Olee1-like protein                                 122   1e-30   
ref|XP_008467237.1|  PREDICTED: olee1-like protein                      122   1e-30   
gb|EYU45018.1|  hypothetical protein MIMGU_mgv1a015317mg                122   1e-30   
gb|ACU23617.1|  unknown                                                 121   2e-30   Glycine max [soybeans]
ref|XP_004143635.1|  PREDICTED: olee1-like protein-like                 120   7e-30   
gb|AFK47865.1|  unknown                                                 120   9e-30   
ref|XP_009759546.1|  PREDICTED: olee1-like protein                      119   2e-29   
ref|XP_011006522.1|  PREDICTED: olee1-like protein                      119   2e-29   
ref|XP_004485892.1|  PREDICTED: olee1-like protein-like                 119   2e-29   
gb|ADI55168.1|  AS1                                                     119   2e-29   
ref|XP_009608960.1|  PREDICTED: olee1-like protein                      117   9e-29   
ref|XP_010103032.1|  hypothetical protein L484_005787                   116   3e-28   
ref|XP_006370166.1|  pollen Ole e 1 allergen and extensin family ...    115   5e-28   
gb|KHG13789.1|  Anther-specific LAT52                                   115   6e-28   
ref|NP_001131377.1|  uncharacterized protein LOC100192702 precursor     114   7e-28   Zea mays [maize]
gb|ACJ83911.1|  unknown                                                 114   2e-27   Medicago truncatula
ref|XP_009340070.1|  PREDICTED: olee1-like protein                      113   3e-27   
ref|XP_007213539.1|  hypothetical protein PRUPE_ppa019680mg             113   3e-27   
gb|AFK46977.1|  unknown                                                 112   5e-27   
ref|XP_009408781.1|  PREDICTED: pollen-specific protein C13-like        112   5e-27   
gb|AAN76546.1|AF393475_1  LLP-B3 protein                                112   6e-27   Lilium longiflorum [Easter lily]
ref|XP_008226528.1|  PREDICTED: olee1-like protein                      112   6e-27   
ref|XP_006857531.1|  hypothetical protein AMTR_s00061p00032820          112   8e-27   
ref|XP_002522577.1|  Pollen allergen Che a 1 precursor, putative        112   8e-27   Ricinus communis
ref|XP_004975466.1|  PREDICTED: pollen-specific protein C13-like        112   9e-27   
gb|AEW90946.1|  pollen-specific protein F8-4                            112   9e-27   
ref|XP_009773994.1|  PREDICTED: olee1-like protein                      112   1e-26   
gb|EPS72638.1|  hypothetical protein M569_02120                         111   1e-26   
gb|EYU43331.1|  hypothetical protein MIMGU_mgv1a014984mg                111   2e-26   
ref|XP_009396935.1|  PREDICTED: pollen-specific protein C13-like        110   3e-26   
ref|XP_008359333.1|  PREDICTED: olee1-like protein                      110   4e-26   
ref|XP_008225283.1|  PREDICTED: olee1-like protein                      110   4e-26   
ref|XP_004233077.1|  PREDICTED: major pollen allergen Lig v 1-like      110   6e-26   
gb|ACG33223.1|  pollen-specific protein C13 precursor                   109   7e-26   Zea mays [maize]
gb|ACF82695.1|  unknown                                                 109   8e-26   Zea mays [maize]
ref|NP_174209.1|  pollen Ole e 1 allergen and extensin family pro...    109   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010057097.1|  PREDICTED: olee1-like protein                      108   1e-25   
gb|KGN49303.1|  hypothetical protein Csa_6G519560                       108   2e-25   
gb|AEW90948.1|  pollen-specific protein F8-6                            108   2e-25   
ref|NP_001148343.1|  LOC100281953 precursor                             108   2e-25   Zea mays [maize]
ref|XP_009334049.1|  PREDICTED: olee1-like protein                      107   4e-25   
gb|KHG12773.1|  Olee1-like protein                                      108   5e-25   
ref|XP_004134662.1|  PREDICTED: olee1-like protein-like                 107   5e-25   
ref|XP_006304746.1|  hypothetical protein CARUB_v10012122mg             107   5e-25   
ref|XP_006434027.1|  hypothetical protein CICLE_v10002743mg             106   9e-25   
ref|XP_006664913.1|  PREDICTED: pollen allergen Phl p 11-like           107   9e-25   
ref|XP_004134927.1|  PREDICTED: olee1-like protein-like                 106   1e-24   
gb|KDO80906.1|  hypothetical protein CISIN_1g031458mg                   106   1e-24   
ref|XP_006472638.1|  PREDICTED: pollen-specific protein C13-like        106   1e-24   
ref|XP_004960638.1|  PREDICTED: pollen allergen Phl p 11-like           106   2e-24   
ref|XP_008775180.1|  PREDICTED: pollen-specific protein C13-like        105   2e-24   
ref|XP_006652233.1|  PREDICTED: pollen-specific protein C13-like        105   2e-24   
gb|KCW69946.1|  hypothetical protein EUGRSUZ_F03264                     105   2e-24   
emb|CDY43319.1|  BnaC03g58910D                                          105   3e-24   
ref|XP_008439742.1|  PREDICTED: olee1-like protein isoform X1           105   3e-24   
ref|XP_010529196.1|  PREDICTED: pollen-specific protein-like At4g...    105   3e-24   
ref|XP_009342278.1|  PREDICTED: olee1-like protein                      105   3e-24   
ref|XP_009109686.1|  PREDICTED: pollen-specific protein-like At4g...    105   3e-24   
gb|EPS70684.1|  hypothetical protein M569_04073                         105   3e-24   
gb|EAY93952.1|  hypothetical protein OsI_15725                          105   4e-24   Oryza sativa Indica Group [Indian rice]
sp|Q8LGR0.1|CHE1_CHEAL  RecName: Full=Pollen allergen Che a 1; Al...    105   4e-24   Chenopodium album [lamb's-quarters]
emb|CAH66537.1|  H0209H04.4                                             105   4e-24   Oryza sativa [red rice]
ref|XP_010481521.1|  PREDICTED: pollen-specific protein-like At4g...    105   4e-24   
ref|NP_001052674.1|  Os04g0398700                                       104   5e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010062811.1|  PREDICTED: olee1-like protein                      105   5e-24   
gb|AFW77548.1|  pollen allergen Phl p 11                                104   5e-24   
ref|XP_011085997.1|  PREDICTED: olee1-like protein                      104   6e-24   
ref|XP_002440811.1|  hypothetical protein SORBIDRAFT_09g007260          104   6e-24   Sorghum bicolor [broomcorn]
ref|XP_002447728.1|  hypothetical protein SORBIDRAFT_06g014740          104   6e-24   Sorghum bicolor [broomcorn]
emb|CDX99789.1|  BnaC05g22110D                                          104   6e-24   
ref|XP_008439743.1|  PREDICTED: olee1-like protein isoform X2           104   7e-24   
gb|KHG18492.1|  Anther-specific LAT52                                   104   7e-24   
ref|XP_007149397.1|  hypothetical protein PHAVU_005G066800g             103   8e-24   
ref|XP_003566418.1|  PREDICTED: major pollen allergen Lol p 11-like     104   8e-24   
ref|XP_010460686.1|  PREDICTED: pollen-specific protein-like At4g...    104   9e-24   
dbj|BAK06698.1|  predicted protein                                      103   1e-23   
ref|XP_010478273.1|  PREDICTED: pollen-specific protein-like At4g...    103   1e-23   
ref|NP_001150330.1|  pollen allergen Phl p 11 precursor                 103   1e-23   Zea mays [maize]
ref|XP_010434511.1|  PREDICTED: pollen-specific protein-like At4g...    103   2e-23   
ref|XP_010499433.1|  PREDICTED: pollen-specific protein-like At4g...    103   2e-23   
ref|XP_009115274.1|  PREDICTED: pollen-specific protein-like At4g...    103   2e-23   
emb|CDY69202.1|  BnaCnng62360D                                          103   2e-23   
gb|AAX93750.1|  pollen allergen Cro s 1                                 102   3e-23   Crocus sativus [saffron crocus]
gb|KFK31513.1|  hypothetical protein AALP_AA6G122400                    102   3e-23   
ref|XP_010439832.1|  PREDICTED: pollen-specific protein-like At4g...    102   3e-23   
ref|XP_002307393.1|  pollen Ole e 1 allergen and extensin family ...    102   4e-23   Populus trichocarpa [western balsam poplar]
ref|XP_009102877.1|  PREDICTED: pollen-specific protein-like At4g...    102   4e-23   
ref|XP_010518802.1|  PREDICTED: pollen-specific protein-like At4g...    102   4e-23   
gb|ABC86745.1|  pollen-specific protein                                 102   4e-23   Vitis pseudoreticulata
ref|XP_006284941.1|  hypothetical protein CARUB_v10006240mg             102   4e-23   
ref|XP_009402012.1|  PREDICTED: pollen-specific protein C13-like        101   6e-23   
ref|XP_010686203.1|  PREDICTED: pollen allergen Che a 1                 102   6e-23   
ref|XP_010496255.1|  PREDICTED: pollen-specific protein-like At4g...    101   7e-23   
ref|XP_008363638.1|  PREDICTED: olee1-like protein                      101   8e-23   
ref|XP_009114385.1|  PREDICTED: pollen-specific protein-like At4g...    101   9e-23   
ref|XP_011079002.1|  PREDICTED: olee1-like protein                      101   9e-23   
ref|XP_010538209.1|  PREDICTED: pollen-specific protein-like At4g...    101   1e-22   
emb|CAA78897.1|  pollen specific gene                                   100   1e-22   Oryza sativa [red rice]
ref|NP_567562.1|  pollen Ole e 1 allergen and extensin family pro...    100   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941451.1|  PREDICTED: pollen-specific protein C13-like        100   1e-22   
gb|KFK44745.1|  hypothetical protein AALP_AA1G297400                    100   2e-22   
ref|XP_009108374.1|  PREDICTED: pollen-specific protein-like At4g...    100   2e-22   
ref|XP_010540511.1|  PREDICTED: pollen-specific protein-like At4g...    100   2e-22   
ref|XP_006415610.1|  hypothetical protein EUTSA_v10008921mg             100   2e-22   
ref|NP_001105351.1|  pollen-specific protein C13 precursor              100   2e-22   Zea mays [maize]
ref|XP_010494740.1|  PREDICTED: pollen-specific protein-like At4g...    100   2e-22   
gb|AFK42345.1|  unknown                                                 100   2e-22   
ref|XP_011006159.1|  PREDICTED: pollen-specific protein C13-like      99.8    3e-22   
ref|XP_011101379.1|  PREDICTED: olee1-like protein                      100   4e-22   
ref|XP_006289520.1|  hypothetical protein CARUB_v10003061mg           99.4    4e-22   
ref|XP_010436385.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        99.4    4e-22   
ref|XP_002870034.1|  pollen ole e 1 allergen and extensin family ...  99.8    4e-22   
ref|XP_008234009.1|  PREDICTED: pollen-specific protein C13           99.4    4e-22   
ref|XP_010441660.1|  PREDICTED: pollen-specific protein-like At4g...  99.8    5e-22   
ref|NP_001235303.1|  uncharacterized protein LOC100306199 precursor   99.4    5e-22   
ref|XP_011016068.1|  PREDICTED: pollen-specific protein C13-like      99.0    6e-22   
emb|CDY52214.1|  BnaAnng11370D                                        99.4    6e-22   
ref|XP_010521200.1|  PREDICTED: major pollen allergen Lol p 11        99.0    6e-22   
ref|XP_006281481.1|  hypothetical protein CARUB_v10027565mg           99.4    6e-22   
ref|XP_008348540.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        99.0    6e-22   
ref|XP_011080816.1|  PREDICTED: major pollen allergen Ole e 1-like    99.0    6e-22   
gb|ADK22842.1|  Sal k 5                                               98.6    6e-22   
ref|XP_003634471.1|  PREDICTED: pollen-specific protein C13           99.0    7e-22   
emb|CDY65576.1|  BnaC09g52000D                                        99.4    7e-22   
ref|XP_002513885.1|  Pollen-specific protein C13 precursor, putative  98.6    7e-22   Ricinus communis
ref|XP_006414083.1|  hypothetical protein EUTSA_v10026398mg           99.0    7e-22   
ref|XP_009403224.1|  PREDICTED: pollen-specific protein C13-like      98.6    7e-22   
gb|KFK28529.1|  hypothetical protein AALP_AA7G008600                  99.0    8e-22   
ref|XP_007153183.1|  hypothetical protein PHAVU_003G013900g           98.2    1e-21   
ref|XP_009409254.1|  PREDICTED: major pollen allergen Lol p 11-like   98.2    1e-21   
ref|XP_010535648.1|  PREDICTED: major pollen allergen Lol p 11-like   98.2    1e-21   
gb|KHN36879.1|  Olee1-like protein                                    97.8    2e-21   
ref|XP_010527375.1|  PREDICTED: major pollen allergen Lol p 11-like   97.8    2e-21   
emb|CDX99452.1|  BnaC01g11000D                                        97.8    2e-21   
ref|XP_010269200.1|  PREDICTED: pollen-specific protein C13-like      97.1    3e-21   
ref|XP_009136942.1|  PREDICTED: pollen-specific protein-like At4g...  97.4    3e-21   
ref|XP_010455288.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        97.1    3e-21   
dbj|BAK07321.1|  predicted protein                                    97.1    4e-21   
ref|XP_009132011.1|  PREDICTED: pollen-specific protein-like At4g...  97.1    4e-21   
emb|CDX77620.1|  BnaC07g18740D                                        97.1    4e-21   
ref|XP_011075627.1|  PREDICTED: olee1-like protein                    96.7    5e-21   
ref|XP_006398273.1|  hypothetical protein EUTSA_v10001051mg           96.7    6e-21   
emb|CDY12288.1|  BnaA09g24880D                                        96.3    6e-21   
ref|XP_010942359.1|  PREDICTED: major pollen allergen Lol p 11-like   96.7    6e-21   
ref|XP_009134109.1|  PREDICTED: pollen-specific protein C13           96.3    6e-21   
gb|ABK92993.1|  unknown                                               96.3    7e-21   Populus trichocarpa [western balsam poplar]
ref|XP_002301038.1|  pollen Ole e 1 allergen and extensin family ...  96.3    7e-21   Populus trichocarpa [western balsam poplar]
ref|XP_009101556.1|  PREDICTED: pollen-specific protein-like At4g...  96.3    8e-21   
ref|NP_567338.1|  protein SAH7                                        95.9    8e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY01556.1|  BnaC07g35460D                                        96.3    8e-21   
ref|XP_007149396.1|  hypothetical protein PHAVU_005G066700g           95.9    8e-21   
gb|ABK94215.1|  unknown                                               95.9    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011075462.1|  PREDICTED: olee1-like protein                    95.9    1e-20   
ref|XP_009600627.1|  PREDICTED: major pollen allergen Lol p 11-like   95.9    1e-20   
ref|XP_010676978.1|  PREDICTED: major pollen allergen Lol p 11-like   95.5    1e-20   
ref|NP_568650.1|  pollen_Ole_e_I-domain containing protein            95.9    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863445.1|  hypothetical protein ARALYDRAFT_494394           95.5    1e-20   
ref|XP_007153182.1|  hypothetical protein PHAVU_003G013800g           95.5    1e-20   
ref|XP_008797140.1|  PREDICTED: major pollen allergen Lol p 11-like   95.5    2e-20   
ref|XP_009128814.1|  PREDICTED: pollen-specific protein-like At4g...  95.5    2e-20   
ref|XP_002454899.1|  hypothetical protein SORBIDRAFT_03g001020        95.1    2e-20   Sorghum bicolor [broomcorn]
ref|XP_002268073.1|  PREDICTED: pollen-specific protein C13           94.7    2e-20   Vitis vinifera
emb|CAA16739.1|  pollen-specific protein - like                         100   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009797814.1|  PREDICTED: major pollen allergen Lol p 11-like   94.7    2e-20   
ref|XP_006442530.1|  hypothetical protein CICLE_v10024378mg           94.7    2e-20   
emb|CDY05022.1|  BnaC03g28200D                                        94.4    3e-20   
sp|Q7M1X5.1|LOLB_LOLPR  RecName: Full=Major pollen allergen Lol p...  93.6    3e-20   Lolium perenne [perennial ryegrass]
ref|XP_004293940.1|  PREDICTED: olee1-like protein-like               94.4    4e-20   
emb|CDX87759.1|  BnaC02g31900D                                        94.4    4e-20   
ref|XP_009366359.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        94.0    4e-20   
ref|XP_003581152.1|  PREDICTED: pollen-specific protein C13-like      94.4    4e-20   
ref|XP_011101449.1|  PREDICTED: olee1-like protein                    94.4    5e-20   
pir||S43242  allergen-like protein Syr v I isoform 1 - Syringa vu...  93.6    5e-20
ref|XP_010424432.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        95.9    5e-20   
ref|XP_008378536.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        95.1    5e-20   
ref|XP_006397273.1|  hypothetical protein EUTSA_v10029031mg           93.6    6e-20   
ref|XP_008234688.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        93.6    6e-20   
ref|XP_007225977.1|  hypothetical protein PRUPE_ppa012675mg           93.6    6e-20   
gb|KDP21093.1|  hypothetical protein JCGZ_21564                       94.7    6e-20   
ref|XP_010549400.1|  PREDICTED: pollen-specific protein-like At4g...  93.6    7e-20   
ref|XP_007206364.1|  hypothetical protein PRUPE_ppa017800mg           93.2    7e-20   
ref|XP_006464247.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        93.2    9e-20   
ref|XP_002890794.1|  hypothetical protein ARALYDRAFT_336019           98.2    9e-20   
ref|XP_004489034.1|  PREDICTED: olee1-like protein-like               93.2    9e-20   
ref|XP_009386950.1|  PREDICTED: pollen-specific protein C13-like      93.2    1e-19   
ref|XP_011030966.1|  PREDICTED: protein DOWNSTREAM OF FLC             92.8    1e-19   
ref|XP_008376286.1|  PREDICTED: pollen-specific protein C13-like      92.8    1e-19   
gb|ABP58635.1|  major pollen allergen Ole e 1                         92.0    1e-19   Olea europaea
dbj|BAB09316.1|  Ole e I (main olive allergen)-like protein           92.8    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009764546.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        92.4    2e-19   
gb|KFK32118.1|  hypothetical protein AALP_AA6G200700                  92.4    2e-19   
sp|Q8H6L7.1|PHLB_PHLPR  RecName: Full=Pollen allergen Phl p 11; A...  91.7    2e-19   Phleum pratense [timothy]
gb|AEW90941.1|  group 11 grass pollen allergen F7-4                   92.4    2e-19   
gb|AAM65838.1|  Ole e I (main olive allergen)-like protein            92.4    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002392460.1|  hypothetical protein MPER_07958                  92.0    2e-19   Moniliophthora perniciosa FA553
ref|XP_011078225.1|  PREDICTED: pollen allergen Che a 1-like          92.0    2e-19   
ref|XP_008245042.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        91.7    3e-19   
ref|XP_010942360.1|  PREDICTED: pollen allergen Phl p 11-like         91.7    3e-19   
pir||S43244  allergen-like protein Syr v I isoform 3 - Syringa vu...  90.9    4e-19
ref|XP_004983223.1|  PREDICTED: pollen-specific protein C13-like      91.7    4e-19   
gb|AEW90942.1|  group 11 grass pollen allergen F7-6                   91.7    4e-19   
ref|XP_002307104.1|  hypothetical protein POPTR_0005s08000g           91.3    4e-19   Populus trichocarpa [western balsam poplar]
gb|AEW90943.1|  group 11 grass pollen allergen F8-6                   91.3    5e-19   
ref|XP_006428158.1|  hypothetical protein CICLE_v10027141mg           92.8    5e-19   
gb|AEW90940.1|  group 11 grass pollen allergen F7-1                   91.3    5e-19   
pir||S43243  allergen-like protein Syr v I isoform 2 - Syringa vu...  90.5    5e-19
gb|EMT13715.1|  Pollen allergen Phl p 11                              91.3    5e-19   
ref|NP_001148443.1|  pollen allergen Phl p 11 precursor               90.9    8e-19   Zea mays [maize]
pir||B53806  major allergen OLE5c - common olive                      90.1    8e-19
gb|KDP32694.1|  hypothetical protein JCGZ_11986                       90.5    9e-19   
ref|XP_002872410.1|  hypothetical protein ARALYDRAFT_489767           90.1    1e-18   
ref|NP_001057857.1|  Os06g0556600                                     90.5    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645671.1|  PREDICTED: pollen allergen Phl p 11-like         89.7    1e-18   
ref|XP_006366520.1|  PREDICTED: olee1-like protein-like               89.7    2e-18   
ref|XP_006399503.1|  hypothetical protein EUTSA_v10014875mg           89.7    2e-18   
ref|XP_007136225.1|  hypothetical protein PHAVU_009G028900g           89.7    2e-18   
ref|XP_002310579.1|  hypothetical protein POPTR_0007s05750g           89.4    2e-18   Populus trichocarpa [western balsam poplar]
ref|NP_001146979.1|  LOC100280588 precursor                           89.7    2e-18   Zea mays [maize]
emb|CAA73037.1|  Ole e 1.0103 protein                                 89.0    2e-18   Olea europaea
ref|NP_001238723.1|  uncharacterized protein LOC100499710 precursor   89.4    2e-18   
sp|P19963.2|ALL1_OLEEU  RecName: Full=Major pollen allergen Ole e...  89.0    2e-18   Olea europaea
ref|XP_004289324.1|  PREDICTED: pollen-specific protein C13-like      89.4    2e-18   
ref|XP_010060161.1|  PREDICTED: protein DOWNSTREAM OF FLC             89.0    2e-18   
gb|ACG32277.1|  pollen-specific protein C13 precursor                 89.4    2e-18   Zea mays [maize]
ref|XP_010321468.1|  PREDICTED: LOW QUALITY PROTEIN: major pollen...  89.0    3e-18   
gb|KHN19737.1|  Pollen-specific protein C13                           89.0    3e-18   
gb|EPS62385.1|  hypothetical protein M569_12405                       88.6    4e-18   
emb|CAA54819.1|  major allergen                                       88.2    4e-18   Ligustrum vulgare [prim]
pir||H53806  major allergen OLE6 - common olive (fragment)            87.8    4e-18
ref|XP_002489221.1|  hypothetical protein SORBIDRAFT_0012s014630      88.6    4e-18   Sorghum bicolor [broomcorn]
ref|XP_002273294.1|  PREDICTED: olee1-like protein                    88.6    5e-18   Vitis vinifera
pir||C53806  major allergen OLE1c - common olive (fragment)           87.8    5e-18
emb|CAA73038.1|  Ole e 1.0102 protein                                 87.8    5e-18   Olea europaea
ref|XP_007018845.1|  Pollen-specific protein C13, putative            87.8    6e-18   
gb|AEW90945.1|  group 11 grass pollen allergen R1-2                   87.8    7e-18   
gb|ABP58632.1|  major pollen allergen Ole e 1                         87.4    8e-18   Olea europaea
ref|XP_004150698.1|  PREDICTED: pollen-specific protein C13-like      87.8    8e-18   
ref|XP_009760524.1|  PREDICTED: pollen-specific protein C13-like      87.4    8e-18   
pir||I53806  major allergen OLE16 - common olive (fragment)           87.0    9e-18
emb|CAA73036.1|  Ole e 1 protein                                      87.4    9e-18   
ref|XP_006344595.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        87.4    9e-18   
gb|AAQ83588.1|  allergen Fra e 1                                      87.0    1e-17   
gb|ABP58634.1|  major pollen allergen Ole e 1                         87.0    1e-17   
sp|O82015.2|LIGV1_LIGVU  RecName: Full=Major pollen allergen Lig ...  87.0    1e-17   
ref|NP_196575.1|  pollen_Ole_e_I-domain containing protein            87.4    1e-17   
ref|XP_010538956.1|  PREDICTED: major pollen allergen Lol p 11        87.0    1e-17   
ref|XP_008453801.1|  PREDICTED: major pollen allergen Lol p 11-like   87.0    1e-17   
ref|XP_004146873.1|  PREDICTED: pollen allergen Che a 1-like          87.0    1e-17   
gb|ABP58636.1|  major pollen allergen Ole e 1                         86.7    1e-17   
ref|XP_008445353.1|  PREDICTED: protein DOWNSTREAM OF FLC             86.7    2e-17   
ref|XP_002533139.1|  Pollen-specific protein C13 precursor, putative  86.7    2e-17   
ref|XP_010261236.1|  PREDICTED: pollen-specific protein C13-like      86.7    2e-17   
gb|KHG30321.1|  Anther-specific LAT52                                 86.7    2e-17   
gb|EPS69662.1|  hypothetical protein M569_05103                       86.3    2e-17   
gb|EAZ45758.1|  hypothetical protein OsJ_30442                        86.3    3e-17   
ref|XP_004500607.1|  PREDICTED: pollen-specific protein C13-like      86.3    3e-17   
gb|ACK44512.1|  AT5G10130-like protein                                86.7    3e-17   
ref|XP_006661014.1|  PREDICTED: pollen-specific protein C13-like      86.3    3e-17   
gb|AEK85661.1|  major pollen allergen Ole e1                          85.5    3e-17   
ref|XP_007141147.1|  hypothetical protein PHAVU_008G171500g           85.9    4e-17   
pir||E53806  major allergen OLE17 - common olive (fragment)           85.1    4e-17
ref|XP_004971474.1|  PREDICTED: pollen allergen Phl p 11-like         85.9    4e-17   
ref|XP_010025486.1|  PREDICTED: protein DOWNSTREAM OF FLC             85.9    4e-17   
ref|XP_009622218.1|  PREDICTED: pollen-specific protein C13-like      85.5    4e-17   
gb|AEK85660.1|  major pollen allergen Ole e1                          85.1    4e-17   
ref|XP_003565925.1|  PREDICTED: pollen allergen Phl p 11              85.9    5e-17   
gb|AEK85659.1|  major pollen allergen Ole e1                          85.1    5e-17   
dbj|BAD46623.1|  putative Pollen specific protein C13 precursor       85.5    6e-17   
gb|EEC85106.1|  hypothetical protein OsI_32490                        85.5    6e-17   
ref|NP_001064001.1|  Os09g0572800                                     85.5    6e-17   
gb|AAV74343.1|  Fra e 1.0102 major allergen                           84.7    6e-17   
pir||G53806  major allergen OLE26 - common olive (fragment)           84.3    7e-17
ref|XP_010547621.1|  PREDICTED: protein DOWNSTREAM OF FLC             85.1    7e-17   
gb|AAF16869.1|AF109693_1  allergen-like protein BRSn20                85.1    7e-17   
ref|NP_001237189.1|  uncharacterized protein LOC100305566 precursor   85.1    8e-17   
pir||F53806  major allergen OLE19 - common olive (fragment)           84.3    8e-17
ref|XP_004502439.1|  PREDICTED: pollen-specific protein C13-like      84.7    8e-17   
gb|AAQ08947.1|  allergen Fra e 1.0101                                 84.3    9e-17   
ref|XP_010453035.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        84.7    1e-16   
ref|XP_004237415.1|  PREDICTED: pollen-specific protein C13           84.3    1e-16   
gb|EYU31033.1|  hypothetical protein MIMGU_mgv1a015328mg              84.3    1e-16   
ref|XP_007048005.1|  Pollen-specific protein C13, putative            84.3    1e-16   
gb|EMS61378.1|  Pollen-specific protein C13                           84.0    1e-16   
gb|AAN18042.1|  major pollen allergen Ole e 1                         83.2    2e-16   
gb|ABP58633.1|  major pollen allergen Ole e 1                         83.6    2e-16   
ref|XP_002873440.1|  pollen ole e 1 allergen and extensin family ...  84.0    2e-16   
ref|XP_010911793.1|  PREDICTED: pollen-specific protein C13-like      84.0    2e-16   
dbj|BAJ86956.1|  predicted protein                                    83.6    2e-16   
gb|AAM78186.1|  putative SAH7 protein                                 82.4    3e-16   
ref|XP_008782123.1|  PREDICTED: pollen-specific protein C13-like      83.6    3e-16   
gb|AFK37732.1|  unknown                                               83.2    3e-16   
pir||A38968  major allergen OLE20 - common olive (fragment)           82.4    4e-16
gb|KEH38612.1|  pollen Ole e I family allergen                        83.2    4e-16   
ref|XP_011090511.1|  PREDICTED: major pollen allergen Lol p 11-like   82.8    4e-16   
ref|XP_011097595.1|  PREDICTED: major pollen allergen Lol p 11-like   82.4    5e-16   
gb|KDP46869.1|  hypothetical protein JCGZ_24078                       82.4    7e-16   
ref|XP_010428908.1|  PREDICTED: major pollen allergen Lol p 11-like   82.4    7e-16   
gb|AAM78185.1|  putative SAH7 protein                                 80.9    8e-16   
gb|EMS52933.1|  hypothetical protein TRIUR3_31283                     82.0    1e-15   
ref|XP_010422886.1|  PREDICTED: protein DOWNSTREAM OF FLC             81.6    1e-15   
gb|AEK85663.1|  major pollen allergen Ole e1                          80.9    1e-15   
ref|XP_010416770.1|  PREDICTED: major pollen allergen Lol p 11-like   81.6    1e-15   
gb|AAM78187.1|  putative SAH7 protein                                 80.5    1e-15   
ref|XP_006355373.1|  PREDICTED: pollen-specific protein C13-like      81.3    1e-15   
ref|XP_011101377.1|  PREDICTED: olee1-like protein isoform X2         81.6    1e-15   
ref|XP_010472003.1|  PREDICTED: major pollen allergen Lol p 11-like   81.6    1e-15   
gb|AFK47744.1|  unknown                                               81.3    2e-15   
ref|XP_006601773.1|  PREDICTED: uncharacterized protein LOC100527...  80.9    2e-15   
ref|XP_002459879.1|  hypothetical protein SORBIDRAFT_02g012930        81.3    2e-15   
gb|EYU24008.1|  hypothetical protein MIMGU_mgv1a015363mg              80.9    2e-15   
gb|AAQ07442.1|  major pollen allergen Ole e 1                         80.1    2e-15   
ref|XP_009383585.1|  PREDICTED: pollen-specific protein C13-like      80.9    3e-15   
ref|XP_006468202.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  79.7    3e-15   
emb|CDX88408.1|  BnaC06g38520D                                        80.9    3e-15   
gb|ABP58637.1|  major pollen allergen Ole e 1                         80.1    3e-15   
gb|AAQ10269.1|  major pollen allergen Ole e 1                         79.7    3e-15   
ref|XP_011101376.1|  PREDICTED: pollen allergen Che a 1-like isof...  80.9    3e-15   
ref|XP_006288804.1|  hypothetical protein CARUB_v10002136mg           80.5    3e-15   
ref|XP_010491667.1|  PREDICTED: protein DOWNSTREAM OF FLC             80.5    3e-15   
gb|AAQ10267.1|  major pollen allergen Ole e 1                         79.7    3e-15   
gb|AAM78189.1|  putative SAH7 protein                                 79.3    3e-15   
gb|KEH38613.1|  pollen Ole e I family allergen                        80.5    4e-15   
ref|XP_003638771.1|  Pollen allergen Phl p                            80.1    4e-15   
gb|AAM78188.1|  putative SAH7 protein                                 79.0    4e-15   
gb|AAT08700.1|  pollen-specific protein                               80.5    4e-15   
gb|KFK42186.1|  hypothetical protein AALP_AA2G222600                  80.1    4e-15   
gb|AAQ10277.1|  major pollen allergen Ole e 1                         79.3    5e-15   
ref|XP_002889170.1|  pollen ole e 1 allergen and extensin family ...  80.1    5e-15   
gb|ACJ86286.1|  unknown                                               79.7    6e-15   
gb|AEK85658.1|  major pollen allergen Ole e1                          79.0    6e-15   
gb|AEK85662.1|  major pollen allergen Ole e1                          78.6    7e-15   
emb|CDX87484.1|  BnaA07g33890D                                        79.3    8e-15   
ref|XP_003543768.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        79.0    1e-14   
gb|AAQ08188.1|  major pollen allergen Ole e 1                         78.2    1e-14   
ref|XP_010317514.1|  PREDICTED: olee1-like protein                    77.8    1e-14   
ref|XP_004959259.1|  PREDICTED: pollen-specific protein C13-like      79.0    1e-14   
gb|ACJ86288.1|  unknown                                               79.0    1e-14   
ref|XP_010916905.1|  PREDICTED: pollen-specific protein C13-like      79.0    1e-14   
gb|AAB32652.2|  main olive allergen                                   77.8    2e-14   
emb|CDY40079.1|  BnaC02g00510D                                        78.6    2e-14   
gb|ACQ44229.1|  putative pollen Ole e 1 allergen and extensin fam...  78.2    2e-14   
ref|XP_008803750.1|  PREDICTED: pollen-specific protein C13           78.2    2e-14   
ref|XP_006302909.1|  hypothetical protein CARUB_v10021044mg           78.2    2e-14   
ref|XP_009125327.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        77.8    3e-14   
gb|AAM08621.1|AC107314_12  Putative Pollen specific protein C13 p...  78.2    3e-14   
gb|AAQ10272.1|  major pollen allergen Ole e 1                         77.0    3e-14   
emb|CDX85777.1|  BnaA02g00360D                                        77.8    3e-14   
ref|XP_011102257.1|  PREDICTED: olee1-like protein                    77.8    3e-14   
ref|NP_001064462.2|  Os10g0371000                                     77.8    4e-14   
gb|AAQ10274.1|  major pollen allergen Ole e 1                         76.6    4e-14   
ref|XP_010105888.1|  hypothetical protein L484_021545                 77.4    5e-14   
ref|XP_009106450.1|  PREDICTED: protein DOWNSTREAM OF FLC             77.0    5e-14   
gb|AAO22132.1|  major pollen allergen Ole e 1                         76.3    6e-14   
ref|NP_177927.1|  pollen Ole e 1 allergen and extensin family pro...  76.6    7e-14   
gb|AAN60344.1|  unknown                                               76.3    8e-14   
gb|AAQ10281.1|  major pollen allergen Ole e 1                         75.5    1e-13   
ref|XP_006390031.1|  hypothetical protein EUTSA_v10019236mg           75.5    2e-13   
ref|XP_008343344.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  74.3    2e-13   
ref|XP_009122085.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        75.1    2e-13   
gb|AAZ67595.1|  80A08_10                                              75.1    2e-13   
ref|XP_003573867.1|  PREDICTED: pollen-specific protein C13           75.1    3e-13   
gb|ADM76653.1|  extensin-like protein                                 74.3    4e-13   
ref|XP_010680579.1|  PREDICTED: major pollen allergen Lol p 11-like   74.3    5e-13   
gb|AAQ10273.1|  major pollen allergen Ole e 1                         73.6    5e-13   
ref|XP_002887714.1|  pollen ole e 1 allergen and extensin family ...  73.9    5e-13   
gb|EAZ04544.1|  hypothetical protein OsI_26693                        73.9    5e-13   
emb|CDY21640.1|  BnaC09g46520D                                        73.6    6e-13   
gb|AAQ10280.1|  major pollen allergen Ole e 1                         73.2    6e-13   
ref|XP_006661725.1|  PREDICTED: pollen-specific protein C13-like      73.9    6e-13   
emb|CDP01424.1|  unnamed protein product                              73.6    7e-13   
ref|XP_004299638.1|  PREDICTED: pollen allergen Phl p 11-like         71.6    2e-12   
gb|EAZ40496.1|  hypothetical protein OsJ_24951                        72.0    2e-12   
ref|XP_010090546.1|  hypothetical protein L484_016596                 72.8    2e-12   
ref|XP_003601984.1|  Pollen-specific protein C13                      72.4    2e-12   
ref|NP_001175282.1|  Os07g0590500                                     71.6    4e-12   
gb|AFO38383.1|  putative pollen-specific protein C13                  72.0    4e-12   
gb|AAQ10279.1|  major pollen allergen Ole e 1                         70.9    5e-12   
gb|AAF17689.1|AC009243_16  F28K19.26                                  75.1    5e-12   
gb|AFW82075.1|  hypothetical protein ZEAMMB73_949741                  69.3    8e-12   
ref|XP_009789881.1|  PREDICTED: olee1-like protein                    70.5    1e-11   
gb|AAO22133.1|  major pollen allergen Ole e 1                         68.6    3e-11   
emb|CDY21637.1|  BnaC09g46550D                                        68.6    5e-11   
gb|ADM76637.1|  extensin-like protein                                 67.8    7e-11   
gb|ADM76665.1|  extensin-like protein                                 67.4    1e-10   
gb|ABK22573.1|  unknown                                               67.4    1e-10   
gb|ABK21930.1|  unknown                                               67.0    1e-10   
gb|KHN44330.1|  Pollen-specific protein C13                           65.1    4e-10   
gb|AFK44177.1|  unknown                                               65.1    6e-10   
ref|XP_006838264.1|  hypothetical protein AMTR_s00103p00069180        64.3    7e-10   
emb|CAC41634.1|  plantain pollen major allergen, Pla l 1.0102         63.9    1e-09   
emb|CAC41635.1|  plantain pollen major allergen, Pla l 1.0103         63.5    2e-09   
sp|P82242.2|PLAL1_PLALA  RecName: Full=Major pollen allergen Pla ...  62.8    3e-09   
gb|AAO41983.1|  unknown protein                                       62.0    4e-09   
ref|XP_008343324.1|  PREDICTED: olee1-like protein                    61.2    6e-09   
ref|XP_008381078.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        62.0    7e-09   
ref|XP_009147847.1|  PREDICTED: pollen-specific protein-like At4g...  61.6    8e-09   
gb|KDO56621.1|  hypothetical protein CISIN_1g041753mg                 60.1    2e-08   
ref|XP_009413179.1|  PREDICTED: pollen-specific protein C13-like      60.1    2e-08   
emb|CDO96791.1|  unnamed protein product                              59.3    5e-08   
ref|XP_010906302.1|  PREDICTED: pollen-specific protein C13-like      58.9    6e-08   
ref|XP_007210061.1|  hypothetical protein PRUPE_ppa018487mg           58.2    2e-07   
ref|XP_008391140.1|  PREDICTED: olee1-like protein                    55.8    6e-07   
ref|XP_008238496.1|  PREDICTED: olee1-like protein                    57.0    7e-07   
ref|XP_008240860.1|  PREDICTED: olee1-like protein                    57.4    7e-07   
ref|XP_009794836.1|  PREDICTED: pollen-specific protein C13-like      55.8    7e-07   
gb|EMS67079.1|  hypothetical protein TRIUR3_25214                     55.1    1e-06   
ref|XP_003596438.1|  Major pollen allergen Lol p                      56.2    1e-06   
ref|XP_007208803.1|  hypothetical protein PRUPE_ppa024703mg           56.2    1e-06   
ref|XP_003596434.1|  Major pollen allergen Lol p                      55.8    1e-06   
ref|XP_008357485.1|  PREDICTED: uncharacterized protein LOC103421237  57.0    2e-06   
gb|EMT21854.1|  hypothetical protein F775_27590                       55.1    2e-06   
ref|XP_003596420.1|  Pollen allergen Che a                            54.7    4e-06   
gb|KEH15235.1|  pollen protein Ole E I-like protein                   53.9    1e-05   
ref|XP_003596443.1|  Major pollen allergen Lol p                      54.3    2e-05   
ref|XP_007208811.1|  hypothetical protein PRUPE_ppa024778mg           53.1    2e-05   
emb|CDY14639.1|  BnaC02g24740D                                        52.0    2e-05   
ref|XP_006449500.1|  hypothetical protein CICLE_v10017321mg           51.2    3e-05   
ref|NP_001237949.1|  uncharacterized protein LOC100527053             50.8    4e-05   
ref|XP_008225290.1|  PREDICTED: olee1-like protein                    51.6    6e-05   
gb|KDO44647.1|  hypothetical protein CISIN_1g045131mg                 50.1    9e-05   
ref|XP_003596436.1|  Major pollen allergen Lol p                      50.4    1e-04   



>ref|XP_009604804.1| PREDICTED: anther-specific protein LAT52 [Nicotiana tomentosiformis]
Length=161

 Score =   174 bits (441),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA + L  +A+C +A A FA  +P + F VEG+VYCD CRVQFETK+SE+++GA VRL
Sbjct  1    MAKAIVLL--SALCIVALANFAHCRP-QVFDVEGKVYCDTCRVQFETKLSENVEGATVRL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             C+N+ TE ET++ E  T  +G Y L VEGDH++ IC+VTVVKSPREDCKE+V   +K+ 
Sbjct  58   QCRNISTETETFSVEGVTDKDGKYKLTVEGDHQDDICEVTVVKSPREDCKESVTGYEKAR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            + CS+N GIH+ VRYANPLFFM  +    CK+VL ++G  P + 
Sbjct  118  IECSDNVGIHNAVRYANPLFFMKTEAVSGCKEVLDELGLFPLEF  161



>ref|XP_004248244.1| PREDICTED: anther-specific protein LAT52 [Solanum lycopersicum]
 sp|P13447.1|LAT52_SOLLC RecName: Full=Anther-specific protein LAT52; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA33854.1| LAT52 [Solanum lycopersicum]
Length=161

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA + L  +A+C LA A FA  +P E F VEG+VYCD CRVQFETK+SE+L+GA V+L
Sbjct  1    MAKAIVLL--SALCILALANFAHCRP-EVFDVEGKVYCDTCRVQFETKLSENLEGATVKL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             C+N+ TE ET++ E  T  +G Y L V GDHE  IC+VTVVKSPREDCKE+V   +K+ 
Sbjct  58   QCRNISTEAETFSVEGVTDKDGKYKLTVNGDHENDICEVTVVKSPREDCKESVSGYEKAR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            + CS+N GIH+ VR+ANPLFFM A+    CK+ L ++G  P + 
Sbjct  118  IECSDNVGIHNAVRFANPLFFMKAESVQGCKEALDELGLFPLEF  161



>gb|AFB73931.1| LAT52-like protein [Lycium barbarum]
Length=161

 Score =   170 bits (430),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA + L  +A+C +A A FA   P E F VEG+VYCD CRVQFETK+S++++GA V+L
Sbjct  1    MAKAIVLL--SALCIVALANFAHCHP-EVFDVEGKVYCDTCRVQFETKLSQNIEGATVKL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             C+N+ TE ET++ E  T  +G Y L VEGDH++ IC+VTVVKSPREDCKE V   +K+ 
Sbjct  58   QCRNITTETETFSVEGVTDKDGKYKLTVEGDHQDDICEVTVVKSPREDCKEAVSGYEKAR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            + CS+N G+H+ VRYANPLFFM A+    CK+ L ++G  P + 
Sbjct  118  IECSDNVGMHNAVRYANPLFFMKAEAVEGCKEALDELGLFPLEF  161



>ref|XP_009794171.1| PREDICTED: anther-specific protein LAT52 [Nicotiana sylvestris]
Length=161

 Score =   169 bits (428),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA + L  +A+C +A A FA   P + F VEG+VYCD CRVQFETK+SE+++GA VRL
Sbjct  1    MAKAILLL--SALCIVALANFAHCHP-QVFDVEGKVYCDTCRVQFETKLSENVEGATVRL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             C+N+ TE ET++ E  T  +G Y L VEGDH++ IC+VTVVKSPREDCKE V   +K+ 
Sbjct  58   QCRNISTEIETFSVEGVTDKDGKYKLTVEGDHQDDICEVTVVKSPREDCKEAVTGYEKAR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            + CS+N GIH+ VRYAN LFFM ++    CK+VL ++G  P + 
Sbjct  118  IECSDNVGIHNAVRYANALFFMKSEAVSGCKEVLDELGLFPLEF  161



>gb|AFB73932.1| LAT52-like protein [Lycium barbarum]
Length=161

 Score =   169 bits (428),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA + L  +A+C  A A FA   P E F VEG+VYCD CRVQFETK+S++++GA V+L
Sbjct  1    MAKAIVLL--SALCIAALANFAHCHP-EVFDVEGKVYCDTCRVQFETKLSQNIEGATVKL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             C+N+ TE ET++ E  T  +G Y L VEGDH++ IC+VTVVKSPREDCKE V   +K+ 
Sbjct  58   QCRNITTETETFSVEGVTDKDGKYKLTVEGDHQDDICEVTVVKSPREDCKEAVSGYEKAR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            + CS+N G+H+ VRYANPLFFM A+    CK+ L ++G  P + 
Sbjct  118  IECSDNVGMHNAVRYANPLFFMKAEAVEGCKEALDELGLFPLEF  161



>ref|XP_006360048.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=161

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 115/164 (70%), Gaps = 3/164 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA + L  +A+C +A A FA     E F VEG+VYCD CRVQFETK+SE+L GA V+L
Sbjct  1    MAKAILLL--SALCIVALANFAHCHS-EVFDVEGKVYCDTCRVQFETKLSENLDGATVKL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             C+N+ TE ET++ E  T  +G Y L V+GDHE  IC+VTVVKSPREDCKE+V   +K+ 
Sbjct  58   QCRNISTEAETFSVEGVTDKDGKYKLTVDGDHENDICEVTVVKSPREDCKESVSGYEKAR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            + CS N GIH+ VRYANPLFFM A+    CK+ L ++G  P + 
Sbjct  118  IECSNNVGIHNAVRYANPLFFMKAESVQGCKEALDELGLFPLEF  161



>ref|XP_009602640.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana tomentosiformis]
Length=163

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 112/165 (68%), Gaps = 2/165 (1%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA + L  +A+C LAF  FA     +   VEG VYCD CRVQF+TK+SE ++GA VRL
Sbjct  1    MAKAILLL--SAVCILAFVNFAQCHDSQAINVEGSVYCDTCRVQFQTKLSEYIEGATVRL  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             CK+++TEKETY+ E  T  NG Y + VEGDHE  +C+V++VKSPREDCKE+    + S 
Sbjct  59   ACKDIETEKETYSVEGVTDKNGKYIIKVEGDHENELCEVSIVKSPREDCKESAIGFENSR  118

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLT  515
            V+CS N GIH+  RYANPLFFM  +    CK VL ++G  P +  
Sbjct  119  VVCSANVGIHNPTRYANPLFFMKTEAVSGCKDVLDELGLFPLEFN  163



>ref|XP_009778120.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana sylvestris]
Length=163

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 111/165 (67%), Gaps = 2/165 (1%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA + L  +A+C LAF  FA     +   VEG VYCD CRVQF+TK+SE ++GA VRL
Sbjct  1    MAKAILLL--SAVCILAFVNFAQCHDSQAINVEGSVYCDTCRVQFQTKLSEYIEGATVRL  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             CK+++TEKETY+ E  T  NG Y + VEGDHE  +C+V++VKSPREDCKE     + S 
Sbjct  59   ACKDIETEKETYSVEGVTDKNGKYIIKVEGDHENELCEVSIVKSPREDCKEPAIGFENSR  118

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLT  515
            V+CS N GIH+  RYANPLFFM  +    CK VL ++G  P +  
Sbjct  119  VVCSGNVGIHNPTRYANPLFFMKTEAVSGCKDVLDELGLFPLEFN  163



>ref|XP_009761932.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana sylvestris]
Length=164

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 111/157 (71%), Gaps = 3/157 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA + L  +A+C LA A FA  +P E F VEGRV+CD CR+ F T +SE+++GA VRL
Sbjct  1    MAKAIVLL--SALCVLAIANFAVAEP-EVFDVEGRVFCDTCRLGFATSLSEAIQGATVRL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             C++++T  ETY+ E  T   G Y+L VEGDHE  IC+VTVV SPREDCKE V  L K  
Sbjct  58   TCRDIETHNETYSTEGKTDMIGKYTLTVEGDHENDICEVTVVNSPREDCKEIVSELVKGR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            V+CS+N G+H+ VR+ NPLFF   KP P CK+++ ++
Sbjct  118  VVCSKNVGMHNAVRFTNPLFFQKDKPVPGCKELVEEM  154



>ref|XP_009598969.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana tomentosiformis]
Length=164

 Score =   156 bits (395),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 110/157 (70%), Gaps = 3/157 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA + L  +A+CFLA A FA  +P E F VEGRV+CD CR+ F T +SE ++GA V L
Sbjct  1    MAKAIVLL--SALCFLAIANFAVAEP-EVFDVEGRVFCDTCRLGFATSLSEVIQGATVGL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             C++++T  ETY+ E  T   G Y+L VEGDHE  IC+VTVV SPREDCKE V  L K  
Sbjct  58   TCRDIETHNETYSTEGKTDMIGKYTLTVEGDHENDICEVTVVNSPREDCKEIVSELVKGR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            V+CS+N G+H+ VR+ NPLFF   KP P CK+++ ++
Sbjct  118  VVCSKNVGMHNAVRFTNPLFFQKDKPVPGCKELVEEM  154



>ref|XP_004251892.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=161

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA + L SA    LAFA FA  +  E F VEG VYCD CRVQF+T+ISE ++GA V+L
Sbjct  1    MAKAILVL-SALCSILAFANFAQCQ--EAFKVEGTVYCDTCRVQFQTRISEYIEGAKVKL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             C++++TEK TYT E  T  NG Y++   GDHE+ +CDV VV+SPREDCK+     + S 
Sbjct  58   TCRDMETEKVTYTAEALTDKNGKYTIEASGDHEKELCDVGVVQSPREDCKDPAIGFENSR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            V+CS N G+H+  RYANPLFFM  +  P CK VL ++G  P + 
Sbjct  118  VVCSNNVGMHNPTRYANPLFFMKKETLPDCKDVLDELGLFPLEF  161



>ref|XP_006358942.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=161

 Score =   154 bits (388),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 112/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA I ++SA    LAFA FA  +  E F VEG VYCD CRVQF+TKISE+++GA V+L
Sbjct  1    MAKA-ILVLSALCSILAFANFA--QSHEVFKVEGTVYCDTCRVQFQTKISENIEGAKVQL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             C++++TEK TYT E  T  +G Y++   GDHE+ +CDV V+ SPREDCKE     + + 
Sbjct  58   TCRDMETEKVTYTTEALTDKDGKYTIEATGDHEKELCDVGVIHSPREDCKEPAIGFENTR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            V+CS N G+H+  RYANPLFFM  +  P CK VL ++G  P + 
Sbjct  118  VVCSNNVGMHNPTRYANPLFFMKKESLPGCKDVLDELGLFPLEF  161



>gb|EYU26327.1| hypothetical protein MIMGU_mgv1a015422mg [Erythranthe guttata]
Length=158

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 104/160 (65%), Gaps = 4/160 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK T+AL+SA +CFLA      G   E F VEG VYCD CRVQFET +++ L GA VRL
Sbjct  1    MAK-TVALISA-LCFLA--AVVHGHQTEHFNVEGDVYCDPCRVQFETVLAQRLIGATVRL  56

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +C++L  +  TY+ E  T  NG+YSL V GDH+  IC+V VVKSPR DC E +    KS 
Sbjct  57   ECRDLVKKAVTYSVEGVTGFNGHYSLPVVGDHQNEICEVAVVKSPRPDCIEPMGDFAKSR  116

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYI  500
            + C+ N G H+ VR+ANP+ FM     P+C  VL D+G +
Sbjct  117  ISCTTNDGTHAAVRFANPIGFMTGAAVPQCTPVLFDLGVL  156



>ref|XP_006348395.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=169

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA I L  +A+C LA A FA     E F VEG+V+CD CR+ F T +S +L+GA VRL
Sbjct  1    MAKAIILL--SALCVLAVANFAVA-DFEIFDVEGKVFCDTCRLGFVTSLSNTLEGATVRL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             CK+++T  ET+T E  T   G Y+L VEGDHE  IC+VT+V SP++DCKE VP +  + 
Sbjct  58   TCKDMETHNETFTTEGKTDYIGKYTLTVEGDHENDICEVTLVNSPKDDCKEIVPDMVNNR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYI  500
            V+CS+N G+H+ VR+ NPLFF   KP   C++++ ++  +
Sbjct  118  VICSKNVGMHNAVRFVNPLFFQKDKPINGCRELVEEMELV  157



>ref|XP_004244268.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=169

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA I L  + +C LA A FA     E F VEG+V+CD CR+ F T +S +L+GA VR+
Sbjct  1    MAKAIILL--STLCVLAVANFAVADV-ETFNVEGKVFCDTCRLGFVTSLSNTLEGATVRM  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             CK+++T  ET+T E  T   G Y+L VEGDHE  IC+VT+V SP++DCKE VP +  + 
Sbjct  58   TCKDMETHNETFTTEGKTDGIGKYTLKVEGDHENDICEVTLVNSPKDDCKEVVPDMVNNR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYI  500
            V+CS+N G+H+ VR+ NPLF+   KP   C K++ ++  +
Sbjct  118  VICSKNVGMHNAVRFVNPLFYQKDKPIDGCAKLVEEMELV  157



>ref|XP_011070069.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=161

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 115/158 (73%), Gaps = 4/158 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA +ALVSA +C LA A   A K  EKF VEG VYCD CRVQFET++S +L GA VRL
Sbjct  1    MAKA-VALVSA-LCILAAAVVDAHK--EKFHVEGDVYCDPCRVQFETELSYNLAGATVRL  56

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +C++++T+  TY+ E  T ++G+YSL V+GDHE+ IC+V  VKSP+ +C E +   ++++
Sbjct  57   ECRDIETKTVTYSMEGVTGSDGHYSLTVKGDHEKDICEVIPVKSPKAECSEPMGDYERAK  116

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIG  494
            + C+EN+G+H+ +RYANP+ FM  +  P C  +LA++ 
Sbjct  117  IECTENSGLHNPIRYANPIGFMTPEILPACGPILANLA  154



>gb|KHG10520.1| Olee1-like protein [Gossypium arboreum]
Length=180

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 101/162 (62%), Gaps = 3/162 (2%)
 Frame = +3

Query  21   MAK-ATIALVSAAICFLAFAGFAAG-KPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK   I LVS AIC     G AA   P EKF VEGRVYCD CRV+FETKIS+ +KGA V
Sbjct  1    MAKVQQITLVSLAICLSTLLGLAAAANPEEKFIVEGRVYCDTCRVEFETKISQPIKGASV  60

Query  195  RLDCKNLkteketyteevttAAN-GNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLD  371
            +L+C+N+  EK     +       G Y + V+GDHE+ IC+V++VKSPR DC E      
Sbjct  61   KLECRNITNEKIVSHSQDVVTDEAGGYKIEVKGDHEDEICEVSLVKSPRADCNEPTEVWR  120

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGY  497
            K+ V+ ++  G+    R+AN L +M  +  P CKKVL ++GY
Sbjct  121  KARVVLTKADGVSGTYRFANNLGYMKKEALPECKKVLTEMGY  162



>ref|XP_011098227.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=163

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA +ALVSA +C LA +        EKF VEG VYCD CRVQFET++S  + GA+VR+
Sbjct  1    MAKA-VALVSA-LCILAVSVVVVHAHKEKFYVEGDVYCDPCRVQFETELSYHIAGAMVRV  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +C++++T+K T++ E  T ++G+YS++V GDHE+ IC+V   +SP+ +C E +   ++++
Sbjct  59   ECRDIETKKITFSMEGVTGSDGHYSIMVTGDHEKDICEVIPTRSPKNECSEPMGDYERAK  118

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
            V C+EN+G+H+ +RYANP+ FM  K  P C  +LAD+     D
Sbjct  119  VECTENSGLHNTIRYANPVGFMTPKVLPECAPILADLATFNED  161



>emb|CDP16229.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 110/164 (67%), Gaps = 7/164 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA +A+VSA +CFLA A  A  +  E FTV+GRVYCD CRV+F+T +S+S++GA V L
Sbjct  1    MAKA-VAVVSA-LCFLALASLAHAQ--EAFTVKGRVYCDPCRVEFQTSLSKSIEGAEVEL  56

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVP-SLDKS  377
             C+  +    T +++ TT ANGNY L  +GDHEE IC+V  V SP ++C   VP + +K+
Sbjct  57   QCRVRENGTVTVSQKATTDANGNYELSAQGDHEEEICEVVSVSSPSQEC--NVPFAENKA  114

Query  378  EVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
             VL ++N G+    RYAN L +   K +P CK +L ++GYIP +
Sbjct  115  RVLLTQNNGVQGTDRYANALGYKTTKTNPDCKAILQEMGYIPDE  158



>ref|XP_002523378.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
 gb|EEF38957.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
Length=166

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = +3

Query  39   ALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            AL+++A+CF +    A    G    VEG+VYCD CRV+FETK+SE + G  V+L+CKN +
Sbjct  9    ALIASALCFSSLLSSALATAG--LYVEGKVYCDTCRVEFETKLSEVIPGTRVKLECKNRE  66

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
                TY  E  T A+G Y L VEG+HEE +C+V ++KS + DC E   S+D + VL + N
Sbjct  67   NNTLTYAVEGVTDASGIYRLPVEGEHEEDLCEVKLIKSGKPDCAEAFKSVDHARVLLTHN  126

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
             G+    RY NPL FM  K  P C KVL D+G++P D
Sbjct  127  VGVVQPTRYTNPLGFMKQKASPECGKVLQDMGFVPLD  163



>emb|CDP16230.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 110/164 (67%), Gaps = 7/164 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA +A+VSA +CFLA A  A  +  E FTV+GRVYCD CRV+F+T +S+S++GA V L
Sbjct  1    MAKA-VAVVSA-LCFLALASLAHAQ--EAFTVKGRVYCDPCRVEFQTSLSKSIEGAEVEL  56

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVP-SLDKS  377
             C+  + E  T +++  T A GNY L V+GDHEE IC+V  V SP ++C   VP   +K+
Sbjct  57   QCRVRENETVTVSQKAKTDAIGNYELSVQGDHEEEICEVVSVSSPSQEC--NVPFGENKA  114

Query  378  EVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
             VL ++N G+    RYAN L +  A+ +P CK VL ++GYIP +
Sbjct  115  RVLLTQNNGVQGTDRYANALGYKTAEANPDCKAVLQEMGYIPDE  158



>emb|CDP06002.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 110/164 (67%), Gaps = 7/164 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAKA +A+VSA +CFLA A  A  +  E FTV+GRVYCD CRV+F+T +S++++GA V L
Sbjct  1    MAKA-VAVVSA-LCFLALASLAHAQ--EAFTVKGRVYCDPCRVEFQTSLSKNIEGAEVEL  56

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVP-SLDKS  377
             C+  +    T +++ TT ANGNY L V+GDHEE IC+V  V SP  +C   VP   +K+
Sbjct  57   QCRVRENGTVTVSQKATTDANGNYELSVQGDHEEEICEVASVSSPSLECN--VPFGENKA  114

Query  378  EVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
             +L ++N G+    R+ANPL +   + +P CK +L ++GYIP +
Sbjct  115  RILLTQNNGVQGTDRFANPLGYKTTEANPDCKPILQEMGYIPDE  158



>gb|KDP32532.1| hypothetical protein JCGZ_14735 [Jatropha curcas]
Length=165

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 104/164 (63%), Gaps = 4/164 (2%)
 Frame = +3

Query  21   MAK--ATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  A   L+++A+CF +   +A    G    VEG+VYCD CRV+FETK+SE +KGAVV
Sbjct  1    MAKSFAFAGLIASALCFSSLFSYAFA--GANMFVEGKVYCDVCRVEFETKLSEPIKGAVV  58

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
            +L+CK  +    TY  E  T   G Y L VEG+HEE IC+V +VKS   DC E   S D+
Sbjct  59   KLECKIRENNTLTYAVEGETDPQGIYRLPVEGEHEEDICEVRLVKSGMTDCIEPFKSTDR  118

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPT  506
            + +L S+N G+    RYANPL +M  + +P C +VL D+G++P 
Sbjct  119  ARILLSQNVGVVQASRYANPLGYMKKEANPNCGQVLLDMGFLPN  162



>ref|XP_008371469.1| PREDICTED: olee1-like protein [Malus domestica]
Length=172

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 103/164 (63%), Gaps = 5/164 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA +   ++ +A+CFL+ AG A    GE   V G VYCDNCR+QF T+ISE+LKGA VRL
Sbjct  1    MANSNSIVLVSALCFLSLAGVAY--CGETLNVHGIVYCDNCRIQFVTRISETLKGAKVRL  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLD---  371
            +C+  +  K T ++E  T   G YS+ VEGDHEE +C+V +VKSP+EDC E    L    
Sbjct  59   ECRENEGGKITLSKEADTDDLGTYSIPVEGDHEEEVCEVILVKSPKEDCSEISNELHVKL  118

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIP  503
             + +  + + GI    R ANPL FM  + DP+C +VL ++G  P
Sbjct  119  SARISLTNHNGITGPHRMANPLGFMKKEVDPKCAEVLKELGLTP  162



>ref|XP_007021723.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY13248.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=162

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 105/165 (64%), Gaps = 5/165 (3%)
 Frame = +3

Query  21   MAKAT-IALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            MAKA+ IALVS AIC  + +   A    + F VEG+VYCD CRV+FET++S+ +KGA V 
Sbjct  1    MAKASLIALVSLAICLSSLSFTYAE---DTFFVEGKVYCDTCRVEFETRLSQPIKGATVI  57

Query  198  LDCKNLkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
            L+C++          + +    +G Y + V+GDHEE IC+V VVKSPREDC E + +  +
Sbjct  58   LECRDRTVGGSITYSQESVTDESGKYRIPVQGDHEEEICEVRVVKSPREDCNEFMEAWQR  117

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
            + VL ++  G+   +RYAN L F+  +  P C +VL ++G++P +
Sbjct  118  ARVLLTKKNGVSDPIRYANNLGFLKKEAVPGCAEVLEELGFLPLN  162



>ref|XP_011029563.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=166

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 106/167 (63%), Gaps = 8/167 (5%)
 Frame = +3

Query  21   MAKA--TIALVSAAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGA  188
            MAK     A VS A+CF  +  + +AA    +   VEG+VYCD CRV+F+TKIS++L GA
Sbjct  1    MAKGFTVAAFVSTALCFSSVLISAYAA----DYLDVEGKVYCDTCRVEFQTKISDALPGA  56

Query  189  VVRLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL  368
             V+L C N +    TYT E +T + G Y L V GDHEE IC+V +V+SPR DC E   S+
Sbjct  57   KVKLACNNRENGTLTYTVEGSTDSRGTYRLPVAGDHEEDICEVRLVESPRADCNEPFKSV  116

Query  369  DKSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
            D + +L ++N G+ + +RYAN L +M     P C KVL ++G++P +
Sbjct  117  DSARILLTKNVGVVNSLRYANALGYMKKVAQPECAKVLEEMGFLPVE  163



>ref|XP_009348994.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=172

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 101/164 (62%), Gaps = 5/164 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA +    + +A+CFL+  G A    GE   V G VYCDNCR+QF T+ISE+LKGA VRL
Sbjct  1    MANSNSIFLVSALCFLSLVGVAY--CGETLNVHGIVYCDNCRIQFVTRISETLKGAKVRL  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLD---  371
            +C+  +  K T ++E  T   G YS+ VEGDHEE +C+V +VKSP+EDC E    L    
Sbjct  59   ECRENEGGKITLSKEADTDDLGTYSIPVEGDHEEEVCEVILVKSPKEDCSEISNELHVKL  118

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIP  503
             + +  + + GI    R ANPL FM  + DP+C +VL ++G  P
Sbjct  119  SARISLTNHNGITGPHRMANPLGFMKKEVDPKCAEVLKELGLTP  162



>sp|O49813.1|OLEE1_BETPN RecName: Full=Olee1-like protein; Flags: Precursor [Betula pendula]
 emb|CAA74365.1| putative Ole e 1 protein [Betula pendula]
Length=166

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 103/167 (62%), Gaps = 6/167 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+ I + + A+CFL+  GFA  +   +F VEG+VYCDNCR QF TK+S  +KGA V L
Sbjct  1    MAKSII-IQAPALCFLSLLGFAYSE--SRFFVEGKVYCDNCRTQFVTKLSTYMKGAKVSL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETV--PSLDK  374
            +C+N +     Y+ +  T  +G Y + V+GDHEE IC++ + KS   DC E    P L K
Sbjct  58   ECRNREGGTLIYSSDSETDKSGTYRIPVDGDHEEEICEIALKKSSDPDCSEVSKDPFLKK  117

Query  375  S-EVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            S  +  ++N GI + VR ANPL FM  KP P C K L ++G  P D+
Sbjct  118  SARISLTKNNGISTPVRLANPLGFMKKKPLPECAKALRELGMNPDDV  164



>ref|XP_010277041.1| PREDICTED: anther-specific protein LAT52 [Nelumbo nucifera]
Length=165

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = +3

Query  102  EKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSLV  281
            E+F V+G+VYCD CR QFETK+SE + GA VRL+C++ + +   Y+ E  T   G Y L 
Sbjct  28   EQFFVQGKVYCDTCRTQFETKLSEPISGAKVRLECRSRENDDVAYSVEGETDTTGIYKLP  87

Query  282  VEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFFMPAKPD  461
            VEG HEE IC+V ++ SPR+DC E  P LD + VL S N GI S  R+AN L FM  KP 
Sbjct  88   VEGSHEEDICEVKLLSSPRKDCSEPAPGLDHARVLLSSNNGISSASRFANSLGFMVLKPI  147

Query  462  PRCKKVLADIGYIP  503
              C  VL ++G +P
Sbjct  148  EGCSDVLKELGLLP  161



>ref|XP_002316866.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|EEE97478.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=164

 Score =   127 bits (320),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 103/159 (65%), Gaps = 6/159 (4%)
 Frame = +3

Query  39   ALVSAAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKN  212
            A V+ A+CF  +  + +AA    +   VEG+VYCD CRV+F+TKIS+++ GA V+L C N
Sbjct  9    AFVATALCFSSVLISAYAA----DYLDVEGKVYCDTCRVEFQTKISDAIPGAKVKLVCNN  64

Query  213  LkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCS  392
             +    TYT E TT ++G Y L V GDHEE IC+V +V+SPR DC E   S+D + +L +
Sbjct  65   RENGTLTYTVEGTTDSSGTYRLPVVGDHEEDICEVRLVESPRADCNEPFKSVDSARILLT  124

Query  393  ENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
            +N G+   +RYAN L +M     P C KVL ++G++P +
Sbjct  125  KNVGVVDNLRYANALGYMKKVAQPECAKVLEEMGFLPVE  163



>gb|KHG25858.1| Olee1-like protein [Gossypium arboreum]
Length=166

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 104/166 (63%), Gaps = 3/166 (2%)
 Frame = +3

Query  21   MAKATI-ALVSAAICFLA-FAGFA-AGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAV  191
            MAKA+  ALVS AIC L+   GFA AG    KF V G+VYCD CRV+FETK+SE + GA 
Sbjct  1    MAKASQRALVSMAICLLSSLVGFAYAGSLSNKFVVLGKVYCDTCRVEFETKLSEPIPGAK  60

Query  192  VRLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLD  371
            V+L+C+    E  TY+ E  T ANG Y + VEGDHEE IC V+ V SPR DC E + + +
Sbjct  61   VKLECRKEGDETVTYSHEAETDANGVYKIPVEGDHEEQICAVSTVSSPRADCNEKMEAFE  120

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
            K++V  + + G+    R AN L F      P C +VL ++G+  T+
Sbjct  121  KAQVELTSDDGLAEPSRKANNLGFKKKVAVPGCAQVLKEMGFPLTE  166



>ref|XP_007212169.1| hypothetical protein PRUPE_ppa012463mg [Prunus persica]
 gb|EMJ13368.1| hypothetical protein PRUPE_ppa012463mg [Prunus persica]
Length=168

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = +3

Query  27   KATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDC  206
            K++  ++++A+CFL+  GFA     +  +V+G VYCDNCR+QF T+ISE L+GA V+L+C
Sbjct  4    KSSGIVLASALCFLSLLGFAYC--ADNLSVDGLVYCDNCRIQFMTRISEPLQGATVKLEC  61

Query  207  KNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKE-TVPSLDK--S  377
            ++ +    T + E  T   G Y + VEGDHEE +C+V +VKSPR+DC E +  S  K  +
Sbjct  62   RDREGGTVTLSSETDTDEQGRYQIPVEGDHEEEVCEVLLVKSPRDDCSEVSTDSHAKLSA  121

Query  378  EVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIP  503
             +  + N GI    R  NPL F+  +PD +C +VL ++G  P
Sbjct  122  RISLTNNNGIAGPHRIPNPLGFLKTEPDAKCAEVLKELGLTP  163



>ref|XP_008383629.1| PREDICTED: olee1-like protein [Malus domestica]
Length=184

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 98/164 (60%), Gaps = 5/164 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA +   ++ +A+CFL+  G A     E   V G VYCDNCR QF T+ISE L GA VRL
Sbjct  1    MANSNSIVLVSALCFLSLIGVAYST--ETLNVHGIVYCDNCRTQFFTRISEPLTGAKVRL  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLD---  371
            +C+  +  K T T+E  T   G YS+ VEGDHEE +C+V +VKSP+EDC E    L    
Sbjct  59   ECRESEGGKVTLTKEXDTEELGTYSIPVEGDHEEEVCEVILVKSPKEDCSEISNELHAKL  118

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIP  503
             + +  + + GI    R ANPL FM  + DPRC +VL ++G  P
Sbjct  119  SARISLTNHNGITGPHRMANPLGFMKKEVDPRCAEVLKELGLTP  162



>ref|XP_008450951.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=165

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 104/161 (65%), Gaps = 5/161 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            M K+TI L+SA +CF++    A+ K  ++F VEG+VYCD CRVQF TK+S+ LKGA V+L
Sbjct  1    MTKSTIILISA-LCFVSLFYLASSK--DQFFVEGKVYCDTCRVQFFTKVSKFLKGATVKL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS--LDK  374
            +CK ++    T  +E  T  +G YS+  +GDHEE +C+V++VKS   DC E         
Sbjct  58   ECKEIEGGSVTLNKEAVTDKSGKYSIEADGDHEEEVCEVSLVKSVDPDCDEISKEGYGHT  117

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGY  497
            S V  + N+GI + VR ANPL F+  +  P CK+VL ++G+
Sbjct  118  SRVTITNNSGITNPVRLANPLAFLKKEKLPECKEVLRELGF  158



>ref|XP_009352776.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=180

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 98/164 (60%), Gaps = 5/164 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA +   ++ +A+CFL+  G A     E   V G VYCDNCR QF T+ISE L GA VRL
Sbjct  1    MANSNSIVLVSALCFLSLIGVAYC--AETLNVHGIVYCDNCRTQFFTRISEPLTGAKVRL  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLD---  371
            +C+  +  K T T+E  T   G YS+ VEGDHEE +C+V +VKSP+EDC E    L    
Sbjct  59   ECRESEGGKVTLTKEADTEELGTYSIPVEGDHEEEVCEVILVKSPKEDCSEISNELHAKL  118

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIP  503
             + +  + + GI    R ANPL FM  + DPRC +VL ++G  P
Sbjct  119  SARISLTNHNGITGPHRMANPLGFMKKEVDPRCAEVLKELGLTP  162



>ref|XP_009421183.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 3/154 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK  +  V AA+CF A AG A   P   F ++GRVYCD CR  FET  ++ ++GA V+L
Sbjct  1    MAKLQLLPVVAALCF-ALAGVALALP--TFRIQGRVYCDKCRAGFETSATDYIEGAKVKL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +C+   T     T    T A+G Y+L VE +HEE IC+V +V+SPR  C E +   D++ 
Sbjct  58   ECRQYDTGVVEQTATAVTDASGTYTLEVEDNHEEEICEVVLVESPRPGCSEIMTGRDRAR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            VL S  +G+ + VRYAN L F+ A P P C  +L
Sbjct  118  VLISAESGLTTSVRYANSLGFLNAAPLPECGLLL  151



>ref|XP_009617824.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=171

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 99/163 (61%), Gaps = 5/163 (3%)
 Frame = +3

Query  36   IALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
            I L+++AIC  +  G    +   +F VEG+VYCD CR  FE ++S+ + GA VRL C+N 
Sbjct  7    IILIASAICLFSLIGITQAQAQAQFHVEGKVYCDFCRALFENRLSKPMPGAEVRLQCRNS  66

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVP----SLDKSEV  383
              +  T T E  T  NG YSL+VE DHE+ IC++ ++KS +EDC E +P    + + + +
Sbjct  67   TDDSVTLTVEGQTDKNGVYSLLVERDHEDEICEMILMKSSKEDCSE-IPNEGHAKESARI  125

Query  384  LCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
              + N G+   +R+ANPLFF+  +  P C +V  ++  +P ++
Sbjct  126  TITSNNGMAETIRHANPLFFVKKEAAPECAEVFKELELLPEEI  168



>ref|XP_003541705.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN08444.1| Olee1-like protein [Glycine soja]
Length=169

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 98/162 (60%), Gaps = 6/162 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK TI ++++ +CFL+F G A  +  ++F VEG VYCD CRVQF TK+SE L+GA VR+
Sbjct  1    MAKTTIIILASTLCFLSFLGSAYAR--DRFMVEGTVYCDTCRVQFLTKLSEFLEGATVRV  58

Query  201  DCKNLkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---L  368
             C  +   K     +     A+G+Y + V+GDHEE  C+VT++KSPR DC E        
Sbjct  59   VCSQVDNAKNVTFSKEAVTDASGSYKVEVDGDHEEDTCEVTLLKSPRADCSEVDQESHLQ  118

Query  369  DKSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIG  494
              + +  ++N GI S +R ANPL F+     P C  +L ++G
Sbjct  119  QAARISITKNNGIVSPIRQANPLGFLKKDRLPGCLDLLKELG  160



>ref|XP_004144129.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004171680.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN66323.1| hypothetical protein Csa_1G597700 [Cucumis sativus]
Length=165

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 104/161 (65%), Gaps = 5/161 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+TI LVSA +CF++    A+ K  ++F VEG+VYCD CRVQF TK+S+ L+GA V+L
Sbjct  1    MAKSTIILVSA-LCFISLFHLASCK--DQFFVEGKVYCDTCRVQFFTKVSKFLEGATVKL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS--LDK  374
            +CK ++    T  +E  T  +G YS+  +GDHEE +C+V+++KS   DC E         
Sbjct  58   ECKEIEGGSVTLDKEAVTDKSGKYSIEADGDHEEEVCEVSLMKSVDPDCDEISKEGYGHT  117

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGY  497
            S V  + N+GI + VR ANPL F+  +    CK+VL ++G+
Sbjct  118  SRVTITNNSGITNPVRLANPLAFLKKEKLSECKEVLRELGF  158



>ref|XP_007148052.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
 gb|ESW20046.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
Length=169

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 103/166 (62%), Gaps = 14/166 (8%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+ I ++++A+CFL+F G A+ +  ++F VEG VYCD CRVQF T++SE L+GA VR+
Sbjct  1    MAKSAIIILASALCFLSFLGSASAR--DRFFVEGTVYCDTCRVQFLTRMSEFLEGAAVRV  58

Query  201  DCKNLkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKS  377
             C  +   K    ++ T   A G+Y + V+GDHEE  C VT+VKSPR DC E    +DK 
Sbjct  59   MCSQVDNAKNVTFDKETVTDALGSYKMEVDGDHEEDNCQVTLVKSPRPDCSE----VDKE  114

Query  378  EVL-------CSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIG  494
              L        ++N GI S +R ANPL F+     P C+ +L ++G
Sbjct  115  SYLQQAARISITKNNGIVSPIRQANPLGFLKKDRLPGCQDLLKELG  160



>ref|XP_003546028.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN18912.1| Olee1-like protein [Glycine soja]
Length=169

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 100/166 (60%), Gaps = 14/166 (8%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            M KA I ++++ +CFL+F G A  +  ++F VEG VYCD CRVQF TK+SE L+GA VR+
Sbjct  1    MGKAAIIILASTLCFLSFLGSAYAR--DRFMVEGTVYCDTCRVQFLTKLSEILEGATVRV  58

Query  201  DCKNLkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK-  374
             C  +   K     +     A+G+Y + VEGDHEE  C+VT++KSPR DC E    +D+ 
Sbjct  59   TCSQVDNAKNVTFSKEAVTDASGSYKVEVEGDHEEDTCEVTLLKSPRPDCSE----IDRE  114

Query  375  ------SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIG  494
                  + +  ++N GI S +R ANPL F+     P C  +L ++G
Sbjct  115  SHLQQAARISITKNNGIVSPLRQANPLGFLKKDRLPGCADLLKELG  160



>ref|XP_007025385.1| Olee1-like protein [Theobroma cacao]
 gb|EOY28007.1| Olee1-like protein [Theobroma cacao]
Length=170

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 99/160 (62%), Gaps = 11/160 (7%)
 Frame = +3

Query  36   IALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
            I  +++A+CFL+  G    +  E+F VEG+VYCDNCR QF TKIS+ + GA VRL+C++ 
Sbjct  8    IFFLASALCFLSLLGIVDAQAPEQFFVEGKVYCDNCRAQFVTKISKYMAGAQVRLECRDR  67

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVL---  386
            +    TY+ +  T  +G Y + VEGDHEE IC+V++V+S   +C E    +DK   L   
Sbjct  68   EGGDITYSVDGETDESGTYHIKVEGDHEEEICEVSLVQSSDPECSE----IDKENFLRKS  123

Query  387  ----CSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIG  494
                 ++ +GI S  R ANPL FM  KP P C +VL ++G
Sbjct  124  ARISLTKYSGITSDSRLANPLGFMVKKPLPECTEVLRELG  163



>ref|XP_008467237.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=166

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 105/163 (64%), Gaps = 8/163 (5%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+ I LVSA +  ++    A  +  ++F VEG+VYCD CRVQF TK S+ L+GA V+L
Sbjct  1    MAKSMILLVSA-LSLMSLLNVAFSQK-DRFLVEGKVYCDACRVQFFTKASKFLEGATVKL  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             CK ++    T ++E  T   G+YS+  +GDHEE +C+VT+VKS   DC E   SL+K E
Sbjct  59   VCKEIEGGSVTLSKEAVTDKTGSYSIEADGDHEEELCEVTLVKSNDPDCSEI--SLEKYE  116

Query  381  ----VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGY  497
                V  + N+GI + VR+ANPL FM  +  P CK++L ++G+
Sbjct  117  HMARVSITNNSGITNPVRHANPLAFMKKEKLPECKEILRELGF  159



>gb|EYU45018.1| hypothetical protein MIMGU_mgv1a015317mg [Erythranthe guttata]
Length=161

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 105/158 (66%), Gaps = 4/158 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEK--FTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAKA +ALVS  +C +A A  +     ++  F +EG VYCD CRVQF T++S+ + GA V
Sbjct  1    MAKA-VALVSV-LCIVALAAASVAHAHQRNVFNIEGDVYCDPCRVQFHTELSKRIPGATV  58

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
            RL+C+N +T+  TY+ E  T A+G+YSL V+GDHE+ +C V  +KSP  +C E +  + +
Sbjct  59   RLECQNEETKAVTYSVEGLTNADGHYSLRVDGDHEKDVCVVKAIKSPIAECSEPMTDVRE  118

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLAD  488
            S ++C+ N G+HS VR+ANP+ FM     P+C  VL D
Sbjct  119  SRIVCTNNIGMHSAVRFANPIGFMTKVGSPQCIPVLQD  156



>gb|ACU23617.1| unknown [Glycine max]
Length=169

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 99/166 (60%), Gaps = 14/166 (8%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            M KA I ++++ +CFL+F G A  +  ++F VEG VYCD CRVQF TK+SE L+GA VR+
Sbjct  1    MGKAAIIILASTLCFLSFLGSAYAR--DRFMVEGTVYCDTCRVQFLTKLSEILEGATVRV  58

Query  201  DCKNLkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK-  374
             C  +   K     +     A+G+Y + VEGDHEE  C+VT++KSPR DC E    +D+ 
Sbjct  59   TCSQVDNAKNVTFSKEAVTDASGSYKVEVEGDHEEDTCEVTLLKSPRPDCSE----IDRE  114

Query  375  ------SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIG  494
                  + +  ++N GI S  R ANPL F+     P C  +L ++G
Sbjct  115  SHLQQAARISITKNNGIVSPFRQANPLGFLKKDRLPGCADLLKELG  160



>ref|XP_004143635.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004168700.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN50408.1| hypothetical protein Csa_5G172880 [Cucumis sativus]
Length=166

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 101/163 (62%), Gaps = 8/163 (5%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+ I  VSA   F       A    ++F VEG+VYCD CRVQF TK S+ L+GA V+L
Sbjct  1    MAKSIILFVSALSLFSLLN--VAYSQKDRFLVEGKVYCDACRVQFFTKASKFLEGATVKL  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
             CK ++    T ++E  T   G+YS+  +GDHEE +C+VT+VKS   DC E   SL+K E
Sbjct  59   VCKEIEGGSVTLSKEAVTDKTGSYSIEADGDHEEDLCEVTLVKSNDPDCSEI--SLEKYE  116

Query  381  ----VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGY  497
                V  + N+GI + VR+ANPL FM  +  P CK+VL ++G+
Sbjct  117  HMARVSITNNSGITNPVRHANPLAFMKKEKLPECKEVLRELGF  159



>gb|AFK47865.1| unknown [Lotus japonicus]
Length=168

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 108/169 (64%), Gaps = 6/169 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            M+K+ I L SA +CFL+  G +     ++F VEG VYCD CR QF TK+SE L+GA VR+
Sbjct  1    MSKSIIFLASA-LCFLSVLG-SVYSDDDRFFVEGVVYCDTCRTQFITKLSEFLEGATVRV  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKE--TVPSLDK  374
            +CK       T+T+EV T A G+Y + V+GDHEE +C V +VKSPR DC E  +   L++
Sbjct  59   ECKEEGNGSVTFTKEVVTDAKGSYKVEVDGDHEEELCQVVLVKSPRSDCSEIDSDSHLEQ  118

Query  375  -SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             +++  ++N GI S VR ANPL F+  +  P C  VL ++G I  D TF
Sbjct  119  AAKISITKNNGIVSPVRAANPLGFLKKERLPGCADVLKELG-IKEDGTF  166



>ref|XP_009759546.1| PREDICTED: olee1-like protein [Nicotiana sylvestris]
Length=172

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 91/164 (55%), Gaps = 3/164 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+ +    + IC  +  G        +F VEG VYCD CR  F+T +S+ L GA VRL
Sbjct  1    MAKSAVIFFVSVICLFSILGLTQAYEKPQFIVEGIVYCDPCRSAFKTNLSQPLAGAGVRL  60

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKE---TVPSLD  371
             C++ +TE+ T T    T + G Y L+VEGDHE  IC+  + KSP+EDC E    V + +
Sbjct  61   QCRHPETEEVTITIASQTNSTGYYHLLVEGDHENEICETYLTKSPKEDCSEIPDEVHTKE  120

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIP  503
             S V  + N G+   +R AN LFF+  K    C +   D+ YIP
Sbjct  121  SSRVTLTNNNGMAGNLREANALFFLAKKSSSECAQEFKDMQYIP  164



>ref|XP_011006522.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=161

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 102/166 (61%), Gaps = 7/166 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK +  + +  +CF  L  + +AA    +   VEG+VYCD CRV+F+TKISE +  A V
Sbjct  1    MAK-SFTIAAFVLCFSSLLISAYAA----DYLNVEGKVYCDPCRVEFQTKISEGIPAAKV  55

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
            +L C N     ETYT E  T ++G Y L V GDHE+ IC++ +V+S R DC E   S+D 
Sbjct  56   KLVCNNRDNGTETYTVEGATDSSGTYRLSVAGDHEDDICEIRLVESSRPDCNEPFRSIDS  115

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            +++L ++NAG+    RY N L +M  +  P C  VL ++G++P ++
Sbjct  116  AKILLTKNAGVVDKTRYPNALGYMKKEAQPECANVLKEMGFLPLEV  161



>ref|XP_004485892.1| PREDICTED: olee1-like protein-like [Cicer arietinum]
Length=165

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 105/161 (65%), Gaps = 7/161 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+TI L+S  +CFL+F  F +    ++F VEG VYCD CR QF TK++E ++GA VR+
Sbjct  1    MAKSTIILIST-LCFLSF--FGSVYCNDRFFVEGVVYCDTCRTQFITKLTEFMEGATVRM  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKE--TVPSLDK  374
            +CK       T+++E  T A+G Y + V+GDHE+ +C++T+ KSPR+DC E  +   L++
Sbjct  58   ECKE-DNGTVTFSKEAVTDASGTYRVEVDGDHEDEVCEITLAKSPRKDCSEVDSDSHLEQ  116

Query  375  -SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIG  494
             + +  + N GI S +R ANPL F+  +  P C  VL D+G
Sbjct  117  AARISITNNNGIVSPLRTANPLGFLKKERLPGCADVLKDLG  157



>gb|ADI55168.1| AS1 [Gossypium hirsutum]
Length=182

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 98/171 (57%), Gaps = 11/171 (6%)
 Frame = +3

Query  21   MAKAT-IALVSAAICFLAFAGFA---------AGKPGEKFTVEGRVYCDNCRVQFETKIS  170
            MAKA+ I+L+S  IC  +   FA         +     +F V G VYCD CRV+FET IS
Sbjct  1    MAKASVISLLSLFICIFSSLSFAYASAPAPAPSSNQQMRFEVLGHVYCDTCRVEFETSIS  60

Query  171  ESLKGAVVRLDCKNLkteketyteevttAAN-GNYSLVVEGDHEEAICDVTVVKSPREDC  347
            E + GA VRL+C+N   EK TY     TA + GNY + V GD+EE+ CDV +VKSPR DC
Sbjct  61   EPIPGATVRLECRNRTDEKITYQSPEITAGDKGNYKIQVTGDYEESDCDVMLVKSPRADC  120

Query  348  KETVPSLDKSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYI  500
             +      K+ V+ +   G+   +R+AN L F   +  P C KVL ++GY 
Sbjct  121  NDPTEEWRKARVVLTTLDGVSGEIRFANNLGFKKKEALPECTKVLTEMGYF  171



>ref|XP_009608960.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=172

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 89/164 (54%), Gaps = 3/164 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+ +    +AIC  +  G        +F VEG VYCD CR  F+T +S+ L GA VRL
Sbjct  1    MAKSAVIFFVSAICLFSLLGLTQASEKPQFIVEGIVYCDPCRSAFKTNLSQPLAGAGVRL  60

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKE---TVPSLD  371
             C++ +TE+ T T    T   G Y L+VEGDHE  IC+  + KS +EDC E    V + +
Sbjct  61   QCRHPETEEVTITIASETNTTGYYHLLVEGDHENEICETYLTKSSKEDCSEIPDEVHTKE  120

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIP  503
             S V  + N GI   +R AN LFF+       C +   D+ YIP
Sbjct  121  SSRVTLTNNNGIAGNLREANALFFLAKNASSECAQEFKDMQYIP  164



>ref|XP_010103032.1| hypothetical protein L484_005787 [Morus notabilis]
 gb|EXB94630.1| hypothetical protein L484_005787 [Morus notabilis]
Length=166

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 99/170 (58%), Gaps = 11/170 (6%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFA-AGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            M K+ I ++++A+CF++  GFA    P     VEGRVYCD CR QF TK+S  +KGA VR
Sbjct  1    MTKSVI-IIASALCFMSLLGFAYCDTP--HLIVEGRVYCDTCRAQFVTKVSNYIKGAKVR  57

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLD--  371
            L+C+  +    TY+ +  T  +G Y + V+GDHEE +C+V +VKS   DC E   S D  
Sbjct  58   LECRESEGGSVTYSNDGVTDESGTYRIAVDGDHEEEVCEVKLVKSSVPDCSEI--SNDPY  115

Query  372  ---KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
                + V  + N GI S VR ANPL F+     P C +VL ++G  P  L
Sbjct  116  NKLNARVSLTSNNGITSPVRQANPLGFLKKNSLPECPEVLRELGITPEGL  165



>ref|XP_006370166.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ERP66735.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=161

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 99/166 (60%), Gaps = 7/166 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK +  + +  +CF  L  + +AA    +   VEG+VYCD CRV+F+TKISE +  A V
Sbjct  1    MAK-SFTIAAFVLCFSSLLISAYAA----DYLDVEGKVYCDPCRVEFQTKISEGIPAAKV  55

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
            +L C N     ETYT E  T  +G Y L V GDHE+ IC+V +V+S R DC E   S+D 
Sbjct  56   KLVCNNRDNGTETYTVEGATDNSGTYRLPVAGDHEDDICEVRLVESSRPDCNEPFRSIDS  115

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            + +L ++N G+    RY N L +M  +  P C  VL ++G++P ++
Sbjct  116  ARILLTKNVGVVDKTRYPNALGYMKKEAQPECADVLKEMGFLPLEV  161



>gb|KHG13789.1| Anther-specific LAT52 [Gossypium arboreum]
Length=188

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 89/141 (63%), Gaps = 1/141 (1%)
 Frame = +3

Query  78   GFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttA  257
             + A +    + V G VYCD CRV+FETK+SE + GAVV+L+C+N   E  T+      A
Sbjct  23   SYGAAEENMHYMVVGHVYCDTCRVEFETKLSEPISGAVVKLECRNRTNEAITFQSSEIVA  82

Query  258  -ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANP  434
             ++G+Y ++VEGD+EE+ CDV +V+SPR DC +   +  KS V+ +   G+ + +R+AN 
Sbjct  83   DSHGDYHIIVEGDYEESDCDVALVRSPRADCSDPTEAWRKSRVVLTTFDGLSNKLRFANN  142

Query  435  LFFMPAKPDPRCKKVLADIGY  497
            L F      P+C ++L ++GY
Sbjct  143  LGFKKDIALPQCTRILKEMGY  163



>ref|NP_001131377.1| uncharacterized protein LOC100192702 precursor [Zea mays]
 gb|ACF79764.1| unknown [Zea mays]
 gb|AFW82076.1| hypothetical protein ZEAMMB73_949741 [Zea mays]
Length=164

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 86/143 (60%), Gaps = 1/143 (1%)
 Frame = +3

Query  57   ICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLktekety  236
            +  +  A   A  PG  F V GR+YCDNCR  FET +S +++GA V ++C++ ++++   
Sbjct  9    VALVLVATAIAAAPGVGFVVTGRIYCDNCRAGFETNVSHAIQGATVEMECRHFESQQVHD  68

Query  237  teevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HS  413
              E TT   G Y + + GDH++ ICDV ++KSP  DC E   S D+  V  + N GI  S
Sbjct  69   KAEATTGPGGWYRMEISGDHQDEICDVRLLKSPEADCAEIDHSRDRCRVPLTRNDGIKQS  128

Query  414  VVRYANPLFFMPAKPDPRCKKVL  482
             VRYANP+ F+  +P P C ++L
Sbjct  129  GVRYANPIAFLRKEPLPNCGELL  151



>gb|ACJ83911.1| unknown [Medicago truncatula]
 gb|ACJ86228.1| unknown [Medicago truncatula]
 gb|AFK43996.1| unknown [Medicago truncatula]
 gb|KEH36588.1| pollen Ole e I family allergen [Medicago truncatula]
Length=168

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 6/161 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+TI LV   +CFL+F G A  K  ++F VEG VYCD CR QF T+++E ++GA VR+
Sbjct  1    MAKSTIPLV-FTLCFLSFLGSAYSK-SDRFFVEGVVYCDTCRTQFITRLTEFIEGATVRV  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---LD  371
            +CK       T+ +E TT  +G YS+ ++GDHE+  C+V + KSPR+DC E         
Sbjct  59   ECKE-DNGTLTFNKEATTDKSGKYSVEIDGDHEDETCEVILCKSPRKDCSEVDSEAHLQQ  117

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIG  494
             + +  + N GI S VR A+PL F+  +  P+C +VL ++G
Sbjct  118  AARISVTNNNGIVSPVRAASPLGFLKKERLPKCGEVLKELG  158



>ref|XP_009340070.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 91/159 (57%), Gaps = 3/159 (2%)
 Frame = +3

Query  21   MAKAT--IALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAKA+   AL     CF + A    G   E   VEG+VYCD CRVQFET++S  L GA V
Sbjct  1    MAKASGIAALFVTLSCFYSLAYATTGADIETLFVEGKVYCDPCRVQFETRLSTPLDGATV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
             L+C++ +     Y  E  T  NG YSL  + + EE IC+V  V SP  DC +    ++K
Sbjct  61   ALECRSRENGTMVYRLEGKTDKNGIYSLPADKNFEEQICEVRTVSSPTGDCADHF-DIEK  119

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            + +L + N G+ ++ RYANPL FM  +  P C+ VL ++
Sbjct  120  ARILLTHNNGVKAMARYANPLGFMKKESTPECEAVLKEL  158



>ref|XP_007213539.1| hypothetical protein PRUPE_ppa019680mg [Prunus persica]
 gb|EMJ14738.1| hypothetical protein PRUPE_ppa019680mg [Prunus persica]
Length=163

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 95/159 (60%), Gaps = 6/159 (4%)
 Frame = +3

Query  21   MAK--ATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  + +A V A  CF + A +A  K      VEGRVYCD CRVQFET++S  L+GAVV
Sbjct  1    MAKNVSIVAFVVALSCFCSLA-YATTKSN--LFVEGRVYCDPCRVQFETRLSVPLEGAVV  57

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
             L+C+  +     YT +  T  NG YSL  + D EE IC+V  V SPR +C E     ++
Sbjct  58   ALECRGRENGTLAYTLQGKTDKNGIYSLPTDEDMEEQICEVRTVSSPRANCNEHF-EFER  116

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            + VL + N G+ S+ RYANPL FM  +    C++VL ++
Sbjct  117  ARVLLTYNNGVKSMARYANPLGFMQKESVTECEQVLKEL  155



>gb|AFK46977.1| unknown [Lotus japonicus]
Length=168

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 95/162 (59%), Gaps = 7/162 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK TI + ++A+CFL   G A  +  ++F +EG VYCD CR QF T++SE + GA V +
Sbjct  1    MAKYTI-IAASALCFLTLVGSAYSQ--DRFFIEGTVYCDTCRTQFLTRVSEFMSGATVGV  57

Query  201  DCKNLkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKE--TVPSLD  371
             C+      +    +     ANG YS+ V+GDHE+ +C+V ++KS R DC E  T   L+
Sbjct  58   VCRERDAGAKVTFSKEAVTDANGMYSVAVDGDHEDEVCEVKLLKSSRADCSEVDTESHLE  117

Query  372  K-SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIG  494
            + S +  + N GI S VR ANPL F+  +  P C  +L  +G
Sbjct  118  QASRISITNNNGIVSPVRTANPLGFLKTERLPECGHILLQLG  159



>ref|XP_009408781.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = +3

Query  63   FLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyte  242
            FL   GFA   P     VEGRVYCD CR  FETK +E ++GA V+L+CKN  T   T T 
Sbjct  17   FLCMVGFAIAAP--NLVVEGRVYCDTCRAGFETKATEYIEGAKVKLECKNYTTGASTLTA  74

Query  243  evttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVR  422
               T   G Y + V  DH+E  C V +V SPR DC E     + + V+ + N GI S VR
Sbjct  75   VAVTNNKGTYQIPVSDDHQEESCAVMLVSSPRSDCSEISDGRNHAAVVLTHNVGITSSVR  134

Query  423  YANPLFFMPAKPDPRCKKVL  482
            YAN L F+   P   C ++L
Sbjct  135  YANSLGFLKDVPLASCGQML  154



>gb|AAN76546.1|AF393475_1 LLP-B3 protein [Lilium longiflorum]
Length=160

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 85/151 (56%), Gaps = 7/151 (5%)
 Frame = +3

Query  63   FLAFAGFAA-------GKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkt  221
            FLAF   A+         P   F VEGRVYCD+CR  FET I+  ++GA V+L+C++   
Sbjct  6    FLAFVAVASLSFRLSLADPNPTFIVEGRVYCDSCRAGFETNITTYIEGAKVKLECRHFDN  65

Query  222  eketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENA  401
            +   +T E  T + G YS+ +E DHE  IC+V +V SP  DC E     D++ V  + N 
Sbjct  66   DSIAHTVEGVTNSTGTYSIQLENDHESEICEVVLVSSPIFDCNEIDYDRDRARVTLTNNN  125

Query  402  GIHSVVRYANPLFFMPAKPDPRCKKVLADIG  494
            GI S +RYAN L F+  +PD  C  +L   G
Sbjct  126  GIDSPIRYANSLGFLQEQPDIICGDLLKAYG  156



>ref|XP_008226528.1| PREDICTED: olee1-like protein [Prunus mume]
Length=163

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 95/159 (60%), Gaps = 6/159 (4%)
 Frame = +3

Query  21   MAK--ATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  + +ALV A  CF + A +A  K      VEGRVYCD CRVQFET++S  L+GAVV
Sbjct  1    MAKNLSIVALVVALSCFCSLA-YATTKTN--LFVEGRVYCDPCRVQFETRLSVPLEGAVV  57

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
             L+C+  +     YT +  T  NG YSL  + D EE IC+V  V SPR +C +     ++
Sbjct  58   ALECRGRENGTLAYTLQGKTDKNGIYSLPADEDMEEQICEVRTVSSPRANCNDHF-DFER  116

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            + VL + N G+ S+ RYANPL FM       C++VL ++
Sbjct  117  ARVLLTHNNGVKSMARYANPLGFMQNASVTECEEVLKEL  155



>ref|XP_006857531.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
 gb|ERN18998.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
Length=159

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 92/154 (60%), Gaps = 3/154 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA++ + L  AA+ FL F+  A G P   F VEGRVYCD CR  FET  +  +KG+ VRL
Sbjct  1    MARSQL-LSVAAVLFL-FSS-ALGTPTPNFEVEGRVYCDTCRAGFETSATTYIKGSTVRL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CK+  T + TY+ E  T A G Y L V  D +  IC+V VV SP   C + +   +++ 
Sbjct  58   ECKDRATHQLTYSIEGVTDATGTYRLPVSDDRQHEICEVVVVSSPEAGCGKAMLGRERAR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            VL + N GI S  RYAN L F+  +P PRC ++L
Sbjct  118  VLLTHNNGIVSNTRYANALAFLKDEPLPRCAELL  151



>ref|XP_002522577.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
 gb|EEF39877.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
Length=171

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 92/163 (56%), Gaps = 6/163 (4%)
 Frame = +3

Query  36   IALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
            I  +++AICFL     A G+    FTVEG+VYCD CRVQF TK +  +KGA VRL+CK+ 
Sbjct  9    IFFLASAICFLCLLSIAHGE--SHFTVEGKVYCDTCRVQFITKATSYIKGARVRLECKDR  66

Query  216  kteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETV--PSLDK-SEV  383
            +              A G Y + V G+HEE +C++  +KSP  DC E    P + K +++
Sbjct  67   EGGGAITFSAEAETDATGTYHIPVNGEHEEELCEIIPLKSPDPDCNEINQDPFVKKAAQI  126

Query  384  LCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
              + + GI S  R ANP+ F+  +  P C  +L ++G  P+ L
Sbjct  127  TLTNHNGIASPTRSANPIGFLKQQAVPECSGILREMGITPSGL  169



>ref|XP_004975466.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=163

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 87/148 (59%), Gaps = 2/148 (1%)
 Frame = +3

Query  45   VSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkte  224
            V+ A+ F      A   P   F ++GRVYCD CR  F+T ++E +KGA VRL+CK+  T 
Sbjct  10   VTVAVLFYGVVAVATNAP--DFVIQGRVYCDTCRAGFQTNVTEYIKGAKVRLECKHFGTG  67

Query  225  ketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAG  404
                  +  T  +G Y++ ++G HEE IC+V +++SPR+DC E     D++ VL +++AG
Sbjct  68   AVERAIDGVTDESGFYTIKLKGGHEEDICEVILIESPRKDCAEVPAHSDRASVLLAKDAG  127

Query  405  IHSVVRYANPLFFMPAKPDPRCKKVLAD  488
            I   +R+ NPL +    P P C  VL +
Sbjct  128  ISDDMRFPNPLGYFKDVPLPVCGAVLKE  155



>gb|AEW90946.1| pollen-specific protein F8-4 [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AEW90947.1| pollen-specific protein F8-5 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 86/154 (56%), Gaps = 0/154 (0%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA   I  V A +   A AG A       + V+GRVYCD CR  FET ++E +KGA VRL
Sbjct  1    MASLRILSVIAVVAIFALAGTAVANDLPDYIVQGRVYCDTCRAGFETNVTEYIKGAKVRL  60

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CK   TEK   + +  T   G Y + ++  H E IC++ +V+SP  +C E     D++E
Sbjct  61   ECKRFGTEKVERSIDGVTDETGTYKIELKDSHPEDICEMVLVQSPLANCNEIQDLRDRAE  120

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            ++ S N GI   +R ANPL ++  KP P C  +L
Sbjct  121  IVLSRNVGISDNIRMANPLGYLKDKPLPVCPDLL  154



>ref|XP_009773994.1| PREDICTED: olee1-like protein [Nicotiana sylvestris]
Length=173

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 96/165 (58%), Gaps = 7/165 (4%)
 Frame = +3

Query  36   IALVSAAICFLAFAGFAAGKPGEK--FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCK  209
            I L+S+ +C  +  G    +   +  F VEG+VYCD CR  FE ++S+ + GA VRL C+
Sbjct  7    IILISSVVCLFSLIGITQAQAQAQAQFHVEGKVYCDFCRALFENRLSKPMAGAEVRLQCR  66

Query  210  NLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVP----SLDKS  377
            N   +  T T E  T  NG YSL+VE DHE+ IC++ ++KS  EDC E +P    + + +
Sbjct  67   NNTDDSVTLTVEGQTDKNGVYSLLVERDHEDEICEMILMKSSMEDCSE-IPNEGHAKESA  125

Query  378  EVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
             +  + N G+    R+ANPLFF+  +  P C +V  ++  +P ++
Sbjct  126  RITITSNNGMAETTRHANPLFFVKKQAAPECAEVFKELELLPEEI  170



>gb|EPS72638.1| hypothetical protein M569_02120, partial [Genlisea aurea]
Length=161

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 81/160 (51%), Gaps = 6/160 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKP-----GEKFTVEGRVYCDNCRVQFETKISESLKG  185
            MAKA   + S   C LA A      P        F V G VYCD CRVQF T++S  L G
Sbjct  1    MAKAVALVGSLLFCVLAIAAAHKKPPPAAAHNRFFDVVGEVYCDPCRVQFMTELSRRLVG  60

Query  186  AVVRLDCKNLkteketyteevttAA-NGNYSLVVEGDHEEAICDVTVVKSPREDCKETVP  362
            A VRL C                   +G Y L V+GDHE  +C V V+ SPR DC   + 
Sbjct  61   ATVRLQCHRYNDTGCITYSVEGKTGFDGRYRLQVKGDHESDLCFVKVIGSPRADCAVPMT  120

Query  363  SLDKSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             + +S ++C++N GI S VRYANPL FM     PRC  VL
Sbjct  121  DVVESRIVCTKNVGISSPVRYANPLGFMTRAAAPRCLPVL  160



>gb|EYU43331.1| hypothetical protein MIMGU_mgv1a014984mg [Erythranthe guttata]
Length=171

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 94/171 (55%), Gaps = 7/171 (4%)
 Frame = +3

Query  21   MAKAT-IA-LVSAAICFLAFAGFA-AGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAV  191
            MA AT IA L + A+C L+  G A +     KF+VEG VYC+ CR  F  K+S+ + GA 
Sbjct  1    MASATQIAILFAGALCLLSLPGGAQSNAAATKFSVEGDVYCEVCRTNFINKLSQPMAGAT  60

Query  192  VRLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCK----ETV  359
            VRL CK       TY+ E  T   G Y L VEGDH E  C++T+V+S R DC     E  
Sbjct  61   VRLQCKGETEGNITYSLEGITDDKGQYHLTVEGDHGEDECEITLVRSSRPDCNVVPDEGW  120

Query  360  PSLDKSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
             +   S +  ++N+G H   R ANPL F   K DP+C ++  ++   P +L
Sbjct  121  ATKPTSRITLTKNSGFHDNTRKANPLGFTKKKADPQCAQLFKELEINPEEL  171



>ref|XP_009396935.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 88/159 (55%), Gaps = 10/159 (6%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAA-----GKPGEKFTVEGRVYCDNCRVQFETKISESLKG  185
            MA  + A   AA CFL FA   A       P     VEGRVYCD CR  FET  +E + G
Sbjct  1    MANGSHAF--AATCFL-FAFLNAVVCVVSTP--DIVVEGRVYCDTCRAGFETTATEYIAG  55

Query  186  AVVRLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS  365
            A V+L+CKN  T +  +T + TT A G Y + V  DH+E  C VT++ SPR DC E    
Sbjct  56   AKVKLECKNYTTGEIIHTNQATTDATGKYQITVVDDHQEETCQVTLISSPRSDCSEISEG  115

Query  366  LDKSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             + + V+ + N GI S VRYAN L F+  KP   C ++L
Sbjct  116  RNSALVVVTHNVGITSGVRYANSLGFLKEKPLETCGQLL  154



>ref|XP_008359333.1| PREDICTED: olee1-like protein [Malus domestica]
Length=166

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 91/159 (57%), Gaps = 3/159 (2%)
 Frame = +3

Query  21   MAKAT--IALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAKA+   AL     CF + A    G   E   VEG+VYCD CRVQFET++S  L GA V
Sbjct  1    MAKASGIAALFVTLSCFYSLAYATTGADIETLFVEGKVYCDPCRVQFETRLSTPLDGATV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
             L+C++ +     YT E  T  NG YSL  + + EE IC+V  V SP  DC +    ++K
Sbjct  61   ALECRSRENGTMVYTLEGKTDKNGIYSLPADKNFEEQICEVRTVSSPTGDCADHF-DIEK  119

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            + +L + N G+ ++ RYANPL FM  +    C+ VL ++
Sbjct  120  ARILLTHNNGVKAMARYANPLGFMKKESTTECEAVLKEL  158



>ref|XP_008225283.1| PREDICTED: olee1-like protein [Prunus mume]
Length=168

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = +3

Query  27   KATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDC  206
            K++  ++++A+CFL+  GFA     +  +V+G VYCD+CR+QF T+ISE+L+GA V+L+C
Sbjct  4    KSSGIVLASALCFLSLLGFAYC--ADNLSVDGLVYCDSCRIQFMTRISEALQGAKVKLEC  61

Query  207  KNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKE-TVPSLDK--S  377
            ++ +    T + E  T   G Y + VEGDHEE +C+V +VKSPR+DC E +  S  K  +
Sbjct  62   RDREGGTITLSSETETDEQGRYQIPVEGDHEEEVCEVVLVKSPRDDCSEISTDSHAKLSA  121

Query  378  EVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIP  503
             +  + N GI    R  NPL F+  +PD +C +VL ++G  P
Sbjct  122  RISLTNNNGIAGPHRIPNPLGFLKKEPDAQCAEVLKELGLTP  163



>ref|XP_004233077.1| PREDICTED: major pollen allergen Lig v 1-like [Solanum lycopersicum]
Length=175

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 99/168 (59%), Gaps = 8/168 (5%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFA-AGKPGEK--FTVEGRVYCDNCRVQFETKISESLKGAV  191
            M K+TI  +++AIC  +  G   A +  +K  F +EG VYCD CR  F+T +SE +  A 
Sbjct  1    MGKSTIIFIASAICLFSLLGITQANEESDKYQFILEGMVYCDPCRSIFKTNLSEPVVDAR  60

Query  192  VRLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVP---  362
            V + C++ +TE+ T T   +T + G Y +++EGDHE  IC+  ++KSP+EDC E +P   
Sbjct  61   VGMQCRHPETERVTITVTASTNSTGYYHMLIEGDHENEICETYLIKSPKEDCSE-IPTEG  119

Query  363  -SLDKSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIP  503
             + + S V  +   GI    R +NPLFF+  K  P C++   ++ Y+P
Sbjct  120  HTRELSRVTLTSKNGIAGKNRESNPLFFLTKKVAPECQQEFKEMEYLP  167



>gb|ACG33223.1| pollen-specific protein C13 precursor [Zea mays]
Length=167

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 88/154 (57%), Gaps = 0/154 (0%)
 Frame = +3

Query  30   ATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCK  209
            AT   V  ++ F A AG A       + ++GRVYCD CR  F T ++E + GA VRL+CK
Sbjct  6    ATTFAVILSVLFCAAAGTAVDNDLPDYVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECK  65

Query  210  NLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLC  389
            +  T K   + +  T ANG Y++ ++  HEE IC+V +V+SPR+DC +     D++ VL 
Sbjct  66   HFGTGKLERSIDGVTDANGTYTIELKDSHEEDICEVVLVESPRKDCDQVQADRDRAGVLL  125

Query  390  SENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            + N GI   +R ANPL +    P P C  +L  +
Sbjct  126  TRNVGISDNLRPANPLGYFKDVPLPICASLLKQL  159



>gb|ACF82695.1| unknown [Zea mays]
 tpg|DAA38042.1| TPA: pollen-specific protein C13 [Zea mays]
Length=167

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 88/154 (57%), Gaps = 0/154 (0%)
 Frame = +3

Query  30   ATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCK  209
            AT   V  ++ F A AG A       + ++GRVYCD CR  F T ++E + GA VRL+CK
Sbjct  6    ATTFAVILSVLFCAAAGTAVDNDLPDYVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECK  65

Query  210  NLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLC  389
            +  T K   + +  T  NG Y++ ++  HEE IC+V +V+SPR+DC +     D++ VL 
Sbjct  66   HFGTGKLERSIDGVTDGNGTYTIELKDSHEEDICEVVLVESPRKDCDQVQADRDRAGVLL  125

Query  390  SENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            + N GI   +R ANPL ++   P P C  +L  +
Sbjct  126  TRNVGISDNLRPANPLGYLKDVPLPICASLLKQL  159



>ref|NP_174209.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAF88123.1|AC021043_16 Similar to major allergen OLE5c [Arabidopsis thaliana]
 gb|AEE31049.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=171

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 99/172 (58%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++A+CF     F A    +  KF ++G VYCD CRVQF T+IS+ L+GA V
Sbjct  1    MAKFFIVFLASALCFTTLVHFTAADADDFDKFHIKGSVYCDTCRVQFITRISKFLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK  + +  T T+E  T   GNY + V GDHEE +C++ +++SP  +C +       
Sbjct  61   KLECKGRENQTVTLTKEAVTDNAGNYQMEVMGDHEEEVCEIVLLQSPDPECGDVNNQEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S   R  NPL FM   P   C +V  ++G +P D+TF
Sbjct  121  RNAARISLTANDGIVSNETRTINPLGFMRKTPLAECPQVFKELGIVP-DVTF  171



>ref|XP_010057097.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
 gb|KCW74109.1| hypothetical protein EUGRSUZ_E02748 [Eucalyptus grandis]
Length=168

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 101/169 (60%), Gaps = 7/169 (4%)
 Frame = +3

Query  21   MAKATIALV--SAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK+  A++  ++A+ FL+  G   G    +F VEG+VYCD CR QF TK+S+ +  A V
Sbjct  1    MAKSLQAIIFLASALSFLSLLGAVYGD--SRFFVEGKVYCDTCRTQFITKVSKDMPDAKV  58

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETV--PSL  368
            RL+CK+ +    TY+ E  T   G Y L V+G+HEE IC++ +VKS +  C+E    P L
Sbjct  59   RLECKDREGGSVTYSIEGVTDNTGMYRLPVDGEHEEEICEIVLVKSSQPGCEEVSNDPFL  118

Query  369  DKS-EVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
             K+  +  ++N G+ + VR ANPL +M  +  P C  VL ++G   T L
Sbjct  119  RKTARISLTKNNGMATPVRQANPLGYMKNESLPECADVLRELGMTSTGL  167



>gb|KGN49303.1| hypothetical protein Csa_6G519560 [Cucumis sativus]
Length=168

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 97/163 (60%), Gaps = 6/163 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+   ++ +A+CFL+F   A     ++F +EG+VYCD CR+QF T++S+ L GA V+L
Sbjct  1    MAKSCAIILVSALCFLSFLDIALSSK-DRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKL  59

Query  201  DCKNLkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK-  374
             C+                  NG Y + V+GDHEE IC+V+V++S  E+C + +P+    
Sbjct  60   VCREEANAGNETFTGEGVTDKNGVYKIEVDGDHEEEICEVSVLESADEECSD-IPTDGYG  118

Query  375  --SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGY  497
              + V  + N GI + VR ANPL F+     P+CK+VL ++G+
Sbjct  119  HFARVSITGNNGIINPVRQANPLGFLKKDALPQCKEVLRELGF  161



>gb|AEW90948.1| pollen-specific protein F8-6 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 85/154 (55%), Gaps = 0/154 (0%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA   I  V A +   A AG A       + V+GRVYCD CR  FET ++E +KGA VRL
Sbjct  1    MASLRILSVIAVVAIFALAGTAVANDLPDYIVQGRVYCDTCRAGFETNVTEYIKGAKVRL  60

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CK   TEK   + +  T   G Y + ++  H E IC++ +V+SP  +C E     D++E
Sbjct  61   ECKRFGTEKVECSIDGVTDETGTYKIELKDSHPEDICEMVLVQSPLANCNEIQDLRDRAE  120

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            ++ S   GI   +R ANPL ++  KP P C  +L
Sbjct  121  IVLSRYVGISDNIRMANPLGYLKDKPLPVCPDLL  154



>ref|NP_001148343.1| LOC100281953 precursor [Zea mays]
 gb|ACG30892.1| pollen-specific protein C13 precursor [Zea mays]
Length=167

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 87/154 (56%), Gaps = 0/154 (0%)
 Frame = +3

Query  30   ATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCK  209
            AT   V  ++ F A AG A       + ++GRVYCD CR  F T ++E + GA VRL+CK
Sbjct  6    ATTFAVILSVLFCAAAGTAVDNDLPDYVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECK  65

Query  210  NLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLC  389
            +  T K   + +  T  NG Y+  ++  HEE IC+V +V+SPR+DC +     D++ VL 
Sbjct  66   HFGTGKLERSIDGVTDGNGTYTXELKDSHEEDICEVVLVESPRKDCDQVQADRDRAGVLL  125

Query  390  SENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            + N GI   +R ANPL ++   P P C  +L  +
Sbjct  126  TRNVGISDNLRPANPLGYLKDVPLPICASLLKQL  159



>ref|XP_009334049.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 90/159 (57%), Gaps = 3/159 (2%)
 Frame = +3

Query  21   MAKA--TIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAKA    AL     CF + A    G       VEG+VYCD CRVQFET++S  + GA V
Sbjct  1    MAKALGIAALFVILSCFYSLAYATRGAATRTLFVEGKVYCDPCRVQFETRLSTPIDGATV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
             L+C++ +     Y  E  T  NG YSL    + EE IC+V  V+SP ++C +    +++
Sbjct  61   ALECRSRENGTIVYVVEGKTDKNGIYSLATHKEFEEQICEVRTVRSPTDECADHF-DIER  119

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            + +L + N G++++ RYANPL FM  +    C+ VL ++
Sbjct  120  ARILLTHNNGVNALARYANPLGFMKKESTSECEAVLKEL  158



>gb|KHG12773.1| Olee1-like protein [Gossypium arboreum]
Length=187

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 87/156 (56%), Gaps = 5/156 (3%)
 Frame = +3

Query  45   VSAAICFLAFA----GFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKN  212
            + A  CF  F      F  G     + V G VYCD CRV+FETK+SE + GAVV+L+C+N
Sbjct  6    IIAIFCFTIFVSSSLNFVYGAENMTYIVVGHVYCDTCRVEFETKLSEPIGGAVVKLECRN  65

Query  213  LkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLC  389
                + T+  +      +G+Y + VEGD+EE+ CDV +V+SP  DC +       S V+ 
Sbjct  66   RTDNQLTFQSQEIVTDEHGDYHIAVEGDYEESDCDVALVRSPNPDCNDPSEIWRISRVVL  125

Query  390  SENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGY  497
            +   G+   +R+AN L F      P+C +VL +IGY
Sbjct  126  TTLDGVSGELRFANNLGFKKKVALPQCTQVLQEIGY  161



>ref|XP_004134662.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004172168.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
Length=168

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 97/163 (60%), Gaps = 6/163 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+   ++ +A+CFL+F   A     ++F +EG+VYCD CR+QF T++S+ L GA V+L
Sbjct  1    MAKSCAIILVSALCFLSFLDIALSSK-DRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKL  59

Query  201  DCKNLkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK-  374
             C+                  NG Y + V+GDHEE IC+V++++S  E+C + +P+    
Sbjct  60   VCREEANAGNETFTGEGVTDKNGVYKIEVDGDHEEEICEVSLLESADEECSD-IPTDGYG  118

Query  375  --SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGY  497
              + V  + N GI + VR ANPL F+     P+CK+VL ++G+
Sbjct  119  HFARVSITGNNGIINPVRQANPLGFLKKDALPQCKEVLRELGF  161



>ref|XP_006304746.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
 gb|EOA37644.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
Length=171

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 98/172 (57%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++A+CF     F A    +  +F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKFFIVFLASALCFTTLVHFTAADADDFDRFHIKGSVYCDTCRVQFITRLSKFLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK  + +  T T+E  T   GNY + V GDHEE +C++ +++SP  +C E       
Sbjct  61   KLECKGRENQTVTLTKEAVTDKAGNYQMEVMGDHEEEVCEIVLLQSPDAECGEVNNQEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S   R  NPL FM   P   C +   ++G +P D+TF
Sbjct  121  RNAARISLTANDGIVSNETRTINPLGFMRKTPLAECPQAFKELGIVP-DVTF  171



>ref|XP_006434027.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
 gb|ESR47267.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
Length=159

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 90/148 (61%), Gaps = 2/148 (1%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            L+  A+C L  A  +A +P  K F+VEGRVYCD C+  FET  +  + GA V+++CK+ K
Sbjct  5    LLLIALCVLP-ALVSAVRPNTKPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRK  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            + +  Y+ E  T + G Y ++V  DH++ +CD  ++ SP+ DCK   P  ++S V+ +  
Sbjct  64   SMQVVYSREGKTDSTGTYKILVSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSY  123

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             GI S  RYAN + FM A+P   C +VL
Sbjct  124  NGISSETRYANSMGFMKAEPMSGCAEVL  151



>ref|XP_006664913.1| PREDICTED: pollen allergen Phl p 11-like [Oryza brachyantha]
Length=175

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 78/132 (59%), Gaps = 3/132 (2%)
 Frame = +3

Query  90   GKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGN  269
            G PG  FTV GRVYCDNCR  FET +S S+KGA V+++C++ +T++  +  E      G 
Sbjct  32   GPPG--FTVTGRVYCDNCRAGFETNVSHSIKGATVQMECRHFETQEVKHRAEAAANEWGW  89

Query  270  YSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANPLFFM  446
            Y + V G+HE  IC+V +V+SP  +C E     D+S V  + N GI     RYANP+ F 
Sbjct  90   YKMEVGGEHEAEICEVALVRSPEAECAEIERFRDRSRVPLTRNNGIKQDGFRYANPIAFF  149

Query  447  PAKPDPRCKKVL  482
               P P C  +L
Sbjct  150  RKDPPPACGDIL  161



>ref|XP_004134927.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004172170.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN49302.1| hypothetical protein Csa_6G519550 [Cucumis sativus]
Length=168

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 95/163 (58%), Gaps = 6/163 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+   ++ +A+CFL+F   A     ++F +EG+VYCD CR+QF T++S+ L GA V+L
Sbjct  1    MAKSCAIILVSALCFLSFLDIALSSK-DRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKL  59

Query  201  DCKNLkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK-  374
             C+                  NG Y + V+GDHEE IC+V++++S    C E +P+    
Sbjct  60   VCREEANAGNETFTGEGVTDKNGVYKIEVDGDHEEEICEVSLLESADTGCGE-IPTDGYG  118

Query  375  --SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGY  497
              + V  + N GI + VR ANPL FM     P+CK+VL ++G+
Sbjct  119  HFARVSITGNNGIINPVRQANPLGFMKKDALPQCKEVLRELGF  161



>gb|KDO80906.1| hypothetical protein CISIN_1g031458mg [Citrus sinensis]
Length=159

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 90/148 (61%), Gaps = 2/148 (1%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            L+  A+C L  A  +A +P  K F+VEGRVYCD C+  FET  +  + GA V+++CK+ K
Sbjct  5    LLLIALCVLP-ALVSAVRPNPKPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRK  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            + +  Y+ E  T + G Y ++V  DH++ +CD  +V SP+ DCK   P  ++S V+ +  
Sbjct  64   SMQVVYSREGKTDSTGTYKILVSEDHQDQLCDAVLVSSPQNDCKTVAPGRERSRVILTSY  123

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             GI S  RYAN + FM A+P   C +VL
Sbjct  124  NGISSETRYANSMGFMKAEPMSGCAEVL  151



>ref|XP_006472638.1| PREDICTED: pollen-specific protein C13-like [Citrus sinensis]
Length=159

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 90/148 (61%), Gaps = 2/148 (1%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            L+  A+C L  A  +A +P  K F+VEGRVYCD C+  FET  +  + GA V+++CK+ K
Sbjct  5    LLLIALCVLP-ALVSAVRPNPKPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRK  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            + +  Y+ E  T + G Y ++V  DH++ +CD  +V SP+ DCK   P  ++S V+ +  
Sbjct  64   SMQVVYSREGKTDSTGTYKILVSEDHQDQLCDAVLVSSPQNDCKTVAPGRERSRVILTSY  123

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             GI S  RYAN + FM A+P   C +VL
Sbjct  124  NGISSETRYANSMGFMKAEPMSGCAEVL  151



>ref|XP_004960638.1| PREDICTED: pollen allergen Phl p 11-like [Setaria italica]
Length=172

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 83/140 (59%), Gaps = 1/140 (1%)
 Frame = +3

Query  66   LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketytee  245
            +A A  A G+P +   V GRVYCDNCR  FET  S ++ GA V+++C++ +T +     E
Sbjct  20   VASAAPAPGQPHKGLVVTGRVYCDNCRAGFETTASHNIAGATVQMECRHFETMQLHDKAE  79

Query  246  vttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVR  422
             TT A G Y + +  DH+E IC+V ++KSP  DC E     D+S +  + N G+  + VR
Sbjct  80   ATTDAGGWYRMDIGDDHQEEICEVVLLKSPEADCAEIEQFRDRSRIALTRNNGMEQNAVR  139

Query  423  YANPLFFMPAKPDPRCKKVL  482
            YANP+ F   +P   C ++L
Sbjct  140  YANPIAFFRKEPLQNCGEIL  159



>ref|XP_008775180.1| PREDICTED: pollen-specific protein C13-like [Phoenix dactylifera]
Length=168

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 88/150 (59%), Gaps = 5/150 (3%)
 Frame = +3

Query  45   VSAAICFL-AFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkt  221
            V AA+C + A  G A   P   F V GRVYCD CR  F  + +E L+GA VRL+CK+  +
Sbjct  8    VLAALCLISALLGIADTTPTPTFHVRGRVYCDTCRAGFVHEYTEYLEGAKVRLECKHYGS  67

Query  222  eketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLD--KSEVLCS  392
             +  +  E      NGNY + +  DH+E  C+V +V+SPR+DCKE +P+    ++ V+ +
Sbjct  68   GEIAHRSEEAVTDGNGNYVIDITDDHQEETCEVVLVESPRDDCKE-IPADHGIRARVMLT  126

Query  393  ENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             N GI S  R ANP+ F+   P P+C  +L
Sbjct  127  SNNGISSEWREANPIGFLRDAPLPKCGAML  156



>ref|XP_006652233.1| PREDICTED: pollen-specific protein C13-like [Oryza brachyantha]
Length=166

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 83/155 (54%), Gaps = 1/155 (1%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAG-FAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            MA      V   I F   AG  A       + V+GRVYCD CR  FET ++E +KGA VR
Sbjct  1    MASLRTIPVIFGILFYVLAGSTATATDAPDYLVQGRVYCDTCRAGFETNVTEYIKGAKVR  60

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKS  377
            L+CK+  T       +  T   G Y + ++  HEE IC+V +VKSP  +C E     D++
Sbjct  61   LECKHYGTGNIERAVDGVTDETGTYKIELKDSHEEDICEVVLVKSPLANCGEVQAERDRA  120

Query  378  EVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             VL + N GI   +R+ANPL ++   P P C ++L
Sbjct  121  RVLLTRNVGICDNLRFANPLGYLKDIPLPVCGELL  155



>gb|KCW69946.1| hypothetical protein EUGRSUZ_F03264 [Eucalyptus grandis]
Length=167

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 88/159 (55%), Gaps = 3/159 (2%)
 Frame = +3

Query  39   ALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            ALV+ A+C  +  GFA G   EK  V G+V+CD CRV FETK+S  L  + VRL+C N  
Sbjct  9    ALVATALCLSSLLGFAYGH--EKLDVVGKVFCDTCRVDFETKVSYGLADSKVRLECHNRT  66

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVP-SLDKSEVLCSE  395
            +   T + E  T   G Y L VEGDHEE IC+V +++S   +C   +  ++  + V  + 
Sbjct  67   SGALTLSAEAVTDKTGEYRLEVEGDHEEEICEVQLIESSEPECSSLLEGAVHNARVALTN  126

Query  396  NAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
              G+    R+AN L F   +    C +VL ++G +P  L
Sbjct  127  KNGVAQPARFANALAFAKKETLADCAQVLLEMGVLPPGL  165



>emb|CDY43319.1| BnaC03g58910D [Brassica napus]
Length=171

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 100/172 (58%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++A+CF     FAA    +  +F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKFFIVFLASALCFTTLLHFAAADADDLDRFHIKGSVYCDTCRVQFMTRLSKVLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK  + +  T T+E  T   G Y +VV GDHEE +C++ +V+SP  +C E       
Sbjct  61   KLECKGRENQTVTLTKEAVTDKEGKYEMVVMGDHEEEVCEIILVESPDAECGEVNNQEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S  VR  NPL FM   P   C +V  ++G +P D+ F
Sbjct  121  RNAARISLTANDGIVSNEVRTINPLGFMRKTPLADCPQVFKELGIVP-DVIF  171



>ref|XP_008439742.1| PREDICTED: olee1-like protein isoform X1 [Cucumis melo]
 ref|XP_008439744.1| PREDICTED: olee1-like protein isoform X3 [Cucumis melo]
Length=168

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 96/163 (59%), Gaps = 6/163 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+   ++ +A+CFL+F   A     ++F +EG+VYCD CR+QF T++S+ L GA V+L
Sbjct  1    MAKSCAIILVSALCFLSFLDIALSSK-DRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKL  59

Query  201  DCKNLkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK-  374
             C+                  NG Y + V+GDHEE IC+V++++S  ++C   +P+    
Sbjct  60   VCREEANAGNETFTGEAVTDKNGVYKIEVDGDHEEEICEVSLLESADKECS-GIPTDGYG  118

Query  375  --SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGY  497
              + V  + N GI + VR ANPL F+     P+CK+VL ++G+
Sbjct  119  HFARVSITGNNGITNPVRQANPLGFLRKDALPQCKEVLRELGF  161



>ref|XP_010529196.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=173

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 98/171 (57%), Gaps = 8/171 (5%)
 Frame = +3

Query  27   KATIALVSAAICFLAFAGFAAGKPG---EKFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            KA   L+++A+C    AGFAA       ++F ++G VYCD CRVQF T++S+ L+GA VR
Sbjct  4    KAIALLMASAVCLSYVAGFAAAADADDLDRFQIQGSVYCDTCRVQFITRLSKFLQGAKVR  63

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---  368
            L+CKN      T ++E  T  +G++ + V GDHEE +C++ +V+SP +DC E        
Sbjct  64   LECKNRVNGTLTVSKEAVTDESGSFLMEVTGDHEEEVCEIVLVESPDKDCSEVSKEAFLR  123

Query  369  DKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
            + +++  + N GI S   R  NPL FM   P   C     ++G  P D+ F
Sbjct  124  NAAKISLTANDGIVSNETRIVNPLGFMVKTPSTECPAAFKELGIKP-DVIF  173



>ref|XP_009342278.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 89/159 (56%), Gaps = 3/159 (2%)
 Frame = +3

Query  21   MAKA--TIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAKA    AL     CF + A    G       VEG+VYCD CRVQFET++S  + GA V
Sbjct  1    MAKALGIAALFVTLSCFYSLAYATRGAATRTLFVEGKVYCDPCRVQFETRLSTPIDGATV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
             L+C++ +     Y  E  T  NG YSL    + EE IC+V  V+S  ++C +    +++
Sbjct  61   ALECRSRENGTIVYVVEGKTDKNGIYSLATHKEFEEQICEVRTVRSSTDECADHF-DIER  119

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            + +L + N G++++ RYANPL FM  +    C+ VL ++
Sbjct  120  ARILLTHNNGVNALARYANPLGFMKKESTSECEAVLKEL  158



>ref|XP_009109686.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX90169.1| BnaA08g18150D [Brassica napus]
Length=171

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 101/172 (59%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++A+CF     FAA    +  +F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKFFIVFLASALCFTTLLHFAAADADDLDRFHIKGSVYCDTCRVQFMTRLSKVLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK  + +  T T+E  T  +G Y +VV GDHEE +C++ +V+SP  +C E       
Sbjct  61   KLECKARENQTVTLTKEAVTDKDGKYEMVVMGDHEEEVCEIILVESPDAECGEVNNQEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S  VR  NPL FM   P   C +V  ++G +P D+ F
Sbjct  121  RNAARISLTANDGIVSNEVRTINPLGFMRKTPLADCPQVFKELGIVP-DVIF  171



>gb|EPS70684.1| hypothetical protein M569_04073 [Genlisea aurea]
Length=170

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 91/164 (55%), Gaps = 7/164 (4%)
 Frame = +3

Query  36   IALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
            +A+ + A+   A    A     E F V+G+V+C+ CR  F  ++SE ++GA VRL+C+  
Sbjct  8    VAIFAGALILFALGDTAVATDPE-FFVQGQVFCEVCRTNFINRLSEPMEGATVRLECRGD  66

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS-----LDKSE  380
                 T+  E  T A GNY L   GDHE+  C VT+VKS R DC+ET PS        S+
Sbjct  67   NVGNITFGIEGVTDAGGNYKLKATGDHEDEDCQVTLVKSSRLDCQET-PSEGWAMQPSSK  125

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            +  ++N G H  +R+ANPL F   + DP C+++  ++   P  L
Sbjct  126  ITITKNNGFHDDIRHANPLGFTKKERDPACQELFKELQINPDSL  169



>gb|EAY93952.1| hypothetical protein OsI_15725 [Oryza sativa Indica Group]
Length=165

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 81/154 (53%), Gaps = 0/154 (0%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA      V   I F   A  A       + V+GRVYCD CR  FET ++E +KGA VRL
Sbjct  1    MASLRTIPVIFGILFYVLASTATATDAPDYVVQGRVYCDTCRAGFETNVTEYIKGAKVRL  60

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CK+  T+K     +  T   G Y + ++  HEE IC+V +V SP  +C E     D++ 
Sbjct  61   ECKHFGTDKVERAIDGVTDETGTYKIELKDSHEEDICEVVLVHSPLANCSEIEAERDRAR  120

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            VL + N GI   +R ANPL ++   P P C  +L
Sbjct  121  VLLTRNVGICDNLRLANPLGYLKDIPLPVCGALL  154



>sp|Q8LGR0.1|CHE1_CHEAL RecName: Full=Pollen allergen Che a 1; AltName: Allergen=Che 
a 1; Flags: Precursor [Chenopodium album]
 gb|AAL07319.1| Che a 1 allergen precursor [Chenopodium album]
Length=168

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 93/161 (58%), Gaps = 5/161 (3%)
 Frame = +3

Query  21   MAK-ATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            MAK   + L+  A+C L+ AG A       F V+G VYCD CR+QF T+IS  ++GA V+
Sbjct  1    MAKCQAVFLLVGALCVLSLAGVANAAENH-FKVQGMVYCDTCRIQFMTRISTIMEGATVK  59

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKET---VPSL  368
            L+C+N+    +T+  E  T   G YS+ V GD E+ IC++ +VKSP  +C E    V + 
Sbjct  60   LECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAK  119

Query  369  DKSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
              ++V  + N G  S +R AN L FM  +P   C +VL ++
Sbjct  120  QSAKVSLTSNNGEASDIRSANALGFMRKEPLKECPEVLKEL  160



>emb|CAH66537.1| H0209H04.4 [Oryza sativa Indica Group]
 gb|AFI71825.1| pollen specific protein [Oryza sativa]
Length=165

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 81/154 (53%), Gaps = 0/154 (0%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA      V   I F   A  A       + V+GRVYCD CR  FET ++E +KGA VRL
Sbjct  1    MASLRTIPVIFGILFYVLASTATATDAPDYVVQGRVYCDTCRAGFETNVTEYIKGAKVRL  60

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CK+  T+K     +  T   G Y + ++  HEE IC+V +V SP  +C E     D++ 
Sbjct  61   ECKHFGTDKVERAIDGVTDETGTYKIELKDSHEEDICEVVLVHSPLANCSEIEAERDRAR  120

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            VL + N GI   +R ANPL ++   P P C  +L
Sbjct  121  VLLTRNVGICDNLRLANPLGYLKDIPLPVCGALL  154



>ref|XP_010481521.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 94/165 (57%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             + +A+C  + A FAA    E  +F ++G VYCD CRVQF T++S+ L+GA V+L+C+N 
Sbjct  11   FIVSALCLSSLACFAAADADEFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRNR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T  +G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     +IG +P D+TF
Sbjct  131  LTANDGIVSHETRIVNPLGFMVKTPSADCAAAFKEIGIVP-DVTF  174



>ref|NP_001052674.1| Os04g0398700 [Oryza sativa Japonica Group]
 emb|CAE05158.2| OSJNBa0039C07.14 [Oryza sativa Japonica Group]
 dbj|BAF14588.1| Os04g0398700 [Oryza sativa Japonica Group]
 gb|EAZ30594.1| hypothetical protein OsJ_14643 [Oryza sativa Japonica Group]
Length=165

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 81/154 (53%), Gaps = 0/154 (0%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA      V   I F   A  A       + V+GRVYCD CR  FET ++E +KGA VRL
Sbjct  1    MASLRTIPVIFGILFYVLASTATATDAPDYVVQGRVYCDTCRAGFETNVTEYIKGAKVRL  60

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CK+  T+K     +  T   G Y + ++  HEE IC+V +V SP  +C E     D++ 
Sbjct  61   ECKHFGTDKVERAIDGVTDETGTYKIELKDSHEEDICEVVLVHSPLANCSEIEAERDRAR  120

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            VL + N GI   +R ANPL ++   P P C  +L
Sbjct  121  VLLTRNVGICDNLRLANPLGYLKDIPLPICGALL  154



>ref|XP_010062811.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
Length=196

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 88/159 (55%), Gaps = 3/159 (2%)
 Frame = +3

Query  39   ALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            ALV+ A+C  +  GFA G   EK  V G+V+CD CRV FETK+S  L  + VRL+C N  
Sbjct  38   ALVATALCLSSLLGFAYGH--EKLDVVGKVFCDTCRVDFETKVSYGLADSKVRLECHNRT  95

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVP-SLDKSEVLCSE  395
            +   T + E  T   G Y L VEGDHEE IC+V +++S   +C   +  ++  + V  + 
Sbjct  96   SGALTLSAEAVTDKTGEYRLEVEGDHEEEICEVQLIESSEPECSSLLEGAVHNARVALTN  155

Query  396  NAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
              G+    R+AN L F   +    C +VL ++G +P  L
Sbjct  156  KNGVAQPARFANALAFAKKETLADCAQVLLEMGVLPPGL  194



>gb|AFW77548.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 80/130 (62%), Gaps = 1/130 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P   F V GRVYCDNCR  FET +S +++GA V ++C++ ++++     E TT A G Y 
Sbjct  23   PSPGFVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYR  82

Query  276  LVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANPLFFMPA  452
            + + GDH++ IC+V ++KSP  DC E   + D+  V  + N GI  S +RYANP+ F   
Sbjct  83   MEISGDHQDEICEVLLLKSPEADCAEIERTRDRCRVPLTRNDGIRQSGIRYANPIAFFRK  142

Query  453  KPDPRCKKVL  482
            +P   C ++L
Sbjct  143  EPLSNCGELL  152



>ref|XP_011085997.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=170

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 90/166 (54%), Gaps = 7/166 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            + +  + L +  +C L   G A     E F V G VYC+ CR+ F  K+SE + GA V+L
Sbjct  4    LKRIEVFLFAGVLCLLCLPGVARATAPEFFVV-GEVYCEVCRLNFINKLSEPMPGAKVKL  62

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVP-----S  365
            +CK  +    TYT+E  T   G Y L VEGDHEE  C +T+VKS R DC E +P     S
Sbjct  63   ECKGEEAGNITYTQEGETNEGGQYRLKVEGDHEEEECGITLVKSSRADCNE-IPDEGWAS  121

Query  366  LDKSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIP  503
               S +  ++N G H   RYANPL F   K +P C +++ ++   P
Sbjct  122  KPSSLITLTKNNGFHGSSRYANPLGFTKKKANPECAELIKELEINP  167



>ref|XP_002440811.1| hypothetical protein SORBIDRAFT_09g007260 [Sorghum bicolor]
 gb|EES19241.1| hypothetical protein SORBIDRAFT_09g007260 [Sorghum bicolor]
Length=169

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = +3

Query  120  GRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSLVVEGDHE  299
            GR+YCDNCR  FET IS +++GA V ++C++ ++++     + TT A G Y + + GDH+
Sbjct  35   GRIYCDNCRAGFETNISHAIQGATVEMECRHFESQQIHDKAQATTDAGGWYKMEIAGDHQ  94

Query  300  EAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANPLFFMPAKPDPRCKK  476
            + ICDV ++KSP  DC E   + D+  V  + N GI  S VRYANP+ F    P P C +
Sbjct  95   DEICDVRLLKSPEADCAEIEVNRDRCRVPLTGNDGIKQSGVRYANPIAFFRKDPLPNCGE  154

Query  477  VL  482
            +L
Sbjct  155  LL  156



>ref|XP_002447728.1| hypothetical protein SORBIDRAFT_06g014740 [Sorghum bicolor]
 gb|EES12056.1| hypothetical protein SORBIDRAFT_06g014740 [Sorghum bicolor]
Length=173

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 77/128 (60%), Gaps = 0/128 (0%)
 Frame = +3

Query  108  FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSLVVE  287
            + ++GRVYCD CR  F T ++E + GA VRL+CK+  T +     +  T A G Y++ ++
Sbjct  38   YVIQGRVYCDTCRAGFVTNVTEYMAGAKVRLECKHFGTGEVERAIDGVTDATGTYTIELK  97

Query  288  GDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFFMPAKPDPR  467
              HEE IC V +V+SPR+DC +T P  D++ VL + N GI   +R ANPL +    P P 
Sbjct  98   DSHEEDICQVVLVQSPRKDCDQTQPLRDRAGVLLTRNVGIADSLRPANPLGYFKDVPLPV  157

Query  468  CKKVLADI  491
            C  +L  +
Sbjct  158  CAALLKQL  165



>emb|CDX99789.1| BnaC05g22110D [Brassica napus]
Length=171

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 97/172 (56%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++A+CF       A    +  +F + G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKFFIVFLASALCFTTLLHLVAADADDFDRFNITGSVYCDTCRVQFVTRLSKFLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK+   +  T T+E  T  +G Y + V GDHEE +C++ +V+SP  +C E       
Sbjct  61   KLECKSRVNQTVTLTKEAVTDKDGKYQMEVMGDHEEELCEIILVQSPDAECGEVNNEEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S  +R  NPL FM   P   C +V  ++G +P D+ F
Sbjct  121  RNAARISLTANDGIVSNEIRTINPLGFMRKTPLADCPQVFKELGIVP-DVIF  171



>ref|XP_008439743.1| PREDICTED: olee1-like protein isoform X2 [Cucumis melo]
Length=168

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 95/163 (58%), Gaps = 6/163 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK+   ++ +A+CFL+F   A     ++F +EG+VYCD CR+QF T++S+ L GA V+L
Sbjct  1    MAKSCAIILVSALCFLSFLDIALSSK-DRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKL  59

Query  201  DCKNLkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK-  374
             C+                  NG Y + V+GDHEE IC+V++++S  + C E +P+    
Sbjct  60   VCREEANAGNETFTGEAVTDKNGVYKIEVDGDHEEEICEVSLLESGDKGCGE-IPTDGYG  118

Query  375  --SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGY  497
              + V  + N GI   VR ANPL F   +  P+CK+VL ++G+
Sbjct  119  HFARVSITGNNGIIDPVRQANPLGFKKKEALPQCKEVLRELGF  161



>gb|KHG18492.1| Anther-specific LAT52 [Gossypium arboreum]
Length=163

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 88/158 (56%), Gaps = 17/158 (11%)
 Frame = +3

Query  30   ATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLD  203
            + IAL+   IC  +   +A G   E  ++ V G VYCD CRV+FETK+SE L GA+    
Sbjct  5    SIIALLCFTICVSSSLNYAYGAAEENMQYMVVGHVYCDTCRVEFETKLSEPLGGAISPEI  64

Query  204  CKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEV  383
              N               ++G+Y ++VEGD+EE+ CDV +V+SPR DC +   +  KS V
Sbjct  65   VAN---------------SHGDYHIIVEGDYEESDCDVALVRSPRVDCSDPTEAWRKSRV  109

Query  384  LCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGY  497
            + +   G+   +R+AN L F      P+C ++L ++GY
Sbjct  110  VLTTLDGLSGKLRFANNLGFKKDVTLPQCTRILQEMGY  147



>ref|XP_007149397.1| hypothetical protein PHAVU_005G066800g [Phaseolus vulgaris]
 gb|ESW21391.1| hypothetical protein PHAVU_005G066800g [Phaseolus vulgaris]
Length=162

 Score =   103 bits (258),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 91/156 (58%), Gaps = 6/156 (4%)
 Frame = +3

Query  30   ATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCK  209
            A +AL  +A+CF   +   A K  EKF VEG++YCD C+  FE+++S +L G  V L C 
Sbjct  6    AVVALFVSAVCF---SSALARKSPEKFFVEGKIYCDPCQFAFESRLSFALSGVNVTLKCI  62

Query  210  NLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPRE-DCKETVPSLDKSEVL  386
              + +  +Y +  TT ANG YS+ V GDHEE IC V V   P E  CKE +P+     ++
Sbjct  63   KEENDIVSYQKNSTTDANGMYSIPVHGDHEEEIC-VVVADPPNEGQCKEAMPN-KSDRII  120

Query  387  CSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIG  494
             ++N G  S+ RY NPL FM    D +C  V+ ++G
Sbjct  121  LTKNMGAASMTRYVNPLGFMTQTTDSQCFAVVQELG  156



>ref|XP_003566418.1| PREDICTED: major pollen allergen Lol p 11-like [Brachypodium 
distachyon]
Length=169

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 80/131 (61%), Gaps = 3/131 (2%)
 Frame = +3

Query  93   KPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNY  272
            KPG  F V GRVYCD CR  FET  S S+ GAVV+++C++ +T +  +  E TT A G Y
Sbjct  28   KPG--FLVTGRVYCDTCRAGFETNASHSIPGAVVQMECRHFETNELHHKAEATTDAQGWY  85

Query  273  SLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANPLFFMP  449
             + V  DH+E IC+V +++SP +DC E   S D+  V  + N GI  S VRYANP+ F  
Sbjct  86   KMEVGEDHQEEICEVALLRSPEKDCAEIEKSRDRCRVPLTRNNGIKQSGVRYANPIAFFR  145

Query  450  AKPDPRCKKVL  482
             +P   C  VL
Sbjct  146  KEPLANCGDVL  156



>ref|XP_010460686.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 99/172 (58%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++AICF  L     A     ++F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKFFIVFLASAICFTTLVHFAAADADDFDRFHIKGSVYCDTCRVQFMTRLSKFLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK  + +  T T+E  T + GNY + V GDHEE +C++ +V+SP  +C E       
Sbjct  61   KLECKGRENQTVTLTKEAVTDSAGNYQMEVMGDHEEELCEIVLVQSPDPECGEVNNQEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S   R  NPL FM   P   C +   ++G +P D+TF
Sbjct  121  RNAARISLTANDGIVSNETRTINPLGFMRKTPLADCPQAFKELGIVP-DVTF  171



>dbj|BAK06698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 87/156 (56%), Gaps = 2/156 (1%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MA   I  V A +   A A  A     +   + V+GRVYCD CR  FET ++E +KGA V
Sbjct  1    MASLRILSVIAVVAIFALADTAVANDRDLPDYIVQGRVYCDTCRAGFETNVTEYIKGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
            RL+C+   T+K   + +  T  +G Y + ++  H E IC++ +V+SP  +C E     ++
Sbjct  61   RLECRRFGTDKLERSIDGVTDESGTYKIELKDSHPEDICEMVLVQSPLPNCNEIQALRNR  120

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            +E++ S N GI   +R ANPL ++  KP P C  +L
Sbjct  121  AEIVLSRNVGISDNIRLANPLGYLKDKPLPVCPDLL  156



>ref|XP_010478273.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 99/172 (58%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++AICF  L     A     ++F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKFFIVFLASAICFTTLVHFAAADADDFDRFHIKGSVYCDTCRVQFMTRLSKFLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK  + +  T T+E  T + GNY + V GDHEE +C++ +V+SP  +C E       
Sbjct  61   KLECKGRENQTVTLTKEAVTDSAGNYEMEVMGDHEEELCEIVLVQSPDPECGEVNNQEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S   R  NPL FM   P   C +   ++G +P D+TF
Sbjct  121  RNAARISLTANDGIVSNETRTINPLGFMRKTPLADCPQAFKELGIVP-DVTF  171



>ref|NP_001150330.1| pollen allergen Phl p 11 precursor [Zea mays]
 gb|ACG38668.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 80/130 (62%), Gaps = 1/130 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P   F V GRVYCDNCR  FET +S +++GA V ++C++ ++++     E TT A G Y 
Sbjct  23   PSPGFVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYR  82

Query  276  LVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANPLFFMPA  452
            + + GDH++ IC+V ++KSP  DC E   + ++  V  + N GI  S +RYANP+ F   
Sbjct  83   MEISGDHQDEICEVLLLKSPEADCAEIERTRERCRVPLTRNDGIRQSGIRYANPIAFFRK  142

Query  453  KPDPRCKKVL  482
            +P   C ++L
Sbjct  143  EPLSNCGELL  152



>ref|XP_010434511.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 96/171 (56%), Gaps = 7/171 (4%)
 Frame = +3

Query  24   AKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            +KA      +A+C  + AG A     +  +F ++G VYCD CRVQF T++S+ L+GA V+
Sbjct  3    SKAIFFFFVSAVCLSSLAGVAIADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVK  62

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---  368
            L+C++      T T+E  T  +G+Y + V GDHEE +C++ +V+SP  +C +        
Sbjct  63   LECRSRVNGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVESPNSECSDVSKEAYLR  122

Query  369  DKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
            + +++  + N GI S   R  NPL FM   P   C     +IG +P D+TF
Sbjct  123  NAAKISLTANDGIVSHETRIVNPLGFMVKTPSAECPAAFKEIGIVP-DVTF  172



>ref|XP_010499433.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 100/172 (58%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++AICF     FAA    +  +F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKFFIVFLASAICFTTLVNFAAADADDFDRFHIKGSVYCDTCRVQFMTRLSKFLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK  + +  T T+E  T + GNY + V GDHEE +C++ +V+SP  +C E       
Sbjct  61   KLECKGRENQTVTLTKEAVTDSAGNYQMEVMGDHEEELCEIVLVQSPDPECGEVNNQEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S   R  NPL FM   P   C +   ++G +P D+TF
Sbjct  121  RNAARISLTANDGIVSNETRTINPLGFMRKTPLADCPQAFKELGIVP-DVTF  171



>ref|XP_009115274.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=171

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 93/167 (56%), Gaps = 6/167 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++A+CF       A    +  +F + G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKFFIVFLASALCFTTLLHLVAADADDFDRFNITGSVYCDTCRVQFVTRLSKFLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK+   +  T T+E  T  +G Y + V GDHEE +C+  +V+SP  +C E       
Sbjct  61   KLECKSRVNQTVTLTKEAVTDKDGKYQMEVMGDHEEELCEFILVQSPDAECGEVNNEEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIP  503
             + + +  + N GI S  +R  NPL FM   P   C +V  ++G +P
Sbjct  121  RNAARISLTANDGIVSNEIRTINPLGFMRKTPLADCPQVFKELGIVP  167



>emb|CDY69202.1| BnaCnng62360D [Brassica napus]
Length=171

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 99/172 (58%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++A+CF  L     A     ++F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKLVIFFLASALCFTTLLHFAAADADDFDRFHIKGSVYCDTCRVQFMTRLSKVLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK  + +  T T+E  T  +GNY + V GDHEE +C++ +V+SP  +C +       
Sbjct  61   KLECKGRENQTVTLTKEAMTDKDGNYEMEVMGDHEEEVCEIILVQSPDAECGDVNNQEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S   R  NPL FM   P   C +   ++G +P D+TF
Sbjct  121  RNAARISLTANDGIVSNETRTINPLGFMRKTPLADCPQAFKELGIVP-DVTF  171



>gb|AAX93750.1| pollen allergen Cro s 1 [Crocus sativus]
Length=168

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 89/153 (58%), Gaps = 4/153 (3%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkt  221
            L+  A+C L+ AG A       F V+G VYCD CR+QF T++S  ++GA V+L+C+N+  
Sbjct  9    LLVGALCVLSLAGVANAAENH-FKVQGMVYCDTCRIQFMTRVSTIMEGATVKLECRNITA  67

Query  222  eketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKET---VPSLDKSEVLCS  392
              +T+  E  T   G YS+ V GD ++ IC++ +VKSP  +C E    V +   ++V  +
Sbjct  68   GTQTFKAEAVTDKVGQYSIPVHGDFQDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLT  127

Query  393  ENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
             N G  S +R AN L FM  +P   C +VL ++
Sbjct  128  SNNGEASDIRSANALGFMRKEPLKECPEVLKEL  160



>gb|KFK31513.1| hypothetical protein AALP_AA6G122400 [Arabis alpina]
Length=173

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 94/165 (57%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             V +A+C  + AGFA+    +  +F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  10   FVVSAVCLSSLAGFASADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSR  69

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T   G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  70   TNGTITLTKEAVTDKTGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSQEAYLRNAAKIS  129

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  130  LTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP-DVTF  173



>ref|XP_010439832.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 96/171 (56%), Gaps = 7/171 (4%)
 Frame = +3

Query  24   AKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            +KA      +A+C  + AG A     +  +F ++G VYCD CRVQF T++S+ L+GA V+
Sbjct  3    SKAIFFFFVSAVCLSSLAGVAIADADDFDRFQIQGSVYCDTCRVQFITRLSKFLEGAKVK  62

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---  368
            L+C++      T T+E  T  +G+Y + V GDHEE +C++ +V+SP  +C +        
Sbjct  63   LECRSRVNGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVESPDSECSDVSKEAYLR  122

Query  369  DKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
            + +++  + N GI S   R  NPL FM   P   C     +IG +P D+TF
Sbjct  123  NAAKISLTANDGIVSHETRIVNPLGFMVKTPSAECPAAFKEIGIVP-DVTF  172



>ref|XP_002307393.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK95954.1| unknown [Populus trichocarpa]
 gb|EEE94389.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = +3

Query  87   AGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAAN  263
            A +P    F V+G VYCD C   FET  + ++ GA VRL+CK+ KT+   Y++E TT + 
Sbjct  19   AARPARNPFVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDST  78

Query  264  GNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFF  443
            G Y++ V+ DHE+ ICD  +V SPR+DC+      D++ V+ + + G+ S  RYAN + F
Sbjct  79   GKYTITVDEDHEDQICDCMLVSSPRKDCRSPSAGRDRARVILTNDNGLVSTTRYANAMGF  138

Query  444  MPAKPDPRCKKVL  482
            M A+P   C ++L
Sbjct  139  MAAQPMSGCTELL  151



>ref|XP_009102877.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY15649.1| BnaA07g08200D [Brassica napus]
Length=171

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 99/172 (58%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++A+CF  L     A     ++F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKFVIFFLASALCFTTLLHFAAADADDFDRFHIKGSVYCDTCRVQFMTRLSKVLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK  + +  T T+E  T  +GNY + V GDHEE +C++ +V+SP  +C +       
Sbjct  61   KLECKGRENQTVTLTKEAMTDKDGNYEMEVMGDHEEEVCEIILVQSPDAECGDVNNQEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S   R  NPL FM   P   C +   ++G +P D+TF
Sbjct  121  RNAARISLTANDGIVSNETRTINPLGFMRKTPLADCPQAFKELGIVP-DVTF  171



>ref|XP_010518802.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=172

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 98/171 (57%), Gaps = 7/171 (4%)
 Frame = +3

Query  24   AKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            +K  + L+++AIC     GFAA    +  +F ++G VYCD CRVQF T++S+ L+GA VR
Sbjct  3    SKGMVLLMASAICVSYVVGFAAADADDLDRFQIQGSVYCDTCRVQFITRLSKFLQGAKVR  62

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---  368
            L+CKN  T   T ++E  T   G++ + V GDHEE +C++ +V+SP ++C +        
Sbjct  63   LECKNRVTGALTVSKEAVTDDTGSFLMQVTGDHEEEVCEIMLVESPDQECSDVSKDAYLR  122

Query  369  DKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
            + ++V  + N GI S   R  NPL FM   P   C     ++G  P D+ F
Sbjct  123  NAAKVSLTANDGIVSNETRIVNPLGFMVKTPSADCPAAFQELGITP-DVIF  172



>gb|ABC86745.1| pollen-specific protein [Vitis pseudoreticulata]
Length=159

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 86/148 (58%), Gaps = 2/148 (1%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKP-GEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            ++  A+C L  A  +AG+P  + F ++GRVYCD CR  FET  +  + GA VR++CK+  
Sbjct  5    MLLVALCVLP-ALVSAGRPVSQPFVLQGRVYCDTCRAGFETSATTYIAGAKVRVECKDRN  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            + +  Y+ E  T + G Y ++V  DHE+ +CD  +V SP+ DC    P  D++ V+ +  
Sbjct  64   SMQLLYSIEGITDSTGTYKIMVTEDHEDQLCDAVLVSSPQSDCASVDPGRDRAAVILTRY  123

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             GI S  RYAN + F+   P   C ++L
Sbjct  124  NGIVSDNRYANSMGFLKDHPMSECTQLL  151



>ref|XP_006284941.1| hypothetical protein CARUB_v10006240mg [Capsella rubella]
 gb|EOA17839.1| hypothetical protein CARUB_v10006240mg [Capsella rubella]
Length=172

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 96/171 (56%), Gaps = 7/171 (4%)
 Frame = +3

Query  24   AKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            +KA      +A+C  + AG A     +  +F ++G VYCD CRVQF T++S+ L+GA V+
Sbjct  3    SKAIFFFFVSAVCLSSLAGVAIADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVK  62

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---  368
            L+C++      T TEE  T  +G+Y + V GDHEE +C++ +++SP  DC +        
Sbjct  63   LECRSRVNGTVTLTEEAVTDKSGSYKMEVAGDHEEEVCELVLLESPDSDCSDVSKEAYLH  122

Query  369  DKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
            + +++  + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  123  NAAKISLTANDGIVSHETRIVNPLGFMVKTPSAECPAAFKELGIVP-DVTF  172



>ref|XP_009402012.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = +3

Query  105  KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSLVV  284
            KF +EGRVYCD CR  F+T +S+ + GA V+L C+N +T+   +  E  T + G Y + V
Sbjct  26   KFVIEGRVYCDTCRAGFQTAVSQYIAGAKVKLQCRNYETDAVEHLVEAVTDSTGTYHIEV  85

Query  285  EGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFFMPAKP  458
            E  HEE IC+V++++SP+  C E   S +++ +L +  +G+ S +RYAN L F+  +P
Sbjct  86   EDSHEEEICEVSLLQSPQPGCTEVAQSRNRARILVTGRSGLASDIRYANSLGFLKDEP  143



>ref|XP_010686203.1| PREDICTED: pollen allergen Che a 1 [Beta vulgaris subsp. vulgaris]
Length=169

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 90/156 (58%), Gaps = 4/156 (3%)
 Frame = +3

Query  33   TIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKN  212
            TI L++  +  L+ AG A       F V+G VYCD CR+QF T++S  ++GA VRL+C+N
Sbjct  6    TIFLLAGVLSVLSLAGVAYAATNH-FKVQGMVYCDTCRIQFITRVSTMMEGATVRLECRN  64

Query  213  LkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKET---VPSLDKSEV  383
            +    ET+  E  T   G YS+ V+GD+E+ IC++ + KS   +C +    V +   ++V
Sbjct  65   ITAGTETFKSEAITDKLGMYSINVDGDYEDDICEIVLAKSSNNECTDISHDVYAKQAAKV  124

Query  384  LCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
              + N G  S VR AN L FM   P P C +VL ++
Sbjct  125  SLTSNNGESSDVRSANALGFMRKTPLPECPEVLKEL  160



>ref|XP_010496255.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score =   101 bits (252),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 96/171 (56%), Gaps = 7/171 (4%)
 Frame = +3

Query  24   AKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            +KA    + +A+C  + A  A     +  +F ++G VYCD CRVQF T++S+ L+GA V+
Sbjct  3    SKAIFFFLVSAVCLSSLASVAVADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVK  62

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---  368
            L+C++      T T+E  T  +G+Y + V GDHEE +C++ +V+SP  +C +        
Sbjct  63   LECRSRVNGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVESPDSECSDVSKEAYLR  122

Query  369  DKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
            + +++  + N GI S   R  NPL FM   P   C     +IG +P D+TF
Sbjct  123  NAAKISLTANDGIVSHETRIVNPLGFMVKTPSAECPAAFKEIGIVP-DVTF  172



>ref|XP_008363638.1| PREDICTED: olee1-like protein [Malus domestica]
Length=163

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 89/159 (56%), Gaps = 6/159 (4%)
 Frame = +3

Query  21   MAKA--TIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAKA    AL     CF + A   A +      VEG+VYCD CRVQFET++S  + GA V
Sbjct  1    MAKALGIAALFITLSCFYSLASTVATRT---LFVEGKVYCDPCRVQFETRLSTPVDGATV  57

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK  374
             L+C++ +     Y  E  T  NG YSL      EE IC+V  V+SP + C +     ++
Sbjct  58   ALECRSRENGTIVYVVEGKTDKNGIYSLASHKXFEEQICEVRTVRSPTDQCADHF-DFER  116

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            + +L ++N G++++ RYANPL FM  +    C+ VL ++
Sbjct  117  ARILLTDNNGVNALARYANPLGFMTKESTYECEAVLKEL  155



>ref|XP_009114385.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=174

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 92/165 (56%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             V + +C  + AGF+A    +  +F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  11   FVVSVVCLSSLAGFSAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                   T+E  T   G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTLALTKEAVTDKTGSYMMEVTGDHEEEVCELVLVQSPDSGCSDVSEEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  131  LTANDGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVP-DVTF  174



>ref|XP_011079002.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=165

 Score =   101 bits (251),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 85/156 (54%), Gaps = 1/156 (1%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkt  221
            +++AA CFL+    A      KF V+G+VYC+ CR  F  + SE + GA V+L+CKN  T
Sbjct  10   ILAAAFCFLSLVDVADSH-APKFIVDGKVYCEVCRANFTNRYSEPMAGAKVKLECKNEVT  68

Query  222  eketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENA  401
            E  TYT E  T   G Y+L  EGDH E +C VT++KS   DC E       +EV  + N 
Sbjct  69   ESVTYTLEGETNEKGVYTLTAEGDHGEDLCAVTLLKSSMADCAEVPDEKPAAEVTLTLNN  128

Query  402  GIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
            G H   R+ANPL F   +  P C ++  ++     D
Sbjct  129  GFHDEFRHANPLTFTRKEALPECAELFKELEEAKKD  164



>ref|XP_010538209.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=170

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 97/172 (56%), Gaps = 8/172 (5%)
 Frame = +3

Query  21   MAKATIALVSAAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++A+C   L     A     + F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKV-IFFLASALCLATLVNFAAADADDFDTFHIKGSVYCDTCRVQFITRLSKFLEGAKV  59

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CKN   +  T  EE  T  +GNY +VV GDHEE +C++ +V+SP  +C+E       
Sbjct  60   KLECKNRVNQTVTLVEEAVTDKSGNYEMVVTGDHEEEVCEIVLVESPEAECREINNEEFL  119

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S   R  NPL FM   P P C K   ++  +P D+ F
Sbjct  120  RNAARISLTANDGIVSNETRTVNPLGFMRNTPLPDCPKAFKELDIVP-DVIF  170



>emb|CAA78897.1| pollen specific gene [Oryza sativa Indica Group]
Length=164

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 77/142 (54%), Gaps = 0/142 (0%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA      V   I F   A  A       + V+GRVYCD CR +FET ++E +KGA VRL
Sbjct  1    MASLRTIPVIFGILFYVLASTATATDAPDYVVQGRVYCDTCRAEFETNVTEYIKGAKVRL  60

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CK+  T+K     +  T   G Y + ++  HEE IC+V +V SP  +C E     D++ 
Sbjct  61   ECKHFGTDKVERAIDGVTDETGTYKIELKDSHEEDICEVVLVHSPLANCSEIEAERDRAR  120

Query  381  VLCSENAGIHSVVRYANPLFFM  446
            VL + N GI   +R ANPL ++
Sbjct  121  VLLTRNVGICDNLRLANPLGYL  142



>ref|NP_567562.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 sp|Q6NMJ2.1|OLE96_ARATH RecName: Full=Pollen-specific protein-like At4g18596; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAS47674.1| At4g18596 [Arabidopsis thaliana]
 dbj|BAD94719.1| pollen-specific protein - like [Arabidopsis thaliana]
 gb|AEE84066.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=172

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 94/171 (55%), Gaps = 7/171 (4%)
 Frame = +3

Query  24   AKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            +KA      +A+C  + AG A     +  +F ++G VYCD CRVQF T++S+ L+GA V+
Sbjct  3    SKAIFFFFVSAVCLSSLAGVAIADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVK  62

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---  368
            L+C++      T T+E  T   G+Y + V GDHEE +C++ +V+SP   C +        
Sbjct  63   LECRSRTNGTVTLTKEAVTDKTGSYRMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLR  122

Query  369  DKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
            + +++  + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  123  NAAKISLTANDGIVSHETRIVNPLGFMVQTPSAECPAAFKELGIVP-DVTF  172



>ref|XP_010941451.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=165

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = +3

Query  42   LVSAAICFL-AFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            LV A++CF+ A  G A   P   F+V GRVYCD CR  F  + +E L GA VRL+C++  
Sbjct  4    LVLASLCFISALIGVADAVPTPSFSVTGRVYCDTCRAGFVHEFTEYLGGAKVRLECRDYV  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS--LDKSEVLCS  392
            + + +++ E  T   G Y++ +  DH+E IC+V ++ SPR DCKE +P+   D++ V  +
Sbjct  64   SGQVSHSGEALTDKYGYYTITMSDDHQEEICEVVLLDSPRYDCKE-IPADHRDRARVALT  122

Query  393  ENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             N G+ S  R  N + ++   P P+C  +L
Sbjct  123  RNNGMSSEQRNVNAIGYLKDVPLPKCGPML  152



>gb|KFK44745.1| hypothetical protein AALP_AA1G297400 [Arabis alpina]
Length=171

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 98/172 (57%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++A+CF  L     A     ++F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKFFIVFLASALCFTTLLHFAAADADDFDRFHIKGSVYCDTCRVQFVTRVSKFLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK  + +  T T+E  T   GNY + V GDHEE +C++ +V+SP  +C +       
Sbjct  61   KLECKGRENQTVTLTKEAVTDNAGNYQMEVMGDHEEEVCEIVLVQSPDPECGDINNQEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S   R  NPL FM   P   C +V  ++G +P D+ F
Sbjct  121  RNAARISLTANDGIVSNETRTINPLGFMRKNPLEDCSQVFKELGIVP-DVIF  171



>ref|XP_009108374.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY34057.1| BnaC03g62750D [Brassica napus]
 emb|CDX76511.1| BnaA08g08890D [Brassica napus]
Length=171

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 94/172 (55%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAG--FAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MA   I    +A+C  + AG   A     + F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MATKAIFFFVSALCLSSLAGKAMADADDFDSFKIQGSVYCDTCRVQFVTRLSKFLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL--  368
            +L+C++        T+E  T  +G+Y++ V GDHEE +C++ +++SP   C +       
Sbjct  61   KLECRSRTNGTVALTKEAVTDKSGSYTMEVTGDHEEEVCELVLLQSPDSACSDVSQDAYL  120

Query  369  -DKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + ++V  + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  121  RNAAKVSLTANDGIVSHETRIVNPLGFMVKTPSAECPAAFKELGIVP-DVTF  171



>ref|XP_010540511.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=170

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 100/172 (58%), Gaps = 8/172 (5%)
 Frame = +3

Query  21   MAKATIALVSAAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I LV++A+C   L     A     ++F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKL-ILLVASALCLATLVNFAAADADDFDRFHIKGSVYCDTCRVQFFTRLSKFLEGAKV  59

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVP---S  365
            +L+CKN+  +  T T+E  T  +GNY +VV GDHE+ +C++ + +SP  +C +      +
Sbjct  60   KLECKNIDNQTVTLTKEAVTDKSGNYEMVVMGDHEDEVCEIVLAESPDTECSDINNEEFT  119

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + +  + N GI S   R  NPL FM   P   C K   ++G +P D+ F
Sbjct  120  RNAARISLTANDGIVSNETRTVNPLGFMRRTPLSDCPKAFEELGIVP-DVIF  170



>ref|XP_006415610.1| hypothetical protein EUTSA_v10008921mg [Eutrema salsugineum]
 gb|ESQ33963.1| hypothetical protein EUTSA_v10008921mg [Eutrema salsugineum]
Length=171

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 97/172 (56%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  +  +++A+CF  L     A     ++F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKFFVVFLASALCFTTLLHFAAADADDFDRFHIKGSVYCDTCRVQFVTRLSKFLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK  + +  T T+E  T   GNY + V GDHEE +C++ +V SP  +C +       
Sbjct  61   KLECKGRENQTVTLTKEAVTDKAGNYQMEVMGDHEEEVCEIVLVHSPDAECSDVNNQEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + + V  + N GI S   R  NPL FM   P   C +   ++G +P D+TF
Sbjct  121  RNAARVSLTANDGIVSNETRTINPLGFMRKTPLADCPQAFQELGIVP-DVTF  171



>ref|NP_001105351.1| pollen-specific protein C13 precursor [Zea mays]
 sp|P33050.1|PSC13_MAIZE RecName: Full=Pollen-specific protein C13; Flags: Precursor [Zea 
mays]
 gb|AAB23277.1| pollen specific protein [Zea mays]
 gb|AFW58125.1| male-gametophyte specific1 [Zea mays]
 prf||2209273A Zm13
Length=170

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 81/153 (53%), Gaps = 0/153 (0%)
 Frame = +3

Query  33   TIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKN  212
            T A V   +C +     A       + ++GRVYCD CR  F T ++E + GA VRL+CK+
Sbjct  10   TTAAVILCLCVVLSCAAADDPNLPDYVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKH  69

Query  213  LkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCS  392
              T K     +  T A G Y++ ++  HEE IC V +V SPR+DC E     D++ VL +
Sbjct  70   FGTGKLERAIDGVTDATGTYTIELKDSHEEDICQVVLVASPRKDCDEVQALRDRAGVLLT  129

Query  393  ENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
             N GI   +R ANPL +    P P C  +L  +
Sbjct  130  RNVGISDSLRPANPLGYFKDVPLPVCAALLKQL  162



>ref|XP_010494740.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 95/165 (58%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             + +A+C  + AGFAA    +  +F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  11   FIVSAVCLSSLAGFAAADADDLDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T  +G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     +IG +P D+TF
Sbjct  131  LTANDGIVSHETRIVNPLGFMVKTPSADCAAAFKEIGIVP-DVTF  174



>gb|AFK42345.1| unknown [Lotus japonicus]
Length=164

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 91/161 (57%), Gaps = 4/161 (2%)
 Frame = +3

Query  30   ATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCK  209
            A +AL+ +A CF +      G   +KF V G++YCD C  +FE+++S  L+G  + L+CK
Sbjct  6    AVVALLVSAFCFSSVLA-RVGPVDDKFVVVGKIYCDPCHFEFESRLSHPLEGVKITLECK  64

Query  210  NLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK-SEVL  386
               T   T+T E  T  NG Y+L  +GDHEE +C+V    + + +C  T+P ++K   ++
Sbjct  65   KADTNNVTFTTEAVTDKNGVYTLTCDGDHEEEVCEVNTDANTKGEC--TIPMVNKFDRIV  122

Query  387  CSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
             + N G+ S+ RY NPL FM      +C  V+ ++G    D
Sbjct  123  LTRNMGVSSLTRYVNPLGFMTKAIHSQCGNVVQELGLDKLD  163



>ref|XP_011006159.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011016058.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
Length=159

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = +3

Query  87   AGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAAN  263
            A +P    F V+G VYCD C   FET  + ++ GA VRL+CK+ KT+   Y++E TT + 
Sbjct  19   AARPARNPFVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDST  78

Query  264  GNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFF  443
            G Y++ V+ DH++ ICD  +V SPR+DC+      D++ V+ + N G+ S  RY N + F
Sbjct  79   GKYTITVDEDHKDQICDCMLVSSPRKDCRSPSAGRDRARVILTNNNGLVSTTRYVNAMGF  138

Query  444  MPAKPDPRCKKVL  482
            M A P   C ++L
Sbjct  139  MAAHPMSGCTELL  151



>ref|XP_011101379.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=176

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 93/167 (56%), Gaps = 9/167 (5%)
 Frame = +3

Query  30   ATIALVSA-AICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDC  206
            A +A++ A A+CFL+ A  A  +  + F V+G+V+C+ CR+ F  K S  +  A V+L+C
Sbjct  6    AQVAIILAGALCFLSLADVANSEVPQ-FIVKGKVFCEVCRLNFINKFSHPMPKAEVKLEC  64

Query  207  KNLkteketyteevttAA-NGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEV  383
            ++  T K  Y         NG Y+L  EGDH E IC+VT+VKS + DC E +P+ D  E 
Sbjct  65   RDEGTGKVMYRLTGGQTNDNGEYTLYAEGDHGEEICEVTLVKSSQHDCAE-IPTDDSGEK  123

Query  384  LCSE-----NAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
              +E     N G H  +R ANPL F   K  P+C K+L ++     D
Sbjct  124  QAAEITLTVNNGFHDNIRLANPLSFTRKKALPKCAKLLKELAEDKED  170



>ref|XP_006289520.1| hypothetical protein CARUB_v10003061mg [Capsella rubella]
 gb|EOA22418.1| hypothetical protein CARUB_v10003061mg [Capsella rubella]
Length=160

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 87/155 (56%), Gaps = 4/155 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            M+KA +     A+CFL      A +P +  F V GRVYCD C   FET  S  + GAVVR
Sbjct  1    MSKAVLLF---ALCFLQVLAIIAARPNKNPFVVRGRVYCDTCLAGFETSASTYIPGAVVR  57

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKS  377
            L+CK+ +T + TY+ E  T + G+Y ++V  DH++  CD T+V+S +  C    P  D++
Sbjct  58   LECKDRRTMELTYSHEARTDSTGSYKILVSEDHDDQFCDATLVRSSQLRCSNVSPGHDRA  117

Query  378  EVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             V  +   GI S  R+AN L F+     P C +++
Sbjct  118  RVTLTRFNGIASDERFANSLGFVRDAAMPGCAEIM  152



>ref|XP_010436385.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Camelina sativa]
Length=159

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 83/148 (56%), Gaps = 0/148 (0%)
 Frame = +3

Query  39   ALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            A++  A+CFL     AA      F V GRVYCD C   FET  S  + GAVVRL+CK+ +
Sbjct  4    AVLLVALCFLPVLTIAARPNKNPFVVRGRVYCDTCLAGFETSASTYIPGAVVRLECKDRR  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            T + TY+ E  T + G+Y ++V  DH++  CD T+V S +  C    P  D++ V  +  
Sbjct  64   TMELTYSHEARTDSTGSYKILVNEDHDDQFCDATLVSSSQLRCSTLSPGHDRARVTLTRF  123

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             GI S  R+AN + F+   P P C +++
Sbjct  124  NGIASDERFANTMGFLRDAPMPGCAEIM  151



>ref|XP_002870034.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH46293.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=173

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 91/162 (56%), Gaps = 7/162 (4%)
 Frame = +3

Query  51   AAICF--LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkte  224
            +A+C   LA    A     ++F ++G VYCD CRVQF T++S+ L+GA V+L+C++    
Sbjct  13   SAVCLSSLARVAIADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNG  72

Query  225  ketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVLCSE  395
              T T+E  T   G+Y + V GDHEE +C++ +V+SP   C +        + +++  + 
Sbjct  73   TVTLTKEAVTDKTGSYRMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTA  132

Query  396  NAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
            N GI S   R  NPL FM   P P C     ++G +P D+TF
Sbjct  133  NDGIVSHETRIVNPLGFMVKTPSPECPAAFKELGIVP-DVTF  173



>ref|XP_008234009.1| PREDICTED: pollen-specific protein C13 [Prunus mume]
Length=159

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 82/150 (55%), Gaps = 0/150 (0%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkt  221
            +V  A+C L     A       FTVEG+VYCD CR  FET  +  + GA VRL+C++ KT
Sbjct  5    IVLFALCVLPALAVATRPMRTPFTVEGKVYCDTCRAGFETSATTYIPGATVRLECRDRKT  64

Query  222  eketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENA  401
                YT+E  T + G Y + V  DHE+  CD  +V S ++DC    P  D++ V+ +   
Sbjct  65   MDIRYTKEGRTDSTGTYKIPVTEDHEDQFCDAVLVSSSQKDCAAAAPGRDRARVILTGYN  124

Query  402  GIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            GI S  R+AN + FM  +  P C ++L  +
Sbjct  125  GIASYNRFANAMGFMKNEAVPGCAQILKQL  154



>ref|XP_010441660.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 95/165 (58%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             + +A+C  + AGFAA    +  +F ++G VYCD CRVQF T++S+ L+GA V+L+C+N 
Sbjct  11   FIVSAVCLSSLAGFAAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRNR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T  +G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     +IG +P D+TF
Sbjct  131  LTANDGIVSHETRIVNPLGFMVKTPSADCAAAFKEIGIVP-DVTF  174



>ref|NP_001235303.1| uncharacterized protein LOC100306199 precursor [Glycine max]
 gb|ACU14266.1| unknown [Glycine max]
Length=165

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 93/163 (57%), Gaps = 7/163 (4%)
 Frame = +3

Query  30   ATIALVSAAICFLAFAGFAAGKPG-EKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDC  206
            A +AL  +A+CF +    A   P  +KF VEG++YCD C   FE+++S  L+G  V L C
Sbjct  6    AVVALFVSALCFSSI--LARKTPALDKFFVEGKIYCDPCHFAFESRLSFPLEGVKVSLQC  63

Query  207  KNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPRE-DCKETVPSLDKSEV  383
               + +  TY +E  T ANG YS+ V GDHEE IC + V  SP E  CKE +P+     +
Sbjct  64   LRSENDTVTYVKEGKTDANGQYSIPVHGDHEEEIC-IVVADSPTEGQCKEAMPN-KSDRI  121

Query  384  LCSENAGIHSVVRYANPLFFMPAKPDP-RCKKVLADIGYIPTD  509
            + ++N G+ S+ RY NPL FM    D  +C  V+ ++G    D
Sbjct  122  VLTKNMGVSSMARYVNPLGFMTQGIDATQCNLVVQELGLDQLD  164



>ref|XP_011016068.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011027685.1| PREDICTED: pollen-specific protein C13 isoform X1 [Populus euphratica]
 ref|XP_011027686.1| PREDICTED: pollen-specific protein C13 isoform X2 [Populus euphratica]
Length=159

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 88/144 (61%), Gaps = 2/144 (1%)
 Frame = +3

Query  54   AICFLAFAGFAAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteke  230
            A+C L  A  +A +PG   F+V+GRVYCD C   FET  +  + G+ V+++C++ KT+  
Sbjct  9    ALCVLP-ALVSAARPGRNPFSVQGRVYCDTCHAGFETPKTTYIAGSKVKVECRDRKTQDL  67

Query  231  tyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIH  410
             Y++E TT + G Y + V+ DH++ ICD  +V SPR+DC       +++ V+ +   G+ 
Sbjct  68   VYSKEGTTDSTGTYIITVDEDHKDQICDAMLVSSPRQDCSSPSAGRERARVILTNYNGLV  127

Query  411  SVVRYANPLFFMPAKPDPRCKKVL  482
            S  RYAN + FM A+P   C ++L
Sbjct  128  STTRYANSMGFMAAQPMSGCTELL  151



>emb|CDY52214.1| BnaAnng11370D [Brassica napus]
Length=174

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 91/165 (55%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             V + +C  +  GF+A    +  +F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  11   FVVSVVCLSSLPGFSAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                   T+E  T   G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTLALTKEAVTDKTGSYMMEVTGDHEEEVCELVLVQSPDSGCSDVSEEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  131  LTANDGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVP-DVTF  174



>ref|XP_010521200.1| PREDICTED: major pollen allergen Lol p 11 [Tarenaya hassleriana]
Length=164

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 87/164 (53%), Gaps = 0/164 (0%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK  + +V   +  L+ A       G    VEGR YCD C   FET  S  + GA V+L
Sbjct  1    MAKLAMLMVLCVMPALSMAARLPKVDGNTMVVEGRTYCDPCLAGFETSASYFIPGATVKL  60

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CK+ KT K  +TEE TT   G+Y   V  DH++ +CDV +VKSP  +C    P  ++S 
Sbjct  61   ECKDRKTMKVMHTEETTTDNGGSYKFFVHEDHKDQMCDVKLVKSPDTNCPRISPGREQSR  120

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
            V+ + N GI S  RYAN + F    PD  C ++L     +  D+
Sbjct  121  VILNHNNGIASQNRYANNMGFEKEAPDAFCAELLKQYQDLNEDI  164



>ref|XP_006281481.1| hypothetical protein CARUB_v10027565mg [Capsella rubella]
 gb|EOA14379.1| hypothetical protein CARUB_v10027565mg [Capsella rubella]
Length=174

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 94/165 (57%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             + +AIC  + AGFAA    +  +F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  11   FIVSAICLSSLAGFAAADADDSDRFQIQGSVYCDTCRVQFITRLSKFLEGAKVKLECRSR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T   G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTVTLTKEAVTDKTGSYMMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  131  LTANDGIVSHETRIVNPLGFMVMTPSADCPAAFKELGIVP-DVTF  174



>ref|XP_008348540.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=162

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 86/154 (56%), Gaps = 2/154 (1%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA + + ++ A   FL     +A   G  F V+GRVYCD CR  FET  +  + GA VR+
Sbjct  1    MAMSRVVVLLALCMFLGLV--SARTLGNPFHVQGRVYCDTCRCGFETTATNYIPGARVRI  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CK+  T +  Y+ E  T + G Y+++VE DHE+ IC+  +V SP  DCK   P   ++ 
Sbjct  59   ECKDRNTLQLAYSVEGETDSTGTYNILVEEDHEDQICESVLVSSPISDCKSADPGRSRAN  118

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            V+ +   G+    RYAN + F   +P   C+K+L
Sbjct  119  VVVTRYNGVVKDKRYANNMGFFKNEPLAGCEKIL  152



>ref|XP_011080816.1| PREDICTED: major pollen allergen Ole e 1-like [Sesamum indicum]
Length=166

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 86/158 (54%), Gaps = 5/158 (3%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkt  221
            L + A+C L F+        E F V G VYC+ CR+ F  K+SE + GA V+L+C+  +T
Sbjct  7    LFAGALCLLCFSSVVRATTPEFFVV-GEVYCEVCRINFINKLSEPMPGAKVKLECRGEET  65

Query  222  eketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDC----KETVPSLDKSEVLC  389
               TYT+E  T   G Y L VEGDHEE  C +T+VKS R DC     E   S   S +  
Sbjct  66   GNITYTQEGVTNEAGQYRLKVEGDHEEEECGITLVKSGRADCDEIPNEGWASKPSSLITL  125

Query  390  SENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIP  503
            ++N G H   RYANPL F   K +  C +++ ++   P
Sbjct  126  TKNNGFHGSSRYANPLGFTKKKANHECAELIKELEIDP  163



>gb|ADK22842.1| Sal k 5, partial [Salsola kali]
Length=151

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 82/138 (59%), Gaps = 4/138 (3%)
 Frame = +3

Query  90   GKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANG  266
            GK G   + V+G VYCD CR+QF T++S  ++GA V L C+NL    ET+  E  T   G
Sbjct  2    GKGGHNLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLG  61

Query  267  NYSLVVEGDHEEAICDVTVVKSPREDCKET---VPSLDKSEVLCSENAGIHSVVRYANPL  437
             Y++ V+GDHE+ IC + +VKSP ++C E    V S   ++V  + N G  S VR AN L
Sbjct  62   MYTIKVDGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANAL  121

Query  438  FFMPAKPDPRCKKVLADI  491
             F+   P P C +VL ++
Sbjct  122  GFLKKAPLPECPEVLKEL  139



>ref|XP_003634471.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CAN61642.1| hypothetical protein VITISV_029644 [Vitis vinifera]
 emb|CBI19132.3| unnamed protein product [Vitis vinifera]
Length=159

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 85/148 (57%), Gaps = 2/148 (1%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKP-GEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            ++  A+C L  A  +AG+P  + F ++GRVYCD CR  FET  +  + GA VR++CK+  
Sbjct  5    MLLVALCVLP-ALVSAGRPVSQPFVLQGRVYCDTCRAGFETSATTYIAGAKVRVECKDRN  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            + +  Y+ E  T + G Y ++V  D E+ +CD  +V SP+ DC    P  D++ V+ +  
Sbjct  64   SMQLLYSIEGITDSTGTYKIMVTEDREDQLCDAVLVSSPQSDCASVDPGRDRAAVILTRY  123

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             GI S  RYAN + F+   P   C ++L
Sbjct  124  NGIVSDNRYANSMGFLKDHPMSECTQLL  151



>emb|CDY65576.1| BnaC09g52000D [Brassica napus]
Length=174

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 88/159 (55%), Gaps = 7/159 (4%)
 Frame = +3

Query  60   CFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteket  233
            C  + AGF+A    +  +F ++G VYCD CRVQF T++S+ L+GA V+L+C++       
Sbjct  17   CLSSLAGFSAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLA  76

Query  234  yteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVLCSENAG  404
             T+E  T   G+Y + V GDHEE +C + +V+SP   C +        + +++  + N G
Sbjct  77   LTKEAVTDKTGSYMMEVTGDHEEEVCQLVLVQSPDSGCSDVSEEAYLRNAAKISLTANDG  136

Query  405  IHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
            I S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  137  IVSHETRIVNPLGFMVKTPSADCPAAFKELGIVP-DVTF  174



>ref|XP_002513885.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF48468.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=159

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 91/155 (59%), Gaps = 5/155 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            MA+A + L   A+C L  A  AA +P    F VEGRVYCD CR  FET  +  + GA VR
Sbjct  1    MARAILLL---ALCVLP-ALVAAARPARNPFEVEGRVYCDTCRAGFETSKTTYVAGAKVR  56

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKS  377
            ++CK+ KT +  Y++E TT + G Y + V+ DH++ +CD  +V SP+ DC +     D++
Sbjct  57   VECKDRKTMELVYSKEGTTDSTGTYRIHVDEDHQDQLCDAMLVSSPQHDCMKPSSGRDRA  116

Query  378  EVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             V+ + N GI S  RYAN + FM       C ++L
Sbjct  117  RVILTNNNGIVSNKRYANSIGFMKEDAMSGCFELL  151



>ref|XP_006414083.1| hypothetical protein EUTSA_v10026398mg [Eutrema salsugineum]
 gb|ESQ55536.1| hypothetical protein EUTSA_v10026398mg [Eutrema salsugineum]
Length=172

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 94/170 (55%), Gaps = 7/170 (4%)
 Frame = +3

Query  27   KATIALVSAAICFLAFAG--FAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            KA      +A+C  + AG   A     ++F ++G VYCD CRVQF T++S+ L+GA V+L
Sbjct  4    KAIFFFFVSAVCLSSLAGKALADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKL  63

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---D  371
            +C++      T T+E  T  +G+Y + V GDHEE +C++ +V+SP   C +        +
Sbjct  64   ECRSRANGTVTLTKEAVTDKSGSYRMEVTGDHEEEVCELVLVQSPDSGCSDVSKEAYLRN  123

Query  372  KSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             +++  + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  124  AAKISLTANDGIVSHETRIVNPLGFMVKTPLADCAAAFKELGIVP-DVTF  172



>ref|XP_009403224.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 78/126 (62%), Gaps = 0/126 (0%)
 Frame = +3

Query  105  KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSLVV  284
            KF ++GRVYCD CR  FET +S+ + GA V+L C++ +T+   +T    T   G Y++ V
Sbjct  26   KFVIQGRVYCDTCRAGFETVVSQYIPGAKVKLQCRHYETDSIEHTAVGVTDGTGTYNIEV  85

Query  285  EGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFFMPAKPDP  464
            E +HEE IC+V++V+SP   C E   + +++ VL +   G+ S VRYAN L F+  +P  
Sbjct  86   EDNHEEEICEVSLVQSPVPGCSEVSGTRNRARVLVTGRNGLASDVRYANSLGFLKDEPLK  145

Query  465  RCKKVL  482
             C  +L
Sbjct  146  ECGLLL  151



>gb|KFK28529.1| hypothetical protein AALP_AA7G008600 [Arabis alpina]
Length=173

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 92/165 (56%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
            L  +A+C  + AG A     +  +F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  10   LFVSAVCLSSLAGVAVADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSR  69

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T   G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  70   TNGTITLTKEAVTDKTGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKIS  129

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  130  LTANDGIVSHETRIVNPLGFMVQTPLADCPAAFKELGIVP-DVTF  173



>ref|XP_007153183.1| hypothetical protein PHAVU_003G013900g [Phaseolus vulgaris]
 gb|ESW25177.1| hypothetical protein PHAVU_003G013900g [Phaseolus vulgaris]
Length=162

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 90/158 (57%), Gaps = 4/158 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA++ + +V+  +  L F+   A K  EKF VEG++YCD C   FE+++S  L G  V L
Sbjct  1    MARSFV-VVALFVSILCFSSTLARKTPEKFFVEGKIYCDPCHFAFESRLSFPLSGVNVSL  59

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPRE-DCKETVPSLDKS  377
             C   +    TY +  T+ ANG Y++ V GDHE+ IC V V  SP E  CKE +P+    
Sbjct  60   QCIQEENNTVTYLKNSTSDANGMYNIPVLGDHEDDIC-VVVADSPNEGQCKEAMPN-KSD  117

Query  378  EVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
             ++ ++N G  S+ RY NPL FM    D +C  V+ ++
Sbjct  118  RIILTDNMGAASLARYVNPLGFMTQTIDSQCNAVVHEL  155



>ref|XP_009409254.1| PREDICTED: major pollen allergen Lol p 11-like [Musa acuminata 
subsp. malaccensis]
Length=168

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 87/162 (54%), Gaps = 10/162 (6%)
 Frame = +3

Query  21   MAKATIALVSAAI---CFL-----AFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISES  176
            MAK  I+ V+A +   C L     A    A GK G  F V+GRV+CD CR  FET +S  
Sbjct  1    MAKHLISAVTAVLAVACVLPSLSVAARNVAGGKQG--FVVQGRVFCDTCRAGFETPVSTY  58

Query  177  LKGAVVRLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKET  356
             KGA VR++C++  T  +T   E TT   G Y+++V  +HE  IC+  +V SP   CK  
Sbjct  59   TKGAKVRIECRSKATGAKTCNFEGTTDHTGTYNILVADEHEHEICESMLVSSPESRCKTP  118

Query  357  VPSLDKSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            +   +++ V  S N GI S  RYAN L F    P   C ++L
Sbjct  119  LQGRERARVFLSHNNGIASDTRYANSLGFQTDTPLSVCAELL  160



>ref|XP_010535648.1| PREDICTED: major pollen allergen Lol p 11-like [Tarenaya hassleriana]
Length=166

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 87/157 (55%), Gaps = 4/157 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPG---EKFTVEGRVYCDNCRVQFETKISESLKGAV  191
            MA+  + ++  A+C L     AA  P        VEGR YCD CR  FET  S  + GA 
Sbjct  1    MARLAVVML-MALCVLPALAMAARLPKVNRNTMVVEGRTYCDPCRAGFETSASYFIPGAT  59

Query  192  VRLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLD  371
            V+L+CK+ KT +  YT+E TT  NG Y   V  DH++ +CDV +VKSP  +C    P  +
Sbjct  60   VKLECKDRKTMEVMYTDEATTDNNGCYKFFVHDDHKDEMCDVKLVKSPDTNCPRISPGRE  119

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            +S V+ +   GI S  RYAN + F   +PD  C ++L
Sbjct  120  QSRVILNHYNGIASQTRYANNMGFEKEEPDVFCAELL  156



>gb|KHN36879.1| Olee1-like protein [Glycine soja]
Length=165

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 93/163 (57%), Gaps = 7/163 (4%)
 Frame = +3

Query  30   ATIALVSAAICFLAFAGFAAGKPG-EKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDC  206
            A +AL  +A+CF +    A   P  +KF VEG++YCD C   FE+++S  L+G  V L C
Sbjct  6    AVVALFVSALCFSSI--LARKTPALDKFFVEGKIYCDPCHFAFESRLSFPLEGVKVSLQC  63

Query  207  KNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPRE-DCKETVPSLDKSEV  383
               + +  TY +E  T ANG YS+ V GDHE+ IC + V  SP E  CKE +P+     +
Sbjct  64   LRSENDTVTYVKEGKTDANGQYSIPVHGDHEDEIC-IVVADSPTEGQCKEAMPN-KSDRI  121

Query  384  LCSENAGIHSVVRYANPLFFMPAKPDP-RCKKVLADIGYIPTD  509
            + ++N G+ S+ RY NPL FM    D  +C  V+ ++G    D
Sbjct  122  VLTKNMGVSSMARYVNPLGFMTQGIDATQCNLVVQELGLDQLD  164



>ref|XP_010527375.1| PREDICTED: major pollen allergen Lol p 11-like [Tarenaya hassleriana]
Length=165

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 87/157 (55%), Gaps = 5/157 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEK---FTVEGRVYCDNCRVQFETKISESLKGAV  191
            MAK  I ++  A+C L     AA  P +      VEGR YCD CR  FET  S  + GA 
Sbjct  1    MAKFVIMMM--ALCALPALAMAARHPKDNRNTMVVEGRTYCDPCRAGFETSASYFIPGAT  58

Query  192  VRLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLD  371
            V+L+CK+ KT    Y++E  T  +G Y   V  DH++ +CDV +VKSP  +C    P  +
Sbjct  59   VKLECKDRKTMDVMYSDEAITDKDGCYKFFVHEDHKDEMCDVKLVKSPDTNCPRISPGRE  118

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            +S+V+ +   GI S  RYAN + F   +PD  C +++
Sbjct  119  QSQVILNHFNGIASQTRYANNMGFEKEEPDVFCAELM  155



>emb|CDX99452.1| BnaC01g11000D [Brassica napus]
Length=172

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 93/170 (55%), Gaps = 7/170 (4%)
 Frame = +3

Query  27   KATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            KA      +A+C  + AG A     +  +F ++G VYCD CRVQF T++S+ L+GA V+L
Sbjct  4    KAIFFFFVSAVCLSSLAGKAVADADDFDRFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKL  63

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---D  371
            +C++      T T+E  T  +G+Y + V GDHEE +C++ +++SP   C +        +
Sbjct  64   ECRSRTNGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLLQSPDSGCSDVSKEAYLRN  123

Query  372  KSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             ++V  + N GI S   R  NPL FM   P   C     ++G +P D+ F
Sbjct  124  AAKVSLTANDGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVP-DVIF  172



>ref|XP_010269200.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=159

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 79/134 (59%), Gaps = 1/134 (1%)
 Frame = +3

Query  84   AAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAA  260
            AA +P    FTV G+VYCDNCR  FET  +  + GA VR++C++  T    ++ +  T +
Sbjct  18   AAARPARNPFTVFGKVYCDNCRAGFETSATTYIPGAKVRVECRDRDTLNLLFSVDGVTDS  77

Query  261  NGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLF  440
             G+Y + V  DHE+ +C+  +V SP+ DC    P  +++ V+ +   GI S  RYAN L 
Sbjct  78   TGSYKIQVAEDHEDQLCESVLVSSPQNDCSAVEPGRERARVILTRGNGIASDNRYANSLG  137

Query  441  FMPAKPDPRCKKVL  482
            F+  +P P C +++
Sbjct  138  FIKDQPLPGCAEIM  151



>ref|XP_009136942.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY53995.1| BnaA03g58200D [Brassica napus]
Length=171

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 92/172 (53%), Gaps = 7/172 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MA   I    +A+C  + AG A     +   F ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MATKAIFFFVSAVCLSSLAGVANADADDFDSFQIQGSVYCDTCRVQFVTRLSQFLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL--  368
            +L+C++      T T+E  T  +G+Y + V GDHEE +C++ ++ SP   C +       
Sbjct  61   KLECRSRTNGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLLHSPDSGCSDVSTEAYL  120

Query  369  -DKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + ++V  + N GI S   R  NPL FM   P   C     ++G +P D+ F
Sbjct  121  RNAAKVSLTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP-DVIF  171



>ref|XP_010455288.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Camelina sativa]
Length=159

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 79/143 (55%), Gaps = 0/143 (0%)
 Frame = +3

Query  54   AICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteket  233
            A+CFL      A      F V GRVYCD C   FET  S  + GAVVRL+CK+ +T + T
Sbjct  9    ALCFLPVLTIVARPNKNPFVVRGRVYCDTCLAGFETSASTYIPGAVVRLECKDRRTMELT  68

Query  234  yteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHS  413
            Y+ E  T + G+Y ++V  DH++  CD T+V S +  C    P  D++ V  +   GI S
Sbjct  69   YSHEARTDSTGSYKILVNEDHDDQFCDATLVSSSQLRCSTRSPGHDRARVTLTRFNGIAS  128

Query  414  VVRYANPLFFMPAKPDPRCKKVL  482
              R+AN + F+   P P C +++
Sbjct  129  DERFANTMGFLRDAPMPGCAEIM  151



>dbj|BAK07321.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 72/130 (55%), Gaps = 1/130 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P   F V GRVYCD CR  FET IS++++GA V +DC+     +     E TT   G Y 
Sbjct  26   PEGGFLVTGRVYCDPCRAGFETNISKNVEGATVAMDCRPFGGGESKLKAEATTDKQGWYK  85

Query  276  LVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANPLFFMPA  452
            + ++ DH++ IC+V + KSP   C E     D++ V  + N G+     RYANP+ F P 
Sbjct  86   IEIDQDHQDEICEVVLTKSPDPACAEIEEFRDRARVPLTSNNGMKQQGTRYANPIAFFPK  145

Query  453  KPDPRCKKVL  482
            +P P C  +L
Sbjct  146  QPRPECGGIL  155



>ref|XP_009132011.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX78874.1| BnaA01g09410D [Brassica napus]
Length=172

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 93/170 (55%), Gaps = 7/170 (4%)
 Frame = +3

Query  27   KATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            KA      +A+C  + AG A     +  +F ++G VYCD CRVQF T++S+ L+GA V+L
Sbjct  4    KAIFFFFVSAVCLSSLAGKAVADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKL  63

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---D  371
            +C++      T T+E  T  +G+Y + V GDHEE +C++ +++SP   C +        +
Sbjct  64   ECRSRTNGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLLQSPDSGCSDVSKEAYLRN  123

Query  372  KSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             ++V  + N GI S   R  NPL FM   P   C     ++G +P D+ F
Sbjct  124  AAKVSLTANDGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVP-DVIF  172



>emb|CDX77620.1| BnaC07g18740D [Brassica napus]
Length=174

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 91/165 (55%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             + + +C  + AGF A    +   F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  11   FIVSTVCLSSLAGFTAADADDFDIFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T  +G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTLTLTKEAVTDKSGSYKIEVTGDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     ++G +P D+ F
Sbjct  131  LTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP-DVIF  174



>ref|XP_011075627.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=163

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 93/166 (56%), Gaps = 7/166 (4%)
 Frame = +3

Query  21   MAKAT-IALV-SAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK T +A++ +AA+CFL  A   A K    F V+G+VYC+ CR  F  + S+ + GA V
Sbjct  1    MAKLTQVAIILAAALCFLDVAASLAPK----FVVDGKVYCEVCRANFTNRYSKPMAGAKV  56

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDH-EEAICDVTVVKSPREDCKETVPSLD  371
            +L+CKN  TEK TYT E  T   G Y+L  EGDH  E +C VT+VKS   DC E      
Sbjct  57   KLECKNEVTEKVTYTLEGETNDKGVYTLTAEGDHGSEDLCAVTLVKSSMADCAEIPDEKP  116

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
             +EV  + N G H   R+ANPL F   +  P C ++  ++     D
Sbjct  117  AAEVTLTLNNGFHDEFRHANPLAFTRKEALPECAELFKELEEAKKD  162



>ref|XP_006398273.1| hypothetical protein EUTSA_v10001051mg [Eutrema salsugineum]
 gb|ESQ39726.1| hypothetical protein EUTSA_v10001051mg [Eutrema salsugineum]
Length=174

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 94/165 (57%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             V AA+C  + AGFAA    +  +F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  11   FVVAAVCLSSLAGFAAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T  +G+Y + V GDHEE +C++ +V+SP   C          + +++ 
Sbjct  71   TNGTLTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVQSPDSGCSNVSKEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  131  LTANDGIVSHETRIVNPLGFMVKTPLADCAAAFKELGIVP-DVTF  174



>emb|CDY12288.1| BnaA09g24880D [Brassica napus]
 emb|CDX90693.1| BnaA03g23730D [Brassica napus]
Length=159

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 80/148 (54%), Gaps = 0/148 (0%)
 Frame = +3

Query  39   ALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            A++  A+CFL     +A      F V GRVYCD C   FET  S  + GAVVRL+CK+ +
Sbjct  4    AILLVALCFLPALAMSARPNKNPFVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRR  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            T + TY  E  T + G+Y ++V  DHE+  CD  +V S +  C    P  D++ V  +  
Sbjct  64   TMELTYRHEARTDSTGSYKILVSEDHEDQFCDTMLVSSSQLRCSNVSPGHDRARVTLTRF  123

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             GI S  R+AN L F+     P C +++
Sbjct  124  NGIASDERFANNLGFLRDAASPGCAEIM  151



>ref|XP_010942359.1| PREDICTED: major pollen allergen Lol p 11-like [Elaeis guineensis]
Length=174

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 75/134 (56%), Gaps = 0/134 (0%)
 Frame = +3

Query  108  FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSLVVE  287
            F + GRVYCD CR  FET I+ S+ GA VRL+CK   T++ TY  E TT  +G Y ++V 
Sbjct  40   FVLTGRVYCDTCRAGFETDITSSMPGAKVRLECKRYGTDELTYEAEATTQLSGMYQMIVP  99

Query  288  GDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFFMPAKPDPR  467
             DH    C V +VKS    C E  P  D+  +  +++ G+ S  R AN L F+  +P P 
Sbjct  100  DDHSNDQCSVVLVKSSFNKCTEIEPGRDRVRITLAQDGGLLSNSRQANALGFLIDEPLPS  159

Query  468  CKKVLADIGYIPTD  509
            C K+L   G+   D
Sbjct  160  CGKLLQKYGFANDD  173



>ref|XP_009134109.1| PREDICTED: pollen-specific protein C13 [Brassica rapa]
Length=159

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 80/148 (54%), Gaps = 0/148 (0%)
 Frame = +3

Query  39   ALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            A++  A+CFL     +A      F V GRVYCD C   FET  S  + GAVVRL+CK+ +
Sbjct  4    AILLVALCFLPALAMSARPNKNPFVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRR  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            T + TY  E  T + G+Y ++V  DHE+  CD  +V S +  C    P  D++ V  +  
Sbjct  64   TMELTYRHEARTDSTGSYRILVSEDHEDQFCDTMLVSSSQLRCSNVSPGHDRARVTLTRF  123

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             GI S  R+AN L F+     P C +++
Sbjct  124  NGIASDERFANNLGFLRDAASPGCAEIM  151



>gb|ABK92993.1| unknown [Populus trichocarpa]
Length=159

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 87/144 (60%), Gaps = 2/144 (1%)
 Frame = +3

Query  54   AICFLAFAGFAAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteke  230
            A+C L  A  +A +PG   F+V+G VYCD C   FET  +  + G+ V+++C++ KT+  
Sbjct  9    ALCVLP-ALVSAARPGRNTFSVQGLVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDL  67

Query  231  tyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIH  410
             Y++E TT + G Y + V+ DH++ ICD  +V SPR+DC       D++ V+ +   G+ 
Sbjct  68   VYSKEGTTDSTGKYIITVDEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLV  127

Query  411  SVVRYANPLFFMPAKPDPRCKKVL  482
            S  RYAN + FM A+P   C ++L
Sbjct  128  STTRYANSMGFMAAQPMSGCTELL  151



>ref|XP_002301038.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK93129.1| unknown [Populus trichocarpa]
 gb|ABK94485.1| unknown [Populus trichocarpa]
 gb|ABK95752.1| unknown [Populus trichocarpa]
 gb|EEE80311.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 87/144 (60%), Gaps = 2/144 (1%)
 Frame = +3

Query  54   AICFLAFAGFAAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteke  230
            A+C L  A  +A +PG   F+V+G VYCD C   FET  +  + G+ V+++C++ KT+  
Sbjct  9    ALCVLP-ALVSAARPGRNPFSVQGLVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDL  67

Query  231  tyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIH  410
             Y++E TT + G Y + V+ DH++ ICD  +V SPR+DC       D++ V+ +   G+ 
Sbjct  68   VYSKEGTTDSTGKYIITVDEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLV  127

Query  411  SVVRYANPLFFMPAKPDPRCKKVL  482
            S  RYAN + FM A+P   C ++L
Sbjct  128  STTRYANSMGFMAAQPMSGCTELL  151



>ref|XP_009101556.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=174

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 91/165 (55%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             + + +C  + AGF A    +   F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  11   FIVSTVCLSSLAGFTAADADDFDIFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T  +G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTLTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVQSPDIGCSDVSKEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     ++G +P D+ F
Sbjct  131  LTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP-DVIF  174



>ref|NP_567338.1| protein SAH7 [Arabidopsis thaliana]
 emb|CAB40579.1| SAH7 protein [Arabidopsis thaliana]
 gb|AAL69502.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45117.1| unknown protein [Arabidopsis thaliana]
 gb|AAM62935.1| allergen-like protein BRSn20 [Arabidopsis thaliana]
 dbj|BAF00475.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82668.1| protein SAH7 [Arabidopsis thaliana]
Length=159

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 81/148 (55%), Gaps = 0/148 (0%)
 Frame = +3

Query  39   ALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            A++  A+CFL     AA      F V GRVYCD C   FET  S  + GAVVRL+CK+ +
Sbjct  4    AVLLVALCFLPALAIAARPNKNPFVVRGRVYCDTCLAGFETPASTYISGAVVRLECKDRR  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            T + TY+ E  T + G+Y ++V  DH+E  CD  +V+S +  C    P  D++ V  +  
Sbjct  64   TMELTYSHEARTDSTGSYKILVNEDHDEQFCDAMLVRSSQLRCSNVSPGHDRARVTLTRF  123

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             GI S  R+AN + F+     P C  ++
Sbjct  124  NGIASDDRFANNMGFLRDAAMPGCADIM  151



>emb|CDY01556.1| BnaC07g35460D [Brassica napus]
Length=172

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 92/170 (54%), Gaps = 7/170 (4%)
 Frame = +3

Query  27   KATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            KA      +A+C  + AG A     +   F ++G VYCD CRVQF T++S+ L+GA V+L
Sbjct  4    KAIFFFFVSAVCLSSLAGVANADADDFDSFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKL  63

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---D  371
            +C++      T T+E  T  +G+Y + V GDHEE +C++ +++SP   C +        +
Sbjct  64   ECRSRTNGTVTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLLQSPDSGCSDVSTEAYLRN  123

Query  372  KSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             ++V  + N GI S   R  NPL FM   P   C     ++G +P D+ F
Sbjct  124  AAKVSLTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP-DVIF  172



>ref|XP_007149396.1| hypothetical protein PHAVU_005G066700g [Phaseolus vulgaris]
 gb|ESW21390.1| hypothetical protein PHAVU_005G066700g [Phaseolus vulgaris]
Length=162

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 83/142 (58%), Gaps = 3/142 (2%)
 Frame = +3

Query  72   FAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevt  251
            F+   A K  EKF VEG++YCD C+  FE+++S +L G  V L C   + +  +Y +  T
Sbjct  17   FSSALARKSPEKFFVEGKIYCDPCQFAFESRLSFALSGVNVTLKCIKEENDIVSYLKNST  76

Query  252  tAANGNYSLVVEGDHEEAICDVTVVKSPRE-DCKETVPSLDKSEVLCSENAGIHSVVRYA  428
            T ANG Y++ V GDHEE IC + V   P E  CKE +P+     ++ ++N G  S+ RY 
Sbjct  77   TDANGMYNIPVRGDHEEEIC-MVVADPPNEGQCKEAMPN-KSDRIILTKNMGAASMTRYV  134

Query  429  NPLFFMPAKPDPRCKKVLADIG  494
            NPL FM    D +C  V+ ++G
Sbjct  135  NPLGFMTQTTDSQCFSVVHELG  156



>gb|ABK94215.1| unknown [Populus trichocarpa]
Length=159

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 87/144 (60%), Gaps = 2/144 (1%)
 Frame = +3

Query  54   AICFLAFAGFAAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteke  230
            A+C L  A  +A +PG   F+V+G VYCD C   FET  +  + G+ V+++C++ KT+  
Sbjct  9    ALCVLP-ALVSAARPGRNPFSVQGIVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDL  67

Query  231  tyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIH  410
             Y++E TT + G Y + V+ DH++ ICD  +V SPR+DC       D++ V+ +   G+ 
Sbjct  68   VYSKEGTTDSTGKYIITVDEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLV  127

Query  411  SVVRYANPLFFMPAKPDPRCKKVL  482
            S  RYAN + FM A+P   C ++L
Sbjct  128  STTRYANSMGFMAAQPMSGCTELL  151



>ref|XP_011075462.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=163

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 88/157 (56%), Gaps = 5/157 (3%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkt  221
            +++ A+CFL  A  A+  P  KF V+G+VYC+ CR  F  + SE + GA V+L+CKN  T
Sbjct  10   ILAVALCFLDVA--ASHAP--KFVVDGKVYCEVCRANFTNRYSEPMPGAKVKLECKNEVT  65

Query  222  eketyteevttAANGNYSLVVEGDH-EEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            EK TYT E  T   G Y+L  EGDH  E +C VT+VKS   DC E       +EV  + N
Sbjct  66   EKVTYTLEGETNDKGVYTLTAEGDHGSEDLCAVTLVKSSMADCAEIPDEKPAAEVTLTLN  125

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
             G H   R+ANPL F   +  P C ++  ++     D
Sbjct  126  NGFHDEFRHANPLAFTRKEALPECAELFKELEEAKKD  162



>ref|XP_009600627.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana tomentosiformis]
Length=162

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 85/163 (52%), Gaps = 3/163 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK     V   +CFL FA  A+    + F V G+VYCD CR  FET  S+ L G+ VR+
Sbjct  1    MAKLVALFV---VCFLVFASIASAHFMDTFLVVGKVYCDTCRCGFETSASKYLAGSRVRI  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CKN  T   +YT E  T + G Y ++V  D  + +CDV +++S    C       D++ 
Sbjct  58   ECKNRDTNDISYTIEGVTNSKGEYKILVYSDRGDEVCDVVLIRSSDPMCAVPNAGRDRAR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
            V+ + N G+ S  R+AN + F+  +P   C ++L        D
Sbjct  118  VVLTRNNGMVSNTRFANSIGFLSNEPLASCNQILQQYQLTDQD  160



>ref|XP_010676978.1| PREDICTED: major pollen allergen Lol p 11-like [Beta vulgaris 
subsp. vulgaris]
Length=162

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 86/152 (57%), Gaps = 2/152 (1%)
 Frame = +3

Query  30   ATIALVSAAICFLAFAGFAAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDC  206
            A IA +   +C L     A G+P +K + V G+VYCD CR  FET  S  L+G  V+L+C
Sbjct  2    AKIAGILFLLCVLPVLAMA-GRPEKKPYCVRGKVYCDTCRAGFETPASTYLEGVKVKLEC  60

Query  207  KNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVL  386
            ++ +T++  Y+   TT   G+Y + VE D +E ICD  ++ SP   CK   P  D+S V+
Sbjct  61   RHRQTQEVLYSAVATTDRTGSYKIFVENDQKENICDTMLLSSPHRRCKLADPGRDRSRVV  120

Query  387  CSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             + N G+ S  RYAN + F   +P   C +++
Sbjct  121  LTSNNGVVSNDRYANNMGFTVEEPMSYCAQLM  152



>ref|NP_568650.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
 dbj|BAD43611.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
 gb|ABR46194.1| At5g45880 [Arabidopsis thaliana]
 gb|AED95311.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
Length=174

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 94/165 (57%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             V +A+C  + AGFAA    +  +F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  11   FVVSAVCLSSLAGFAAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T   G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTITLTKEAVTDKTGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSTEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  131  LTANDGIVSHETRIVNPLGFMVQTPLADCPAAFKELGIVP-DVTF  174



>ref|XP_002863445.1| hypothetical protein ARALYDRAFT_494394 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39704.1| hypothetical protein ARALYDRAFT_494394 [Arabidopsis lyrata subsp. 
lyrata]
Length=174

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 94/165 (57%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             V +A+C  + AGFAA    +  +F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  11   FVVSAVCLSSLAGFAAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T   G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTVTLTKEAVTDKTGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  131  LTANDGIVSHETRIVNPLGFMVQTPLADCPAAFKELGIVP-DVTF  174



>ref|XP_007153182.1| hypothetical protein PHAVU_003G013800g [Phaseolus vulgaris]
 gb|ESW25176.1| hypothetical protein PHAVU_003G013800g [Phaseolus vulgaris]
Length=163

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 90/159 (57%), Gaps = 5/159 (3%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MA++ + +V+  +  L F+   A K  EKF+V+G++YCD C   FE+++S  L G  V L
Sbjct  1    MARSFV-VVALFVSVLCFSSALARKTPEKFSVQGKIYCDPCHFAFESRLSFPLSGVSVSL  59

Query  201  DC-KNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPRE-DCKETVPSLDK  374
             C K       TY +  T+ ANG Y++ V GDHE+ IC V V  SP E  CKE +P+   
Sbjct  60   QCIKEENNTIITYLKNSTSDANGMYNIPVLGDHEDDIC-VVVADSPNEGQCKEAMPN-KS  117

Query  375  SEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
              ++ + N G  S+ RY NPL FM    D +C  V+ ++
Sbjct  118  DRIIITNNMGAASLTRYVNPLGFMTQTIDSQCNVVVHEL  156



>ref|XP_008797140.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
 ref|XP_008797142.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
Length=174

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 79/136 (58%), Gaps = 0/136 (0%)
 Frame = +3

Query  102  EKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSLV  281
            +   +EG VYCD CR  FET ++  + GA VRL+C    T++ TY  E TT   G Y +V
Sbjct  38   DGLVLEGHVYCDTCRAGFETDLTAYIPGAKVRLECTRYGTDEVTYAAEATTDLLGIYQIV  97

Query  282  VEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFFMPAKPD  461
            V GDH E  C V ++KS  ++C E  P  D++ V+ +++ G+ S VR AN L F+ A+P 
Sbjct  98   VPGDHSEDQCSVVLMKSAVDNCTEIKPGRDRARVVLAQDGGLLSNVRRANALGFLIAEPL  157

Query  462  PRCKKVLADIGYIPTD  509
              C K+L   G+   D
Sbjct  158  AECGKLLQKYGFANDD  173



>ref|XP_009128814.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY06029.1| BnaA09g37510D [Brassica napus]
Length=174

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 94/165 (57%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEK--FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
            LV + +C  + AGFAA    +   F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  11   LVVSTVCLFSLAGFAAADADDFDLFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T  +G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTLTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  131  LTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP-DVTF  174



>ref|XP_002454899.1| hypothetical protein SORBIDRAFT_03g001020 [Sorghum bicolor]
 gb|EES00019.1| hypothetical protein SORBIDRAFT_03g001020 [Sorghum bicolor]
Length=166

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 84/153 (55%), Gaps = 3/153 (2%)
 Frame = +3

Query  27   KATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDC  206
            ++ +ALV+A +  LA  G A+ +    F V GRVYCD CR  FET +S+S+ GA V + C
Sbjct  4    QSMVALVAAGVLLLA--GVASAEKAGGFVVTGRVYCDPCRAGFETNVSKSVAGATVEVVC  61

Query  207  KNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVL  386
            ++ +  KET   E TT   G Y L ++ DH+E IC+V + KSP   C E      ++ V 
Sbjct  62   RHFEASKETLKAEATTDDFGWYKLEIDQDHQEEICEVVLKKSPDPACAEIEEQRARARVP  121

Query  387  CSENAGI-HSVVRYANPLFFMPAKPDPRCKKVL  482
             + N GI     RYANP+ F    P   C  +L
Sbjct  122  LTSNNGIKQKGTRYANPIAFFRKDPLKECGAIL  154



>ref|XP_002268073.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CBI33037.3| unnamed protein product [Vitis vinifera]
Length=159

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 82/148 (55%), Gaps = 2/148 (1%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            L+S A+C L     +  +P  K F + GRVYCD CR  FET  +  + GA VR++CK+  
Sbjct  5    LMSIALCLL-LVYVSEARPMRKPFVLHGRVYCDTCRAGFETSATTYIAGARVRIECKDRN  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            + +  Y+ E  T + G Y   +  DH + +CD  +VKSP+ DC +     D+S +  + +
Sbjct  64   SLQLVYSVEGVTDSTGTYKFSIADDHGDQMCDAVLVKSPQPDCAKVDAGRDRSRLSLTRS  123

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             G+ S  R+AN + FM  +P   C ++L
Sbjct  124  NGLVSDTRFANAMGFMKDEPASGCTQLL  151



>emb|CAA16739.1| pollen-specific protein - like [Arabidopsis thaliana]
 emb|CAB78861.1| pollen-specific protein-like [Arabidopsis thaliana]
Length=842

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 92/171 (54%), Gaps = 6/171 (4%)
 Frame = +3

Query  24   AKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            +KA      +A+C  + AG A     +  +F ++G VYCD CRVQF T++S+ L+GA V+
Sbjct  276  SKAIFFFFVSAVCLSSLAGVAIADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVK  335

Query  198  LDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---  368
            L+C++      T T+E  T   G+Y + V GDHEE +C++ +V+SP   C +        
Sbjct  336  LECRSRTNGTVTLTKEAVTDKTGSYRMEVTGDHEEEVCELVLVESPDSGCSDVSKEAYLR  395

Query  369  DKSEVLCSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
            + +++  + N GI S   R  NPL FM   P   C     ++G +P  L F
Sbjct  396  NAAKISLTANDGIVSHETRIVNPLGFMVQTPSAECPAAFKELGIVPDGLLF  446



>ref|XP_009797814.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana sylvestris]
Length=161

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 83/154 (54%), Gaps = 3/154 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            MAK     V   +CFL FA  A+    + F V G+VYCD CR  FET  S+ L G+ VR+
Sbjct  1    MAKLVALFV---VCFLVFASIASAHFMDTFLVVGKVYCDTCRCGFETSASKYLAGSRVRI  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CK   T   +YT E  T + G Y ++V  D  + +CDV +++S    C       D++ 
Sbjct  58   ECKKRDTNDVSYTIEGVTNSKGEYKILVYSDRGDEVCDVVLIRSSDPMCATPAAGRDRAR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            V+ + N G+ S  R+AN + F+  +P   C ++L
Sbjct  118  VVLTRNNGMISNTRFANSIGFLSDEPLASCNQIL  151



>ref|XP_006442530.1| hypothetical protein CICLE_v10024378mg [Citrus clementina]
 gb|ESR55770.1| hypothetical protein CICLE_v10024378mg [Citrus clementina]
Length=163

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 97/161 (60%), Gaps = 6/161 (4%)
 Frame = +3

Query  21   MAKAT--IALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK+   +A+V+ A+CF +   FA      K TVEG VYCD+CRV+++T++S+ + GA V
Sbjct  1    MAKSMKLVAVVATALCFTSLLSFALAAKDPK-TVEGLVYCDSCRVKYKTELSDYIAGATV  59

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVP-SLD  371
             L+CK  +  +  Y+ EV +  +G Y + +EG H + +C V +VKSP+ +C E V   L 
Sbjct  60   ALECKESEGGEVVYSREVVSDQSGTYKIPIEGCHAK-LCQVRLVKSPKPECSEIVADGLS  118

Query  372  KSEVLCSENAGIH-SVVRYANPLFFMPAKPDPRCKKVLADI  491
             + +  + + G    ++RYAN L FM  +  P C KVL ++
Sbjct  119  SARIDLTPSVGSDPELIRYANDLGFMKKESLPECAKVLEEM  159



>emb|CDY05022.1| BnaC03g28200D [Brassica napus]
Length=159

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 80/148 (54%), Gaps = 0/148 (0%)
 Frame = +3

Query  39   ALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            A++  A+CFL     +A      F V GRVYCD C   FET  S  + GAVVRL+CK+ +
Sbjct  4    AILLVALCFLPALAMSARPNKNPFVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRR  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            T + TY  E  T + G+Y ++V  DHE+  CD  +V S +  C    P  +++ V  +  
Sbjct  64   TMELTYRHEARTDSTGSYKILVSEDHEDQFCDTMLVSSSQLRCSNVSPGHNRARVTLTRF  123

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             GI S  R+AN L F+     P C +++
Sbjct  124  NGIASDERFANNLGFLRDAASPGCAEIM  151



>sp|Q7M1X5.1|LOLB_LOLPR RecName: Full=Major pollen allergen Lol p 11; AltName: Full=Allergen 
Lol p XI; AltName: Allergen=Lol p 11 [Lolium perenne]
 prf||2118270A allergen Lol p XI
Length=134

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 72/129 (56%), Gaps = 1/129 (1%)
 Frame = +3

Query  99   GEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSL  278
            G  F V GRVYCD CR  FET +S +++GA V +DC+     +     E TT  +G Y +
Sbjct  3    GPGFVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKI  62

Query  279  VVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANPLFFMPAK  455
             ++ DH+E IC+V + KSP + C E     D++ V  + N GI    +RYANP+ F   +
Sbjct  63   EIDQDHQEEICEVVLAKSPDKSCSEIEEFRDRARVPLTSNXGIKQQGIRYANPIAFFRKE  122

Query  456  PDPRCKKVL  482
            P   C  +L
Sbjct  123  PLKECGGIL  131



>ref|XP_004293940.1| PREDICTED: olee1-like protein-like [Fragaria vesca subsp. vesca]
Length=169

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 85/136 (63%), Gaps = 3/136 (2%)
 Frame = +3

Query  105  KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSLVV  284
            K  VEG V+CD+CR+QF T+I + ++GA V+L+CK+L +   TY++E  T   G YS+ V
Sbjct  29   KLQVEGVVFCDSCRIQFITRIDKLIQGAKVKLECKDLDSGSITYSKEAETNEQGRYSIEV  88

Query  285  EGDHEEAICDVTVVKSPREDCKETVPSLDK---SEVLCSENAGIHSVVRYANPLFFMPAK  455
            + DHEE  C+V +V SP EDC +    L +   + +  +++ GI   VR  NPL FM  +
Sbjct  89   DSDHEEEECEVVLVSSPDEDCNQISHELHQQISARISLTQHNGIAGPVRIPNPLGFMKKE  148

Query  456  PDPRCKKVLADIGYIP  503
            P P C +VL ++G  P
Sbjct  149  PAPECPQVLKELGLTP  164



>emb|CDX87759.1| BnaC02g31900D [Brassica napus]
Length=174

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 94/165 (57%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEK--FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
            LV + +C  + AGFAA    +   F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  11   LVVSTVCLSSLAGFAAADADDFDLFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T  +G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTLTLTKEAVTDKSGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM   P   C     ++G +P D+TF
Sbjct  131  LTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP-DVTF  174



>ref|XP_009366359.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Pyrus x bretschneideri]
Length=162

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 76/133 (57%), Gaps = 0/133 (0%)
 Frame = +3

Query  84   AAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAAN  263
            +A   G  F V+GRVYCD CR  FET  +  + GA VR++CK+  T +  Y+ E  T + 
Sbjct  20   SARTLGNPFHVQGRVYCDTCRCGFETTATNYISGARVRIECKDRNTLQLAYSVEGETDST  79

Query  264  GNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFF  443
            G Y++++E DHE+ IC   +V SP  DCK   P   ++ V+ +   G+    RYAN + F
Sbjct  80   GTYNILIEEDHEDQICKSVLVSSPISDCKSADPGRSRANVVVTRYNGVVKDKRYANNMGF  139

Query  444  MPAKPDPRCKKVL  482
               +P   C+K+L
Sbjct  140  FKDEPLADCEKIL  152



>ref|XP_003581152.1| PREDICTED: pollen-specific protein C13-like [Brachypodium distachyon]
Length=171

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 80/149 (54%), Gaps = 0/149 (0%)
 Frame = +3

Query  36   IALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
            ++ V+ A+     AG +       + V+GRVYCD CR  FET ++  +KGA VRL+CK  
Sbjct  7    LSAVALAVIMAGLAGTSDAVDLPDYIVQGRVYCDTCRAGFETNVTTYIKGAKVRLECKRF  66

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSE  395
             TEK     +  T   G Y + ++  H E IC+V +++SP  DC +     D++ V  + 
Sbjct  67   GTEKVERALDGVTDETGTYKIELKDSHPEDICEVVLIQSPLADCNKIQALRDRARVELTR  126

Query  396  NAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            N GI   +R AN L ++   P P C ++L
Sbjct  127  NIGISDNLRLANSLGYLKDVPLPVCAQLL  155



>ref|XP_011101449.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=171

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 90/159 (57%), Gaps = 9/159 (6%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFA-AGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVR  197
            MA+  I L + A+C L+ A  A A +P  +F V+GRV+C+ CR  F  K S+ + GA V+
Sbjct  1    MARLAIVL-AGALCLLSLAQLANAQEP--QFIVKGRVFCEVCRANFINKFSKPMVGAEVK  57

Query  198  LDCKNLkteketyteevttAAN-GNYSLVVEGDHEEAICDVTVVKSPREDCKET----VP  362
            L+C++ ++   TY+       + G Y L  EGDHE   C+VT+VKS   DC E     + 
Sbjct  58   LECRDEESGMVTYSLTGGVTNDKGEYRLAAEGDHEAEYCEVTLVKSSEPDCAEIPVDGLG  117

Query  363  SLDKSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKV  479
             +  +E+  + N G H   R+AN LFF   +  P+C+++
Sbjct  118  EIPAAEITLTANNGFHDTFRHANALFFTKKEAMPQCEEL  156



>pir||S43242 allergen-like protein Syr v I isoform 1 - Syringa vulgaris
Length=145

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 82/140 (59%), Gaps = 2/140 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P  +F ++G+VYCD CR +F T++SE + GA +RL CK+ +  K T+TE   T A G YS
Sbjct  7    PIPQFHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDRENGKITFTEIGYTRAEGLYS  66

Query  276  LVVEGDHEEAICDVTVVKSPREDCKET-VPSLDKSEVLCSENAGIHSVVRYANPLFFMPA  452
            ++VEGDH+   C++T++ S REDC E  V    K  +    N  ++   R  NP+ F   
Sbjct  67   MLVEGDHKNEFCEITLISSGREDCDEIPVEGWAKPSLKFKLNT-VNGTTRTINPIGFFKK  125

Query  453  KPDPRCKKVLADIGYIPTDL  512
            +  P+C +V   +G  P ++
Sbjct  126  EALPKCTQVYNKLGMYPPNM  145



>ref|XP_010424432.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Camelina sativa]
Length=268

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 84/158 (53%), Gaps = 3/158 (2%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            M+KA + +   A+CFL     AA      F V GRVYC  C   FET  S  + GAVVRL
Sbjct  1    MSKAVLLV---ALCFLPVLTIAARPNKNPFVVRGRVYCHTCLAGFETSASTYIPGAVVRL  57

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CK+ +T + TY+ E  T + G+Y ++V  DH++  CD T+V S +  C    P  D++ 
Sbjct  58   ECKDRRTMELTYSHEARTDSTGSYKILVNEDHDDQFCDATLVSSSQLRCSTLSPGHDRAR  117

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIG  494
            V  +   GI S  R+AN + F+   P P C  V    G
Sbjct  118  VTLTRFNGIASDERFANTMGFLRDAPMPDCADVAKSTG  155



>ref|XP_008378536.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=218

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 85/147 (58%), Gaps = 2/147 (1%)
 Frame = +3

Query  54   AICFLAFAGFAAGKPGEK-FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteke  230
            A+C L  A  AA +P    FTVEG+VYCD CR  +ETK    + GA VRL+C++  +   
Sbjct  68   ALCMLP-ALAAATRPMRTPFTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKTSMAL  126

Query  231  tyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIH  410
             YT+E TT + G Y + V  DH +  CD  +V SP++DC    P  +++ V+ + N GI 
Sbjct  127  LYTKEGTTDSAGCYKIPVAEDHLDQFCDAVLVSSPQKDCATVSPGRERARVILTANNGIA  186

Query  411  SVVRYANPLFFMPAKPDPRCKKVLADI  491
            S  R+AN + FM  +    C ++L ++
Sbjct  187  SYNRFANAMGFMRTEALSGCTQILKEL  213



>ref|XP_006397273.1| hypothetical protein EUTSA_v10029031mg [Eutrema salsugineum]
 gb|ESQ38726.1| hypothetical protein EUTSA_v10029031mg [Eutrema salsugineum]
Length=161

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 78/148 (53%), Gaps = 0/148 (0%)
 Frame = +3

Query  39   ALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            A++  A+CFL     AA      F V GRVYCD C   FET  S  + GAVVRL+CK+  
Sbjct  4    AVLLVALCFLPVLAMAARPNKNPFVVRGRVYCDTCLAGFETPASTYIPGAVVRLECKDRN  63

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            T   TYT E  T + G+Y ++V  DHE+  CD  +  S +  C    P  D++ V  +  
Sbjct  64   TMDLTYTHEARTDSTGSYKILVSEDHEDQFCDTMLGSSSQLRCSNVSPGHDRARVTLTRF  123

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             GI S  R+AN L F+     P C +++
Sbjct  124  NGIASNERFANNLGFLRDAELPGCAEIM  151



>ref|XP_008234688.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 83/148 (56%), Gaps = 3/148 (2%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKP-GEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            L+  A+C L   G  + +  G  F ++GRVYCD CR  FET  +  + GA VR++CK   
Sbjct  7    LLLFALCVLP--GLVSARTLGNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRN  64

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            T +  Y+ E  T A G Y+++VE DHE+ IC+  +V SP  DCK   P  +++ V+ +  
Sbjct  65   TLQLAYSVEGETDATGTYNILVEDDHEDQICESVLVSSPVNDCKSADPRRNRANVVVTRY  124

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             GI     YAN + F   +P   C+++L
Sbjct  125  NGIVKDKHYANNMGFFKDQPLAGCEELL  152



>ref|XP_007225977.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
 gb|EMJ27176.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
Length=159

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 81/150 (54%), Gaps = 0/150 (0%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkt  221
            +V  A+C L     A       FTVEG+V+CD CR  FET  +  + GA VRL+C++ KT
Sbjct  5    IVLFALCVLPALAVATRPMRTPFTVEGKVFCDPCRAGFETSATTYIPGATVRLECRDRKT  64

Query  222  eketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENA  401
                YT+E  T + G Y + V  DHE+  CD  +V S ++DC    P  D++ V+ +   
Sbjct  65   MDIRYTKEGRTDSTGTYKIPVTEDHEDQFCDAVLVSSSQKDCAAAAPGRDRARVILTGYN  124

Query  402  GIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            GI S  R+AN + FM  +    C ++L  +
Sbjct  125  GIASYNRFANAMGFMKNEAVSGCAQILKQL  154



>gb|KDP21093.1| hypothetical protein JCGZ_21564 [Jatropha curcas]
Length=221

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 99/220 (45%), Gaps = 61/220 (28%)
 Frame = +3

Query  30   ATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCK  209
            A I  +++AICFL+  G A G+   KF VEG VYCD CRVQF TK++  ++GA V L+C 
Sbjct  2    ANIICLASAICFLSLFGLAYGE--AKFNVEGVVYCDTCRVQFMTKVTTLIEGATVHLECF  59

Query  210  NLkteketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDC-------------  347
            N   +  TYT       A G YS+ VEGDHE+ +C V ++KSP  DC             
Sbjct  60   NRTGDVLTYTSPEAVTDAAGKYSIPVEGDHEDELCQVMLLKSPNPDCATVHLECFNRTGD  119

Query  348  ---------------KETVP-SLDKSEVLC-----------------------------S  392
                           K ++P   D  + LC                             +
Sbjct  120  VLTYTSPEAVTDAAGKYSIPVEGDHEDELCQVMLLKSPNPDCNEINKDPFVRESASVTLT  179

Query  393  ENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTDL  512
             + GI    R ANPL F+  +  P C +VL ++G  P+ L
Sbjct  180  NDNGIAGPAREANPLGFLKKEILPECPEVLRELGITPSGL  219



>ref|XP_010549400.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=171

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 85/143 (59%), Gaps = 5/143 (3%)
 Frame = +3

Query  102  EKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSLV  281
            ++F ++G VYCD CRVQF T++S+ L+GA V+L+CKN   +  T T+E  T  +GNY + 
Sbjct  30   DRFHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKNRVNQTVTLTKEAVTDKSGNYEME  89

Query  282  VEGDHEEAICDVTVVKSPREDCKETVP---SLDKSEVLCSENAGIHS-VVRYANPLFFMP  449
            V GDHEE +C++ + +SP  +C E      + + + +  + N GI S   R  NPL FM 
Sbjct  90   VMGDHEEEVCEIVLGESPDAECSEINNEEFTRNAARISLTANDGIVSNETRSVNPLGFMR  149

Query  450  AKPDPRCKKVLADIGYIPTDLTF  518
              P   C +   ++G +P D+ F
Sbjct  150  KTPLGDCPEAFKELGIVP-DVIF  171



>ref|XP_007206364.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
 gb|EMJ07563.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
Length=160

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 83/150 (55%), Gaps = 3/150 (2%)
 Frame = +3

Query  36   IALVSAAICFLAFAGFAAGKP-GEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKN  212
            + L+  A+C L   G  + +  G  F ++GRVYCD CR  FET  +  + GA VR++CK 
Sbjct  3    VVLLLFALCVLP--GLVSARTLGNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKY  60

Query  213  LkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCS  392
              T +  Y+ E  T A G Y+++VE DHE+ IC+  +V SP  DCK   P   ++ V+ +
Sbjct  61   RNTLQLAYSVEGETDATGTYNILVEDDHEDQICESVLVSSPVNDCKSADPGRKRANVVVT  120

Query  393  ENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
               G+     YAN + F   +P   C+++L
Sbjct  121  RYNGVVKDKHYANNMGFFKDQPLAGCEELL  150



>ref|XP_006464247.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Citrus sinensis]
Length=161

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 80/137 (58%), Gaps = 2/137 (1%)
 Frame = +3

Query  99   GEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSL  278
            G+ F + GRVYCD CR  FET  +  ++GA VR++CK+  +    Y+ +  T + G Y++
Sbjct  22   GDPFHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNI  81

Query  279  VVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFFMPAKP  458
             V+GDH++ IC   ++ SP  DCK   P    S+V+ + + G  S + +AN L F+ A+P
Sbjct  82   HVDGDHQDQICYSKLISSPLADCKTADPGRACSQVILTRSNGAVSNLHFANALGFLKARP  141

Query  459  DPRCKKVLADIGYIPTD  509
               C ++L    Y+P +
Sbjct  142  LAFCPELLKK--YLPQN  156



>ref|XP_002890794.1| hypothetical protein ARALYDRAFT_336019 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67053.1| hypothetical protein ARALYDRAFT_336019 [Arabidopsis lyrata subsp. 
lyrata]
Length=621

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 87/152 (57%), Gaps = 6/152 (4%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVV  194
            MAK  I  +++A+CF     F A    +  KF ++G VYCD CRVQF T++S+ L+GA V
Sbjct  1    MAKFFILFLASALCFTTLIHFTAADADDFDKFHIKGSVYCDTCRVQFITRLSKFLEGAKV  60

Query  195  RLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPS---  365
            +L+CK  + +  T T+E  T   GNY + V GDHEE +C++ +V+SP  +C E       
Sbjct  61   KLECKGRENQTVTLTKEAVTDNAGNYQMEVMGDHEEEVCEIVLVQSPDAECGEVNNQEFL  120

Query  366  LDKSEVLCSENAGIHS-VVRYANPLFFMPAKP  458
             + + +  + N GI S   R  NPL FM   P
Sbjct  121  RNAARISLTANDGIVSNETRTINPLGFMRKTP  152



>ref|XP_004489034.1| PREDICTED: olee1-like protein-like [Cicer arietinum]
Length=166

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 92/166 (55%), Gaps = 4/166 (2%)
 Frame = +3

Query  21   MAKA--TIALVSAAICFLAFAGFAAGKPG-EKFTVEGRVYCDNCRVQFETKISESLKGAV  191
            MA++   +A++ +  CF +         G E F+V G++YCD C  +FE+++S+ L+G  
Sbjct  1    MARSFVVVAIIVSTFCFSSVLAARKAPTGVEIFSVVGKIYCDPCHFEFESRLSQPLEGVK  60

Query  192  VRLDCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLD  371
            V L C+   +   TY +E  T  NG Y + V+GDHEE +C+V    + +  C + + +  
Sbjct  61   VTLKCRKGDSNNVTYVKESRTDINGVYKINVDGDHEEEVCEVNADATGKGACSQVMAN-K  119

Query  372  KSEVLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADIGYIPTD  509
               ++ ++N G+ S+VR+ NPL FM    D +C  V +++G    D
Sbjct  120  SDRIVLTKNMGVSSLVRFVNPLGFMTQAIDSQCGNVFSELGLDKLD  165



>ref|XP_009386950.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=166

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 81/140 (58%), Gaps = 1/140 (1%)
 Frame = +3

Query  66   LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketytee  245
            LA A    G     F V+GRV+CD CR  FET +S  ++GA VR++C++  T  +T + E
Sbjct  19   LAIAARDVGVVKRGFVVQGRVFCDTCRAGFETPVSTYIQGATVRVECRSEFTGAKTCSFE  78

Query  246  vttAANGNYSLVVEGDHEE-AICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVR  422
             TT   G Y+++VEG+H++  IC+  +V SP   CK  +   +++ V  S N GI S  R
Sbjct  79   GTTDHTGTYNILVEGEHDDHEICESLLVSSPESGCKTALQGRERAPVFLSHNNGIASDTR  138

Query  423  YANPLFFMPAKPDPRCKKVL  482
            +AN L F+     P C ++L
Sbjct  139  FANSLGFLKDTSLPVCTELL  158



>ref|XP_011030966.1| PREDICTED: protein DOWNSTREAM OF FLC [Populus euphratica]
Length=157

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 85/150 (57%), Gaps = 1/150 (1%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkt  221
            L+  A+C L  +  +A + G  F V GRVYCD C+  FETK +  + GA VR++CK+   
Sbjct  4    LLLFALCVLP-SLVSAWRMGNPFHVRGRVYCDTCQCGFETKKTTYIPGATVRIECKDRTD  62

Query  222  eketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENA  401
             +  Y+ E  T + G Y + V GD  + IC V +V SP  DCK   P L+++EV+ + + 
Sbjct  63   LQLRYSLEGVTDSTGAYKIKVVGDQADRICHVVLVDSPLADCKTVHPVLNRAEVILTRSN  122

Query  402  GIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            G  S + YAN L F+  +  P C +++  +
Sbjct  123  GAISDLHYANSLGFVKDEALPGCAELVKKL  152



>ref|XP_008376286.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008343323.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008353938.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_009369651.1| PREDICTED: pollen-specific protein C13-like [Pyrus x bretschneideri]
Length=159

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 80/146 (55%), Gaps = 0/146 (0%)
 Frame = +3

Query  54   AICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteket  233
            A+C L     A       FTVEG+VYCD CR  +ETK    + GA VRL+C++  +    
Sbjct  9    ALCVLPALAAATRPMKTPFTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKSSMALV  68

Query  234  yteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHS  413
            YT+E TT + G Y + V  DH +  CD  +V SP++DC    P  +++ V+ +   GI S
Sbjct  69   YTKEGTTDSAGCYKIPVAEDHLDQFCDAVLVSSPQKDCATVSPGRERARVILTGYNGIAS  128

Query  414  VVRYANPLFFMPAKPDPRCKKVLADI  491
              R+AN + FM  +    C ++L ++
Sbjct  129  YTRFANAMGFMRTEALSGCTQILKEL  154



>gb|ABP58635.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 82/140 (59%), Gaps = 2/140 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P  +F ++G+VYCD CR +F T++SE + GA VRL C++ +    T+TE  +T A G YS
Sbjct  2    PVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCRDGENGSITFTEVGSTRAEGLYS  61

Query  276  LVVEGDHEEAICDVTVVKSPREDCKET-VPSLDKSEVLCSENAGIHSVVRYANPLFFMPA  452
            +++E DH++  C++T++ S R+DC E  V    K  +    N  ++   R  NPL F   
Sbjct  62   MLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNT-VNGTTRTVNPLGFFKK  120

Query  453  KPDPRCKKVLADIGYIPTDL  512
            +  P+C +V   +G  P D+
Sbjct  121  EALPKCPQVFNKLGMYPPDM  140



>dbj|BAB09316.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
Length=168

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 82/142 (58%), Gaps = 5/142 (4%)
 Frame = +3

Query  105  KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSLVV  284
            +F ++G VYCD CRVQF T++S+ L+GA V+L+C++      T T+E  T   G+Y + V
Sbjct  28   RFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTITLTKEAVTDKTGSYKMEV  87

Query  285  EGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVLCSENAGIHS-VVRYANPLFFMPA  452
             GDHEE +C++ +V+SP   C +        + +++  + N GI S   R  NPL FM  
Sbjct  88   TGDHEEEVCELVLVQSPDSGCSDVSTEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVQ  147

Query  453  KPDPRCKKVLADIGYIPTDLTF  518
             P   C     ++G +P D+TF
Sbjct  148  TPLADCPAAFKELGIVP-DVTF  168



>ref|XP_009764546.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Nicotiana sylvestris]
Length=161

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 81/142 (57%), Gaps = 0/142 (0%)
 Frame = +3

Query  57   ICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLktekety  236
            +C L+ +  +A   G  F V+G+ YCD CR  FET  ++ L GA VR++C++   E  TY
Sbjct  10   LCLLSASVASATFTGNPFLVKGKAYCDTCRCGFETPATKYLAGAKVRIECRHRVIEASTY  69

Query  237  teevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSV  416
            T E  T + G Y+++V  D  +  CDV +VKSP   C +     D+S V+ + N G+ S 
Sbjct  70   TVEGVTNSKGEYNILVNSDRGDDACDVILVKSPDRTCTKPNAGRDRSRVILTRNNGMISN  129

Query  417  VRYANPLFFMPAKPDPRCKKVL  482
             R+AN + F+  +P   C ++L
Sbjct  130  TRFANAMGFLRDEPLSSCTQIL  151



>gb|KFK32118.1| hypothetical protein AALP_AA6G200700 [Arabis alpina]
Length=160

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 82/154 (53%), Gaps = 2/154 (1%)
 Frame = +3

Query  21   MAKATIALVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRL  200
            M KA   +V  A+CFL     AA      F V GRV+CD C   FET  S  + GAVVRL
Sbjct  1    MWKAVTMVV--ALCFLPVLVMAARPNKNPFVVRGRVFCDTCLAGFETPASTYIPGAVVRL  58

Query  201  DCKNLkteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSE  380
            +CK+ +T +  YT +  T + G+Y ++V  DHE+  CD  +V S +  C    P  D++ 
Sbjct  59   ECKDRRTMELRYTHDAKTDSTGSYKILVNEDHEDQFCDTMLVSSSQLRCSNVSPGHDRAR  118

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVL  482
            V  +   GI +  R+AN + F+     P C +++
Sbjct  119  VTLTRFNGIATDDRFANNMAFLRDAALPGCAEIM  152



>sp|Q8H6L7.1|PHLB_PHLPR RecName: Full=Pollen allergen Phl p 11; AltName: Allergen=Phl 
p 11 [Phleum pratense]
 gb|AAN32987.1| pollen allergen Phl p 11 [Phleum pratense]
Length=143

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 70/129 (54%), Gaps = 1/129 (1%)
 Frame = +3

Query  99   GEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSL  278
            G  F V GRVYCD CR  FET +S +++GA V +DC+     +     E TT   G Y +
Sbjct  3    GPGFVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKI  62

Query  279  VVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANPLFFMPAK  455
             ++ DH+E IC+V + KSP   C E     D++ V  + N GI    +RYANP+ F   +
Sbjct  63   EIDQDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFRKE  122

Query  456  PDPRCKKVL  482
            P   C  +L
Sbjct  123  PLKECGGIL  131



>gb|AEW90941.1| group 11 grass pollen allergen F7-4 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 72/130 (55%), Gaps = 1/130 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P   F V GRVYCD CR  FET +S++++GA V +DC+     +     E TT   G Y 
Sbjct  26   PESGFIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYK  85

Query  276  LVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANPLFFMPA  452
            + ++ DH++ IC+V + KSP   C E     D++ V  + N G+     R+ANP+ F+P 
Sbjct  86   IEIDQDHQDEICEVVLTKSPDASCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFLPK  145

Query  453  KPDPRCKKVL  482
            +P   C  +L
Sbjct  146  EPRKECGGIL  155



>gb|AAM65838.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
Length=174

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 93/165 (56%), Gaps = 7/165 (4%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGE--KFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNL  215
             V +A+C  + AGFAA    +  +F ++G VYCD CRVQF T++S+ L+GA V+L+C++ 
Sbjct  11   FVVSAVCLSSLAGFAAADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSR  70

Query  216  kteketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSL---DKSEVL  386
                 T T+E  T   G+Y + V GDHEE +C++ +V+SP   C +        + +++ 
Sbjct  71   TNGTITLTKEAVTDKTGSYKMEVTGDHEEEVCELVLVQSPDSGCSDVSTEAYLRNAAKIS  130

Query  387  CSENAGIHS-VVRYANPLFFMPAKPDPRCKKVLADIGYIPTDLTF  518
             + N GI S   R  NPL FM       C     ++G +P D+TF
Sbjct  131  LTANDGIVSHETRIVNPLGFMVQTXLADCPAAFKELGIVP-DVTF  174



>ref|XP_002392460.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
 gb|EEB93390.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
Length=160

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 80/139 (58%), Gaps = 3/139 (2%)
 Frame = +3

Query  66   LAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketytee  245
            +AFA   A  P    TV G+VYCD CR  FET  S  + GA V+++CK+  + K  Y++E
Sbjct  17   IAFAARPARNP---LTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQE  73

Query  246  vttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRY  425
             TT + G Y L V  DH++ +CD  ++ SP+ +C++     D++ V+ +   GI S  RY
Sbjct  74   ATTDSTGTYKLFVSEDHQDQLCDAMLLSSPQPNCQKPAAGRDRARVILTRYNGIVSDTRY  133

Query  426  ANPLFFMPAKPDPRCKKVL  482
            AN + F   +P   C +VL
Sbjct  134  ANNMGFEMDQPLAGCTQVL  152



>ref|XP_011078225.1| PREDICTED: pollen allergen Che a 1-like [Sesamum indicum]
Length=170

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 89/157 (57%), Gaps = 10/157 (6%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkt  221
            +++ A+CFL+ A  A  + G +F V+G VYCD CRV F  K SE + GA V+L+CK+ ++
Sbjct  10   ILAGALCFLSLADVANSQ-GPEFIVKGMVYCDVCRVNFFNKFSEPMSGAQVKLECKDKES  68

Query  222  eketyteevttA-ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDK------SE  380
             K TY         NG Y+L  EGDH   +C+VT+VKS R +C E +P +D+      SE
Sbjct  69   GKVTYRMTGGETDDNGIYTLPAEGDHLGEVCEVTLVKSSRAECSE-IP-IDRSGKSPTSE  126

Query  381  VLCSENAGIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            V     +     +R ANPL F   +   +C + L D+
Sbjct  127  VTLVATSSFMDNIRLANPLVFTRKEALRKCIEFLKDV  163



>ref|XP_008245042.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 82/148 (55%), Gaps = 3/148 (2%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKP-GEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLk  218
            L+  A+C L   G  + +  G  F ++GRVYCD CR  FET  +  + GA VR++CK   
Sbjct  7    LLLFALCVLP--GLVSARTLGNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRN  64

Query  219  teketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSEN  398
            T +  Y+ E  T   G Y+++VE DHE+ IC+  +V SP  DCK   P  +++ V+ +  
Sbjct  65   TLQLAYSVEGETDTTGTYNILVEDDHEDQICESVLVSSPVNDCKSADPGRNRANVVVTRY  124

Query  399  AGIHSVVRYANPLFFMPAKPDPRCKKVL  482
             G+     YAN + F   +P   C+++L
Sbjct  125  NGVVKDKHYANNMGFFKDQPLAGCEELL  152



>ref|XP_010942360.1| PREDICTED: pollen allergen Phl p 11-like [Elaeis guineensis]
Length=174

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 76/136 (56%), Gaps = 0/136 (0%)
 Frame = +3

Query  102  EKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSLV  281
            + FT+EGRVYCD CR  FET ++  + GA VRL+C    T++ TY  E TT   G Y + 
Sbjct  38   KDFTLEGRVYCDTCRTGFETDLTTYMPGAKVRLECMRYGTDELTYKAEATTDFLGIYQMT  97

Query  282  VEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFFMPAKPD  461
            V  DH    C V +VKS  ++C E  P  D+  +  +++ G+ S +R AN L ++  KP 
Sbjct  98   VPDDHSNDQCSVVLVKSSLDNCTEIEPGRDRVRITLAQDGGLLSNIRQANALGYLIDKPL  157

Query  462  PRCKKVLADIGYIPTD  509
              C K+L   G+   D
Sbjct  158  LECGKLLQKYGFANDD  173



>pir||S43244 allergen-like protein Syr v I isoform 3 - Syringa vulgaris
Length=145

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 82/140 (59%), Gaps = 2/140 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P  +F ++G+VYCD CR +F T++SE + GA +RL CK+ +  K T+TE   T A G YS
Sbjct  7    PVPQFHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDGENGKITFTEIGYTRAEGLYS  66

Query  276  LVVEGDHEEAICDVTVVKSPREDCKET-VPSLDKSEVLCSENAGIHSVVRYANPLFFMPA  452
            ++VEGDH+   C++T++ S R+DC E  V    K  +    N  ++   R  NP+ F   
Sbjct  67   MLVEGDHKNEFCEITLISSGRKDCDEIPVEGWVKPSLKFKLNT-VNGTTRTINPIGFFKK  125

Query  453  KPDPRCKKVLADIGYIPTDL  512
            +  P+C +V   +G  P ++
Sbjct  126  EALPKCTQVYNKLGMYPPNM  145



>ref|XP_004983223.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=170

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 73/125 (58%), Gaps = 0/125 (0%)
 Frame = +3

Query  108  FTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSLVVE  287
            F V GRV+CD CR  FET +S  + GA VR++C++  T  ++ T E  T   G Y+++V 
Sbjct  36   FVVRGRVWCDTCRAGFETPVSTYIAGAKVRVECRSKTTGLKSCTYEGHTDRTGTYNILVT  95

Query  288  GDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFFMPAKPDPR  467
             +HE+ +C+  ++ SP   C  TVP  +++ V  + N G+ S VR AN L F      PR
Sbjct  96   DEHEDELCESVLISSPDMRCATTVPGRERAPVFLTSNNGVASNVRMANALGFQKDVALPR  155

Query  468  CKKVL  482
            C +VL
Sbjct  156  CAQVL  160



>gb|AEW90942.1| group 11 grass pollen allergen F7-6 [Secale cereale x Triticum 
turgidum subsp. durum]
 gb|AEW90944.1| group 11 grass pollen allergen F8-9 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 71/130 (55%), Gaps = 1/130 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P   F V GRVYCD CR  FET +S++++GA V +DC+     +     E TT   G Y 
Sbjct  26   PESGFIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYK  85

Query  276  LVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANPLFFMPA  452
            + ++ DH++ IC+V + KSP   C E     D++ V  + N G+     R+ANP+ F P 
Sbjct  86   IEIDQDHQDEICEVVLTKSPDASCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFFPK  145

Query  453  KPDPRCKKVL  482
            +P   C  +L
Sbjct  146  EPRKECGGIL  155



>ref|XP_002307104.1| hypothetical protein POPTR_0005s08000g [Populus trichocarpa]
 gb|EEE94100.1| hypothetical protein POPTR_0005s08000g [Populus trichocarpa]
Length=157

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 84/150 (56%), Gaps = 1/150 (1%)
 Frame = +3

Query  42   LVSAAICFLAFAGFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkt  221
            L+  A+C L  +  +A + G  F V GRVYCD C+  FETK +  + GA VR++CK+   
Sbjct  4    LLLFALCVLP-SLVSAWRMGNPFHVRGRVYCDTCQCGFETKKTTYISGATVRIECKDRTD  62

Query  222  eketyteevttAANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENA  401
             +  Y+ E  T + G Y + V GD  + IC V +V SP  DCK   P  +++EV+ + + 
Sbjct  63   LQLRYSMEGVTDSTGAYKIKVVGDQADRICHVVLVDSPLADCKTVHPVRNRAEVILTRSN  122

Query  402  GIHSVVRYANPLFFMPAKPDPRCKKVLADI  491
            G  S + YAN L F+  +  P C +++  +
Sbjct  123  GAISDLHYANSLGFVKDEALPGCAELVKKL  152



>gb|AEW90943.1| group 11 grass pollen allergen F8-6 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 71/130 (55%), Gaps = 1/130 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P   F V GRVYCD CR  FET +S++++GA V +DC+     +     E TT   G Y 
Sbjct  26   PESGFIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYK  85

Query  276  LVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANPLFFMPA  452
            + ++ DH++ IC+V + KSP   C E     D++ V  + N G+     R+ANP+ F P 
Sbjct  86   IEIDRDHQDEICEVVLTKSPDASCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFFPK  145

Query  453  KPDPRCKKVL  482
            +P   C  +L
Sbjct  146  EPRKECGGIL  155



>ref|XP_006428158.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
 gb|ESR41398.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
Length=250

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 77/131 (59%), Gaps = 0/131 (0%)
 Frame = +3

Query  99   GEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYSL  278
            G+ F + GRVYCD CR  FET  +  ++GA VR++CK+  +    Y+ +  T + G Y++
Sbjct  22   GDPFHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNI  81

Query  279  VVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGIHSVVRYANPLFFMPAKP  458
             V+GDH++ IC   ++ SP  DCK   P    S+V+ + + G  S + +AN L F+ A+P
Sbjct  82   HVDGDHQDQICYSKLISSPLADCKTADPGRACSQVILTRSNGAVSNLHFANALGFLKARP  141

Query  459  DPRCKKVLADI  491
               C ++L  +
Sbjct  142  LAFCPELLKKL  152



>gb|AEW90940.1| group 11 grass pollen allergen F7-1 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 70/130 (54%), Gaps = 1/130 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P   F V GRVYCD CR  FET +S++++GA V +DC+     +     E TT   G Y 
Sbjct  26   PEGGFLVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDKQGWYK  85

Query  276  LVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEV-LCSENAGIHSVVRYANPLFFMPA  452
            + ++ DH++ IC+V + KSP   C E     D++ V L S N       RYANP+ F P 
Sbjct  86   IEIDQDHQDEICEVVLTKSPDPSCAEIEEFRDRARVPLTSNNDMKQQGTRYANPIAFFPK  145

Query  453  KPDPRCKKVL  482
            +P   C  +L
Sbjct  146  EPRKECGGIL  155



>pir||S43243 allergen-like protein Syr v I isoform 2 - Syringa vulgaris
Length=145

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 83/140 (59%), Gaps = 2/140 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P  +F ++G+VYCD CR +F T++SE + GA +RL CK+ +  K T+TE   T A G YS
Sbjct  7    PVPQFHIQGQVYCDTCRARFITELSEFIPGAGIRLQCKDGEHGKITFTEIGYTRAEGLYS  66

Query  276  LVVEGDHEEAICDVTVVKSPREDCKET-VPSLDKSEVLCSENAGIHSVVRYANPLFFMPA  452
            ++VEGDH+   C++T++ S R+DC+E  +    K  +    N  ++   R  NPL F   
Sbjct  67   MLVEGDHKNEFCEITLLSSSRKDCEEIPIEGWVKPSLKFILNT-VNGTTRTINPLGFFKK  125

Query  453  KPDPRCKKVLADIGYIPTDL  512
            +  P+C +V   +G  P ++
Sbjct  126  EVLPKCPQVFNKLGMYPPNM  145



>gb|EMT13715.1| Pollen allergen Phl p 11 [Aegilops tauschii]
Length=167

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 71/130 (55%), Gaps = 1/130 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P   F V GRVYCD CR  FET +S++++GA V +DC+     +     E TT   G Y 
Sbjct  26   PEGGFIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYK  85

Query  276  LVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANPLFFMPA  452
            + ++ DH++ IC+V + KSP   C E     D++ V  + N G+     R+ANP+ F P 
Sbjct  86   IEIDQDHQDEICEVVLTKSPDPSCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFFPK  145

Query  453  KPDPRCKKVL  482
            +P   C  +L
Sbjct  146  EPRKECGGIL  155



>ref|NP_001148443.1| pollen allergen Phl p 11 precursor [Zea mays]
 gb|ACG31481.1| pollen allergen Phl p 11 [Zea mays]
 gb|ACN35276.1| unknown [Zea mays]
 gb|AFW80473.1| pollen allergen Phl p 11 [Zea mays]
Length=178

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 74/136 (54%), Gaps = 1/136 (1%)
 Frame = +3

Query  78   GFAAGKPGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttA  257
            G A+ +    F V GRVYCD CR  FET +S S+ GA V + C++    KET   E TT 
Sbjct  31   GVASAEKAGGFVVTGRVYCDPCRAGFETNVSRSVAGATVEVVCRHFGASKETLKAEATTD  90

Query  258  ANGNYSLVVEGDHEEAICDVTVVKSPREDCKETVPSLDKSEVLCSENAGI-HSVVRYANP  434
             +G Y L ++ DH+E IC+V + +SP   C E     D++ V  + N GI    VRYANP
Sbjct  91   DSGWYKLEIDQDHQEEICEVVLARSPDPGCAEIEEFRDRARVPLTSNNGIKQQGVRYANP  150

Query  435  LFFMPAKPDPRCKKVL  482
            + F    P   C  +L
Sbjct  151  IAFFRKDPLKECGALL  166



>pir||B53806 major allergen OLE5c - common olive
Length=145

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 81/140 (58%), Gaps = 2/140 (1%)
 Frame = +3

Query  96   PGEKFTVEGRVYCDNCRVQFETKISESLKGAVVRLDCKNLkteketyteevttAANGNYS  275
            P  +F ++G+VYCD CR +F T++SE + GA VRL CK+ +    T+TE   T A G YS
Sbjct  7    PVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYS  66

Query  276  LVVEGDHEEAICDVTVVKSPREDCKET-VPSLDKSEVLCSENAGIHSVVRYANPLFFMPA  452
            +++E DH++  C++T++ S R+DC E  V    K  +    N  ++   R  NPL F   
Sbjct  67   MLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNT-VNGTTRTINPLGFFKK  125

Query  453  KPDPRCKKVLADIGYIPTDL  512
            +  P+C +V   +G  P ++
Sbjct  126  EALPKCPQVFNKLGMYPPNM  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1141669978128