BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c40246_g1_i1 len=753 path=[1:0-752]

Length=753
                                                                      Score     E

ref|XP_004248170.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      284   1e-89   
ref|XP_006367645.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    283   3e-89   
ref|XP_009588484.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    278   3e-87   
gb|EYU24916.1|  hypothetical protein MIMGU_mgv1a007803mg                275   1e-86   
ref|XP_009757172.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    276   2e-86   
ref|XP_011100262.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    274   4e-86   
ref|XP_002273772.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    273   1e-85   Vitis vinifera
emb|CBI21857.3|  unnamed protein product                                273   1e-85   
emb|CDP14790.1|  unnamed protein product                                273   1e-85   
ref|XP_009590206.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    267   3e-83   
ref|XP_009793291.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    266   1e-82   
ref|XP_007198827.1|  hypothetical protein PRUPE_ppa005783mg             266   1e-82   
ref|XP_006357475.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    265   3e-82   
ref|XP_008229003.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    264   7e-82   
ref|XP_004243357.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    263   1e-81   
ref|XP_008367886.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    260   2e-80   
gb|EPS70897.1|  mannan endo-1,4-beta-mannosidase 2                      259   4e-80   
ref|XP_009357862.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    259   5e-80   
dbj|BAM05595.1|  (1-4)-beta-mannan endohydrolase                        248   2e-78   
gb|ABD47731.1|  (1-4)-beta-mannan endohydrolase                         246   2e-78   Eucalyptus globulus subsp. globulus
gb|ABD47730.1|  (1-4)-beta-mannan endohydrolase                         247   3e-78   Eucalyptus globulus subsp. globulus
ref|XP_009341984.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    254   4e-78   
dbj|BAM05593.1|  (1-4)-beta-mannan endohydrolase                        245   2e-77   
ref|XP_008353782.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    252   3e-77   
ref|NP_001280862.1|  mannan endo-1,4-beta-mannosidase 2-like            252   3e-77   
ref|XP_011037345.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    251   3e-77   
ref|XP_009336206.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    252   3e-77   
ref|XP_004139946.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    248   8e-76   
ref|XP_006376482.1|  glycosyl hydrolase family 5 family protein         247   2e-75   
gb|ABK95966.1|  unknown                                                 246   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_010490281.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      243   3e-75   
ref|XP_010052017.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    245   7e-75   
ref|XP_008448293.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      245   1e-74   
gb|KDP24127.1|  hypothetical protein JCGZ_25784                         244   2e-74   
ref|XP_010035760.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    244   2e-74   
ref|XP_010272456.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    244   2e-74   
ref|XP_002517909.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    243   4e-74   Ricinus communis
emb|CDY05783.1|  BnaC07g00200D                                          243   4e-74   
ref|XP_010260197.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    243   5e-74   
ref|XP_010260194.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    243   6e-74   
ref|XP_006409005.1|  hypothetical protein EUTSA_v10001990mg             243   6e-74   
ref|XP_010260196.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    243   6e-74   
emb|CDY31945.1|  BnaA07g00500D                                          241   2e-73   
gb|AAD20927.1|  (1-4)-beta-mannan endohydrolase                         240   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102000.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    242   6e-73   
ref|NP_179660.2|  mannan endo-1,4-beta-mannosidase 2                    240   7e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884216.1|  glycosyl hydrolase family 5 protein                238   3e-72   
ref|XP_010689012.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    238   8e-72   
ref|XP_007043603.1|  Glycosyl hydrolase superfamily protein             238   8e-72   
ref|NP_194561.1|  mannan endo-1,4-beta-mannosidase 5                    237   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296707.1|  hypothetical protein CARUB_v10013751mg             237   1e-71   
gb|KFK40440.1|  hypothetical protein AALP_AA3G373500                    237   1e-71   
gb|KDO53904.1|  hypothetical protein CISIN_1g014151mg                   236   2e-71   
ref|XP_010540874.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      235   5e-71   
ref|XP_010915914.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    234   1e-70   
ref|XP_010089553.1|  Mannan endo-1,4-beta-mannosidase 2                 234   1e-70   
emb|CDX81978.1|  BnaC08g36230D                                          234   2e-70   
ref|XP_009117471.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      234   2e-70   
ref|XP_004303129.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    233   5e-70   
ref|XP_002867455.1|  glycosyl hydrolase family 5 protein                232   7e-70   
ref|XP_006447301.1|  hypothetical protein CICLE_v10015394mg             231   1e-69   
ref|XP_008775171.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    228   2e-69   
ref|XP_006283768.1|  hypothetical protein CARUB_v10004854mg             231   2e-69   
ref|XP_008775162.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    226   6e-69   
ref|XP_006412972.1|  hypothetical protein EUTSA_v10025261mg             229   1e-68   
ref|XP_010433238.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      229   2e-68   
ref|XP_010438480.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    228   5e-68   
gb|KFK35900.1|  hypothetical protein AALP_AA4G051000                    226   2e-67   
ref|XP_010447999.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    224   1e-66   
gb|KHG04578.1|  Mannan endo-1,4-beta-mannosidase 2 -like protein        224   2e-66   
ref|XP_010526516.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    222   6e-66   
ref|XP_007152175.1|  hypothetical protein PHAVU_004G108000g             221   2e-65   
ref|XP_009144379.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    221   3e-65   
ref|XP_009144375.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    221   4e-65   
ref|XP_006594850.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    220   4e-65   
emb|CDY18983.1|  BnaC01g20850D                                          219   6e-65   
gb|KHN27892.1|  Mannan endo-1,4-beta-mannosidase 2                      217   3e-64   
ref|XP_004487276.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    217   4e-64   
ref|XP_003540365.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    217   7e-64   
ref|XP_008791709.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      216   2e-63   
gb|AFK34066.1|  unknown                                                 206   2e-62   
gb|KEH39139.1|  glycoside hydrolase family 5 protein                    212   6e-62   
ref|XP_010915420.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    211   7e-62   
ref|XP_003607459.1|  Mannan endo-1,4-beta-mannosidase                   211   1e-61   
gb|AES89656.2|  glycoside hydrolase family 5 protein                    211   1e-61   
gb|KHN31990.1|  Mannan endo-1,4-beta-mannosidase 2                      204   2e-59   
ref|XP_009400567.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    205   3e-59   
ref|XP_003527431.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    204   4e-59   
ref|XP_003539924.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    204   4e-59   
ref|XP_006859039.1|  hypothetical protein AMTR_s00068p00182430          204   4e-59   
ref|XP_004505577.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    204   5e-59   
gb|KHN35251.1|  Mannan endo-1,4-beta-mannosidase 2                      202   1e-58   
ref|XP_009421284.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    201   7e-58   
gb|AFK46805.1|  unknown                                                 201   8e-58   
ref|XP_007132717.1|  hypothetical protein PHAVU_011G118900g             194   4e-55   
ref|XP_009386799.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    191   4e-54   
ref|XP_009413849.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    191   1e-53   
gb|ADE76368.1|  unknown                                                 187   1e-52   
ref|XP_006644697.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    187   2e-52   
ref|XP_003569799.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    183   6e-51   
ref|XP_002458478.1|  hypothetical protein SORBIDRAFT_03g034420          183   6e-51   Sorghum bicolor [broomcorn]
ref|XP_010252627.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    182   1e-50   
emb|CBI33116.3|  unnamed protein product                                182   2e-50   
ref|XP_003635019.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    182   2e-50   
ref|XP_006656920.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    179   4e-50   
ref|XP_007026255.1|  Glycosyl hydrolase superfamily protein             179   3e-49   
gb|EMT32497.1|  Mannan endo-1,4-beta-mannosidase 2                      177   3e-49   
dbj|BAJ87988.1|  predicted protein                                      178   3e-49   
ref|XP_010913204.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    177   7e-49   
ref|XP_010057854.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    178   7e-49   
ref|XP_008775972.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    177   8e-49   
ref|XP_010928140.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    177   8e-49   
ref|NP_001044230.2|  Os01g0746700                                       177   1e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75800.1|  hypothetical protein OsI_03716                          177   1e-48   Oryza sativa Indica Group [Indian rice]
emb|CAN77937.1|  hypothetical protein VITISV_033630                     177   1e-48   Vitis vinifera
ref|XP_010646197.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    177   2e-48   
ref|XP_004969933.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    177   2e-48   
ref|XP_010090975.1|  Mannan endo-1,4-beta-mannosidase 6                 176   4e-48   
ref|XP_006839096.1|  hypothetical protein AMTR_s00090p00128510          175   4e-48   
ref|NP_001130322.1|  uncharacterized protein LOC100191416               176   5e-48   Zea mays [maize]
sp|Q0DCM5.2|MAN6_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    174   1e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EMS67718.1|  Mannan endo-1,4-beta-mannosidase 2                      175   2e-47   
ref|XP_002436944.1|  hypothetical protein SORBIDRAFT_10g011830          172   8e-47   Sorghum bicolor [broomcorn]
ref|XP_002520563.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    171   2e-46   Ricinus communis
ref|XP_009766447.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   3e-46   
ref|XP_011008632.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    170   6e-46   
ref|XP_008798844.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    169   7e-46   
gb|KHG13584.1|  Mannan endo-1,4-beta-mannosidase 6                      170   9e-46   
gb|EMT00136.1|  Mannan endo-1,4-beta-mannosidase 6                      163   1e-45   
ref|XP_004965323.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    169   1e-45   
ref|XP_008659495.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   2e-45   
gb|EMS62212.1|  Mannan endo-1,4-beta-mannosidase 6                      167   2e-45   
ref|XP_008659494.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   6e-45   
ref|XP_002307872.2|  hypothetical protein POPTR_0006s01100g             167   6e-45   Populus trichocarpa [western balsam poplar]
ref|XP_009401505.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   6e-45   
gb|EMT32180.1|  Mannan endo-1,4-beta-mannosidase 6                      159   2e-44   
ref|XP_003563908.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    165   5e-44   
gb|KDP37779.1|  hypothetical protein JCGZ_06458                         164   1e-43   
gb|EYU27707.1|  hypothetical protein MIMGU_mgv1a006272mg                164   2e-43   
dbj|BAK00462.1|  predicted protein                                      163   2e-43   
gb|KHG16155.1|  Mannan endo-1,4-beta-mannosidase 2 -like protein        156   8e-43   
gb|KEH36174.1|  mannan endo-1,4-beta-mannosidase-like protein           159   3e-42   
ref|XP_009631226.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    159   6e-42   
ref|NP_001280873.1|  mannan endo-1,4-beta-mannosidase 7-like prec...    158   2e-41   
ref|XP_010924296.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    154   6e-41   
ref|XP_009336054.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    154   4e-40   
ref|XP_010924295.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    154   4e-40   
ref|XP_006352457.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    149   4e-40   
ref|XP_002974444.1|  hypothetical protein SELMODRAFT_101148             153   5e-40   
ref|XP_002985744.1|  hypothetical protein SELMODRAFT_234864             153   5e-40   
ref|XP_009365114.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    154   5e-40   
ref|XP_007017589.1|  Glycosyl hydrolase superfamily protein             153   9e-40   
gb|EAZ13519.1|  hypothetical protein OsJ_03436                          152   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006352360.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    152   2e-39   
ref|XP_006878501.1|  hypothetical protein AMTR_s00011p00202020          151   2e-39   
ref|XP_004250262.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      152   3e-39   
gb|ABD47729.1|  (1-4)-beta-mannan endohydrolase                         146   5e-39   Eucalyptus globulus subsp. globulus
ref|XP_006649074.1|  PREDICTED: putative mannan endo-1,4-beta-man...    150   6e-39   
ref|XP_007046870.1|  Glycosyl hydrolase superfamily protein isofo...    150   7e-39   
ref|XP_008797528.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    150   1e-38   
ref|XP_002281804.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      150   2e-38   Vitis vinifera
ref|XP_006435034.1|  hypothetical protein CICLE_v10001262mg             149   2e-38   
gb|KEH23290.1|  mannan endo-1,4-beta-mannosidase-like protein           149   2e-38   
ref|XP_007222385.1|  hypothetical protein PRUPE_ppa006029mg             149   3e-38   
ref|XP_001760262.1|  predicted protein                                  149   3e-38   
gb|ABV32547.1|  endo-1,4-beta-mannosidase protein 1                     149   3e-38   Prunus persica
ref|XP_008220834.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    148   5e-38   
ref|XP_010113415.1|  Mannan endo-1,4-beta-mannosidase 7                 148   7e-38   
ref|XP_004512071.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   8e-38   
ref|XP_008800703.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   1e-37   
ref|XP_009407087.1|  PREDICTED: putative mannan endo-1,4-beta-man...    146   1e-37   
gb|KDO84614.1|  hypothetical protein CISIN_1g014426mg                   147   1e-37   
ref|XP_010921181.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   2e-37   
gb|KDP38537.1|  hypothetical protein JCGZ_04462                         147   2e-37   
ref|XP_006473535.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   2e-37   
ref|XP_011083658.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   2e-37   
ref|XP_010921182.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   2e-37   
ref|XP_010029765.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      146   2e-37   
ref|XP_010926118.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      146   2e-37   
ref|XP_009406291.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    146   3e-37   
ref|XP_004232427.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      146   3e-37   
ref|XP_010686734.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    146   3e-37   
ref|XP_010921180.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    146   4e-37   
gb|KCW46727.1|  hypothetical protein EUGRSUZ_K00550                     145   4e-37   
gb|KCW46726.1|  hypothetical protein EUGRSUZ_K00548                     145   4e-37   
gb|EEC71222.1|  hypothetical protein OsI_03157                          146   4e-37   Oryza sativa Indica Group [Indian rice]
gb|KHN29491.1|  Mannan endo-1,4-beta-mannosidase 6                      146   4e-37   
ref|XP_009762330.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    145   4e-37   
sp|Q0JKM9.2|MAN1_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    145   4e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009416732.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    145   5e-37   
ref|XP_010038519.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    145   5e-37   
ref|XP_003534636.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    146   5e-37   
ref|XP_010038521.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    145   6e-37   
ref|XP_010035363.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   7e-37   
ref|XP_011085841.1|  PREDICTED: putative mannan endo-1,4-beta-man...    144   8e-37   
ref|XP_004495835.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   8e-37   
ref|XP_009619497.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    145   9e-37   
gb|KEH23282.1|  mannan endo-1,4-beta-mannosidase                        145   9e-37   
gb|KEH23283.1|  mannan endo-1,4-beta-mannosidase                        145   1e-36   
ref|XP_010679767.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      145   1e-36   
emb|CBI18021.3|  unnamed protein product                                144   1e-36   
gb|ABF69949.1|  (1-4)-beta-mannan endohydrolase (mannan endo-1,4-...    144   1e-36   Musa acuminata [banana]
ref|XP_009394803.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   2e-36   
dbj|BAD17132.1|  putative (1-4)-beta-mannan endohydrolase               144   2e-36   Oryza sativa Japonica Group [Japonica rice]
gb|KHN43366.1|  Mannan endo-1,4-beta-mannosidase 1                      142   2e-36   
ref|XP_009602297.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   2e-36   
ref|NP_001048226.2|  Os02g0766900                                       143   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009365529.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   2e-36   
ref|XP_002273230.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   3e-36   Vitis vinifera
ref|XP_007140064.1|  hypothetical protein PHAVU_008G081200g             143   4e-36   
gb|KHG22102.1|  Mannan endo-1,4-beta-mannosidase 7 -like protein        143   4e-36   
ref|XP_008648425.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    144   5e-36   
ref|XP_009785219.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    142   5e-36   
gb|AFY10517.1|  endo-beta-1,4-mannanase                                 140   5e-36   
ref|XP_006373633.1|  hypothetical protein POPTR_0016s01650g             140   5e-36   
gb|KDO64139.1|  hypothetical protein CISIN_1g012093mg                   142   6e-36   
gb|KDO64137.1|  hypothetical protein CISIN_1g012093mg                   142   6e-36   
ref|XP_006340651.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    142   7e-36   
ref|XP_003552321.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    143   7e-36   
ref|XP_003612065.1|  Mannan endo-1,4-beta-mannosidase                   142   1e-35   
gb|KDO64138.1|  hypothetical protein CISIN_1g012093mg                   142   1e-35   
ref|XP_006429615.1|  hypothetical protein CICLE_v10011654mg             142   1e-35   
ref|XP_006481220.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    142   1e-35   
gb|ACU19893.1|  unknown                                                 142   2e-35   Glycine max [soybeans]
ref|XP_009410508.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 8      141   2e-35   
ref|XP_009395690.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    141   2e-35   
ref|XP_006841534.1|  hypothetical protein AMTR_s00003p00158370          141   2e-35   
gb|ACN78662.1|  endo-beta-mannanase                                     141   2e-35   Actinidia arguta
ref|XP_006373632.1|  hypothetical protein POPTR_0016s01650g             138   2e-35   
ref|XP_004492573.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    141   2e-35   
gb|KDP21853.1|  hypothetical protein JCGZ_00640                         141   2e-35   
emb|CDP07490.1|  unnamed protein product                                141   2e-35   
ref|XP_010444793.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      141   2e-35   
ref|XP_010484638.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    141   2e-35   
emb|CAC51690.3|  endo-beta-1,4-mannanase                                140   2e-35   Lactuca sativa [cultivated lettuce]
ref|XP_006841527.1|  hypothetical protein AMTR_s00003p00152240          140   3e-35   
ref|XP_010522867.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   3e-35   
ref|XP_001762204.1|  predicted protein                                  140   4e-35   
gb|KEH17803.1|  mannan endo-1,4-beta-mannosidase-like protein           140   4e-35   
ref|XP_003626672.1|  Mannan endo-1,4-beta-mannosidase                   140   4e-35   
gb|EYU45779.1|  hypothetical protein MIMGU_mgv1a020287mg                139   4e-35   
gb|AET01148.2|  mannan endo-1,4-beta-mannosidase-like protein           140   5e-35   
ref|XP_007134569.1|  hypothetical protein PHAVU_010G058300g             140   6e-35   
gb|KHN42134.1|  Mannan endo-1,4-beta-mannosidase 6                      139   6e-35   
ref|XP_006836841.1|  hypothetical protein AMTR_s00099p00070100          139   7e-35   
ref|XP_010061294.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   7e-35   
ref|XP_007134568.1|  hypothetical protein PHAVU_010G058300g             140   7e-35   
gb|AET01118.2|  mannan endo-1,4-beta-mannosidase-like protein           140   7e-35   
ref|XP_006444660.1|  hypothetical protein CICLE_v10020376mg             139   8e-35   
ref|XP_003522088.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   8e-35   
ref|XP_006576282.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   8e-35   
ref|XP_003626642.1|  Mannan endo-1,4-beta-mannosidase                   140   8e-35   
ref|XP_010522865.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   8e-35   
ref|XP_010522866.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   9e-35   
gb|KHN45867.1|  Mannan endo-1,4-beta-mannosidase 7                      139   9e-35   
ref|XP_006576281.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   9e-35   
ref|XP_002323680.2|  hypothetical protein POPTR_0016s14550g             139   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_006576280.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-34   
ref|XP_010911335.1|  PREDICTED: putative mannan endo-1,4-beta-man...    137   1e-34   
ref|XP_002466346.1|  hypothetical protein SORBIDRAFT_01g006080          140   1e-34   Sorghum bicolor [broomcorn]
gb|AFX59322.1|  endo-1,4-beta-mannanase                                 139   1e-34   
ref|XP_003548330.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-34   
ref|XP_004291857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-34   
gb|KCW68225.1|  hypothetical protein EUGRSUZ_F01879                     139   1e-34   
ref|XP_006644473.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-34   
ref|XP_001784893.1|  predicted protein                                  139   1e-34   
gb|EYU45795.1|  hypothetical protein MIMGU_mgv1a0212342mg               134   1e-34   
ref|XP_006466833.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-34   
ref|XP_011001681.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-34   
ref|XP_006599739.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-34   
ref|XP_006491440.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-34   
ref|XP_003528027.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-34   
ref|XP_003545272.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   2e-34   
emb|CAN70632.1|  hypothetical protein VITISV_020726                     135   2e-34   Vitis vinifera
ref|XP_009340713.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      139   2e-34   
ref|XP_008782689.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   2e-34   
ref|XP_010098023.1|  Mannan endo-1,4-beta-mannosidase 6                 138   2e-34   
ref|XP_011018983.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   2e-34   
ref|XP_011018989.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   2e-34   
ref|XP_011018985.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   2e-34   
ref|XP_011018984.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   2e-34   
gb|KDO70993.1|  hypothetical protein CISIN_1g013811mg                   138   2e-34   
ref|XP_011018981.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   2e-34   
ref|XP_011018982.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   2e-34   
gb|KEH17608.1|  mannan endo-1,4-beta-mannosidase-like protein           136   2e-34   
gb|EYU45780.1|  hypothetical protein MIMGU_mgv1a025011mg                137   3e-34   
gb|AGG82699.1|  endo-1,4-beta-mannosidase                               138   3e-34   
gb|KDP28371.1|  hypothetical protein JCGZ_14142                         137   3e-34   
gb|ABY58035.1|  mannase                                                 137   4e-34   
emb|CBI18019.3|  unnamed protein product                                138   4e-34   
ref|XP_010653331.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   4e-34   
ref|XP_007033492.1|  Mannan endo-1,4-beta-mannosidase 6 isoform 1       138   4e-34   
ref|XP_004143522.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   4e-34   
gb|ACN78663.1|  endo-beta-mannanase                                     137   5e-34   
ref|NP_001241893.1|  uncharacterized protein LOC100814337 precursor     137   5e-34   
gb|ACN78666.1|  endo-beta-mannanase                                     137   5e-34   
ref|XP_010327704.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   5e-34   
ref|XP_010653330.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   5e-34   
ref|XP_004238284.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   5e-34   
ref|XP_006342222.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   6e-34   
ref|XP_004249033.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   6e-34   
gb|KHG12601.1|  Mannan endo-1,4-beta-mannosidase 4                      137   7e-34   
ref|XP_002273389.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   7e-34   
ref|XP_002983364.1|  hypothetical protein SELMODRAFT_234217             135   7e-34   
ref|XP_004303778.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   7e-34   
ref|XP_002309191.2|  hypothetical protein POPTR_0006s11040g             137   8e-34   
ref|XP_003605853.1|  Mannan endo-1,4-beta-mannosidase                   136   8e-34   
gb|KDP44593.1|  hypothetical protein JCGZ_22175                         137   9e-34   
ref|XP_010327703.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   9e-34   
ref|XP_008338221.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    136   1e-33   
ref|XP_006279868.1|  hypothetical protein CARUB_v10028560mg             136   1e-33   
ref|XP_008440745.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      136   1e-33   
ref|XP_009347596.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    136   1e-33   
ref|XP_004147857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    136   1e-33   
ref|XP_004154850.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    136   1e-33   
ref|XP_006425633.1|  hypothetical protein CICLE_v10025631mg             136   1e-33   
ref|XP_004955228.1|  PREDICTED: putative mannan endo-1,4-beta-man...    136   1e-33   
gb|KGN59983.1|  hypothetical protein Csa_3G859700                       136   1e-33   
ref|XP_007160733.1|  hypothetical protein PHAVU_001G012600g             136   1e-33   
ref|XP_007051341.1|  Glycosyl hydrolase superfamily protein isofo...    135   1e-33   
ref|XP_008241714.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      136   2e-33   
gb|KHN14221.1|  Mannan endo-1,4-beta-mannosidase 1                      135   2e-33   
emb|CDY68324.1|  BnaCnng58510D                                          139   2e-33   
ref|NP_201447.1|  mannan endo-1,4-beta-mannosidase 7                    135   2e-33   
ref|XP_003521650.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    135   2e-33   
ref|XP_007136624.1|  hypothetical protein PHAVU_009G059700g             135   2e-33   
gb|KFK28321.1|  hypothetical protein AALP_AA8G500900                    135   2e-33   
ref|XP_002865067.1|  predicted protein                                  135   2e-33   
ref|XP_006362338.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    135   2e-33   
ref|XP_007202078.1|  hypothetical protein PRUPE_ppa005992mg             135   2e-33   
gb|ABV32548.1|  endo-1,4-beta-mannosidase protein 2                     135   2e-33   
ref|XP_002454605.1|  hypothetical protein SORBIDRAFT_04g034200          135   2e-33   
gb|EAZ36778.1|  hypothetical protein OsJ_21115                          136   2e-33   
ref|XP_003553696.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    135   2e-33   
gb|KHN36084.1|  Mannan endo-1,4-beta-mannosidase 7                      135   2e-33   
ref|XP_011083199.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      135   2e-33   
emb|CDX81394.1|  BnaC09g08050D                                          139   3e-33   
ref|XP_010465469.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    135   3e-33   
ref|XP_006300225.1|  hypothetical protein CARUB_v10016461mg             135   3e-33   
ref|XP_002960673.1|  hypothetical protein SELMODRAFT_403117             134   3e-33   
ref|XP_009621242.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    135   3e-33   
gb|KGN52652.1|  hypothetical protein Csa_5G648730                       130   3e-33   
gb|KDO37208.1|  hypothetical protein CISIN_1g048104mg                   133   4e-33   
gb|KHG08771.1|  Mannan endo-1,4-beta-mannosidase 6 -like protein        135   4e-33   
ref|XP_002515142.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    134   4e-33   
gb|KHN12693.1|  Mannan endo-1,4-beta-mannosidase 7                      134   4e-33   
gb|EMT21291.1|  Putative mannan endo-1,4-beta-mannosidase 9             135   4e-33   
ref|XP_006304532.1|  hypothetical protein CARUB_v10011405mg             134   5e-33   
ref|XP_010683461.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      135   5e-33   
ref|XP_002264115.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      134   5e-33   
ref|XP_008799989.1|  PREDICTED: putative mannan endo-1,4-beta-man...    134   5e-33   
gb|ACU18982.1|  unknown                                                 134   5e-33   
ref|XP_004510098.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   5e-33   
ref|XP_008800333.1|  PREDICTED: putative mannan endo-1,4-beta-man...    134   6e-33   
emb|CDP19235.1|  unnamed protein product                                134   6e-33   
gb|KEH43147.1|  mannan endo-1,4-beta-mannosidase-like protein           134   6e-33   
emb|CAC08442.1|  (1-4)-beta-mannan endohydrolase                        134   6e-33   
ref|XP_003517214.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    134   6e-33   
ref|NP_187700.1|  mannan endo-1,4-beta-mannosidase 3                    134   6e-33   
ref|XP_003549439.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    134   6e-33   
ref|XP_010490700.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   6e-33   
gb|KHN20963.1|  Mannan endo-1,4-beta-mannosidase 7                      134   7e-33   
ref|XP_009789472.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    133   7e-33   
ref|XP_002884818.1|  predicted protein                                  134   7e-33   
ref|XP_011015126.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    134   7e-33   
ref|XP_006393839.1|  hypothetical protein EUTSA_v10004263mg             134   7e-33   
ref|XP_010911765.1|  PREDICTED: putative mannan endo-1,4-beta-man...    132   7e-33   
ref|XP_009112304.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    134   8e-33   
ref|XP_008805818.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    133   8e-33   
gb|ADN34185.1|  endo-beta-mannanase                                     134   8e-33   
ref|XP_008805817.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    133   8e-33   
ref|XP_010943133.1|  PREDICTED: putative mannan endo-1,4-beta-man...    134   9e-33   
dbj|BAK01294.1|  predicted protein                                      130   9e-33   
ref|XP_010064850.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    133   1e-32   
emb|CDP01989.1|  unnamed protein product                                134   1e-32   
ref|XP_009616057.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      133   1e-32   
ref|XP_010254774.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    133   1e-32   
ref|XP_008466539.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    134   1e-32   
ref|XP_003573047.1|  PREDICTED: putative mannan endo-1,4-beta-man...    133   1e-32   
ref|XP_009785881.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      133   1e-32   
ref|XP_011013722.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    133   1e-32   
ref|XP_002510418.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    133   1e-32   
gb|AFK43830.1|  unknown                                                 133   1e-32   
ref|XP_003591288.1|  Mannan endo-1,4-beta-mannosidase                   133   2e-32   
ref|XP_002528703.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    133   2e-32   
ref|XP_011025293.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   2e-32   
ref|XP_002306881.1|  hypothetical protein POPTR_0005s25120g             132   2e-32   
ref|XP_009789471.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   2e-32   
gb|EYU42035.1|  hypothetical protein MIMGU_mgv1a005847mg                133   2e-32   
gb|EYU42036.1|  hypothetical protein MIMGU_mgv1a005847mg                133   2e-32   
gb|ACG41070.1|  1,4-beta-D-mannan endohydrolase precursor               132   2e-32   
ref|XP_010490985.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   3e-32   
ref|XP_010490914.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   3e-32   
ref|XP_003634618.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    132   3e-32   
ref|XP_010550422.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      132   3e-32   
ref|XP_006407494.1|  hypothetical protein EUTSA_v10020842mg             132   3e-32   
ref|XP_008664308.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    132   4e-32   
gb|KHN46504.1|  Mannan endo-1,4-beta-mannosidase 5                      131   4e-32   
ref|XP_010263608.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   4e-32   
ref|XP_003626162.1|  Mannan endo-1,4-beta-mannosidase                   132   4e-32   
ref|XP_009760858.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      132   4e-32   
ref|XP_009103527.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      132   4e-32   
ref|XP_008804040.1|  PREDICTED: putative mannan endo-1,4-beta-man...    131   5e-32   
gb|EYU22710.1|  hypothetical protein MIMGU_mgv1a023976mg                131   5e-32   
ref|XP_010457203.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   5e-32   
ref|XP_008372937.1|  PREDICTED: putative mannan endo-1,4-beta-man...    129   5e-32   
ref|XP_006356528.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   5e-32   
ref|XP_011007449.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   5e-32   
ref|XP_011011941.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   5e-32   
ref|XP_010110051.1|  Mannan endo-1,4-beta-mannosidase 7                 131   6e-32   
ref|NP_001234473.1|  (1-4)-beta-mannan endohydrolase precursor          131   6e-32   
ref|XP_006478472.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   6e-32   
emb|CDY18606.1|  BnaA09g07890D                                          135   7e-32   
ref|XP_009779875.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   7e-32   
ref|XP_010911540.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   8e-32   
ref|XP_010480869.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      131   8e-32   
ref|XP_010464779.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   8e-32   
gb|ACL52784.1|  unknown                                                 127   8e-32   
emb|CDY45231.1|  BnaA07g12590D                                          131   9e-32   
ref|XP_003540598.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   9e-32   
ref|XP_011090525.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   9e-32   
ref|XP_002272344.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      130   9e-32   
ref|XP_006441716.1|  hypothetical protein CICLE_v10023981mg             130   9e-32   
ref|XP_010418656.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    125   1e-31   
ref|XP_004962462.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    131   1e-31   
ref|XP_009370901.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   1e-31   
ref|XP_009370900.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    131   1e-31   
ref|XP_004141631.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   1e-31   
ref|XP_010244546.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      131   1e-31   
ref|XP_003591290.1|  Mannan endo-1,4-beta-mannosidase                   130   1e-31   
ref|XP_008456477.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      131   1e-31   
ref|XP_010914840.1|  PREDICTED: putative mannan endo-1,4-beta-man...    130   1e-31   
ref|XP_009614144.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   2e-31   
ref|XP_002974905.1|  hypothetical protein SELMODRAFT_232427             130   2e-31   
ref|XP_002988915.1|  hypothetical protein SELMODRAFT_129038             130   2e-31   
gb|KHN12618.1|  Mannan endo-1,4-beta-mannosidase 4                      129   2e-31   
ref|XP_009614143.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   2e-31   
ref|XP_006383170.1|  (1-4)-beta-mannan endohydrolase family protein     130   2e-31   
ref|XP_004164540.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   2e-31   
ref|XP_002270023.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      130   2e-31   
ref|XP_007163300.1|  hypothetical protein PHAVU_001G223100g             130   2e-31   
ref|XP_010490811.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   2e-31   
ref|XP_006296763.1|  hypothetical protein CARUB_v10015594mg             130   2e-31   
gb|EMT06168.1|  Mannan endo-1,4-beta-mannosidase 7                      129   2e-31   
ref|XP_010486712.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   2e-31   
ref|XP_010543149.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   2e-31   
ref|XP_010543147.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   3e-31   
ref|XP_006588317.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   3e-31   
ref|XP_009774303.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   3e-31   
ref|XP_010543148.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   3e-31   
gb|EMS49637.1|  Mannan endo-1,4-beta-mannosidase 7                      129   3e-31   
ref|XP_004149910.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   3e-31   
ref|XP_009593808.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   3e-31   
ref|XP_009774302.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   3e-31   
ref|XP_009774301.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   3e-31   
ref|XP_002302695.1|  hypothetical protein POPTR_0002s18530g             129   3e-31   
ref|XP_009614142.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   3e-31   
ref|XP_006663750.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    129   3e-31   
dbj|BAJ87939.1|  predicted protein                                      127   4e-31   
ref|XP_007216338.1|  hypothetical protein PRUPE_ppa020168mg             129   4e-31   
ref|XP_011069567.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   4e-31   
ref|XP_006279332.1|  hypothetical protein CARUB_v10012718mg             129   4e-31   
emb|CBI17044.3|  unnamed protein product                                129   4e-31   
ref|XP_006590697.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    128   5e-31   
ref|XP_011025835.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      129   5e-31   
ref|XP_010474643.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   5e-31   
gb|AFY10516.1|  endo-beta-1,4-mannanase                                 126   5e-31   
ref|NP_187701.1|  putative mannan endo-1,4-beta-mannosidase 4           129   5e-31   
gb|EPS69785.1|  endo-beta-mannanase                                     129   6e-31   
ref|XP_009119647.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      129   6e-31   
sp|Q0IQJ7.2|MAN8_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    128   6e-31   
gb|ACN33740.1|  unknown                                                 126   7e-31   
ref|XP_008459570.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    128   7e-31   
gb|AAN34823.1|  endo-beta-mannanase                                     128   7e-31   
gb|KEH43148.1|  mannan endo-1,4-beta-mannosidase-like protein           128   8e-31   
gb|ABC87082.1|  1,4-beta-D-mannan endohydrolase precursor               127   8e-31   
gb|EEE52650.1|  hypothetical protein OsJ_35012                          127   8e-31   
emb|CDX89985.1|  BnaA10g00970D                                          128   9e-31   
ref|XP_006398561.1|  hypothetical protein EUTSA_v10013730mg             128   9e-31   
ref|XP_010490492.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    128   1e-30   
dbj|BAJ34043.1|  unnamed protein product                                128   1e-30   
ref|XP_006356570.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    128   1e-30   
ref|XP_008245064.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   1e-30   
emb|CDP06381.1|  unnamed protein product                                128   1e-30   
ref|XP_004141536.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   1e-30   
ref|NP_195813.1|  mannan endo-1,4-beta-mannosidase 6                    127   2e-30   
ref|XP_006418357.1|  hypothetical protein EUTSA_v10007769mg             127   2e-30   
ref|XP_006590696.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   2e-30   
ref|XP_006356569.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   2e-30   
ref|XP_003537602.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   2e-30   
emb|CDP20125.1|  unnamed protein product                                127   2e-30   
emb|CAC08208.1|  (1-4)-beta-mannan endohydrolase                        127   2e-30   
ref|XP_010043514.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   2e-30   
gb|EEC67554.1|  hypothetical protein OsI_34887                          127   2e-30   
ref|XP_010424015.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   2e-30   
tpg|DAA58240.1|  TPA: putative endo-1,4-beta-mannosidase family p...    127   2e-30   
ref|XP_010043507.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   2e-30   
ref|NP_001145882.1|  uncharacterized protein LOC100279398 precursor     127   2e-30   
ref|XP_008370277.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   2e-30   
ref|XP_007207326.1|  hypothetical protein PRUPE_ppa005849mg             127   2e-30   



>ref|XP_004248170.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Solanum lycopersicum]
Length=444

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG KS K  + NPEFWAADLG+DFIRNS + T+DFASVHVYPD W  +++FEEK+ F
Sbjct  261  EGFYGRKSPKRSTGNPEFWAADLGSDFIRNSMLSTIDFASVHVYPDHWFHDKNFEEKLKF  320

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW++SHI DGDK L+KP+MFTEFGLS EN++F+P +RD+F+K++LD IYKSA+RN SG
Sbjct  321  AAKWMLSHIEDGDKELRKPIMFTEFGLSNENEDFEPAQRDRFYKMVLDFIYKSAKRNRSG  380

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSFFWQFL EGME YNDDFGIVPWERPSTY+LITEHSCRLA+ HG L TQ ++LK  C+
Sbjct  381  AGSFFWQFLVEGMELYNDDFGIVPWERPSTYELITEHSCRLAKEHGLLHTQMEHLKDFCA  440

Query  541  S  543
            S
Sbjct  441  S  441



>ref|XP_006367645.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Solanum tuberosum]
Length=444

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG KS K  S NPEFWAADLG+DFIRNS + T+DFASVHVYPD W  ++ FEEK+ F
Sbjct  261  EGFYGRKSPKRSSGNPEFWAADLGSDFIRNSMLSTIDFASVHVYPDHWFHDKKFEEKLKF  320

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW++SHI DGDK L+KP+MFTEFGLS EN++F+P +RD+F+K++LD IYKSA+RN SG
Sbjct  321  AAKWMLSHIEDGDKELRKPIMFTEFGLSNENEDFEPAQRDRFYKMVLDFIYKSAKRNRSG  380

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSFFWQFL EGME YNDDFGIVPWERPSTYQLITE SCRLA+ HG L TQ ++LK  C+
Sbjct  381  AGSFFWQFLVEGMELYNDDFGIVPWERPSTYQLITEQSCRLAKEHGVLPTQMEHLKDFCA  440

Query  541  S  543
            S
Sbjct  441  S  441



>ref|XP_009588484.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
tomentosiformis]
Length=444

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 152/183 (83%), Gaps = 1/183 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG KS K  + NPEFWAADLG+DFIRNS + T+DFASVH+YPD W  ++ FEEK+ F
Sbjct  262  EGFYGRKSPKRSTGNPEFWAADLGSDFIRNSMLSTIDFASVHIYPDHWF-HKKFEEKLKF  320

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW++SHI DGDK L+KP+MFTEFGLS EN++F+P +RD+F+K++LD+IYKSA+RN SG
Sbjct  321  AAKWMLSHIEDGDKELRKPIMFTEFGLSNENEDFEPVQRDRFYKMVLDIIYKSAKRNRSG  380

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSFFWQFL EGME YNDDFGIVPWERPSTYQLITE SCRLAR H  L TQ +YLK  C+
Sbjct  381  AGSFFWQFLVEGMELYNDDFGIVPWERPSTYQLITEQSCRLAREHDILPTQTEYLKDFCT  440

Query  541  SHS  549
              S
Sbjct  441  RTS  443



>gb|EYU24916.1| hypothetical protein MIMGU_mgv1a007803mg [Erythranthe guttata]
Length=394

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPEFWAAD+G DFIRNSKI TVDFASVH+YPD W  N  FE K+ F
Sbjct  213  EGFYGPKSPKRLTVNPEFWAADIGTDFIRNSKISTVDFASVHIYPDHWTHNPDFEYKLKF  272

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK LKKP+MFTEFGLSTEN +F P +R++F+KVILD+IYKSA RN SG
Sbjct  273  VTKWMLSHIEDGDKELKKPIMFTEFGLSTENIDFTPSQRERFYKVILDIIYKSAVRNKSG  332

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AGS  WQFL EGME++NDDFGIVP++ PST +L TE SC+LAR+ G L TQ DYLK LC
Sbjct  333  AGSLVWQFLVEGMEEFNDDFGIVPYDNPSTDKLFTEQSCKLARIQGALPTQMDYLKKLC  391



>ref|XP_009757172.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
sylvestris]
 ref|XP_009757173.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
sylvestris]
 ref|XP_009757174.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
sylvestris]
Length=444

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 151/183 (83%), Gaps = 1/183 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG KS K  + NPEFWAADLG+DFIRNS + T+DFASVH+YPD W  ++ FEEK+ F
Sbjct  262  EGFYGRKSPKRSTGNPEFWAADLGSDFIRNSMLSTIDFASVHIYPDHWF-HKKFEEKLKF  320

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW++SHI DGDK L+KP+MFTEFGLS EN +F+P +RD+F+K++LD+IYKSA+RN SG
Sbjct  321  AAKWMLSHIEDGDKELRKPIMFTEFGLSNENDDFEPVQRDRFYKMVLDIIYKSAKRNRSG  380

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSF WQFL EGME YNDDFGIVPWERPSTYQLITE SCRLAR HG L TQ ++LK  C+
Sbjct  381  AGSFIWQFLVEGMELYNDDFGIVPWERPSTYQLITEQSCRLAREHGVLPTQTEHLKDFCT  440

Query  541  SHS  549
              S
Sbjct  441  RTS  443



>ref|XP_011100262.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Sesamum indicum]
Length=436

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPEFWAAD+G DFIRNSKI  VDFASVH+YPD W  N  FE K+ F
Sbjct  255  EGFYGPKSPKRLTVNPEFWAADVGTDFIRNSKISAVDFASVHIYPDHWTHNPDFEYKLKF  314

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK LKKPVMFTEFGLSTEN +F P +R++ +KVI D+IYKSA RN +G
Sbjct  315  VYKWMLSHIEDGDKELKKPVMFTEFGLSTENNDFTPTQRERMYKVIYDVIYKSALRNKAG  374

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL EGMED+NDDFGI+PW+RPSTY+L TE SCRLAR+ G L +Q  YL+ LC+
Sbjct  375  AGALVWQFLVEGMEDFNDDFGIIPWKRPSTYKLFTEQSCRLARVQGALPSQLGYLRRLCT  434



>ref|XP_002273772.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Vitis vinifera]
 ref|XP_010656969.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Vitis vinifera]
 ref|XP_010656970.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Vitis vinifera]
Length=437

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K ++VNP  WAA LGADFIRNSKI T+DFAS H+YPD W   Q FE ++ +
Sbjct  255  EGFYGPNSPKRLTVNPAEWAATLGADFIRNSKISTIDFASAHIYPDHWFHGQEFEAELKY  314

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DG+K LKKPVMFTEFG ST+NK F P KRD+FFK + D++Y+SAR+N +G
Sbjct  315  VSKWMLSHIEDGEKELKKPVMFTEFGFSTDNKNFHPSKRDRFFKTVFDVMYQSARKNGAG  374

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSF WQFL  GME+YNDDFGIVPWERP+TY+LITEH+CRLAR+ G L+ QK  LK LCS
Sbjct  375  AGSFVWQFLVGGMEEYNDDFGIVPWERPATYRLITEHTCRLARIQGGLAQQKASLKDLCS  434



>emb|CBI21857.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K ++VNP  WAA LGADFIRNSKI T+DFAS H+YPD W   Q FE ++ +
Sbjct  250  EGFYGPNSPKRLTVNPAEWAATLGADFIRNSKISTIDFASAHIYPDHWFHGQEFEAELKY  309

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DG+K LKKPVMFTEFG ST+NK F P KRD+FFK + D++Y+SAR+N +G
Sbjct  310  VSKWMLSHIEDGEKELKKPVMFTEFGFSTDNKNFHPSKRDRFFKTVFDVMYQSARKNGAG  369

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSF WQFL  GME+YNDDFGIVPWERP+TY+LITEH+CRLAR+ G L+ QK  LK LCS
Sbjct  370  AGSFVWQFLVGGMEEYNDDFGIVPWERPATYRLITEHTCRLARIQGGLAQQKASLKDLCS  429



>emb|CDP14790.1| unnamed protein product [Coffea canephora]
Length=440

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPEFWAADLG+DFIRNSKI TVDFASVH+YPD W  +Q+FEEK+ F
Sbjct  258  EGFYGPKSPKRLTVNPEFWAADLGSDFIRNSKISTVDFASVHIYPDHWFHDQAFEEKLKF  317

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGD  LKKPV+FTEFGLS ENK+F P +RDKF K+ILD+IYKSA+R+ +G
Sbjct  318  VSKWMLSHIEDGDGELKKPVLFTEFGLSDENKDFTPSQRDKFMKLILDIIYKSAKRDKAG  377

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSF WQF   GME Y DDF IVPWERPSTYQL T  SC+LA L G L +QK  LK  CS
Sbjct  378  AGSFVWQFFVGGMEKYYDDFAIVPWERPSTYQLFTRQSCKLAALQGVLPSQKQRLKDFCS  437



>ref|XP_009590206.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009590207.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009590208.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
tomentosiformis]
Length=440

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K    NPE WAADLG+DFIRNS + TVDFASVHVYPD W  +++FEE + F
Sbjct  258  EGFYGPKSPKKSIANPEVWAADLGSDFIRNSILSTVDFASVHVYPDHWFHHKNFEEMLKF  317

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW++SHI DGD+ LKKPV+FTEFGLS +N++F+P +RD+F K++LD+IYKSA+RN SG
Sbjct  318  AAKWMLSHIEDGDRELKKPVLFTEFGLSNDNEDFEPAQRDRFLKMVLDVIYKSAKRNRSG  377

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSFFWQFL E ME +ND++GIVPWE PSTY+LIT+ SCRLA++ G LSTQ ++LK+ C+
Sbjct  378  AGSFFWQFLVERMERFNDEYGIVPWENPSTYRLITDQSCRLAKVQGLLSTQVEHLKNFCA  437

Query  541  SHS  549
            + +
Sbjct  438  ARN  440



>ref|XP_009793291.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
sylvestris]
Length=440

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K    NPE WAADLG+DFIRNS + TVDFASVHVYPD W  +++FEE + F
Sbjct  258  EGFYGPKSPKKSIANPEVWAADLGSDFIRNSILSTVDFASVHVYPDHWFHHKNFEEMLKF  317

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW++SHI DGD+ LKKPV+FTEFGLS +N++F+P +RD+F K++LD+IYKSA+RN SG
Sbjct  318  AAKWMLSHIEDGDRELKKPVLFTEFGLSNDNEDFEPAQRDRFLKMVLDVIYKSAKRNRSG  377

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSFFWQFL E ME +ND++GIVPWE PSTY+LIT+ SCRLA++ G LSTQ ++LK+ C+
Sbjct  378  AGSFFWQFLVERMERFNDEYGIVPWENPSTYRLITDQSCRLAKVQGLLSTQVEHLKNFCA  437



>ref|XP_007198827.1| hypothetical protein PRUPE_ppa005783mg [Prunus persica]
 gb|EMJ00026.1| hypothetical protein PRUPE_ppa005783mg [Prunus persica]
Length=444

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK+ K ++VNPE WA+ LG+DFIRNSK+P +DFASVH+YPD W  ++ F E + F
Sbjct  263  EGFYGPKNPKRLTVNPEMWASRLGSDFIRNSKVPNIDFASVHIYPDHWFHDKEFHENLKF  322

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGDK L KPVMFTE+GLS +NK+F+P +RD+F+KVILD IYKSA++N SG
Sbjct  323  VSKWMHSHIEDGDKELNKPVMFTEYGLSNQNKDFEPSQRDRFYKVILDAIYKSAKKNGSG  382

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGS  WQ    GM+ YND+FGIVPWERPSTY+LI E SCRLARLHGP   Q++ LK LCS
Sbjct  383  AGSLVWQLFVGGMDKYNDEFGIVPWERPSTYKLIIEQSCRLARLHGPTQQQRN-LKDLCS  441



>ref|XP_006357475.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Solanum tuberosum]
Length=441

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K  + NPE WAADLG+DF+RNS + TVDFASVHVYPD W  +++FEE + F
Sbjct  258  EGFYGPKSPKKTTANPEIWAADLGSDFVRNSILSTVDFASVHVYPDHWFHHKNFEEMLKF  317

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW++SHI DGDK LKKPV+FTEFGLS +N +F+P +RD+F K++LD++YKSA+RN SG
Sbjct  318  AAKWMLSHIEDGDKELKKPVLFTEFGLSNDNDDFEPAQRDRFLKMVLDVLYKSAKRNKSG  377

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSFFWQFLAE ME +ND++G+VPWE PSTY+LIT+ SCRLA++ G  STQ + +K+ C+
Sbjct  378  AGSFFWQFLAEKMERFNDEYGVVPWESPSTYRLITQQSCRLAKVQGLHSTQIENVKNFCA  437

Query  541  S  543
            S
Sbjct  438  S  438



>ref|XP_008229003.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Prunus mume]
 ref|XP_008229004.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Prunus mume]
Length=444

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK+ K ++VNPE WA+ LG+DFIRNSKIP +DFASVH+YPD W  ++ F E + F
Sbjct  263  EGFYGPKNPKRLTVNPEMWASRLGSDFIRNSKIPNIDFASVHIYPDHWFHDKEFHENLKF  322

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGDK L KPVMFTE+GLS +NK+F+P +RD+F+KVILD IYKSA++N SG
Sbjct  323  VSKWMHSHIEDGDKELNKPVMFTEYGLSNQNKDFEPSQRDRFYKVILDAIYKSAKKNGSG  382

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGS  WQ    GM+ YND+FGIVPWERPSTY+LI E SCRLARLH P   Q++ LK+LCS
Sbjct  383  AGSLVWQLFVGGMDKYNDEFGIVPWERPSTYKLIIEQSCRLARLHRPTQQQRN-LKNLCS  441



>ref|XP_004243357.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Solanum lycopersicum]
Length=441

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K  + NPE WAADLG+DF+RNS + TVDFASVHVYPD W  +++FEE + F
Sbjct  258  EGFYGPKSPKKTTANPEIWAADLGSDFVRNSILSTVDFASVHVYPDHWFHHKNFEEMLKF  317

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW++SHI DGDK LKKPV+FTEFGLS +N +F+P +RD+F K++LD+IYKSA+RN SG
Sbjct  318  AAKWMLSHIEDGDKELKKPVLFTEFGLSNDNDDFEPAQRDRFLKMVLDVIYKSAKRNKSG  377

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSFFWQFL E ME +ND++G+VPWE PSTY+LITE SCRLA++ G  STQ + + + C+
Sbjct  378  AGSFFWQFLVEKMERFNDEYGVVPWESPSTYRLITEQSCRLAKVQGLHSTQIENVNNFCA  437

Query  541  S  543
            S
Sbjct  438  S  438



>ref|XP_008367886.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Malus domestica]
Length=443

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++ NPE WA+ LG+DFIRNSKIP +DFASVH+YPD W  ++ F E + F
Sbjct  262  EGFYGPKSPKRLTANPEMWASRLGSDFIRNSKIPNIDFASVHIYPDHWFHDEEFHENLKF  321

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DG+  L KPVMFTE+GLS +NK+F+P +R++F+K ILD+IYKSA++N SG
Sbjct  322  VSKWMRSHIEDGBNELNKPVMFTEYGLSNQNKDFEPSQRERFYKTILDVIYKSAKKNRSG  381

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL EGM++YND+FGIVPW+RPS Y++I E SCRLARL GP   Q++ LK LCS
Sbjct  382  AGALAWQFLVEGMDEYNDEFGIVPWKRPSEYKIIVEQSCRLARLKGPTQQQRN-LKDLCS  440



>gb|EPS70897.1| mannan endo-1,4-beta-mannosidase 2 [Genlisea aurea]
Length=439

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS+K ++VNPE WAA+ G DFIRNSKIPT+DFASVH+YPD W R   FE ++ F
Sbjct  258  EGFYGPKSAKRLTVNPEVWAAEFGTDFIRNSKIPTIDFASVHIYPDHWTRKPDFEYQLRF  317

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              +W++SHI DGDK L+KP++FTEFGLSTENK F    RDK +++ILD+IYKS  R  SG
Sbjct  318  AFRWMLSHIEDGDKELRKPILFTEFGLSTENKGFSHSNRDKLYRIILDVIYKSGLRKRSG  377

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL EGME++NDDFGIVPWER STY+L  E SCRLAR+ G L +Q  +L+ LC+
Sbjct  378  AGTLVWQFLVEGMEEFNDDFGIVPWERQSTYKLFAEQSCRLARIQGALPSQLRHLRKLCT  437



>ref|XP_009357862.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Pyrus x bretschneideri]
 ref|XP_009357869.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Pyrus x bretschneideri]
Length=443

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 144/180 (80%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++ NPE WA+ LG+DFIRNSKI  +DFASVH+YPD W  ++ F E + F
Sbjct  262  EGFYGPKSPKRLTANPEMWASRLGSDFIRNSKITNIDFASVHIYPDHWFHDEEFHENLKF  321

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGD  L KP+MFTE+GLS +NK+F+P +R++F+K ILD+IYKSA++N SG
Sbjct  322  VSKWMRSHIEDGDNELNKPIMFTEYGLSNQNKDFEPSQRERFYKTILDVIYKSAKKNRSG  381

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL EGM++YND+FGIVPWERPS Y++I E SCRLARL GP   Q++ LK LCS
Sbjct  382  AGALAWQFLVEGMDEYNDEFGIVPWERPSEYKMIVEQSCRLARLKGPTQQQRN-LKDLCS  440



>dbj|BAM05595.1| (1-4)-beta-mannan endohydrolase [Eucalyptus globulus subsp. globulus]
Length=221

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK+ KS++VNP  WAA  G+DF+ NS +P +DFAS H+YPD W     FEE V F
Sbjct  40   EGFYGPKNPKSLTVNPADWAALYGSDFVHNSNLPNIDFASAHIYPDHWFHEIEFEESVKF  99

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGD+VLKKPVMFTEFG S +N  F P +RD+FFK I D IY SAR+N +G
Sbjct  100  VSKWVRSHIDDGDRVLKKPVMFTEFGYSNQNPNFHPSQRDRFFKTIFDEIYASARKNGAG  159

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AGSF WQF   GME+YNDDFGIVPW+R STYQLITEHSCRLA L G L+  K  L+ LC
Sbjct  160  AGSFVWQFFVGGMEEYNDDFGIVPWQRSSTYQLITEHSCRLAALRG-LNQLKGSLRELC  217



>gb|ABD47731.1| (1-4)-beta-mannan endohydrolase [Eucalyptus globulus subsp. globulus]
Length=182

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K  +VNP  + + LG+DFIRNS+IP +DFAS H+YPD W +NQ FEE++ +
Sbjct  3    EGFYGPNSPKKPTVNPGEYFSLLGSDFIRNSEIPNIDFASAHIYPDHWFKNQDFEEELKY  62

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V  W  SHI DGD++L+KP+MFTEFG ST NK+FDP KRD+FFK I D+IYKSA++  +G
Sbjct  63   VALWTRSHIDDGDRILRKPIMFTEFGYSTLNKDFDPSKRDRFFKTIYDVIYKSAKKQGAG  122

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSF WQF   GME YNDDFGIVPWERP TY+LIT+HSCR+AR+ G  +  K  LK LCS
Sbjct  123  AGSFVWQFWVGGMEKYNDDFGIVPWERPETYKLITQHSCRMARIRGS-AELKGNLKELCS  181



>gb|ABD47730.1| (1-4)-beta-mannan endohydrolase [Eucalyptus globulus subsp. globulus]
Length=224

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK+ KS++VNP  WAA  G+DF+ NS +P +DFAS H+YPD W     FEE V F
Sbjct  43   EGFYGPKNPKSLTVNPADWAALYGSDFVHNSNLPNIDFASAHIYPDHWFHEIEFEESVKF  102

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGD+VLKKPVMFTEFG S +N  F P +RD+FFK I D IY SAR+N +G
Sbjct  103  VSKWVRSHIDDGDRVLKKPVMFTEFGYSNQNPNFHPSQRDRFFKTIFDEIYASARKNGAG  162

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AGSF WQF   GME+YNDDFGIVPW+R STYQLITEHSCRLA L G L+  K  L+ LC
Sbjct  163  AGSFVWQFFVGGMEEYNDDFGIVPWQRSSTYQLITEHSCRLAALRG-LNQLKGSLRELC  220



>ref|XP_009341984.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Pyrus x bretschneideri]
Length=443

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA+ LG+DFIRNSKIP +DFASVH+YPD W  ++ F   + F
Sbjct  262  EGFYGPKSPKRLTVNPEMWASRLGSDFIRNSKIPNIDFASVHIYPDHWFHDEEFHNNLKF  321

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGD  L KPVMFTE+GLS ENK+F+P +R +F+K ILD+IYKSA++N SG
Sbjct  322  VSKWMRSHIEDGDNELNKPVMFTEYGLSNENKDFEPSQRGRFYKTILDVIYKSAKKNQSG  381

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQF   GM++YND+FGI+PWE PS Y+++ E SCRLARL GP   Q++ LK LCS
Sbjct  382  AGALAWQFFVGGMDEYNDEFGIIPWESPSEYKMMIEQSCRLARLKGPTQQQRN-LKDLCS  440



>dbj|BAM05593.1| (1-4)-beta-mannan endohydrolase [Eucalyptus pilularis]
 dbj|BAM05594.1| (1-4)-beta-mannan endohydrolase [Eucalyptus pyrocarpa]
Length=221

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK+ KS++VNP  WAA  G+DF+RNS +P +DFAS H+YPD W     FEE V F
Sbjct  40   EGFYGPKNPKSLTVNPADWAALYGSDFVRNSNLPNIDFASAHIYPDHWFHEIEFEESVKF  99

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGD+ LKKPV+FTEFG S +N  F P +RD+FFK I D IY SAR+N +G
Sbjct  100  VSKWVRSHIDDGDRELKKPVVFTEFGYSNQNPNFHPSQRDRFFKTIFDEIYASARKNGAG  159

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AGSF WQF   GME+YNDDFGIVPW+R STYQLITEHSCRLA L G L+  K  L+ LC
Sbjct  160  AGSFVWQFFVGGMEEYNDDFGIVPWQRSSTYQLITEHSCRLAALRG-LNQLKGSLRELC  217



>ref|XP_008353782.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Malus domestica]
Length=443

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA+ LG+DFIRNSKIP +DFASVH+YPD W  ++ F   + F
Sbjct  262  EGFYGPKSPKRLTVNPEMWASRLGSDFIRNSKIPNIDFASVHIYPDHWFHDEEFHNNLKF  321

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGD  L KPVMFTE+GLS +NK+F+P +R +F+K ILD+IYKSA++N SG
Sbjct  322  VYKWMRSHIEDGDNELNKPVMFTEYGLSNQNKDFEPSQRVRFYKTILDVIYKSAKKNQSG  381

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQF   GM++YND+FGI+PWE PS Y+++ E SCRLARL GP   Q++ LK LCS
Sbjct  382  AGALAWQFFVGGMDEYNDEFGIIPWESPSEYKMMIEQSCRLARLXGPTQXQRN-LKDLCS  440



>ref|NP_001280862.1| mannan endo-1,4-beta-mannosidase 2-like [Malus domestica]
 gb|ACN78665.1| endo-beta-mannanase [Malus domestica]
Length=443

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA+ LG+DFIRNSKIP +DFASVH+YPD W  ++ F   + F
Sbjct  262  EGFYGPKSPKRLTVNPEMWASRLGSDFIRNSKIPNIDFASVHIYPDHWFHDEEFHNNLKF  321

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGD  L KPVMFTE+GLS +NK+F+P +R +F+K ILD+IYKSA++N SG
Sbjct  322  VYKWMRSHIEDGDNELNKPVMFTEYGLSNQNKDFEPSQRVRFYKTILDVIYKSAKKNQSG  381

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQF   GM++YND+FGI+PWE PS Y+++ E SCRLARL GP   Q++ LK LCS
Sbjct  382  AGALAWQFFVGGMDEYNDEFGIIPWESPSEYKMMIEQSCRLARLKGPTQQQRN-LKDLCS  440



>ref|XP_011037345.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Populus euphratica]
Length=435

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 143/179 (80%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK+ K ++VNPE WA++LG+DF+RNSK P +DFASVH+YPD W  +Q FE+K+ +
Sbjct  254  EGFYGPKNPKRLTVNPESWASNLGSDFVRNSKAPAIDFASVHIYPDHWFPHQEFEDKLKY  313

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DG   L KPV FTEFGLS  NK+F P +RD+F+K I D+IYKS++RN +G
Sbjct  314  VSKWMLSHIEDGHYELNKPVFFTEFGLSNLNKDFQPSQRDRFYKTIFDIIYKSSKRNRAG  373

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AG+  WQ   EGM+++NDDFGIVPWER STY+++T+ SCRLAR+HG +S Q  YLK LC
Sbjct  374  AGALIWQLFVEGMDEFNDDFGIVPWERESTYRILTDQSCRLARIHG-ISPQNKYLKELC  431



>ref|XP_009336206.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Pyrus x bretschneideri]
Length=443

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA+ LG+DFIRNSKIP +DFASVH+YPD W  ++ F   + F
Sbjct  262  EGFYGPKSPKRLTVNPEMWASRLGSDFIRNSKIPNIDFASVHIYPDHWFHDEEFHNNLKF  321

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGD  L KPVMFTE+GLS +NK+F+P +R +F+K ILD+IYKSA++N SG
Sbjct  322  VSKWMRSHIEDGDNELNKPVMFTEYGLSNQNKDFEPSQRGRFYKTILDVIYKSAKKNQSG  381

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQF   GM +YND+FGI+PWE PS Y+++ E SCRLARL GP   Q++ LK LCS
Sbjct  382  AGALAWQFFVGGMGEYNDEFGIIPWESPSEYKMMMEQSCRLARLKGPTQQQRN-LKDLCS  440



>ref|XP_004139946.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Cucumis sativus]
 ref|XP_004154548.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Cucumis sativus]
 gb|KGN46738.1| hypothetical protein Csa_6G127990 [Cucumis sativus]
Length=431

 Score =   248 bits (632),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K  +VNPE WA+ LG+DFIRNS+I  VDFASVH+YPD W  +Q FE+++ F
Sbjct  250  EGFYGPNSPKKSTVNPEEWASRLGSDFIRNSEIQHVDFASVHIYPDHWFHDQDFEDELKF  309

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK LKKPVMFTEFGLS  NK F P +RD F+K + D+IYKSA+RN SG
Sbjct  310  VSKWMLSHIEDGDKELKKPVMFTEFGLSDLNKGFTPAQRDSFYKTVYDVIYKSAKRNRSG  369

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGS  WQFL EGME+ NDDFGIVPWER S YQLI E SCRLAR+ G  + Q   LK +C+
Sbjct  370  AGSLAWQFLVEGMEESNDDFGIVPWERSSIYQLIIEQSCRLARIGGD-TQQLKALKYVCA  428



>ref|XP_006376482.1| glycosyl hydrolase family 5 family protein [Populus trichocarpa]
 gb|ERP54279.1| glycosyl hydrolase family 5 family protein [Populus trichocarpa]
Length=435

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 140/179 (78%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK+ K ++VNPE WA+ LG+DF+RNSK P +DFASVH+YPD W  +Q FE+K+ +
Sbjct  254  EGFYGPKNPKRLTVNPESWASSLGSDFVRNSKAPAIDFASVHIYPDHWFPHQEFEDKLKY  313

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DG   L KPV FTEFGLS  NK+F P +RD+F+K I D+IYKS++R  +G
Sbjct  314  VSKWMLSHIEDGHYELNKPVFFTEFGLSNLNKDFQPSQRDRFYKTIFDIIYKSSKRKRAG  373

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AG+  WQ   EGM+D+NDDFGIVPWER ST +++T+ SCRLAR+HG +S Q  YLK LC
Sbjct  374  AGALIWQLFVEGMDDFNDDFGIVPWERESTNRILTDQSCRLARIHG-ISPQNKYLKELC  431



>gb|ABK95966.1| unknown [Populus trichocarpa]
Length=435

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 140/179 (78%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK+ K ++VNPE WA+ LG+DF+RNSK P +DFASVH+YPD W  +Q FE+K+ +
Sbjct  254  EGFYGPKNPKRLTVNPESWASSLGSDFVRNSKAPAIDFASVHIYPDHWFPHQEFEDKLKY  313

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DG   L KPV FTEFGLS  NK+F P +RD+F+K I D+IYKS++R  +G
Sbjct  314  VSKWMLSHIEDGHYELSKPVFFTEFGLSNLNKDFQPSQRDRFYKTIFDIIYKSSKRKRAG  373

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AG+  WQ   EGM+D+NDDFGIVPWER ST +++T+ SCRLAR+HG +S Q  YLK LC
Sbjct  374  AGALIWQLFVEGMDDFNDDFGIVPWERESTNRILTDQSCRLARIHG-ISPQNKYLKELC  431



>ref|XP_010490281.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Camelina sativa]
Length=330

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K ++VNPE WA++LG+DF+RNS  P +DFASVH+YPD W  ++ FEEK+ F
Sbjct  148  EGFYGPNSPKRLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDKGFEEKLKF  207

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK LKKPV+FTEFGLS  NK++DP +RD+F++ I D+IYKSA+R  SG
Sbjct  208  VVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDIIYKSAKRRRSG  267

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL +GME +NDDFGIVPWE+ S  +L+ EHSCRL R+ G    Q +    +CS
Sbjct  268  AGTLMWQFLIQGMERFNDDFGIVPWEQGSIQRLMMEHSCRLGRVTGRHLLQDNKSIDMCS  327



>ref|XP_010052017.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Eucalyptus 
grandis]
 gb|KCW89538.1| hypothetical protein EUGRSUZ_A01823 [Eucalyptus grandis]
Length=435

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 134/179 (75%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK+ KS++VNP  WAA  G+DF+ NS +P +DFAS H+YPD W     FEE V F
Sbjct  254  EGFYGPKNPKSLTVNPADWAALYGSDFVHNSNLPNIDFASAHIYPDHWFHEIEFEESVKF  313

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGD+ LKKPVMFTEFG S +N  F P +RD+FFK I D IY SAR+N +G
Sbjct  314  VSKWVRSHIDDGDRELKKPVMFTEFGYSNQNPNFHPSQRDRFFKTIFDEIYASARKNGAG  373

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AGSF WQF   GME+YNDDFGIVPW+R STYQLITEHSCRLA L G L+  K  L+ LC
Sbjct  374  AGSFVWQFFVGGMEEYNDDFGIVPWQRSSTYQLITEHSCRLAALRG-LNQLKGSLRELC  431



>ref|XP_008448293.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Cucumis melo]
Length=431

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 138/180 (77%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K  +VNPE WA+ LG+DFIRNS+IP VDFASVH+YPD W  +Q FE+++ F
Sbjct  250  EGFYGPNSPKKSTVNPEEWASRLGSDFIRNSEIPHVDFASVHIYPDHWFHDQDFEDELKF  309

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK LKKPVMFTEFGLS  NK F   +RD F+K + D+IYKSA+R  SG
Sbjct  310  VSKWMLSHIEDGDKELKKPVMFTEFGLSDLNKGFTHAQRDSFYKTVYDVIYKSAKRKRSG  369

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGS  WQFL EGME+ NDDFGIVPWER S YQLI E SCRLAR+ G  + Q   LK +C+
Sbjct  370  AGSLAWQFLVEGMEESNDDFGIVPWERSSIYQLIIEQSCRLARIGGD-TQQLKALKYVCA  428



>gb|KDP24127.1| hypothetical protein JCGZ_25784 [Jatropha curcas]
Length=433

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK++K ++VNPE WA  LG+DFIRNSK+P +DFA+VH+YPD W  +Q FEEK+ F
Sbjct  250  EGFYGPKNAKRLTVNPENWAETLGSDFIRNSKVPDIDFATVHIYPDHWFNDQEFEEKLRF  309

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DG   L KPV FTE+G S  +K F P +R++F+K +LD+IYKSA+R  +G
Sbjct  310  VSKWMLSHIEDGHYELNKPVFFTEYGFSNMSKGFQPSQRERFYKTVLDIIYKSAKRKRAG  369

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AG+  WQF  EGME++ND+FGIVPWER STY+L TE SCRLAR+HG +  Q   LK LC
Sbjct  370  AGALVWQFFVEGMEEFNDEFGIVPWERISTYRLFTEQSCRLARIHG-IPEQNKNLKELC  427



>ref|XP_010035760.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Eucalyptus 
grandis]
 gb|KCW47223.1| hypothetical protein EUGRSUZ_K01032 [Eucalyptus grandis]
Length=438

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K  +VNP  + + LG+DFIRNS+I  +DFAS H+YPD W +NQ FEE++ +
Sbjct  259  EGFYGPNSPKKPTVNPGEYFSLLGSDFIRNSEIQNIDFASAHIYPDHWFKNQDFEEELKY  318

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V  W  SHI DGD++L+KP+MFTEFG ST NK+FDP KRD+FFK I D+IYKSA++  +G
Sbjct  319  VALWTRSHIDDGDRILRKPIMFTEFGYSTLNKDFDPSKRDRFFKTIYDVIYKSAKKQGAG  378

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGSF WQF   GME YNDDFGIVPWERP TY+LIT+HSCR+AR+ G  +  K  LK LCS
Sbjct  379  AGSFVWQFWVGGMEKYNDDFGIVPWERPETYKLITQHSCRMARIRGS-AELKGNLKELCS  437



>ref|XP_010272456.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nelumbo nucifera]
 ref|XP_010272457.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nelumbo nucifera]
Length=428

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGP-KSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP ++ + +SVNPE WA  LG+DFI+NS+I T+DFAS+HVYPD W + +  E+K+ 
Sbjct  250  EGFYGPSRNPEKLSVNPEAWATLLGSDFIQNSEISTIDFASIHVYPDNWFKEKELEDKLK  309

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            FV KW++SHI DGDKVLKKPVM TEFGLS +NK+F+P  RDKF+K I D+IY+SAR+N +
Sbjct  310  FVSKWVISHIEDGDKVLKKPVMVTEFGLSNKNKDFEPSHRDKFYKTIYDIIYESARKNGA  369

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            GAG+F WQFL EGME+YNDDFGIVPWER STY++I + SCRLA + G     K  LK +C
Sbjct  370  GAGAFPWQFLVEGMEEYNDDFGIVPWERSSTYRMILDQSCRLAGIGGQ-DQSKGILKEIC  428



>ref|XP_002517909.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF44427.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=431

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK+ K ++VNPE WA++LG+DFIRNSK+P +DFASVH+YPD W++NQ  EEK+ F
Sbjct  250  EGFYGPKNPKRLTVNPEEWASNLGSDFIRNSKVPDIDFASVHIYPDHWIQNQGLEEKLTF  309

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DG   L KPV FTE+G S  NK+F P+ RD+F+K +LD+IYKSA+R  +G
Sbjct  310  VYKWMQSHIEDGHYELNKPVFFTEYGFSNLNKDFRPDHRDRFYKTVLDVIYKSAKRKRAG  369

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG-PLSTQKDYLKSLC  537
            AG+  WQ   E ME++NDDFGIVPWERPSTY+ +TE SC+LAR+ G P   Q  Y K LC
Sbjct  370  AGALVWQLFVEEMEEFNDDFGIVPWERPSTYRFLTEQSCKLARIQGDPRPNQ--YFKDLC  427



>emb|CDY05783.1| BnaC07g00200D [Brassica napus]
Length=431

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA++LG+DF+RNS+ P +DFASVH+YPD W  +Q FE+KV F
Sbjct  250  EGFYGPKSPKRLTVNPERWASELGSDFVRNSESPNIDFASVHIYPDHWFHDQGFEDKVKF  309

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK LKKPV+FTEFGLS  NK+++P +RD+F++ I D++YKSA+R  SG
Sbjct  310  VVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYEPSQRDRFYRTIFDVVYKSAKRTRSG  369

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL +GME +NDDFGIVPWE+ S  +L+TE SCRLAR+ G    Q +  + +CS
Sbjct  370  AGTLVWQFLIQGMEGFNDDFGIVPWEKDSIQRLMTEQSCRLARVTGR-HLQDEKWREICS  428



>ref|XP_010260197.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like isoform X3 
[Nelumbo nucifera]
Length=427

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP+S + +SVNPE WA+ LG+DFIRNSKI  +DFASVH+YPDQW +    E+K+ F
Sbjct  250  EGFYGPRSPEKLSVNPEAWASVLGSDFIRNSKISIIDFASVHIYPDQWFKEIELEDKLKF  309

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGDK+LKKPVMFTEFGLS  N+ F P  R+K +K + D+IY+SAR+N +G
Sbjct  310  VSKWMTSHIEDGDKMLKKPVMFTEFGLSNTNRNFQPSHREKLYKTVYDIIYESARKNGAG  369

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AG+F WQFL  GME+YNDDFGIVPWER STY++I E SCRLA + G     K  L+ +C
Sbjct  370  AGAFPWQFLVGGMEEYNDDFGIVPWERSSTYRMILEQSCRLAGIGGH-DQSKGSLQEIC  427



>ref|XP_010260194.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010260195.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like isoform X1 
[Nelumbo nucifera]
Length=437

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP+S + +SVNPE WA+ LG+DFIRNSKI  +DFASVH+YPDQW +    E+K+ F
Sbjct  260  EGFYGPRSPEKLSVNPEAWASVLGSDFIRNSKISIIDFASVHIYPDQWFKEIELEDKLKF  319

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGDK+LKKPVMFTEFGLS  N+ F P  R+K +K + D+IY+SAR+N +G
Sbjct  320  VSKWMTSHIEDGDKMLKKPVMFTEFGLSNTNRNFQPSHREKLYKTVYDIIYESARKNGAG  379

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AG+F WQFL  GME+YNDDFGIVPWER STY++I E SCRLA + G     K  L+ +C
Sbjct  380  AGAFPWQFLVGGMEEYNDDFGIVPWERSSTYRMILEQSCRLAGIGGH-DQSKGSLQEIC  437



>ref|XP_006409005.1| hypothetical protein EUTSA_v10001990mg [Eutrema salsugineum]
 gb|ESQ50458.1| hypothetical protein EUTSA_v10001990mg [Eutrema salsugineum]
Length=434

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 139/182 (76%), Gaps = 0/182 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA++LG+DF+RNS+ P +DFASVH+YPD W  +Q FEEKV F
Sbjct  251  EGFYGPKSPKRLTVNPERWASELGSDFVRNSESPNIDFASVHIYPDHWFHDQGFEEKVKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGDK LKKPV+FTEFGLS  NK+++P +RD+F++ I D++YKSA+R  SG
Sbjct  311  VVKWMQSHIEDGDKELKKPVLFTEFGLSNLNKDYEPSQRDRFYRTIFDVVYKSAKRRRSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ L +GME +NDDFGIVPWE+ S  +L+ E SCRL R+ G    Q    + +CS
Sbjct  371  AGTLVWQLLIQGMEGFNDDFGIVPWEQDSIQRLMMEQSCRLIRVTGRHHLQDKKSRDMCS  430

Query  541  SH  546
             H
Sbjct  431  QH  432



>ref|XP_010260196.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like isoform X2 
[Nelumbo nucifera]
Length=433

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP+S + +SVNPE WA+ LG+DFIRNSKI  +DFASVH+YPDQW +    E+K+ F
Sbjct  256  EGFYGPRSPEKLSVNPEAWASVLGSDFIRNSKISIIDFASVHIYPDQWFKEIELEDKLKF  315

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGDK+LKKPVMFTEFGLS  N+ F P  R+K +K + D+IY+SAR+N +G
Sbjct  316  VSKWMTSHIEDGDKMLKKPVMFTEFGLSNTNRNFQPSHREKLYKTVYDIIYESARKNGAG  375

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AG+F WQFL  GME+YNDDFGIVPWER STY++I E SCRLA + G     K  L+ +C
Sbjct  376  AGAFPWQFLVGGMEEYNDDFGIVPWERSSTYRMILEQSCRLAGIGGH-DQSKGSLQEIC  433



>emb|CDY31945.1| BnaA07g00500D [Brassica napus]
Length=423

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA++LG+DF+RNS+ P +DFASVH+YPD W  +Q FE+KV F
Sbjct  242  EGFYGPKSPKRLTVNPERWASELGSDFVRNSESPNIDFASVHIYPDHWFHDQGFEDKVKF  301

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGD+ LKKPV+FTEFGLS  NK+++P +RD+F++ I D++YKSA+R  SG
Sbjct  302  VVKWMLSHIEDGDQELKKPVLFTEFGLSNLNKDYEPSQRDRFYRTIFDLVYKSAKRKRSG  361

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL +GME +NDDFGIVPWE+ S  +L+TE SCRLAR+ G    Q    + +CS
Sbjct  362  AGTLVWQFLIQGMEGFNDDFGIVPWEKKSIQRLMTEQSCRLARVTGR-HLQDKKSREICS  420



>gb|AAD20927.1| (1-4)-beta-mannan endohydrolase [Arabidopsis thaliana]
Length=403

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K ++VNPE WA++LG+DF+RNS  P +DFASVH+YPD W  +Q FEEK+ F
Sbjct  222  EGFYGPSSPKKLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDQGFEEKLKF  281

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK LKKPV+FTEFGLS  NK++DP +RD+F++ I D+IYKSA+R  SG
Sbjct  282  VVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDVIYKSAKRKRSG  341

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL EGME +NDDFGIVPWE+ S  +L+ E SCRL+R+ G     K  ++ +CS
Sbjct  342  AGTLVWQFLIEGMEGFNDDFGIVPWEQDSIQRLMIEQSCRLSRITGRHLLDKKSIE-MCS  400



>ref|XP_009102000.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Brassica 
rapa]
Length=498

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA++LG+DF+RNS+ P +DFASVH+YPD W  +Q FE+KV F
Sbjct  317  EGFYGPKSPKRLTVNPERWASELGSDFVRNSESPNIDFASVHIYPDHWFHDQGFEDKVKF  376

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGD+ LKKPV+FTEFGLS  NK+++P +RD+F++ I D++YKSA+R  SG
Sbjct  377  VVKWMLSHIEDGDQELKKPVLFTEFGLSNLNKDYEPSQRDRFYRTIFDLVYKSAKRKRSG  436

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL +GME +NDDFGIVPWE+ S  +L+TE SCRLAR+ G    Q    + +CS
Sbjct  437  AGTLVWQFLIQGMEGFNDDFGIVPWEKKSIQRLMTEQSCRLARVTGR-HLQDKKSREICS  495



>ref|NP_179660.2| mannan endo-1,4-beta-mannosidase 2 [Arabidopsis thaliana]
 sp|Q7Y223.1|MAN2_ARATH RecName: Full=Mannan endo-1,4-beta-mannosidase 2; AltName: Full=Beta-mannanase 
2; AltName: Full=Endo-beta-1,4-mannanase 2; 
Short=AtMAN2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAP40422.1| putative glycosyl hydrolase family 5 protein/cellulase ((1-4)-beta-mannan 
endohydrolase) [Arabidopsis thaliana]
 gb|ABG25077.1| At2g20680 [Arabidopsis thaliana]
 dbj|BAF00487.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07056.1| mannan endo-1,4-beta-mannosidase 2 [Arabidopsis thaliana]
Length=433

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K ++VNPE WA++LG+DF+RNS  P +DFASVH+YPD W  +Q FEEK+ F
Sbjct  252  EGFYGPSSPKKLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDQGFEEKLKF  311

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK LKKPV+FTEFGLS  NK++DP +RD+F++ I D+IYKSA+R  SG
Sbjct  312  VVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDVIYKSAKRKRSG  371

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL EGME +NDDFGIVPWE+ S  +L+ E SCRL+R+ G     K  ++ +CS
Sbjct  372  AGTLVWQFLIEGMEGFNDDFGIVPWEQDSIQRLMIEQSCRLSRITGRHLLDKKSIE-MCS  430



>ref|XP_002884216.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60475.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=432

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + K ++VNPE WA++LG+DF+RNS  P +DFASVH+YPD W  +Q FEEK+ F
Sbjct  251  EGFYGPNNPKRLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDQGFEEKLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK LKKPV+FTEFGLS  NK++DP +RD+F++ I D+IYKSA+R  SG
Sbjct  311  VVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDVIYKSAKRKRSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL EGME +NDDFGIVPWE+ S  +L+ E SCRL+R+ G     K  ++ +CS
Sbjct  371  AGTLVWQFLIEGMEGFNDDFGIVPWEQDSIQRLMIEQSCRLSRVTGRHLLDKKSIE-MCS  429



>ref|XP_010689012.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=444

 Score =   238 bits (607),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 139/179 (78%), Gaps = 2/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG K+SKS ++NP  W   +G DF+RN+ IPTVDFAS+H+YPDQWL   + E+K+ F
Sbjct  264  EGFYGSKNSKS-ALNPSEWEGTIGTDFVRNNDIPTVDFASIHMYPDQWLTVDNLEDKLEF  322

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            VRKW+ SHI DG+K LKKPVM TEFGLS++NK+FDP +RD+ FKV+ D+IYKSA++N SG
Sbjct  323  VRKWVSSHIEDGEKQLKKPVMLTEFGLSSQNKDFDPAQRDRLFKVVYDIIYKSAKKNGSG  382

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AGS  WQ   EGM+D++DDFGI+PW R STY +IT  SCRLA LH   S  +  LK+LC
Sbjct  383  AGSLLWQLFVEGMDDFHDDFGIIPWRRQSTYDVITRQSCRLALLH-QRSNLEGNLKNLC  440



>ref|XP_007043603.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
 gb|EOX99434.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
Length=451

 Score =   238 bits (607),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K  +VNPE WA+ LG+DF+RNS I  VDF SVH+YPD W  +  FEEK  +
Sbjct  270  EGFYGPKSPKKSTVNPEEWASTLGSDFVRNSNIANVDFTSVHIYPDHWFHDLGFEEKRSY  329

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI D DK LKKPVMFTE+GLS +NK+F P +R++F++ I D+IYKSA++  SG
Sbjct  330  VSKWMRSHIEDCDKELKKPVMFTEYGLSNQNKDFQPSQRERFYRTISDIIYKSAKKKGSG  389

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQF  EGME+YNDDFG+VPWE P+ Y+L  E SCRLAR+ G L  +K   K LCS
Sbjct  390  AGALVWQFFVEGMEEYNDDFGLVPWESPAIYKLTIEQSCRLARIQG-LIHEKGNWKELCS  448



>ref|NP_194561.1| mannan endo-1,4-beta-mannosidase 5 [Arabidopsis thaliana]
 sp|Q9M0H6.1|MAN5_ARATH RecName: Full=Mannan endo-1,4-beta-mannosidase 5; AltName: Full=Beta-mannanase 
5; AltName: Full=Endo-beta-1,4-mannanase 5; 
Short=AtMAN5; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB79634.1| putative (1-4)-beta-mannan endohydrolase [Arabidopsis thaliana]
 gb|ABG48480.1| At4g28320 [Arabidopsis thaliana]
 dbj|BAF00634.1| putative (1-4)-beta-mannan endohydrolase [Arabidopsis thaliana]
 gb|AEE85469.1| mannan endo-1,4-beta-mannosidase 5 [Arabidopsis thaliana]
Length=431

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K ++VNPE WA+ LG DF++NS    +DFASVH+YPD W  NQ+FEEK+ F
Sbjct  251  EGFYGPNSPKGLTVNPEQWASQLGTDFVQNSNSSNIDFASVHIYPDHWFHNQTFEEKLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DG K LKKPV+FTEFGLS +NK+++P +RDKF+++I D++YKSA+R  SG
Sbjct  311  VVKWMQSHIEDGLKELKKPVLFTEFGLSNQNKDYEPSQRDKFYRIIFDVVYKSAKRKKSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ   EGME +NDDFGIVP E+ S Y+L+ E SCRL ++ G L  QK  LK LCS
Sbjct  371  AGTLVWQLFMEGMETFNDDFGIVPHEQDSIYKLMIEQSCRLGKVTGRLKEQK--LKELCS  428



>ref|XP_006296707.1| hypothetical protein CARUB_v10013751mg [Capsella rubella]
 gb|EOA29605.1| hypothetical protein CARUB_v10013751mg [Capsella rubella]
Length=433

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA++LG+DF+RNS  P +DFASVH+YPD W  +  FE+K+ F
Sbjct  252  EGFYGPKSPKRLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDLGFEDKLKF  311

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK LKKPV+FTEFGLS  NK++DP +RD+F++ I D+IYKSA+R  SG
Sbjct  312  VVKWILSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDIIYKSAKRRRSG  371

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL EGME +NDDFGIVPWE+ S  +L+ E SCRL R+ G     K  ++ +CS
Sbjct  372  AGTLMWQFLIEGMEGFNDDFGIVPWEQDSIQRLMIEQSCRLGRITGRHLQDKKSIE-ICS  430



>gb|KFK40440.1| hypothetical protein AALP_AA3G373500 [Arabis alpina]
Length=432

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA++LG+DF+RNS  P +DFASVH+YPD W  +Q FEEK+ F
Sbjct  251  EGFYGPKSPKRLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDQGFEEKLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK LKKPV+FTEFGLS  NK+++P +RD+F++ I D++YKSA+R  SG
Sbjct  311  VVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYEPAQRDRFYRTIFDVVYKSAKRKRSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQF+ EGME +NDDFGIVPWE+ S  +L+ E SCRL R+ G     K   + +CS
Sbjct  371  AGTLVWQFVIEGMEGFNDDFGIVPWEQDSIQRLMKEQSCRLGRVTGRHLLDKKS-REMCS  429



>gb|KDO53904.1| hypothetical protein CISIN_1g014151mg [Citrus sinensis]
Length=430

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA+ LG+DFIRNS    +DFASVH+YPD W  +  FE+ + F
Sbjct  251  EGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDLEFEDDLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK L KPV FTE+GLS   K F+P  RDK +K ILD++YKSA+R  SG
Sbjct  311  VTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYKSAKRKRSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ   EGME+YNDDFGIVPWER STY+L+TE SC L R+   L+ +K  LK LCS
Sbjct  371  AGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRI-SRLNLEKGNLKELCS  429



>ref|XP_010540874.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Tarenaya hassleriana]
Length=428

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 135/180 (75%), Gaps = 5/180 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + K ++VNPE WA++LG+DFIRNS    +DFASVH+YPD W  +Q FE+K+ F
Sbjct  251  EGFYGSNNPKRLTVNPERWASELGSDFIRNSASRNIDFASVHIYPDHWFHDQGFEDKLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK LKKPV+FTEFGLS  NK+++P +RD+F+K I D+IYKSA+R  SG
Sbjct  311  VMKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYEPSQRDRFYKTIFDVIYKSAKRKRSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ L EGME +NDDFGIVPWER S Y+L+ + SCRL R       Q   LK LCS
Sbjct  371  AGTLVWQLLVEGMEGFNDDFGIVPWERESLYKLMIQQSCRLGR-----DRQDKSLKELCS  425



>ref|XP_010915914.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
2-like [Elaeis guineensis]
Length=433

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 133/166 (80%), Gaps = 1/166 (1%)
 Frame = +1

Query  1    EGFYGPK-SSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP  S++ +SVNP  W + LG+DFIRNSKIP +DFASVH+YPD WL    F+EK+ 
Sbjct  252  EGFYGPTXSAEKLSVNPGPWFSTLGSDFIRNSKIPDIDFASVHIYPDNWLVQAGFDEKMK  311

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            ++ KW+VSHI DGD+VLKKP++FTEFG+S  NK FD   RD F+K I D+I++SA++N +
Sbjct  312  YISKWVVSHIEDGDRVLKKPILFTEFGISNRNKNFDHSHRDVFYKNIFDIIHESAKKNGA  371

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
            GAG+F WQF+ EGM++YNDDFGIVPWERPS YQLI   SCRLA LH
Sbjct  372  GAGAFVWQFMVEGMQEYNDDFGIVPWERPSMYQLIKGQSCRLASLH  417



>ref|XP_010089553.1| Mannan endo-1,4-beta-mannosidase 2 [Morus notabilis]
 gb|EXB37999.1| Mannan endo-1,4-beta-mannosidase 2 [Morus notabilis]
Length=433

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 140/179 (78%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA+ LGADFIRNS+IP +DFASVH+YPD W    +FE+ + +
Sbjct  252  EGFYGPKSPKRLTVNPEEWASRLGADFIRNSQIPYIDFASVHIYPDHWFHGLAFEDNLKY  311

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + KW+ SHI DGDK L KPVMFTEFGLS  NK+F+P +RDK++  I D+IYKSA++  +G
Sbjct  312  LSKWVRSHIEDGDKELMKPVMFTEFGLSNLNKDFEPSQRDKYYITIYDLIYKSAKKGGAG  371

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AG+F WQFL EGME+YNDDFG++PWE PS Y L+   SCRLARL G ++ Q+  L +LC
Sbjct  372  AGAFIWQFLVEGMEEYNDDFGMIPWENPSIYSLVVRQSCRLARLQG-VTQQQGNLNALC  429



>emb|CDX81978.1| BnaC08g36230D [Brassica napus]
Length=432

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 138/181 (76%), Gaps = 1/181 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA++LG+DF+RNS+ P +DFASVH+YPD W  +Q FEE + F
Sbjct  251  EGFYGPKSPKRLTVNPERWASELGSDFVRNSESPNIDFASVHIYPDHWFHDQGFEENLRF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW+ SH+ DGDK LKKPV+FTEFGLS  NK+++P +RD+F++ I D++YKSA+R  SG
Sbjct  311  AVKWMQSHMEDGDKELKKPVLFTEFGLSNMNKDYEPSQRDRFYRTIFDVVYKSAKRKRSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL +GME +ND+FGIVPWE+ S  +L+ E SCRL R+ G L  Q      +CS
Sbjct  371  AGTLVWQFLIQGMEGFNDEFGIVPWEKDSIQRLMMEQSCRLGRVTGRL-LQDKKATEICS  429

Query  541  S  543
            +
Sbjct  430  N  430



>ref|XP_009117471.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Brassica rapa]
 ref|XP_009117472.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Brassica rapa]
 emb|CDY13860.1| BnaA09g43620D [Brassica napus]
Length=432

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 139/181 (77%), Gaps = 1/181 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA++LG+DF+RNS+ P +DFASVH+YPD W  +Q FEE + F
Sbjct  251  EGFYGPKSPKRLTVNPERWASELGSDFVRNSESPNIDFASVHIYPDHWFHDQGFEENLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW+ SH+ DGDK LKKPV+FTEFGLS  NK+++P +RD+F++ I D+IYKSA+R  SG
Sbjct  311  AVKWMQSHMEDGDKELKKPVLFTEFGLSNMNKDYEPSQRDRFYRTIFDVIYKSAKRKRSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFL +GME +ND+FGIVPWE+ S  +L+ E SCRL R+ G L   K   + +CS
Sbjct  371  AGTLVWQFLIQGMEGFNDEFGIVPWEKDSIQRLMMEQSCRLGRVTGRLLQDKKSTE-VCS  429

Query  541  S  543
            +
Sbjct  430  N  430



>ref|XP_004303129.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 140/179 (78%), Gaps = 9/179 (5%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK  K+++VNPE WA+ LG+DFIRNSKIP++DFASVH+YPD W  +   E+ + F
Sbjct  264  EGFYGPKDPKALTVNPERWASRLGSDFIRNSKIPSIDFASVHIYPDHWFHDLEVEDHLKF  323

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DG+K L KPVMFTEFGL+        ++ D+F+K I D+IYKSA+++ +G
Sbjct  324  VTKWMLSHIEDGEKELNKPVMFTEFGLA--------DQLDRFYKTIYDIIYKSAKKHQAG  375

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            AG+  WQF+  GME +ND+FGI+PWERP+TY+LI EH+CRLAR+ GP+  Q++ LK LC
Sbjct  376  AGALAWQFIVGGMEKFNDEFGIIPWERPATYKLIIEHTCRLARIQGPVLEQRN-LKELC  433



>ref|XP_002867455.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43714.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=431

 Score =   232 bits (592),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 136/180 (76%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K ++VNPE WA++LG DF++NS    +DFASVH+YPD W  NQ+FEEK+ F
Sbjct  251  EGFYGPNSPKRLTVNPEQWASELGTDFVQNSNSSNIDFASVHIYPDHWFHNQTFEEKLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DG K LKKPV+FTEFGLS  NK+++P +RDKF+++I D+IYKSA+R  SG
Sbjct  311  VVKWMQSHIEDGFKELKKPVLFTEFGLSNLNKDYEPSQRDKFYRIIFDVIYKSAKRKKSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ   EGME ++DDFGIVP E+ S Y+L+ E SCRL ++ G L  Q   LK LCS
Sbjct  371  AGTLVWQLFMEGMETFSDDFGIVPHEQDSIYKLMIEQSCRLGKVTGRLKEQN--LKELCS  428



>ref|XP_006447301.1| hypothetical protein CICLE_v10015394mg [Citrus clementina]
 ref|XP_006494943.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Citrus sinensis]
 gb|ESR60541.1| hypothetical protein CICLE_v10015394mg [Citrus clementina]
Length=415

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE WA+ LG+DFIRNS    +DFASVH+YPD W  +  FE+ + F
Sbjct  251  EGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDLEFEDDLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK L KPV FTE+GLS   K F+P  RDK +K ILD++YKSA+R  SG
Sbjct  311  VTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYKSAKRKRSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ   EGME+YNDDFGIVPWER STY+L+TE SCRL R+
Sbjct  371  AGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCRLGRI  414



>ref|XP_008775171.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Phoenix dactylifera]
Length=321

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSS-KSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP    + +SVNP  W   LG+DFIRNSKI  +DFASVH+YPD WL     +EK+ 
Sbjct  140  EGFYGPTCPPEKLSVNPGPWFRTLGSDFIRNSKILDIDFASVHIYPDHWLVQAGLDEKMK  199

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            ++ KW+VSHI DGD VLKKPV+FTEFGLS  NK F+   RD F+K I D+I++SA +N +
Sbjct  200  YISKWVVSHIEDGDSVLKKPVLFTEFGLSNRNKNFNHSHRDVFYKNIFDIIHESATKNGA  259

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            GAG+F WQF+ EGM++ NDDFGIVPWERPSTYQLI E SCRLA LH      K   + +C
Sbjct  260  GAGAFVWQFMVEGMQENNDDFGIVPWERPSTYQLIKEQSCRLASLHYAKDLAKKSFRKIC  319



>ref|XP_006283768.1| hypothetical protein CARUB_v10004854mg [Capsella rubella]
 gb|EOA16666.1| hypothetical protein CARUB_v10004854mg [Capsella rubella]
Length=432

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 138/180 (77%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP++ K +++NPE WA+ LG+DF++NS    +DFASVHVYPD W  NQ+FEEK+ F
Sbjct  252  EGFYGPENPKRLTINPEQWASQLGSDFVQNSNSSNIDFASVHVYPDHWFHNQTFEEKLKF  311

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DG K LKKPV+FTEFGLS  NK+++P +RDKF++VI D++YKSA+R  +G
Sbjct  312  VVKWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPAQRDKFYRVIFDVVYKSAKRRKAG  371

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGS  WQ   EGME ++DDFGIVP E+ S Y+L+ E SCRL ++ G L  +K  LK LCS
Sbjct  372  AGSLVWQLFMEGMETFSDDFGIVPHEQDSIYKLMIEQSCRLGKVTGRLKERK--LKELCS  429



>ref|XP_008775162.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Phoenix dactylifera]
Length=314

 Score =   226 bits (577),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSS-KSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP    + +SVNP  W   LG+DFIRN KI  +DFASVH+YPD WL     +EK+ 
Sbjct  133  EGFYGPTCPPEKLSVNPGPWFRTLGSDFIRNCKILDIDFASVHIYPDHWLVQAGLDEKMK  192

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            ++ KW+VSHI DGD VLKKPV+FTEFGLS  NK F+   RD F+K I D+I++SA +N +
Sbjct  193  YISKWVVSHIEDGDSVLKKPVLFTEFGLSNRNKNFNHSHRDVFYKNIFDIIHESATKNGA  252

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            GAG+F WQF+ EGM++ NDDFGIVPWERPSTYQLI E SCRLA LH      K   + +C
Sbjct  253  GAGAFVWQFMVEGMQENNDDFGIVPWERPSTYQLIKEQSCRLASLHYAKDLAKKSFRKIC  312



>ref|XP_006412972.1| hypothetical protein EUTSA_v10025261mg [Eutrema salsugineum]
 gb|ESQ54425.1| hypothetical protein EUTSA_v10025261mg [Eutrema salsugineum]
Length=431

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 136/180 (76%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K ++VNPE W ++LG DF+RNS    +DFASVH+YPD W  +QSFE+K+ F
Sbjct  251  EGFYGPKSPKRLTVNPEQWPSELGTDFVRNSNSSNIDFASVHIYPDHWFHDQSFEDKLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SH+ DG K LKKPV+FTEFGLS  NK+++P +R++F+++I D++YKSA+R  SG
Sbjct  311  VVKWMQSHVEDGMKELKKPVLFTEFGLSNLNKDYEPSQRERFYRIIFDVVYKSAKRRKSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ   EGME +ND+FGIVP E+ S Y+L+ E SCRL R+ G L   K  LK LCS
Sbjct  371  AGTLVWQLFMEGMEGFNDEFGIVPHEQDSMYRLMIEQSCRLGRVTGRLKEHK--LKKLCS  428



>ref|XP_010433238.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Camelina sativa]
Length=432

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP++ K ++VNPE WA+ LG+DF++NS    +DFASVH+YPD W  NQ+FEEK+ F
Sbjct  252  EGFYGPENPKRLTVNPEQWASALGSDFVQNSNSSNIDFASVHIYPDHWFHNQTFEEKLKF  311

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DG K LKKPV+FTEFGLS  NK+++P +RDKF+++I D++YKSA+R  +G
Sbjct  312  VVKWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPSQRDKFYRIIFDVVYKSAKRRKAG  371

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ   EGME + DDFGIVP E+ S Y+L+ E SCRLA++ G  +  K  LK LCS
Sbjct  372  AGTLVWQLFMEGMETFGDDFGIVPHEQDSIYKLMIEQSCRLAKVTGRRNEHK--LKKLCS  429



>ref|XP_010438480.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Camelina 
sativa]
Length=432

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP++ K ++VNPE WA+ LG+DF++NS    +DFASVH+YPD W  NQ++EEK+ F
Sbjct  252  EGFYGPENPKRLTVNPEQWASALGSDFVQNSNSSNIDFASVHIYPDHWFHNQTYEEKLKF  311

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DG K LKKPV+FTEFGLS  NK+++P +RDKF+++I D++YKSA+R  +G
Sbjct  312  VVKWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPSQRDKFYRIIFDVVYKSAKRRKAG  371

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ   EGME + DDFGIVP E+ S Y+L+ E SCRLA++ G  +  K  LK LCS
Sbjct  372  AGTLVWQLFMEGMETFGDDFGIVPHEQDSIYKLMIEQSCRLAKVTGRRNEHK--LKKLCS  429



>gb|KFK35900.1| hypothetical protein AALP_AA4G051000 [Arabis alpina]
Length=431

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 135/180 (75%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPK+ K ++VNPE W ++LG DF++NS    +DFASVH+YPD W  NQSFE+K+ F
Sbjct  251  EGFYGPKNPKRLTVNPEQWPSELGTDFVQNSNSSNIDFASVHIYPDHWFHNQSFEDKLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DG K LKKPV+FTEFGLS  NK+++P +RD+F++VI D+IYKSA+R  SG
Sbjct  311  VVKWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPSQRDRFYRVIFDVIYKSAKRRKSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ   EGME +ND+FGIVP E+ S Y+L+ E SCRL ++ G     K  L+ +CS
Sbjct  371  AGTLVWQLFMEGMEGFNDEFGIVPHEQDSMYRLMIEQSCRLGKVTGRRKEHK--LRQICS  428



>ref|XP_010447999.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Camelina 
sativa]
Length=432

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 136/180 (76%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP++ K ++VNPE WA+ LG+DF++NS    +DFASVH+YPD W  NQ++EEK+ F
Sbjct  252  EGFYGPENPKRLTVNPEQWASTLGSDFVQNSNSSNIDFASVHIYPDHWFHNQTYEEKLKF  311

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DG K LKKPV+FTEFGLS   K+++P +RDKF+++I D++YKSA+R  +G
Sbjct  312  VVKWMQSHIEDGMKELKKPVLFTEFGLSNLTKDYEPSQRDKFYRIIFDVVYKSAKRRKAG  371

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ   EGME + D+FGIVP E+ S Y+L+ E SCRLA++ G  +  K  LK LCS
Sbjct  372  AGTLVWQLFMEGMETFGDEFGIVPHEQDSIYKLMIEQSCRLAKVTGRRNEHK--LKKLCS  429



>gb|KHG04578.1| Mannan endo-1,4-beta-mannosidase 2 -like protein [Gossypium arboreum]
Length=445

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K  +VNPE WA+ LGADF+RNS I  VDFASVH+YPDQ      FEEK  +
Sbjct  265  EGFYGPSSPKKATVNPEQWASALGADFMRNSNITNVDFASVHIYPDQ-FHGLGFEEKRNY  323

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI D DK LKKPVMFTE+GLS +NK+F   +R++ ++ I D+IYKSA++  SG
Sbjct  324  VSKWMHSHIEDCDKELKKPVMFTEYGLSDQNKDFQLSQREQLYRTIQDIIYKSAKKKGSG  383

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQF  EGM++Y+DDFG+VPW+ P  Y+L  EHSC+LAR+ G L  +   LK LCS
Sbjct  384  AGALVWQFFVEGMQEYSDDFGMVPWQSPPIYKLTIEHSCKLARIQG-LIQENGNLKQLCS  442



>ref|XP_010526516.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Tarenaya 
hassleriana]
Length=431

 Score =   222 bits (566),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + K ++VNPE WA++LG+DF+RNS    +DFASVH+YPD W  ++ FEE + F
Sbjct  251  EGFYGPDNPKRLTVNPERWASELGSDFVRNSASSNIDFASVHIYPDHWFHDKGFEENLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNL--  354
            V+KW++SHI DGDKVLKKPV+FTEFGLS  NK+++P +RD+F++ I D+IYK ++RN   
Sbjct  311  VKKWMMSHIEDGDKVLKKPVVFTEFGLSNLNKDYEPSQRDRFYREIFDVIYKCSKRNRTS  370

Query  355  -SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLAR  489
             S AG+  WQ L EGM+ +NDDFGIVPWER S ++L+ E SCRL R
Sbjct  371  SSAAGTLVWQLLMEGMDGFNDDFGIVPWERESIHRLMIEQSCRLGR  416



>ref|XP_007152175.1| hypothetical protein PHAVU_004G108000g [Phaseolus vulgaris]
 gb|ESW24169.1| hypothetical protein PHAVU_004G108000g [Phaseolus vulgaris]
Length=428

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 130/180 (72%), Gaps = 3/180 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP   KS +VNPE WA+ LG+DFIRNSKI  +DFASVH+YPD W   Q FE+++ F
Sbjct  251  EGFYGPNDPKSSTVNPELWASRLGSDFIRNSKISNIDFASVHIYPDHWFHEQVFEDQLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDKVLKKPV+F+EFGLS  N+ F    R+K  + +LD+IYKSA+RN SG
Sbjct  311  VSKWMLSHIEDGDKVLKKPVLFSEFGLSETNQNFSLSDREKMHRTVLDIIYKSAKRNRSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDY-LKSLC  537
             G+  WQFL  GM++++D++G+VPWE  ST  +  E SCRLA   G  STQ D   K  C
Sbjct  371  GGALVWQFLVGGMKEFSDEYGMVPWESSSTPSIFIEQSCRLANAKG--STQLDVSFKEYC  428



>ref|XP_009144379.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 isoform X2 [Brassica 
rapa]
 emb|CDX89187.1| BnaA01g17060D [Brassica napus]
Length=431

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K ++VNPE W ++LG DF+RNS    +DFASVH+YPD W  NQ+FE+K+ F
Sbjct  251  EGFYGPNSPKRLTVNPEMWPSELGTDFVRNSNSSNIDFASVHIYPDHWFHNQTFEDKLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V +W+ SHI DG K LKKPV+FTEFGLS  NK+++P +R++F++ I D++YKSA+R  +G
Sbjct  311  VVQWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPSQRERFYRTIFDVVYKSAKRRKAG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ   EGME +ND+FGIVP E+   Y+L+ E SCRL ++ G     K  L+ LCS
Sbjct  371  AGTLVWQLFMEGMEGFNDEFGIVPHEQDPMYRLMVEQSCRLGKVTGRREEHK--LRKLCS  428



>ref|XP_009144375.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 isoform X1 [Brassica 
rapa]
Length=463

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K ++VNPE W ++LG DF+RNS    +DFASVH+YPD W  NQ+FE+K+ F
Sbjct  283  EGFYGPNSPKRLTVNPEMWPSELGTDFVRNSNSSNIDFASVHIYPDHWFHNQTFEDKLKF  342

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V +W+ SHI DG K LKKPV+FTEFGLS  NK+++P +R++F++ I D++YKSA+R  +G
Sbjct  343  VVQWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPSQRERFYRTIFDVVYKSAKRRKAG  402

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ   EGME +ND+FGIVP E+   Y+L+ E SCRL ++ G     K  L+ LCS
Sbjct  403  AGTLVWQLFMEGMEGFNDEFGIVPHEQDPMYRLMVEQSCRLGKVTGRREEHK--LRKLCS  460



>ref|XP_006594850.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Glycine max]
Length=428

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP   KS +VNPE WA+ LG+DFIRNSKI  +DFASVH+YPD W   Q FE+++ F
Sbjct  251  EGFYGPNDPKSSTVNPELWASRLGSDFIRNSKISNIDFASVHIYPDHWFHEQVFEDQLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDKVLKKPV+F+EFGLS  N+ F    R+K  + +LD+IYKSA+RN SG
Sbjct  311  VSKWMLSHIEDGDKVLKKPVLFSEFGLSETNQNFSMSDREKMHRAVLDIIYKSAKRNRSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
            AG+  WQFL  GM++++D++G+VPWE  ST  +  E SCRLA   G
Sbjct  371  AGALVWQFLVGGMKEFSDEYGMVPWESSSTPHIFIEQSCRLANAKG  416



>emb|CDY18983.1| BnaC01g20850D [Brassica napus]
Length=431

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S K ++V+PE W ++LG DF+RNS    +DFASVH+YPD W  NQ+FE+K+ F
Sbjct  251  EGFYGPNSPKRLTVHPEMWPSELGTDFVRNSNSSNIDFASVHIYPDHWFHNQTFEDKLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DG K LKKPV+FTEFGLS  NK+++P +R++F++ I D++YKSA+R  +G
Sbjct  311  VVKWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPSQRERFYRTIFDVVYKSAKRRKAG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ   EGME +ND+FGIVP E+   Y+L+ E SCRL ++ G     K  L+ LCS
Sbjct  371  AGTLVWQLFMEGMEGFNDEFGIVPHEQDPMYRLMVEQSCRLGKVTGRREEHK--LRKLCS  428



>gb|KHN27892.1| Mannan endo-1,4-beta-mannosidase 2 [Glycine soja]
Length=406

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP   KS +VNPE WA+ LG+DFIRNSKI  +DFASVH+YPD W   Q FE+++ F
Sbjct  229  EGFYGPNDPKSSTVNPELWASRLGSDFIRNSKISHIDFASVHIYPDHWFHEQVFEDQLKF  288

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGD+VLKKPV+F+EFGLS  N+ F    R+K  + +LD+IYKSA+RN SG
Sbjct  289  VYKWMLSHIEDGDEVLKKPVLFSEFGLSKTNQNFSLSDREKMHRAVLDIIYKSAKRNRSG  348

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
            AG+  WQFL  GM++++D++G+VPWE  ST  +  E SCRLA   G
Sbjct  349  AGALVWQFLVGGMKEFSDEYGMVPWESSSTPHVFIEQSCRLANAKG  394



>ref|XP_004487276.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Cicer arietinum]
Length=428

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 131/180 (73%), Gaps = 3/180 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP   K ++VNP +WA+ LG+D+IRNS++  +DF SVH+YPDQW   +  E ++ F
Sbjct  251  EGFYGPNDPKDLTVNPNYWASKLGSDYIRNSELANIDFTSVHIYPDQWFHEKEIEAQLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ SHI DGD+VLKKPV+F+E+GLS  N  F    R+K +++IL +IYKSA++N SG
Sbjct  311  VSKWMHSHIEDGDEVLKKPVLFSEYGLSKTNPNFKLSDREKMYEIILGIIYKSAKKNRSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDY-LKSLC  537
            AG+  WQFL  GMEDY+DD+GIVP E PST  L  + SCRLA+L G   TQ+D   K LC
Sbjct  371  AGALVWQFLVGGMEDYSDDYGIVPGENPSTLSLFIKQSCRLAKLKG--YTQQDVSFKELC  428



>ref|XP_003540365.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Glycine max]
Length=428

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP   KS +VNPE WA+ LG+DFIRNSKI  +DFASVH+YPD W   Q FE+++ F
Sbjct  251  EGFYGPNDPKSSTVNPELWASRLGSDFIRNSKISHIDFASVHIYPDHWFHEQVFEDQLKF  310

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGD+VLKKPV+F+EFGLS  N+ F    R+K  + +LD+IYKSA+RN SG
Sbjct  311  VYKWMLSHIEDGDEVLKKPVLFSEFGLSKTNQNFSLSDREKMHRAVLDIIYKSAKRNRSG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
            AG+  WQFL  GM++++D++G+VPWE  ST  +  E SCRLA   G
Sbjct  371  AGALVWQFLVGGMKEFSDEYGMVPWESSSTPHVFIEQSCRLANAKG  416



>ref|XP_008791709.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Phoenix dactylifera]
Length=428

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 127/180 (71%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSS-KSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP S  + +S+NP  W   +G+DFIRNSKI  +DFASVH+YPDQWL     +EK+ 
Sbjct  249  EGFYGPTSPPEKLSMNPGEWYNTIGSDFIRNSKISAIDFASVHIYPDQWLLEAELDEKLE  308

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            ++ KW+ SHI DGD+ LKKPV+FTEFGLS +NK FD   R+ F+K I D IY+SAR+N +
Sbjct  309  YISKWMTSHIEDGDRELKKPVLFTEFGLSNKNKNFDHSHREAFYKSIFDTIYESARKNGA  368

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            GAG+F WQ L  GME+YNDDFGI+P ERPS  +LI E SCRL  L       +   K +C
Sbjct  369  GAGAFIWQILVPGMEEYNDDFGIIPGERPSIDRLIKEQSCRLMALQHQHDLSRRSSKGIC  428



>gb|AFK34066.1| unknown [Lotus japonicus]
Length=197

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNP-EFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP   K ++VNP E WA+ LG+DFIRNS+I  +DF SVH+YPD W + Q FE+ + 
Sbjct  19   EGFYGPNDPKRLTVNPPEEWASRLGSDFIRNSQISGIDFTSVHIYPDHWFKKQVFEDYMK  78

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            F+ KW++SHI DGD VLKKPV+F+E+GLS   K F    R+  ++ ILD+ YKSA++N S
Sbjct  79   FLSKWMLSHIEDGDTVLKKPVLFSEYGLSDSIKNFSMAHRETMYRTILDISYKSAKKNGS  138

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
            GAG+  WQFL  GM+++ DDFG+VPWE+PS Y L  + SC+LA++ G
Sbjct  139  GAGALVWQFLVGGMDEFIDDFGMVPWEKPSIYSLFIQQSCKLAQVKG  185



>gb|KEH39139.1| glycoside hydrolase family 5 protein [Medicago truncatula]
Length=430

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 131/181 (72%), Gaps = 2/181 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRN--QSFEEKV  174
            EGFYGP   K ++VNP +WA+ LG+D+IRNSKI  +DF SVH+YPDQW     ++ E ++
Sbjct  250  EGFYGPNDPKDLTVNPNYWASRLGSDYIRNSKISDIDFTSVHIYPDQWFHEDEKAIETQL  309

Query  175  GFVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNL  354
             FV KW++SHI DGD+VLKKPV+F+E+GLS +N+ F    R+K +  IL+++YKSA+RN 
Sbjct  310  KFVHKWMLSHIDDGDEVLKKPVLFSEYGLSKKNQNFTVSDREKMYDTILNIVYKSAKRNK  369

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSL  534
            SGAG+  WQFL  GME+Y+DD+GIVP E  ST  L  + SCR+ +  G ++ Q    K+L
Sbjct  370  SGAGALVWQFLVGGMEEYSDDYGIVPAESRSTQSLFIKQSCRMGKTKGWINQQDVNFKAL  429

Query  535  C  537
            C
Sbjct  430  C  430



>ref|XP_010915420.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Elaeis guineensis]
Length=428

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 123/180 (68%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSS-KSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP S  + +S+NP  W   +G+DFIRNSKI  +DFASVH+YPDQWL   + +EK  
Sbjct  249  EGFYGPTSPPEKLSMNPGEWYKTIGSDFIRNSKISAIDFASVHIYPDQWLLEAALDEKFE  308

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            ++ KW+ SHI DGD+ LKKPV+FTEFGLS  NK FD   R+ F K I D IY SAR N +
Sbjct  309  YISKWMTSHIEDGDRELKKPVLFTEFGLSNRNKNFDHSHREAFCKSIFDTIYASARMNGA  368

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            GAG+F WQFL  GME+YNDDFG +P ERPS  +LI E SCRL  L       +   K +C
Sbjct  369  GAGAFIWQFLVPGMEEYNDDFGFIPGERPSIDRLIKEQSCRLMALQRRHDLSRRSSKGIC  428



>ref|XP_003607459.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
Length=427

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 126/180 (70%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNP-EFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP   K ++VNP E WA+ LG+DFIRNS+   +DF SVH+YPD W   Q FEE + 
Sbjct  248  EGFYGPNDPKRLTVNPPEGWASRLGSDFIRNSQTSNIDFTSVHIYPDHWFHKQDFEEYMK  307

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            F+ KW++SHI DGD VL KPV+F+E+GLS   + F    R+K +K ILD+ +KSA++N S
Sbjct  308  FLSKWMLSHIEDGDNVLNKPVLFSEYGLSDSIENFSLSNREKMYKKILDISHKSAKKNQS  367

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            GAG+  WQFL  GM ++ DDFG+VPWE+PS Y L  EHSCRL +++  L+      K +C
Sbjct  368  GAGALVWQFLVSGMSEFIDDFGMVPWEKPSMYSLFIEHSCRLTKVNKGLTLHNPSFKHVC  427



>gb|AES89656.2| glycoside hydrolase family 5 protein [Medicago truncatula]
Length=428

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 126/180 (70%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNP-EFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP   K ++VNP E WA+ LG+DFIRNS+   +DF SVH+YPD W   Q FEE + 
Sbjct  249  EGFYGPNDPKRLTVNPPEGWASRLGSDFIRNSQTSNIDFTSVHIYPDHWFHKQDFEEYMK  308

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            F+ KW++SHI DGD VL KPV+F+E+GLS   + F    R+K +K ILD+ +KSA++N S
Sbjct  309  FLSKWMLSHIEDGDNVLNKPVLFSEYGLSDSIENFSLSNREKMYKKILDISHKSAKKNQS  368

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            GAG+  WQFL  GM ++ DDFG+VPWE+PS Y L  EHSCRL +++  L+      K +C
Sbjct  369  GAGALVWQFLVSGMSEFIDDFGMVPWEKPSMYSLFIEHSCRLTKVNKGLTLHNPSFKHVC  428



>gb|KHN31990.1| Mannan endo-1,4-beta-mannosidase 2 [Glycine soja]
Length=403

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP   K ++VNPE WA+ LG+DFIRNSKI  +DF SVH+YPD W  +Q FE+ + F
Sbjct  228  EGFYGPNDPKRLTVNPEDWASRLGSDFIRNSKISNIDFTSVHIYPDHWFHHQVFEDYMKF  287

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDKVL KPV+F+E+GLS  N  F   +R   +K ILD+ YKSA++N SG
Sbjct  288  VSKWMLSHIEDGDKVLNKPVLFSEYGLSDIN--FTMPERKTMYKTILDISYKSAKKNRSG  345

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
            AG+  WQFL  GM+++ DDFGI+PWE+     L  E SCRLA+  G
Sbjct  346  AGALVWQFLVGGMQEFTDDFGIIPWEKTPIPSLFVEQSCRLAKTKG  391



>ref|XP_009400567.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = +1

Query  1    EGFYGPKSS-KSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYG  S  + ++VNP  W + +G+DF++NS++P +DFASVH+YPDQW      ++K+ 
Sbjct  253  EGFYGSTSPPEKLNVNPGQWFSTVGSDFVQNSRVPEIDFASVHIYPDQWEVGAGLDQKMK  312

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            ++ +WL SHI DGDK LKKPV+FTEFGLS + K FD   RD F+K I +++Y+SAR+  S
Sbjct  313  YISRWLTSHIEDGDKELKKPVLFTEFGLSDKTKGFDHSHRDVFYKSIFNIVYRSARKGRS  372

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            GAG+F WQF+  GM++Y DDFG VP ERPS Y+LI + SCR+A+L       K     LC
Sbjct  373  GAGAFVWQFMVAGMQEYCDDFGFVPEERPSMYRLIKKQSCRMAKLSYGKGLLKTRFGKLC  432

Query  538  S  540
            +
Sbjct  433  T  433



>ref|XP_003527431.2| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Glycine max]
Length=436

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP   K ++VNPE WA+ LG+DFIRNSKI  +DF SVH+YPD W  +Q FE+ + F
Sbjct  261  EGFYGPNDPKRLTVNPEDWASRLGSDFIRNSKISNIDFTSVHIYPDHWFHHQVFEDYMKF  320

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK+L KPV+F+E+GLS  N  F   +R   +K ILD+ YKSA+RN SG
Sbjct  321  VSKWMLSHIEDGDKILNKPVLFSEYGLSDIN--FTMPERKTMYKTILDISYKSAKRNRSG  378

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
            AG+  WQFL  GM+++ DDFGI+PWE+     L  E SCRL ++ G
Sbjct  379  AGALVWQFLVGGMQEFTDDFGIIPWEKTPIPSLFVEQSCRLTKVKG  424



>ref|XP_003539924.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Glycine max]
Length=436

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP   K ++VNPE WA+ LG+DFIRNSKI  +DF SVH+YPD W  +Q FE+ + F
Sbjct  261  EGFYGPNDPKRLTVNPEDWASRLGSDFIRNSKISNIDFTSVHIYPDHWFHHQVFEDYMKF  320

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDKVL KPV+F+E+GLS  N  F   +R   +K ILD+ YKSA++N SG
Sbjct  321  VSKWMLSHIEDGDKVLNKPVLFSEYGLSDIN--FTMPERKTMYKTILDISYKSAKKNRSG  378

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
            AG+  WQFL  GM+++ DDFGI+PWE+     L  E SCRLA+  G
Sbjct  379  AGALVWQFLVGGMQEFTDDFGIIPWEKTPIPSLFVEQSCRLAKTKG  424



>ref|XP_006859039.1| hypothetical protein AMTR_s00068p00182430 [Amborella trichopoda]
 gb|ERN20506.1| hypothetical protein AMTR_s00068p00182430 [Amborella trichopoda]
Length=428

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 121/180 (67%), Gaps = 0/180 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +    NP  WA+ LG DFIRN+ I  +DFASVH YPD W    S E+K+ +
Sbjct  249  EGFYGPTTPEKFDRNPGDWASSLGVDFIRNNMISAIDFASVHAYPDNWFPEPSPEKKLNY  308

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + KW+ SHI DGD +L+KPV+FTEFG+ST+ + F+P +RD F+  I D+IYKSA+R  SG
Sbjct  309  LAKWVKSHIEDGDTMLQKPVLFTEFGISTQQEGFEPTQRDAFYSTIYDIIYKSAKRRRSG  368

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQFLA GM +Y D F IVPWE PSTY LI + SCRL  +            S+CS
Sbjct  369  AGAMAWQFLAGGMNEYGDAFAIVPWEWPSTYSLIIKQSCRLRAIRQDKGLVDSDSSSICS  428



>ref|XP_004505577.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Cicer arietinum]
Length=429

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 121/180 (67%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNP-EFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP   K ++ NP E WA+ LG+DFIRNS+   +DF SVH+Y D W   Q FE+ + 
Sbjct  250  EGFYGPNDPKRLTANPPEEWASKLGSDFIRNSQTSNIDFTSVHIYADHWFHKQVFEDYMK  309

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            FV KW+ SHI DGD VL KPV+F+E+GLS   K F    R+  +K ILD+ + SA++N S
Sbjct  310  FVSKWMHSHIEDGDNVLNKPVLFSEYGLSDTVKNFSLSNRETMYKTILDISFNSAKKNRS  369

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            GAG+  WQFL  GM +  DDFG+VPWER STY L  +HSCRL +++  L+ Q    K LC
Sbjct  370  GAGALVWQFLVGGMSELIDDFGMVPWERSSTYSLFIKHSCRLTKVNKGLTQQNPSFKQLC  429



>gb|KHN35251.1| Mannan endo-1,4-beta-mannosidase 2 [Glycine soja]
Length=425

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP   K ++VNPE WA+ LG+DFIRNSKI  +DF SVH+YPD W  +Q FE+ + F
Sbjct  250  EGFYGPNDPKRLTVNPEDWASRLGSDFIRNSKISNIDFTSVHIYPDHWFHHQVFEDYMKF  309

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDK+L KPV+F+E+GLS  N  F   +R   +K ILD+ YKSA+RN SG
Sbjct  310  VSKWMLSHIEDGDKILNKPVLFSEYGLSDIN--FTMPERKTMYKTILDISYKSAKRNRSG  367

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQFL  GM+++ DDFGI+PWE+     L  E SCRL ++
Sbjct  368  AGALVWQFLVGGMQEFTDDFGIIPWEKTPIPSLFVEQSCRLTKV  411



>ref|XP_009421284.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    EGFYGPKSSK-SVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP S +   ++NP  W + LG+DF+RNSK+P VDFAS H+YPDQWL      EKV 
Sbjct  269  EGFYGPVSPEVKQNINPGKWYSTLGSDFVRNSKVPYVDFASAHIYPDQWLVEADLNEKVE  328

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            ++ KW+ SHI DG+K L KP+MFTEFGLST+ K F+   R  F+K I + I++SAR+N +
Sbjct  329  YISKWITSHIEDGEKTLNKPIMFTEFGLSTKAKNFEYSHRIIFYKSIFNKIHESARQNGA  388

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            GAG+  WQ L +GMEDYNDD+GIVP ERPS  +LI E SC+L
Sbjct  389  GAGALIWQLLVQGMEDYNDDYGIVPRERPSVDKLIKEQSCQL  430



>gb|AFK46805.1| unknown [Lotus japonicus]
Length=440

 Score =   201 bits (511),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNP-EFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP   K ++VNP E WA+ LG+DFIRNS+I  +DF SVH+YPD W + Q FE+ + 
Sbjct  262  EGFYGPNDPKRLTVNPPEEWASRLGSDFIRNSQISDIDFTSVHIYPDHWFKKQVFEDYMK  321

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            F+ KW++SHI DGD VLKKPV+F+E+GLS   K F    R+  ++ ILD+ YK A++N  
Sbjct  322  FLSKWMLSHIEDGDTVLKKPVLFSEYGLSDSIKNFSMAHRETMYRTILDISYKFAKKNRF  381

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
            GAG+  WQFL  GM+++ DDFG+VPWE+PS Y L  + SC+LA++ G
Sbjct  382  GAGALVWQFLVGGMDEFIDDFGMVPWEKPSIYSLFIQQSCKLAKVKG  428



>ref|XP_007132717.1| hypothetical protein PHAVU_011G118900g [Phaseolus vulgaris]
 gb|ESW04711.1| hypothetical protein PHAVU_011G118900g [Phaseolus vulgaris]
Length=436

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 116/166 (70%), Gaps = 2/166 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP   K ++VNPE WA+ LG+DFI NS I  +DF SVH+YPD W   Q  E+ + F
Sbjct  261  EGFYGPNDPKRLTVNPEDWASRLGSDFITNSLISNIDFTSVHIYPDHWFHEQVSEDYIKF  320

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW++SHI DGDKVL KPV+F+EFGLS  N  F   +R   +K ILD+ YKSA++N SG
Sbjct  321  VSKWMLSHIEDGDKVLNKPVVFSEFGLSDIN--FTMSERKTMYKTILDISYKSAKKNRSG  378

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
            AG+  WQFL  GM+++ DDFGI+P E+     L  E SCRLA++ G
Sbjct  379  AGALVWQFLVGGMQEFTDDFGIIPAEKTPIPSLFIEQSCRLAKVKG  424



>ref|XP_009386799.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Musa acuminata 
subsp. malaccensis]
Length=436

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 131/178 (74%), Gaps = 7/178 (4%)
 Frame = +1

Query  1    EGFYGPKSS-KSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP SS + + VNP  W   LG+DFIRNSK+  +DFASVH+YPDQW      EEK+ 
Sbjct  254  EGFYGPASSPEKLKVNPGQWFGTLGSDFIRNSKVSDIDFASVHIYPDQWQVGAGLEEKMK  313

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            ++  WL SHI DG++ LKKPV+FTEFGLS ++++FD   RD F++ I D++Y+SARR  +
Sbjct  314  YISGWLTSHIEDGEEELKKPVLFTEFGLSDKSRDFDHAHRDVFYESIFDVVYESARRGGA  373

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL-HGPLSTQKDYLK  528
            GAG+  WQF+A GM++Y+DDFGIVP ER S Y+LI + SCRL RL HG     +D++K
Sbjct  374  GAGALVWQFMAAGMQEYSDDFGIVPEERSSMYRLIKKQSCRLMRLSHG-----RDWMK  426



>ref|XP_009413849.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 113/168 (67%), Gaps = 2/168 (1%)
 Frame = +1

Query  1    EGFYG-PKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYG P   +   VNP     +LG+DF+RNSK P +DFAS H+ PD WL + +  EK  
Sbjct  270  EGFYGAPSPPEKTKVNPGKSYGELGSDFLRNSKTPDIDFASAHINPDNWLMDANLTEKTD  329

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            +V KW+ SHI DG+K L KPV+FTEFGLS +NK FD   R  F+K I D IY+SA RN +
Sbjct  330  YVSKWVTSHIEDGEKELNKPVLFTEFGLSDKNKNFDHSHRATFYKSIYDTIYESALRNGA  389

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL-HG  498
            GAG+F W FL  GME Y DDFGI+P E PS  +LI E SCRL  L HG
Sbjct  390  GAGTFIWHFLVGGMEKYTDDFGIIPGETPSIDRLIKEQSCRLITLQHG  437



>gb|ADE76368.1| unknown [Picea sitchensis]
Length=429

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 121/181 (67%), Gaps = 0/181 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  +   + +NP  WA  LG+DFI NS++  +DFASVH YPD W+ N   E+ + +
Sbjct  249  EGFYGKTTPNKIELNPGDWAVSLGSDFIWNSQVEEIDFASVHAYPDSWIPNVDLEDHLNY  308

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW+ SHI DG+++LKKPV+FTEFGLS+ +K F+   RD+ FK + + I +SAR+  +G
Sbjct  309  FSKWVTSHIDDGEQILKKPVLFTEFGLSSHHKGFEQSHRDRLFKTMYEEIDESARKGGAG  368

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
             G+  WQF+ EGME+Y D+F  VPW+ PST++LI E SCRL  L+         L + CS
Sbjct  369  GGALIWQFVVEGMEEYGDEFAFVPWQFPSTHKLIVEQSCRLQTLYEGQHQVNKSLYAACS  428

Query  541  S  543
            S
Sbjct  429  S  429



>ref|XP_006644697.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Oryza brachyantha]
Length=444

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 128/182 (70%), Gaps = 2/182 (1%)
 Frame = +1

Query  1    EGFYGPKSSKS-VSVNP-EFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKV  174
            EGFYGP SS+  +++NP E++  + GADFIRNSKIP +DFASVHVYPD WL++ S +EK+
Sbjct  263  EGFYGPTSSQDKLNINPGEWFPNNYGADFIRNSKIPDIDFASVHVYPDNWLQHASLDEKL  322

Query  175  GFVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNL  354
             F+ +W+ SH+ DGDK L KPV+ TEFGLS + + FD   RD  ++ + D++Y SARR  
Sbjct  323  KFMTQWITSHVEDGDKELDKPVLVTEFGLSHQVEGFDDAHRDVLYRAVYDIVYDSARRGG  382

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSL  534
            +G G+  WQ  AEGME Y+D F IVP ERPS  +LI E SCRLA +       +  LK++
Sbjct  383  AGGGALVWQLAAEGMEQYHDGFSIVPVERPSMMRLIKEQSCRLAAVRYGEEGARKVLKTV  442

Query  535  CS  540
            CS
Sbjct  443  CS  444



>ref|XP_003569799.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Brachypodium 
distachyon]
Length=446

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 119/181 (66%), Gaps = 2/181 (1%)
 Frame = +1

Query  1    EGFYGPKSS-KSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP S+   ++VNP  W  + G DFIRNS +  +DFAS+H+YPD WL +   EEK+ 
Sbjct  265  EGFYGPTSTPDKLNVNPGHWFNNYGLDFIRNSMVSDIDFASIHLYPDTWLLDAKLEEKIK  324

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            FV +W+ SH  DG+K L KPV+ TEFGLS   K F+   RD  ++ + D+ Y SA R  +
Sbjct  325  FVGQWMSSHFEDGEKELGKPVLLTEFGLSHMTKGFEQSHRDALYRAVYDIAYASAERGGA  384

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL-HGPLSTQKDYLKSL  534
            GAG+F WQ  AEGMEDY+D F IVP E PS   L+ E SCR+A L HG  +  K  L+++
Sbjct  385  GAGAFVWQLAAEGMEDYHDGFSIVPSETPSMRALLKEQSCRMAALRHGEAAEAKRILRTV  444

Query  535  C  537
            C
Sbjct  445  C  445



>ref|XP_002458478.1| hypothetical protein SORBIDRAFT_03g034420 [Sorghum bicolor]
 gb|EES03598.1| hypothetical protein SORBIDRAFT_03g034420 [Sorghum bicolor]
Length=461

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 129/188 (69%), Gaps = 5/188 (3%)
 Frame = +1

Query  1    EGFYGPKS-SKSVSVNPEFWA-ADLGADFIRNSKIPTVDFASVHVYPDQWLRNQ--SFEE  168
            EGFYGP S  + ++VNP  W   + G+DFIRN+KIP +DFAS+H+YPD WL+ Q  + +E
Sbjct  273  EGFYGPTSPQEKLNVNPGIWKDNNYGSDFIRNAKIPDIDFASIHLYPDTWLQQQHATVDE  332

Query  169  KVGFVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARR  348
            K+ FV++W+ SHI DGD+ L KPV+ TEFGLS   K FD   RD F+K + D++Y+SA R
Sbjct  333  KLKFVKRWVASHIEDGDRELGKPVLTTEFGLSHRAKGFDHAHRDVFYKAVYDIVYRSAVR  392

Query  349  NLSGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL-HGPLSTQKDYL  525
              +GAG+F WQ   E ME+++DDF +VP E PS ++LI   SCRLARL  G    +    
Sbjct  393  GGAGAGAFVWQLAVEDMEEFHDDFSVVPSEHPSLHRLIKSQSCRLARLRRGVAGEEAKRT  452

Query  526  KSLCSSHS  549
             S+C++ S
Sbjct  453  LSVCAAGS  460



>ref|XP_010252627.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Nelumbo nucifera]
Length=443

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 108/161 (67%), Gaps = 0/161 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP++++    NP  WA+  G+DFI+NS I  +DFASVH YPD W+ +   +EK  +
Sbjct  259  EGFYGPETTERSGANPGDWASSFGSDFIQNSAIENIDFASVHAYPDSWIPDADLKEKANY  318

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + KW+  H++D + VLKKPV+FTE G S   KE     RD   K++ D IY+SA+R  +G
Sbjct  319  LSKWVDYHVNDSEYVLKKPVLFTEVGSSLHAKEQGTYDRDFLLKIVYDKIYESAKRRQAG  378

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            AG+  WQ L E MEDY D F +V WE PSTY+LI E SCRL
Sbjct  379  AGALIWQLLVEKMEDYGDQFSLVAWEHPSTYKLILEQSCRL  419



>emb|CBI33116.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 109/161 (68%), Gaps = 0/161 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG K+++   VNP  WA+ LG+DFI+NS I  +DFASVH YPD WL +   EEK  F
Sbjct  260  EGFYGLKTTERSGVNPGDWASKLGSDFIQNSAIDDIDFASVHAYPDSWLPDADLEEKANF  319

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SHI DG+ VLKKPV+FTE G     K+      D F K + D IY+SA++  +G
Sbjct  320  LSHWVDSHISDGEYVLKKPVLFTEVGSIMHRKKQGLYDTDTFLKTVYDKIYESAKKRQAG  379

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            AG+  WQ L EGME+Y+D F IV W+ PST++LI E SCRL
Sbjct  380  AGALIWQLLVEGMEEYSDQFSIVAWDYPSTHELIIEQSCRL  420



>ref|XP_003635019.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Vitis vinifera]
Length=449

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 109/161 (68%), Gaps = 0/161 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG K+++   VNP  WA+ LG+DFI+NS I  +DFASVH YPD WL +   EEK  F
Sbjct  260  EGFYGLKTTERSGVNPGDWASKLGSDFIQNSAIDDIDFASVHAYPDSWLPDADLEEKANF  319

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SHI DG+ VLKKPV+FTE G     K+      D F K + D IY+SA++  +G
Sbjct  320  LSHWVDSHISDGEYVLKKPVLFTEVGSIMHRKKQGLYDTDTFLKTVYDKIYESAKKRQAG  379

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            AG+  WQ L EGME+Y+D F IV W+ PST++LI E SCRL
Sbjct  380  AGALIWQLLVEGMEEYSDQFSIVAWDYPSTHELIIEQSCRL  420



>ref|XP_006656920.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Oryza brachyantha]
Length=340

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S++ + +NP  WAA L +DFI+NS +  +DFASVH YPD WL   S EEKV +
Sbjct  163  EGFYGPGSAERMDINPGEWAASLCSDFIQNSVVEHIDFASVHAYPDSWLPKASLEEKVRY  222

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D + +LKKPV+FTE G    +       +D   +++ D IY SAR+  +G
Sbjct  223  LSSWVDSHLNDSEHILKKPVIFTEVGYLQHSDANSTVDKDIILRIVYDKIYDSARKLQAG  282

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
             G+  WQ + EG   Y DDF IV  +RPSTY LITE SCRL R++G
Sbjct  283  GGALIWQLMVEGTHMYADDFSIVARDRPSTYSLITEQSCRLQRMYG  328



>ref|XP_007026255.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
 gb|EOY28877.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
Length=448

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 112/182 (62%), Gaps = 0/182 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  ++K   VNP  WAA LG+DF++NS I  +DFASVH YPD W+ +   EEK  +
Sbjct  265  EGFYGLNTTKGPEVNPGEWAASLGSDFVQNSAIENIDFASVHAYPDSWIPHADLEEKTRY  324

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + +W+ SHI DGD+VLKKP++FTE G            +D   K + D IY+SA++  +G
Sbjct  325  LSQWVDSHISDGDQVLKKPILFTEVGSLVYVNNQSIADKDILLKTMYDKIYESAKKRQAG  384

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG+  WQ L EG+E+Y D F  + W++PSTY+LI   SCRL  +    S  +   K  CS
Sbjct  385  AGALIWQLLVEGVEEYGDRFSFIAWDKPSTYKLILRQSCRLQSIFPKSSQNRKLSKDPCS  444

Query  541  SH  546
              
Sbjct  445  GQ  446



>gb|EMT32497.1| Mannan endo-1,4-beta-mannosidase 2 [Aegilops tauschii]
Length=392

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 120/181 (66%), Gaps = 2/181 (1%)
 Frame = +1

Query  1    EGFYGPKSS-KSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP S  + +SVNP  W  + G DFIRNSKI  +DFASVH+YPD WL +   EEK+ 
Sbjct  211  EGFYGPTSPPEKLSVNPGHWFNNYGLDFIRNSKISDIDFASVHLYPDTWLLHADLEEKLK  270

Query  178  FVRKWLVSHIHDGDKVLK-KPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNL  354
            FV +W+ SH  DGD  L  KPV+ TEFGLS   K F+  +RD F+K + D+++ SA+R  
Sbjct  271  FVTQWVSSHFEDGDTELGGKPVVLTEFGLSHLVKGFEQSQRDAFYKSVYDIVHASAKRGG  330

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSL  534
            +GAG+  WQ  AE ME+Y+D F IVP E PS  +L+TE SCRLA L       K  LK++
Sbjct  331  AGAGAIVWQLAAEDMEEYHDGFAIVPSETPSMQKLLTEQSCRLAALRHGEEEAKRILKAV  390

Query  535  C  537
            C
Sbjct  391  C  391



>dbj|BAJ87988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 123/182 (68%), Gaps = 2/182 (1%)
 Frame = +1

Query  1    EGFYGPKSS-KSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP S  + +SVNP  W  + G DFIRNSKI  +DFAS+H+YPD WL + + EEK+ 
Sbjct  263  EGFYGPTSPPEKLSVNPGHWFNNYGLDFIRNSKISDIDFASIHLYPDNWLLHANLEEKLK  322

Query  178  FVRKWLVSHIHDGDKVLK-KPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNL  354
            FV +W+ SH  DGD  L  KPV+ TEFGLS   + F+  +RD F+K + D++++SA+R  
Sbjct  323  FVTQWVSSHFEDGDTELGGKPVVLTEFGLSHMVQGFEQSQRDAFYKSVYDIVHESAKRGG  382

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSL  534
            +GAG+  WQ  AE ME+++D F IVP ERPS  +L+TE SCRLA L       K  LK++
Sbjct  383  AGAGAMVWQLAAEDMEEFHDGFAIVPSERPSMQKLLTEQSCRLATLRHGEQEAKRILKTV  442

Query  535  CS  540
            C 
Sbjct  443  CG  444



>ref|XP_010913204.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Elaeis guineensis]
Length=442

 Score =   177 bits (450),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP  ++ + VNP  WAA  G+DF++NS    +DFASVH YPD W+   S EEKV +
Sbjct  263  EGFYGPGRTERLEVNPGEWAATFGSDFVKNSADEHIDFASVHAYPDSWIPTASLEEKVKY  322

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D   +L KPV+F EFG +   K+    +RD   KV+ D +Y+SA++  +G
Sbjct  323  LSSWVDSHVNDSQNILNKPVLFLEFGSNLHVKKNGTFERDVLLKVVYDRVYESAKKGQAG  382

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ +  GM+ Y+D+F +V WE PSTY+LI + SCRL RL
Sbjct  383  AGALLWQLMVGGMQKYHDEFSLVAWEHPSTYKLIVQQSCRLLRL  426



>ref|XP_010057854.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Eucalyptus 
grandis]
 gb|KCW75194.1| hypothetical protein EUGRSUZ_E03950 [Eucalyptus grandis]
Length=453

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 108/164 (66%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG +  +  +VNP  WA+ LG DF+ NS I  +DFASVH YPD W+   S +EKV +
Sbjct  269  EGFYGLQRQEKNAVNPGEWASSLGTDFLNNSAIHNIDFASVHAYPDSWIPEASLDEKVKY  328

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + +W+ SHIHDGD++LKKPV+FTE G S    + +  +RD F K + D IY+SA++  +G
Sbjct  329  LSQWVDSHIHDGDEILKKPVLFTEVGSSLHQNQQELHQRDIFLKTVYDKIYESAKKRQAG  388

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ L +  + Y D F  V W   STY+LI E SCRL R+
Sbjct  389  AGALIWQLLVDDTQGYADQFSFVAWNHLSTYKLIIEQSCRLRRM  432



>ref|XP_008775972.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Phoenix dactylifera]
Length=438

 Score =   177 bits (450),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP  ++ ++ NP  WAA  G+DF++NS    +DFASVH YPD W+   S EEKV +
Sbjct  259  EGFYGPGRTERLNANPGEWAATFGSDFLQNSADEHIDFASVHAYPDSWIPRASLEEKVKY  318

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D   +LKKPV+F EFG +   K+    +RD    V+ D +Y+SA++  +G
Sbjct  319  LSSWVDSHVNDSQNILKKPVLFLEFGSNLHAKKNGTYERDVLLNVVYDKVYESAKKGQAG  378

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ + EGM+ Y+D+F +V WE PSTY+ I + SCRL RL
Sbjct  379  AGALIWQLMVEGMQKYHDEFSLVAWENPSTYESIVQQSCRLLRL  422



>ref|XP_010928140.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Elaeis guineensis]
Length=438

 Score =   177 bits (449),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 111/164 (68%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP  ++ + VNP  WAA  G+DF++NS    +DFASVH YPD W+   S EEKV +
Sbjct  259  EGFYGPGRTERLRVNPGEWAATFGSDFLQNSADEHIDFASVHAYPDSWIPRASLEEKVKY  318

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D   VLKKPV+F EFG +   K+    +++    V+ D +Y+SA++  +G
Sbjct  319  LSSWVDSHVNDSQNVLKKPVLFLEFGSNLRAKKNGTYEKNVLLNVVYDKVYESAKKGQAG  378

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ + EGM++Y D+F ++ WE PSTY+LI + SCRL RL
Sbjct  379  AGALIWQLMVEGMQNYRDEFSLIAWENPSTYKLIVQQSCRLLRL  422



>ref|NP_001044230.2| Os01g0746700 [Oryza sativa Japonica Group]
 sp|Q0JJD4.2|MAN2_ORYSJ RecName: Full=Mannan endo-1,4-beta-mannosidase 2; AltName: Full=Beta-mannanase 
2; AltName: Full=Endo-beta-1,4-mannanase 2; 
AltName: Full=OsMAN2; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB56016.1| putative (1-4)-beta-mannan endohydrolase [Oryza sativa Japonica 
Group]
 dbj|BAC05600.1| putative (1-4)-beta-mannan endohydrolase [Oryza sativa Japonica 
Group]
 dbj|BAF06144.2| Os01g0746700 [Oryza sativa Japonica Group]
Length=445

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 127/182 (70%), Gaps = 2/182 (1%)
 Frame = +1

Query  1    EGFYGPKSSKS-VSVNP-EFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKV  174
            EGFYGP SS+  +++NP E++  + GADFIRNSKI  +DFASVHVYPD WL++ S +EK+
Sbjct  264  EGFYGPTSSQEKLNINPGEWFPNNYGADFIRNSKIQDIDFASVHVYPDNWLQHASLDEKL  323

Query  175  GFVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNL  354
             F+ +W+ +H+ DGD  L+KPV+ TEFGLS + + F+   RD  ++ + D+++ SARR  
Sbjct  324  KFMTRWITAHVEDGDGELEKPVLVTEFGLSHQVEGFEDAHRDVLYRAVYDIVHGSARRGG  383

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSL  534
            +  G+  WQ  AEGME+Y+D F IVP ERPS  +LI E SCRLA +       +  LK++
Sbjct  384  AAGGALVWQLAAEGMEEYHDGFSIVPSERPSMMRLIKEQSCRLAAVRYGEEGARKVLKTV  443

Query  535  CS  540
            C+
Sbjct  444  CA  445



>gb|EAY75800.1| hypothetical protein OsI_03716 [Oryza sativa Indica Group]
Length=445

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 127/182 (70%), Gaps = 2/182 (1%)
 Frame = +1

Query  1    EGFYGPKSSKS-VSVNP-EFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKV  174
            EGFYGP SS+  +++NP E++  + GADFIRNSKI  +DFASVHVYPD WL++ S +EK+
Sbjct  264  EGFYGPTSSQEKLNINPGEWFPNNYGADFIRNSKIQDIDFASVHVYPDNWLQHASLDEKL  323

Query  175  GFVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNL  354
             F+ +W+ +H+ DGD  L+KPV+  EFGLS + + F+   RD  ++ + D+++ SARR  
Sbjct  324  KFMTRWITAHVEDGDGELEKPVLVMEFGLSHQVEGFEDAHRDVLYRAVYDIVHGSARRGG  383

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSL  534
            +  G+F WQ  AEGME+Y+D F IVP ERPS  +LI E SCRLA +       +  LK++
Sbjct  384  AAGGAFVWQLAAEGMEEYHDGFSIVPSERPSMMRLIKEQSCRLAAVRYGEEGARKVLKTV  443

Query  535  CS  540
            C+
Sbjct  444  CA  445



>emb|CAN77937.1| hypothetical protein VITISV_033630 [Vitis vinifera]
Length=451

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 109/163 (67%), Gaps = 2/163 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG K+++   VNP  WA+ LG+DFI+NS I  +DFASVH YPD WL +   EEK  F
Sbjct  260  EGFYGLKTTERSGVNPGDWASKLGSDFIQNSAIDDIDFASVHAYPDSWLPDADLEEKANF  319

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSA--RRNL  354
            +  W+ SHI DG+ VLKKPV+FTE G     K+      D F K + D IY+SA  R+  
Sbjct  320  LSHWVDSHISDGEYVLKKPVLFTEVGSIMHRKKQGLYDTDTFLKTVYDKIYESAKKRQAG  379

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            +GAG+  WQ L EGME+Y+D F IV W+ PST++LI E SCRL
Sbjct  380  AGAGALIWQLLVEGMEEYSDQFSIVAWDYPSTHELIIEQSCRL  422



>ref|XP_010646197.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Vitis vinifera]
 emb|CBI33121.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 109/163 (67%), Gaps = 2/163 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG K+++   VNP  WA+ LG+DFI+NS I  +DFASVH YPD WL +   EEK  F
Sbjct  260  EGFYGLKTTERSGVNPGDWASKLGSDFIQNSAIDDIDFASVHAYPDSWLPDADLEEKANF  319

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSA--RRNL  354
            +  W+ SHI DG+ VLKKPV+FTE G     K+      D F K + D IY+SA  R+  
Sbjct  320  LSHWVDSHISDGEYVLKKPVLFTEVGSIMHRKKQGLYDTDTFLKTVYDKIYESAKKRQAG  379

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            +GAG+  WQ L EGME+Y+D F IV W+ PST++LI E SCRL
Sbjct  380  AGAGALIWQLLVEGMEEYSDQFSIVAWDYPSTHELIIEQSCRL  422



>ref|XP_004969933.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Setaria italica]
Length=464

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 126/187 (67%), Gaps = 4/187 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSV-SVNPEFWA-ADLGADFIRNSKIPTVDFASVHVYPDQWLRNQ--SFEE  168
            EGFYGP S +S   VNP  W   + G+DFIRN+KIP +DFAS+H+YPD WL+ Q  +  E
Sbjct  277  EGFYGPTSPESKRDVNPGVWKDNNYGSDFIRNAKIPDIDFASIHLYPDTWLQKQHATVNE  336

Query  169  KVGFVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARR  348
            K+ FV++W+ SHI DGDK L KPV+ TEFGLS   + FDP  RD F+K I D++Y SA R
Sbjct  337  KLQFVKRWVSSHIEDGDKELNKPVLTTEFGLSHRAQGFDPSHRDVFYKAIYDIVYASASR  396

Query  349  NLSGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLK  528
              +GA +  WQ   EGME+++DD+ +VP E PS  +LI + SCRLA+L   +  +   + 
Sbjct  397  GGAGAAALVWQLAPEGMEEFHDDYSVVPSEHPSLRRLIKKQSCRLAKLRPGVGEEAKRVL  456

Query  529  SLCSSHS  549
            + C++ S
Sbjct  457  AACAAGS  463



>ref|XP_010090975.1| Mannan endo-1,4-beta-mannosidase 6 [Morus notabilis]
 gb|EXB41560.1| Mannan endo-1,4-beta-mannosidase 6 [Morus notabilis]
Length=440

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 115/174 (66%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG KS++  SVNP  W A LG+DFI+NS I  +DFASVH YPD W+R+   E K  F
Sbjct  262  EGFYGLKSTQRSSVNPGEWGALLGSDFIQNSAINNIDFASVHAYPDSWIRHGDLEAKANF  321

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTE-NKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            +  W+ SH+ D + VLKKPV+FTE G S   NK+   E  +   K + D IY+SA++  +
Sbjct  322  LSHWVDSHMSDAENVLKKPVLFTEVGFSLRMNKK--TEDVNFLLKTVYDRIYESAKKRQA  379

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKD  519
            GAG+  WQ L EG+E+Y+D F +V  + PST++LIT HSCRL R+     T ++
Sbjct  380  GAGALIWQLLVEGVEEYSDQFSLVARDHPSTFKLITRHSCRLRRIFSNSKTNEE  433



>ref|XP_006839096.1| hypothetical protein AMTR_s00090p00128510 [Amborella trichopoda]
 gb|ERN01665.1| hypothetical protein AMTR_s00090p00128510 [Amborella trichopoda]
Length=431

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 111/164 (68%), Gaps = 1/164 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +  +VNP  WAA LG+DFI++SK   +DFASVH YPD W+ N   EEKV +
Sbjct  252  EGFYGPTTPEKSNVNPGSWAASLGSDFIQDSKSEYIDFASVHSYPDSWIPNARLEEKVKY  311

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + KW+ SHI+DG+ VLKKPV+FTE G S      DP       +++ D I++SAR+  +G
Sbjct  312  LSKWVDSHINDGENVLKKPVLFTEVG-SLRGNMHDPHGGGVLLEIVYDKIFESARKKQAG  370

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ   +G++ Y D+F +V W++PS Y+L+ E SCRL  L
Sbjct  371  AGALVWQLTVQGLDKYGDEFSLVAWDQPSIYKLMLEQSCRLKVL  414



>ref|NP_001130322.1| uncharacterized protein LOC100191416 [Zea mays]
 gb|ACF78505.1| unknown [Zea mays]
 gb|ACF87838.1| unknown [Zea mays]
 gb|ACN30643.1| unknown [Zea mays]
 tpg|DAA57619.1| TPA: putative endo-1,4-beta-mannosidase family protein [Zea mays]
Length=453

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 125/187 (67%), Gaps = 4/187 (2%)
 Frame = +1

Query  1    EGFYGPKS-SKSVSVNPEFWA-ADLGADFIRNSKIPTVDFASVHVYPDQWLRNQ--SFEE  168
            EGFYGP S  + + VNP  W   + G+DFIRN+KIP +DFAS+H+YPD WL  Q  + +E
Sbjct  266  EGFYGPTSPQEKLDVNPGTWKDNNYGSDFIRNAKIPDIDFASIHLYPDTWLLQQHATVDE  325

Query  169  KVGFVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARR  348
            K+ FV++W+ SHI DGDK L KPV+ TEFGLS   K F    RD F+K + D +Y+SA R
Sbjct  326  KLKFVKRWVASHIEDGDKELGKPVLATEFGLSHRAKGFHHSHRDVFYKAVYDTVYRSAAR  385

Query  349  NLSGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLK  528
              +GAG+F WQ   E ME+++DDF +VP E PS ++LI   SCRLA+L   +  +     
Sbjct  386  GGAGAGAFVWQLAVEDMEEFHDDFSVVPSEHPSLHRLIKSQSCRLAKLRHGVGEEAKRTL  445

Query  529  SLCSSHS  549
            S+C++ S
Sbjct  446  SVCAAGS  452



>sp|Q0DCM5.2|MAN6_ORYSJ RecName: Full=Mannan endo-1,4-beta-mannosidase 6; AltName: Full=Beta-mannanase 
6; AltName: Full=Endo-beta-1,4-mannanase 6; 
AltName: Full=OsMAN6; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61770.1| putative endo-beta-1,4-mannanase [Oryza sativa Japonica Group]
Length=440

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 111/171 (65%), Gaps = 8/171 (5%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP  ++ + VNP  WAA L +DFI+NS +  +DFASVH YPD WL   S EEKV +
Sbjct  261  EGFYGPGIAERLGVNPGEWAASLCSDFIQNSAVEHIDFASVHAYPDSWLPRASLEEKVRY  320

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGL-----STENKEFDPEKRDKFFKVILDMIYKSAR  345
            +  W+ SH++D +++LKKPV+FTE G      +  N   D   RD   +++ D IY SAR
Sbjct  321  LSNWVDSHLNDSEQILKKPVLFTEVGYLQHSDANSNSTVD---RDIILRIVYDKIYDSAR  377

Query  346  RNLSGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
            +  +G+G+  WQ + EG   Y D+F +V  +RPSTY LIT  SCRL RL+G
Sbjct  378  KLQAGSGALIWQLMVEGTHMYGDNFSVVARDRPSTYSLITNQSCRLQRLYG  428



>gb|EMS67718.1| Mannan endo-1,4-beta-mannosidase 2 [Triticum urartu]
Length=509

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 121/180 (67%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    EGFYGPKSS-KSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYGP S  + +SVNP  W  + G DFIRNSKI  +DFASVH+YPD WL + + EEK+ 
Sbjct  263  EGFYGPTSPPEKLSVNPGHWFNNYGLDFIRNSKISDIDFASVHLYPDTWLLDANLEEKLK  322

Query  178  FVRKWLVSHIHDGDKVLK-KPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNL  354
            FV KW+ SH  DGD  L  KPV+ TEFGLS   K F+  +RD F+K + D++++SA+R  
Sbjct  323  FVTKWVSSHFEDGDTELGGKPVVLTEFGLSHLVKGFEQSQRDAFYKSVYDIVHESAKRGG  382

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSL  534
            +GAG+  WQ  AE ME+Y+D F IVP E PS  +L+TE SCRLA L       K  LK++
Sbjct  383  AGAGAIVWQLAAEDMEEYHDGFAIVPSETPSMQKLLTEQSCRLAALRHGEQEAKRILKAV  442



>ref|XP_002436944.1| hypothetical protein SORBIDRAFT_10g011830 [Sorghum bicolor]
 gb|EER88311.1| hypothetical protein SORBIDRAFT_10g011830 [Sorghum bicolor]
Length=438

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP     + VNP  WAA L +DFI+NS +  +DFASVH YPD WL   S EEKV +
Sbjct  260  EGFYGPGRGDRLGVNPGDWAASLCSDFIQNSAVKDIDFASVHAYPDSWLPKASMEEKVKY  319

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D + +L+KPV+F+E G     +  +    D   KV+ D +Y SA++  +G
Sbjct  320  LSVWVDSHLNDSEYILRKPVLFSEVGYLQHAEADNTLDGDTLLKVVYDKLYNSAKKLQAG  379

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
             G+  WQ + EGM+ Y+D+F +V  +RPSTY+LI E SCRL RL+G
Sbjct  380  GGALIWQLMVEGMQMYHDNFSMVARDRPSTYKLINEQSCRLQRLYG  425



>ref|XP_002520563.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF41796.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=440

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  ++    VNP  WAA LG+DFI+NS +  +DFASVH YPD W+ +  FE K  +
Sbjct  262  EGFYGLNTTNKSEVNPGKWAALLGSDFIQNSAVDNIDFASVHAYPDSWIPDADFEAKADY  321

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH+ DGD VL+KPV+FTE G      +     RD   K++ D IY  A++  +G
Sbjct  322  LSLWMDSHVSDGDFVLRKPVLFTEVGSIWHVNKKGANDRDILLKIVYDKIYDWAKKRQAG  381

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ L EG+E+Y+D F IVPW+ P+TY+LI E S RL  L
Sbjct  382  AGALIWQLLVEGVEEYSDQFSIVPWDYPATYKLIQEQSYRLQNL  425



>ref|XP_009766447.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Nicotiana 
sylvestris]
Length=452

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 105/161 (65%), Gaps = 0/161 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG + + S  VNP  WAA LG DFI NS I  +DF SVH YP  W++  + + KV F
Sbjct  268  EGFYGVEKTGSFGVNPGKWAASLGVDFIENSAIDNIDFTSVHAYPHSWIQGINSDAKVEF  327

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SHI + +K+LKKPV+FTE G  +  ++     R+ + K++ D IY+SA++  +G
Sbjct  328  LSHWVDSHISEAEKILKKPVLFTEVGFPSSTQKEGLHDRNIYLKIVYDKIYESAKKRKAG  387

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            AG+  WQ L EGME Y D F  + W+ PSTY+LI + SCRL
Sbjct  388  AGALVWQLLVEGMERYGDKFSFIAWKHPSTYKLIVQQSCRL  428



>ref|XP_011008632.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Populus euphratica]
Length=440

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  ++    VNP  WAA LG DFI NS I  +DFASVH YPD W+ +   E K  +
Sbjct  266  EGFYGLNTTNKSEVNPGIWAASLGTDFILNSAIDKIDFASVHAYPDSWIPHTDLEAKTNY  325

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SHI DG+ VL+KPV+FTE G   +       +RD   KV+ D IY+SA++  +G
Sbjct  326  LSNWVDSHISDGEFVLRKPVLFTEVGSRWDEDGKGVHERDVLLKVVYDKIYESAKKRQAG  385

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ L E ++ Y+D F  +P + PSTY+LI E SCRL RL
Sbjct  386  AGALIWQLLVEDVDRYSDQFSFIPQDSPSTYKLIEEQSCRLQRL  429



>ref|XP_008798844.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Phoenix dactylifera]
Length=436

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 113/180 (63%), Gaps = 4/180 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFY    ++ + VNP  WAA  G+DF++NS    +DF+SVH YPD W+   S EEK+ +
Sbjct  257  EGFYESGRTERLGVNPGEWAATFGSDFVKNSADEHIDFSSVHAYPDSWMPMASLEEKIKY  316

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D   +LKKPV+F EFG +   K     +RD   KVI D +Y+SA++  +G
Sbjct  317  LSSWVDSHVNDSQNILKKPVLFLEFGSNLHVKRNGTYERDVQLKVIYDKVYESAKKGEAG  376

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AG   WQ +A GM +Y DDF +V W+ PSTY+LI + SCRL R    LS +K  +   CS
Sbjct  377  AGVLLWQLMAGGMGEYLDDFSLVAWDHPSTYKLIVQQSCRLLR----LSQRKKNIGKPCS  432



>gb|KHG13584.1| Mannan endo-1,4-beta-mannosidase 6 [Gossypium arboreum]
Length=468

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 110/183 (60%), Gaps = 1/183 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWL-RNQSFEEKVG  177
            EGFYG  ++K + VNP  WAA LG+DFI+NS I  +DFASVH YPD WL  +   E K  
Sbjct  284  EGFYGLNTTKGLEVNPGEWAASLGSDFIQNSAIENIDFASVHAYPDSWLIPHDDMEAKAR  343

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            F+ +W+ SHI DGD VLKKPV+FTE G            +D   K + + IY+SA++  +
Sbjct  344  FLSRWVDSHISDGDHVLKKPVIFTEVGTLVHADNQGLADKDILLKTMYEKIYESAKKRQA  403

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLC  537
            GAG+  WQ L EG  +Y+D F  V W+ PSTY+LI + SCRL  +       +   K  C
Sbjct  404  GAGALIWQLLVEGAGEYSDRFSFVAWDNPSTYKLILKQSCRLKSIFAKSIQSQKLNKDPC  463

Query  538  SSH  546
            S +
Sbjct  464  SGN  466



>gb|EMT00136.1| Mannan endo-1,4-beta-mannosidase 6 [Aegilops tauschii]
Length=197

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 103/165 (62%), Gaps = 0/165 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG   ++ +  NP  WAA   +DFI+NS +  +DFASVH YPD WL   S EEK+ +
Sbjct  19   EGFYGTGIAERLGYNPGDWAASFCSDFIQNSAVENIDFASVHAYPDSWLPKASMEEKLRY  78

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D + +LKKPV+F+E G            RD   +V+ D IY SAR+  +G
Sbjct  79   LSSWVDSHLNDSEHILKKPVLFSEVGYLQHVDGNSTVDRDILLRVVYDKIYDSARKLQAG  138

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
             G+  WQ + EG   Y+DDF +V  + PSTY+LITE SCRL  L+
Sbjct  139  GGALIWQLMVEGTHMYHDDFSLVARDHPSTYKLITEQSCRLQMLY  183



>ref|XP_004965323.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Setaria italica]
Length=438

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 106/166 (64%), Gaps = 0/166 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP  S+ + VNP  WAA L +DFI+NS +  +DFASVH YPD WL   S EEKV +
Sbjct  260  EGFYGPGRSERLGVNPGDWAASLCSDFIQNSAVKDIDFASVHAYPDSWLPKASMEEKVKY  319

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D + +L+KPV+F+E G        +    D   K++ D IY SA++  +G
Sbjct  320  LSNWVDSHLNDSEYILRKPVLFSEVGYLQHLGVNNMVNGDTILKLVYDKIYDSAKKLQAG  379

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
             G+  WQ + EG   Y D F +V  ERPSTY+LI E SCRL RL+G
Sbjct  380  GGALIWQLMVEGSHMYQDGFSMVAGERPSTYKLIKEQSCRLQRLYG  425



>ref|XP_008659495.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X2 
[Zea mays]
Length=369

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 108/166 (65%), Gaps = 0/166 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP   + + VNP  WAA + +DFI+NS +  +DFASVH YPD WL   S EEKV +
Sbjct  193  EGFYGPGRGERLGVNPGDWAASVCSDFIQNSAVKDIDFASVHAYPDSWLPKASMEEKVKY  252

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D + VL+KPV+FTE G     +       D   KV+ D +Y SA++  +G
Sbjct  253  LSVWVDSHLNDSEYVLRKPVLFTEVGYLQHAEANSTVDGDILLKVVYDKLYDSAKKLQAG  312

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
            +G+  WQ + EG + Y+DDF +V  +RPSTY+L+ E SCRL  L+G
Sbjct  313  SGALIWQLMVEGTQMYHDDFSMVARDRPSTYKLMKEQSCRLQSLYG  358



>gb|EMS62212.1| Mannan endo-1,4-beta-mannosidase 6 [Triticum urartu]
Length=397

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 106/165 (64%), Gaps = 0/165 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG   ++ +  NP  WAA L +DFI+NS +  +DFASVH YPD WL   S EEK+ +
Sbjct  219  EGFYGTGIAERLGFNPGDWAASLCSDFIQNSAVENIDFASVHAYPDSWLPKASMEEKLRY  278

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D + +LKKPV+F+E G     +      RD   +V+ D IY SAR+  +G
Sbjct  279  LSSWVDSHLNDSEHILKKPVLFSEVGYLQHVEGNSTVDRDILLRVVYDKIYDSARKLQAG  338

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
             G+F WQ + EG   Y+DDF +V  + PSTY+LITE SCRL  L+
Sbjct  339  GGAFIWQLMVEGTHMYHDDFSLVAHDHPSTYKLITEQSCRLQMLY  383



>ref|XP_008659494.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Zea mays]
Length=435

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 108/166 (65%), Gaps = 0/166 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP   + + VNP  WAA + +DFI+NS +  +DFASVH YPD WL   S EEKV +
Sbjct  259  EGFYGPGRGERLGVNPGDWAASVCSDFIQNSAVKDIDFASVHAYPDSWLPKASMEEKVKY  318

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D + VL+KPV+FTE G     +       D   KV+ D +Y SA++  +G
Sbjct  319  LSVWVDSHLNDSEYVLRKPVLFTEVGYLQHAEANSTVDGDILLKVVYDKLYDSAKKLQAG  378

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHG  498
            +G+  WQ + EG + Y+DDF +V  +RPSTY+L+ E SCRL  L+G
Sbjct  379  SGALIWQLMVEGTQMYHDDFSMVARDRPSTYKLMKEQSCRLQSLYG  424



>ref|XP_002307872.2| hypothetical protein POPTR_0006s01100g [Populus trichocarpa]
 gb|EEE91395.2| hypothetical protein POPTR_0006s01100g [Populus trichocarpa]
Length=439

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 104/164 (63%), Gaps = 1/164 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  ++    VNP  WAA LG DFI NS I  +DFASVH YPD W+ +   E K  +
Sbjct  266  EGFYGLNTTNKSEVNPGIWAASLGTDFILNSAIDNIDFASVHAYPDSWIPHADLEAKTNY  325

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SHI DGD VL+KPV FTE G S  + +    +RD   K++ D IY+SA++  +G
Sbjct  326  LSNWVDSHISDGDFVLRKPVFFTEVG-SRWDVDGKVHERDVLLKIVYDKIYESAKKRQAG  384

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ L E ++ Y+D F  VP   PSTY+LI E SCRL R+
Sbjct  385  AGALIWQLLVEDVDGYSDQFSFVPQYSPSTYKLIEEQSCRLQRI  428



>ref|XP_009401505.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 108/165 (65%), Gaps = 0/165 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP  +  +  NP  WAA LG+DFI+NS I  +DFASVH YPD W+   S EEKV +
Sbjct  256  EGFYGPARNDRLGANPGSWAASLGSDFIQNSAIENIDFASVHAYPDSWIPKASLEEKVEY  315

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D + VLKKPV+F+E G     K+     RD   K++ D +Y+SA++  + 
Sbjct  316  LSSWVDSHVNDSEHVLKKPVLFSEVGSHLRVKKNGTYDRDILLKIVYDKVYESAKKGQAA  375

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
            AG+  WQ + EGM+ Y D+F +V  E PSTY+LI + SCRL  LH
Sbjct  376  AGALIWQLMVEGMQSYQDEFSLVASEHPSTYKLIAQQSCRLRNLH  420



>gb|EMT32180.1| Mannan endo-1,4-beta-mannosidase 6 [Aegilops tauschii]
Length=191

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 102/165 (62%), Gaps = 0/165 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG   ++ +  NP  WAA   +DFI+NS +  +DFASVH YPD WL   S EEK+ +
Sbjct  13   EGFYGTGIAERLGYNPGDWAASFCSDFIQNSAVENIDFASVHAYPDSWLPKASMEEKLRY  72

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D + +LKKPV+F+E G            RD   +V+ D IY SAR+  +G
Sbjct  73   LSSWVDSHLNDSEHILKKPVLFSEVGYLQHVDGNSTVDRDILLRVVYDKIYDSARKLQAG  132

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
             G+  WQ + EG   Y+DDF +V  + PSTY+ ITE SCRL  L+
Sbjct  133  GGALIWQLMVEGTHMYHDDFSLVARDHPSTYKWITEQSCRLQMLY  177



>ref|XP_003563908.2| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Brachypodium 
distachyon]
Length=473

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 103/165 (62%), Gaps = 0/165 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP  ++ +  NP  WAA L  DF++NS +  +DFASVH YPD WL     EEKV +
Sbjct  295  EGFYGPGIAERLGFNPGDWAASLCCDFLQNSAVEHIDFASVHAYPDSWLPKARMEEKVRY  354

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D + +LKKPV+F+E G            RD   +V+ D IY SAR+  +G
Sbjct  355  LSSWVDSHLNDSENILKKPVLFSEVGYLQHANANTTVDRDILLRVVYDKIYDSARKLQAG  414

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
             G+  WQ + +G   Y+D+F +V  + PSTY+LI EHSCRL  LH
Sbjct  415  GGALIWQLMVKGTHMYHDNFSLVARDHPSTYKLIKEHSCRLQMLH  459



>gb|KDP37779.1| hypothetical protein JCGZ_06458 [Jatropha curcas]
Length=436

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 102/164 (62%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  ++    VNP  WAA LG+DFI+NS I  +DFASVH YPD W+ +   E K  +
Sbjct  262  EGFYGLNTTNKSEVNPGEWAASLGSDFIQNSAIDNIDFASVHAYPDSWIPHADSEAKANY  321

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SHI DG+ VL+KPV+FTE G +           D   K++ + IY SA++  SG
Sbjct  322  LSLWVDSHISDGEFVLRKPVLFTEVGSTRHVNNKGLYDLDVLLKIVYNKIYDSAKKGQSG  381

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ L EG+E+Y+D F  VPW  PSTY+LI   S RL  L
Sbjct  382  AGALIWQLLVEGVEEYSDRFSFVPWNYPSTYKLIEAQSYRLRNL  425



>gb|EYU27707.1| hypothetical protein MIMGU_mgv1a006272mg [Erythranthe guttata]
Length=450

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 101/164 (62%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFY  KS+++   NP  WAA LG+DFI NS I  +DFASVH YP  W+     E KV +
Sbjct  267  EGFYASKSTENYGANPGEWAASLGSDFINNSAIKDIDFASVHAYPHSWIPQADLEAKVKY  326

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W  +HI D + VLKKP++FTE G     +      RD   K++ D +YKSA++  +G
Sbjct  327  LSNWADAHISDSENVLKKPLLFTEIGAPLSVQTDGSYDRDILLKIVYDKVYKSAKKREAG  386

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG   WQ L EG+E+Y D F +V  + PSTY+LI E SCRL  +
Sbjct  387  AGVLIWQLLVEGVEEYRDRFSLVASKYPSTYKLILEQSCRLKNM  430



>dbj|BAK00462.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 102/165 (62%), Gaps = 0/165 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG   ++ +  NP  WAA L +DFI NS +  +DFASVH YPD WL   S EEK+ +
Sbjct  259  EGFYGTGIAERLGYNPGDWAASLCSDFIENSAVENIDFASVHAYPDSWLPKASMEEKIRY  318

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SH++D + +LKKPV+F+E G            RD   +++ D IY SAR+   G
Sbjct  319  LSNWVDSHVNDSEYILKKPVLFSEVGYLQHVDANSTVNRDILLRIVYDKIYDSARKLQVG  378

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
             G+  WQ + EG   Y+DDF +V  + PSTY+LITE SCRL  L+
Sbjct  379  GGALIWQLMVEGTHMYHDDFSLVARDHPSTYKLITEQSCRLQTLY  423



>gb|KHG16155.1| Mannan endo-1,4-beta-mannosidase 2 -like protein [Gossypium arboreum]
Length=232

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 106/180 (59%), Gaps = 37/180 (21%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGPKS K  ++NP  WA+ LG+DF+RNS I  VDF  V +Y                
Sbjct  90   EGFYGPKSPKKSALNPGEWASTLGSDFVRNSNITNVDFTFV-IY----------------  132

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
                               ++  E+GLS +NK+    +R++F++ ILD+ YKSA++  SG
Sbjct  133  -------------------ILTIEYGLSNQNKDVQASQREQFYRTILDLNYKSAKKKGSG  173

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
             G+  WQFL EGME+YNDDFG+VPWE PS ++L  + SCRLAR+ G L+ Q   LK LCS
Sbjct  174  VGALVWQFLVEGMEEYNDDFGLVPWETPSIHKLTIQQSCRLARIQG-LNQQTGNLKQLCS  232



>gb|KEH36174.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=410

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 105/166 (63%), Gaps = 8/166 (5%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG   ++S   NP F    +G DFI N++IPT+DFA++H YPDQWL N  +E+++ F
Sbjct  235  EGFYGQSKTES---NPNF---QVGTDFIANNQIPTIDFATLHSYPDQWLSNSGYEDQISF  288

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTEN--KEFDPEKRDKFFKVILDMIYKSARRNL  354
            +R WL  HI D   +L KP++F EFG+S++N     +  KRD+FF  +   IY SA    
Sbjct  289  LRGWLNEHIQDAQNILHKPLLFAEFGISSKNLGSSNNSTKRDQFFNTVYSAIYSSASGGG  348

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            +  G  FWQ LAEGM+ + DD+ ++  E PST  LI + S +L R+
Sbjct  349  TAVGGLFWQLLAEGMDSFRDDYEVILAESPSTATLIAQESQKLKRI  394



>ref|XP_009631226.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Nicotiana 
tomentosiformis]
Length=453

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 105/161 (65%), Gaps = 0/161 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG + + S  VNP  WAA LG DFI NS I  +DF SVH YP  W++  + + KV F
Sbjct  269  EGFYGVEKTGSFGVNPGKWAASLGVDFIENSAIDNIDFTSVHAYPHSWIQGINSDAKVNF  328

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SHI + +K+LKKPV+FTE G  +  ++     R+ + K++ D IY+SA++  +G
Sbjct  329  LSHWVDSHISEAEKILKKPVLFTEVGFPSSTQKEGLHDRNIYLKIVYDKIYESAKKKKAG  388

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            AG+  WQ L EGME Y D F  + W+ PSTY+LI E SCRL
Sbjct  389  AGALVWQLLVEGMERYGDKFSFIAWKHPSTYKLIVEQSCRL  429



>ref|NP_001280873.1| mannan endo-1,4-beta-mannosidase 7-like precursor [Malus domestica]
 gb|ACN78664.1| endo-beta-mannanase [Malus domestica]
Length=429

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 102/164 (62%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + K+   NP ++   +G DF+ N++IP +DFA+VH YPDQWL   S+E++V F
Sbjct  236  EGFYGPSNPKT---NPNYY--QIGTDFLANNQIPGIDFATVHSYPDQWLNGSSYEDQVSF  290

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+  HIHD   +LKKPV+F EFG S +   +   +RD+ F  +   IY SAR     
Sbjct  291  LNSWVNDHIHDAQNILKKPVLFAEFGRSLKESGYTINQRDRIFTTVYSGIYSSARGGGPA  350

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ LA+GM+ + D +G+V  E  ST  LI E S +L ++
Sbjct  351  VGGLFWQLLAQGMDSFQDGYGVVLSESSSTVGLIAEESQKLIKI  394



>ref|XP_010924296.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like isoform X2 
[Elaeis guineensis]
Length=327

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 108/178 (61%), Gaps = 5/178 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  SSK +  NP F    +G DFI N++IP +DFA+VH YPDQWL + +   ++ F
Sbjct  133  EGFYGA-SSKHLQFNPGF---QVGTDFISNNQIPGIDFATVHSYPDQWLSSSNDHMQLAF  188

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + +WL SHIHD   +L+KP++ TEFG S ++  F   +RD  F  +   IY SAR   + 
Sbjct  189  LNRWLDSHIHDASNILRKPLLLTEFGKSWKDPGFSSSQRDALFNTVYSKIYWSARTGGAT  248

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSL  534
            AG  FWQ L EGM+ + D + I+  E PST ++IT + CR+    G L  +   +K L
Sbjct  249  AGGLFWQLLTEGMDSFRDGYEIILSETPSTAKMITAY-CRILHYWGKLYARMQNIKQL  305



>ref|XP_009336054.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Pyrus x bretschneideri]
Length=429

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 101/164 (62%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + K+   NP ++   +G DF+ N++IP +DFA+VH YPDQWL   S+E++V F
Sbjct  236  EGFYGSSNPKT---NPNYY--QIGTDFLANNQIPGIDFATVHSYPDQWLTGSSYEDQVSF  290

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+  HIHD   +LKKPV+F EFG S +   +   +RD+ F  +   IY SAR     
Sbjct  291  LNSWVNDHIHDAQNILKKPVLFAEFGRSLKESGYTINQRDRIFTTVYSGIYSSARGGGPA  350

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ LA+GM+ + D +G+V  E  ST  LI E S +L ++
Sbjct  351  VGGLFWQLLAQGMDSFQDGYGVVLSEGSSTVGLIAEESRKLIKI  394



>ref|XP_010924295.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like isoform X1 
[Elaeis guineensis]
Length=430

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 108/178 (61%), Gaps = 5/178 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  SSK +  NP F    +G DFI N++IP +DFA+VH YPDQWL + +   ++ F
Sbjct  236  EGFYGA-SSKHLQFNPGF---QVGTDFISNNQIPGIDFATVHSYPDQWLSSSNDHMQLAF  291

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + +WL SHIHD   +L+KP++ TEFG S ++  F   +RD  F  +   IY SAR   + 
Sbjct  292  LNRWLDSHIHDASNILRKPLLLTEFGKSWKDPGFSSSQRDALFNTVYSKIYWSARTGGAT  351

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSL  534
            AG  FWQ L EGM+ + D + I+  E PST ++IT + CR+    G L  +   +K L
Sbjct  352  AGGLFWQLLTEGMDSFRDGYEIILSETPSTAKMITAY-CRILHYWGKLYARMQNIKQL  408



>ref|XP_006352457.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Solanum tuberosum]
Length=244

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 104/178 (58%), Gaps = 7/178 (4%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSF------  162
            EGFYG + + +V +NP  WAA LG DFI NS I   DF S+H+ P Q +           
Sbjct  58   EGFYGVEKAGNVGLNPGKWAASLGVDFIENSDIENFDFTSIHI-PPQLVSQAEIKGGINS  116

Query  163  EEKVGFVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSA  342
            + +V F+  W+ SHI + +K+LKKPV+FT+ G  +  ++     R+ F K++ D IY+ A
Sbjct  117  DARVDFLSHWVDSHISEAEKILKKPVLFTKVGFPSSIQKNGLYVRNIFLKIVYDKIYELA  176

Query  343  RRNLSGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQK  516
            ++   GAG+  WQ L EGME Y D F  + W+ PSTY+L+ E SCRL  +     T K
Sbjct  177  KKRKGGAGALVWQLLVEGMEQYGDQFSFIAWKHPSTYKLMVEQSCRLLNISSQGLTHK  234



>ref|XP_002974444.1| hypothetical protein SELMODRAFT_101148 [Selaginella moellendorffii]
 gb|EFJ24666.1| hypothetical protein SELMODRAFT_101148 [Selaginella moellendorffii]
Length=398

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 101/164 (62%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFY   S  S+  NP  WA  LG+DFIRN  + T+DFAS+H YPD W+   SFEE++  
Sbjct  213  EGFYNSWSPDSLVANPGHWADFLGSDFIRNHLLSTIDFASIHAYPDIWMPEVSFEEQLKG  272

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW+ +H+ DG   L+KPV+ TEFGL T++       R +  K + D  + SAR   + 
Sbjct  273  FSKWVDTHVQDGALRLQKPVLVTEFGLKTKSS---TRHRLELLKAMYDAAFDSARNGEAC  329

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ L EG+++Y DD+ IVP + P   +L+  HSCRL +L
Sbjct  330  AGAMLWQLLEEGLDEYGDDYAIVPRDEPQVTELVGAHSCRLEKL  373



>ref|XP_002985744.1| hypothetical protein SELMODRAFT_234864 [Selaginella moellendorffii]
 gb|EFJ13322.1| hypothetical protein SELMODRAFT_234864 [Selaginella moellendorffii]
Length=398

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 101/164 (62%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFY   S  S+  NP  WA  LG+DFIRN  + T+DFAS+H YPD W+   SFEE++  
Sbjct  213  EGFYNSWSPDSLVANPGHWADFLGSDFIRNHLLSTIDFASIHAYPDIWMPEVSFEEQLKG  272

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW+ +H+ DG   L+KPV+ TEFGL T++       R +  K + D  + SAR   + 
Sbjct  273  FSKWVDTHVQDGALRLQKPVLVTEFGLKTKSS---TRHRLELLKAMYDAAFDSARNGEAC  329

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ L EG+++Y DD+ IVP + P   +L+  HSCRL +L
Sbjct  330  AGAMLWQLLEEGLDEYGDDYAIVPRDEPQVTELVGAHSCRLEKL  373



>ref|XP_009365114.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Pyrus x bretschneideri]
Length=429

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 101/164 (62%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + K+   NP ++   +G DF+ N++IP +DFA+VH YPDQWL   S+E++V F
Sbjct  236  EGFYGSSNPKT---NPNYY--QIGTDFLANNQIPGIDFATVHSYPDQWLTGSSYEDQVSF  290

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+  HIHD   +LKKPV+F EFG S +   +   +RD+ F  +   IY SAR     
Sbjct  291  LNSWVNDHIHDAQNILKKPVLFAEFGRSLKESGYTINQRDRIFTTVYSGIYSSARGGGPA  350

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ LA+GM+ + D +G+V  E  ST  LI E S +L ++
Sbjct  351  VGGLFWQLLAQGMDSFQDGYGVVLSEGSSTVGLIAEESRKLIKI  394



>ref|XP_007017589.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
 gb|EOY14814.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
Length=431

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 101/164 (62%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP SS+    NP F    +G DFI N++IP +DFA+VH YPDQWL++ S E ++ F
Sbjct  238  EGFYGPSSSQKQQYNPNF---QVGTDFIANNQIPGIDFATVHSYPDQWLQSSSEESQIAF  294

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +HI D   +L+KP++F EFG S   K   P +RD+ F  +   IY SAR   + 
Sbjct  295  LNNWLNNHIQDAQNILQKPLLFAEFGKSL--KISGPSQRDELFNTVYTAIYSSARGGGTA  352

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ  AEGM+ + D + ++  E  ST  +IT+ S +L R+
Sbjct  353  IGGLFWQLFAEGMDSFRDGYEVILSEGTSTVNIITQESQKLNRI  396



>gb|EAZ13519.1| hypothetical protein OsJ_03436 [Oryza sativa Japonica Group]
Length=422

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 110/156 (71%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    EGFYGPKSSKS-VSVNP-EFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKV  174
            EGFYGP SS+  +++NP E++  + GADFIRNSKI  +DFASVHVYPD WL++ S +EK+
Sbjct  264  EGFYGPTSSQEKLNINPGEWFPNNYGADFIRNSKIQDIDFASVHVYPDNWLQHASLDEKL  323

Query  175  GFVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNL  354
             F+ +W+ +H+ DGD  L+KPV+ TEFGLS + + F+   RD  ++ + D+++ SARR  
Sbjct  324  KFMTRWITAHVEDGDGELEKPVLVTEFGLSHQVEGFEDAHRDVLYRAVYDIVHGSARRGG  383

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLI  462
            +  G+  WQ  AEGME+Y D   IVP +RPS  + I
Sbjct  384  AAGGALVWQLAAEGMEEYQDGLSIVPGKRPSIERQI  419



>ref|XP_006352360.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Solanum tuberosum]
Length=439

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 107/165 (65%), Gaps = 1/165 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQ-SFEEKVG  177
            EGFYG + + +V +NP  WAA LG DFI NS I  +DF SVH YP  W++   + + +V 
Sbjct  268  EGFYGVEKTGNVGLNPGKWAASLGVDFIENSAIENIDFTSVHAYPHSWIKGGINSDARVD  327

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            F+  W+ SHI + +K+LKKPV+FTE G  +  ++     R+ F K++ D IY+SA++  +
Sbjct  328  FLSHWVDSHISEAEKILKKPVLFTEVGFPSSIQKNGLYDRNIFLKIVYDKIYESAKKKKA  387

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            GAG+  WQ L EGME Y D F  + W+ PSTY+L+ E SCRL  +
Sbjct  388  GAGALVWQLLVEGMERYGDQFSFIAWKHPSTYKLMVEQSCRLLNI  432



>ref|XP_006878501.1| hypothetical protein AMTR_s00011p00202020 [Amborella trichopoda]
 gb|ERM94646.1| hypothetical protein AMTR_s00011p00202020 [Amborella trichopoda]
Length=404

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 101/164 (62%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  S +    NP F    +G DFI N++I  +DFA+VH YPDQWL   ++E ++ F
Sbjct  209  EGFYGESSPQKQQFNPGF---QVGTDFIANNQIWGIDFATVHSYPDQWLSGSNYETQLSF  265

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +HI D + +L+KP++  EFG S ++  F+  +RD  F  + + IY SARR  + 
Sbjct  266  LGSWLNTHIQDAETILRKPLLLAEFGNSWKDPGFNEYQRDMLFNTVYNSIYASARRGGAT  325

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ LAEGM+ Y D + IV  + PST  +IT+ S +L  L
Sbjct  326  VGGLFWQLLAEGMDSYRDGYEIVLTQNPSTVNIITQQSHKLTYL  369



>ref|XP_004250262.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 [Solanum lycopersicum]
Length=457

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 118/185 (64%), Gaps = 2/185 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQ-SFEEKVG  177
            EGFYG + +++V +NP  WA  LG DFI NS I  +DF SVH YP  W++   + + ++ 
Sbjct  272  EGFYGAEKTENVGLNPGKWAESLGVDFIENSAIENIDFTSVHAYPHSWIKGGINSDARLD  331

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            F+  W+ SHI + +K+LKKPV+FTE G  +  ++     R+ F K++ + IY+SA++  +
Sbjct  332  FLSHWVDSHISEAEKILKKPVLFTEVGFPSSIQKNGLYDRNIFLKIVYEKIYESAKKKKA  391

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGP-LSTQKDYLKSL  534
            GAG+  WQ L EGME Y D F  + W+ PSTY+L+ E SCRL  +    L+ +K   K+ 
Sbjct  392  GAGALVWQLLVEGMERYGDQFSFIAWKHPSTYKLMVEQSCRLLNISSQGLTDKKLNQKNH  451

Query  535  CSSHS  549
            CS+++
Sbjct  452  CSANA  456



>gb|ABD47729.1| (1-4)-beta-mannan endohydrolase [Eucalyptus globulus subsp. globulus]
Length=231

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 103/164 (63%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + +   +NP F   D+G DFI N++IP +DFA+ H YPDQW+ + + + ++ F
Sbjct  43   EGFYGQSTPQRKRLNPGF---DIGTDFIANNRIPGIDFATAHSYPDQWVSSSNDQYQLSF  99

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +HI D   +L+KP++ TEFG S ++  F   +RD+ F ++   +Y SA+R  + 
Sbjct  100  LNNWLNTHIQDAQYILRKPILLTEFGKSQKDHGFSTYQRDQLFNMVYYKVYASAKRGGAA  159

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AGS FWQ L EGM+ + D + +V  + PST  +I   S +L ++
Sbjct  160  AGSLFWQLLTEGMDSFRDGYEVVLNQSPSTANIIAYQSHKLYQI  203



>ref|XP_006649074.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9-like [Oryza 
brachyantha]
Length=409

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 99/164 (60%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    K++  NP +    +G DFI N+ +P VDFA++H YPDQW+   S +E+V F
Sbjct  238  EGFYGESMHKNL--NPGY---TVGTDFIANTLVPAVDFATIHSYPDQWVAGASSDEQVAF  292

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +R+WL SHI D   VL+KP++ TEFG S  +  +    RD +F+++ D +Y SAR     
Sbjct  293  MRRWLASHIQDAAAVLRKPLLVTEFGWSARSNGYAVAARDAYFRMVFDAVYASARAGGPC  352

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ +A GME + D + +V    PST  ++     R+A L
Sbjct  353  AGGLFWQVMAPGMESWTDGYEVVLERSPSTASVVAHQCARIAGL  396



>ref|XP_007046870.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046871.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046872.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046873.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91027.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91028.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91029.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91030.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
Length=433

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 105/164 (64%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  +++ + +NP     ++G DFI N++IP +DFA+VH YPDQWL + + + ++ F
Sbjct  238  EGFYGQSTAQKMRLNPNL---NIGTDFIANNQIPGIDFATVHSYPDQWLSSSNDQYQLSF  294

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + KWL +HI D   +L+KPV+ TEFG S ++  F   KRD+ F  +   IY SA+R    
Sbjct  295  LNKWLDAHIQDAQFILRKPVLLTEFGKSWKDPGFSTYKRDQLFNTVYYKIYSSAKRGGPA  354

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ L+EGM+ + D + IV  E PST   I++ S +L ++
Sbjct  355  AGGLFWQLLSEGMDSFRDGYDIVLSESPSTANAISQQSHKLDQI  398



>ref|XP_008797528.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
1-like [Phoenix dactylifera]
Length=430

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 102/168 (61%), Gaps = 5/168 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  S++    NP F    +G DFI N++IP +DFA+VH YPDQWL N + + ++ F
Sbjct  236  EGFYGASSAQK-QFNPGF---QVGTDFISNNQIPGIDFATVHSYPDQWLSNTNDQTQLAF  291

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + KWL SHI D   +L+KP++  EFG S ++  F   +RD+ F  +   IY SAR   + 
Sbjct  292  LNKWLDSHIQDARSILRKPLLLAEFGKSWKDPGFSSSQRDELFNTVYSKIYWSARTGGAT  351

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPL  504
            AG  FWQ L EGM+ Y D + ++  E PST  +IT + CR  R  G L
Sbjct  352  AGGLFWQLLTEGMDSYRDGYEVILNETPSTSNMITAY-CRRLRYLGKL  398



>ref|XP_002281804.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Vitis vinifera]
 emb|CBI19729.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 99/164 (60%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  S +    NP F    +G DFI N++IP +DFA+VH YPDQW  + S + ++ F
Sbjct  238  EGFYGQTSPQKQQYNPNF---QVGTDFIANNQIPGIDFATVHSYPDQWFSSSSDDTQLSF  294

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + +WL +HI D   VL+KP++FTEFG S+++  +   +RD  F  +   IY SAR   + 
Sbjct  295  LNEWLKNHIQDAQNVLRKPLLFTEFGKSSKDSGYSTYQRDMLFNTVYSAIYSSARSGGAA  354

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ L EGM+ + D + IV  E PST  +I + S +L  L
Sbjct  355  VGGMFWQLLTEGMDSFRDGYEIVLSESPSTANVIAQQSHKLYLL  398



>ref|XP_006435034.1| hypothetical protein CICLE_v10001262mg [Citrus clementina]
 gb|ESR48274.1| hypothetical protein CICLE_v10001262mg [Citrus clementina]
Length=425

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 99/164 (60%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP SS+    NP F    +G DFI N++IP++DFA++H YPDQWL + S E ++ F
Sbjct  232  EGFYGPSSSEKQQYNPNF---QVGTDFIANNQIPSIDFATLHSYPDQWLPSSSDESQISF  288

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +HI D   +L+KP++  EFG S   K     +RD+ F  +   IY SAR   + 
Sbjct  289  LNNWLYNHIQDAQDILRKPILLAEFGKSL--KTSGANQRDQLFDTVYSAIYSSARSGGAA  346

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ   EG++ Y D + ++  E PST  +IT+ S +L R+
Sbjct  347  VGGMFWQLFTEGLDSYRDGYEVIFSENPSTATIITDQSQKLNRI  390



>gb|KEH23290.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=410

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 106/174 (61%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + + +  NP  +A  +G DFIRN ++  VDFASVH+Y D W+  Q  +  + F
Sbjct  220  EGFYGPSTPQRLQFNPNTYAQQVGTDFIRNHQVLGVDFASVHMYADSWVSQQIADTHIPF  279

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +HI D +K L  PV+F+EFG+S+++  ++   RD     +   I  S ++  SG
Sbjct  280  VKSWMDAHIEDAEKYLGMPVIFSEFGVSSKDPGYNSTYRDTLISTVYSSILNSTKKGGSG  339

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDY  522
            AGS  WQ  +EGM++ +D + IV  + PST  ++T  S RLA  +   ST+ ++
Sbjct  340  AGSLLWQVFSEGMDNMDDGYAIVFSKSPSTSSIVTLQSTRLALFNSLCSTRCNW  393



>ref|XP_007222385.1| hypothetical protein PRUPE_ppa006029mg [Prunus persica]
 gb|EMJ23584.1| hypothetical protein PRUPE_ppa006029mg [Prunus persica]
Length=431

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 102/164 (62%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    ++   NP ++   +G DFI N++IP +DFA+VH YPDQWL   S+E++V F
Sbjct  238  EGFYGASKQQT---NPNYF--QVGTDFIANNQIPGIDFATVHSYPDQWLSGSSYEDQVAF  292

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+  HI D  K+LKKP++F EFG S +   +   +RD+ F  +   IY SAR   + 
Sbjct  293  LNNWVNDHIQDAQKILKKPILFAEFGRSLKESGYTTNQRDRIFTTVYSAIYSSARGGGAA  352

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ LAEGM+ + D +G+V  E  ST  LI+E S RL ++
Sbjct  353  VGGLFWQLLAEGMDSFQDGYGVVLSESSSTVSLISEESQRLIKI  396



>ref|XP_001760262.1| predicted protein [Physcomitrella patens]
 gb|EDQ75018.1| predicted protein [Physcomitrella patens]
Length=420

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 101/170 (59%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EG+Y   S    S NP  +   +G DFIR+ + P +DFA+VH YPDQWL  + ++E + F
Sbjct  217  EGYYASDSIGCSSSNPHNYCGTMGTDFIRDHQSPYLDFATVHAYPDQWLSTEDYDEMLEF  276

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              +W+ +HI D ++VL+ PV+F EFGLS +N  F  EK + F+ V+ D  Y+SA  + +G
Sbjct  277  FDRWVRAHIVDAERVLRMPVLFAEFGLSDKNSGFTKEKLEVFYSVVYDQSYESALNHGAG  336

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLST  510
            AG+  WQ L   M D+ND + I P    S   ++   S RL  LH P+ +
Sbjct  337  AGALMWQLLPAEMSDWNDGYSIEPSCGSSICNMMLLQSARLKALHKPVCS  386



>gb|ABV32547.1| endo-1,4-beta-mannosidase protein 1 [Prunus persica]
Length=431

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 102/164 (62%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    ++   NP ++   +G DFI N++IP +DFA+VH YPDQWL   S+E++V F
Sbjct  238  EGFYGASKQQT---NPNYF--QVGTDFIANNQIPGIDFATVHSYPDQWLSGSSYEDQVAF  292

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+  HI D  K+LKKP++F EFG S +   +   +RD+ F  +   IY SAR   + 
Sbjct  293  LNNWVNDHIQDAQKILKKPILFAEFGRSLKESGYTTNQRDRIFTTVYSAIYSSARGGGAA  352

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ LAEGM+ + D +G+V  E  ST  LI+E S RL ++
Sbjct  353  VGGLFWQLLAEGMDSFQDGYGVVLSESSSTVSLISEESQRLIKI  396



>ref|XP_008220834.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Prunus mume]
Length=431

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 102/164 (62%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    ++   NP+++   +G DFI N++IP +DFA+VH YPDQWL   S+E++V F
Sbjct  238  EGFYGASKQQT---NPKYF--QVGTDFIANNQIPGIDFATVHSYPDQWLSGSSYEDQVSF  292

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+  HI D   +LKKP++F EFG S +   +   +RD+ F  +   IY SAR   + 
Sbjct  293  LNNWVNDHIQDAQNILKKPILFAEFGRSLKESGYTTNQRDQIFTTVYSAIYSSARGGGAA  352

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ LAEGM+ + D +GIV  E  ST  LI+E S RL ++
Sbjct  353  VGGLFWQLLAEGMDSFQDGYGIVLSESSSTVSLISEQSQRLIKI  396



>ref|XP_010113415.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
 gb|EXC35442.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
Length=436

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 103/161 (64%), Gaps = 3/161 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + +  S+NP F   D+G DFI N++I  +DFA+VH YPDQWL + + ++++ F
Sbjct  241  EGFYGQSTPQRKSLNPGF---DIGTDFIANNRIHGIDFATVHCYPDQWLSSSNDQKQLSF  297

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +HI D  K+L+KP++ TEFG S ++  F+  +RD+ F  +   IY SA+R    
Sbjct  298  LNNWLDTHIQDAQKILRKPLLLTEFGKSGKDPGFNTYQRDQLFNTVYYKIYSSAKRGGVA  357

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
             GS FWQ L EGM+ + D + I+  +  ST  +I++ S +L
Sbjct  358  GGSLFWQLLTEGMDSFRDGYEIILSQSSSTANIISQQSHKL  398



>ref|XP_004512071.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cicer arietinum]
Length=424

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 103/161 (64%), Gaps = 3/161 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + +  S+NP F   ++G DFI N+++P +DFA+VH YPDQW+ + + E++V F
Sbjct  235  EGFYGQSTPQRTSLNPGF---NIGTDFIANNRVPNIDFATVHCYPDQWVSSTNEEDQVAF  291

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +H  D    LKKP++  EFG S ++  ++  +RD+ F+ +   IY SA+R    
Sbjct  292  LNNWLSAHFLDAQYALKKPILVAEFGKSFKDSSYNTNQRDQLFRTVYYKIYSSAKRGGPA  351

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            +G+ FWQ L +GME ++D +GI+  +  ST  +I + S +L
Sbjct  352  SGALFWQLLTQGMESFDDGYGIMLGQTSSTGNVIAQQSHKL  392



>ref|XP_008800703.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Phoenix dactylifera]
Length=430

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 100/165 (61%), Gaps = 7/165 (4%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  SSK    N  F    +G DFI N++IP +DFA+VH YPDQWL N + + ++ F
Sbjct  236  EGFYGA-SSKQQQFNTGF---QVGTDFISNNQIPGIDFATVHSYPDQWLSNSNDQAQLAF  291

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL SHI D   +L+KP++ TEFG S ++  F   +RD  F  +   IY SAR   + 
Sbjct  292  LNTWLDSHIQDARNILRKPLLLTEFGKSWKDPGFSSSQRDALFNTVFSKIYWSARTGGAT  351

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
            AG  FWQ L EGM+ + D + I+  E PST ++I  H CR  RLH
Sbjct  352  AGGLFWQLLTEGMDSFRDGYEIILNETPSTAKMIAAH-CR--RLH  393



>ref|XP_009407087.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Musa 
acuminata subsp. malaccensis]
Length=395

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 99/164 (60%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    +    NP +   ++G DFI N+++P +DFA++H YPDQW+   + + ++ F
Sbjct  226  EGFYGESMPERKKYNPGY---EVGTDFIANNQVPGIDFATIHAYPDQWVPGSNDDGQLAF  282

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +R W+ SHI D   +L KP+M TEFG S+    +   KRD F+  I D IY SA+     
Sbjct  283  LRSWIQSHIQDAGSILGKPLMVTEFGKSSRQAGYTVSKRDAFYATIYDAIYASAKAGGPC  342

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ LA+GM+ + D + I+  E PST  +I+  S R++ L
Sbjct  343  AGGLFWQLLAQGMDSFRDGYEIIFAESPSTTSIISRQSHRISNL  386



>gb|KDO84614.1| hypothetical protein CISIN_1g014426mg [Citrus sinensis]
Length=425

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 96/164 (59%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP SS+    NP F    +G DFI N++IP +DFA++H YPDQWL + S E +  F
Sbjct  232  EGFYGPSSSEKQQYNPNF---QVGTDFIANNQIPGIDFATLHSYPDQWLPSSSDESQTSF  288

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +HI D    L+KP++  EFG S   K     +RD+ F  +   IY SAR   + 
Sbjct  289  LNNWLYNHIQDAQDTLRKPILLAEFGKSL--KTSGANQRDQLFDTVYSAIYLSARSGGAA  346

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ   EG++ Y D + ++  E PST  +IT+ S +L RL
Sbjct  347  VGGMFWQLFTEGLDSYRDGYEVIFSENPSTATIITDQSQKLNRL  390



>ref|XP_010921181.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X2 
[Elaeis guineensis]
Length=434

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 98/161 (61%), Gaps = 0/161 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + + + +NP  +A  +GADFIRN +   +DFAS H+YPD W+ N   +  + F
Sbjct  242  EGFYGPSTPERLQLNPNTFAGQVGADFIRNHRALGIDFASAHMYPDSWVSNSISDAHIQF  301

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +H  D + VL  PV+F EFGLS+++ +F+   RDKF   +      S RR  SG
Sbjct  302  VKTWMQNHTDDAENVLGMPVVFGEFGLSSKDDKFNLTFRDKFINTVFATQLNSLRRGGSG  361

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            AG   WQ   EG +  +D + +VP + PST  +++ HS RL
Sbjct  362  AGCLLWQLFPEGTDYMDDGYAVVPSKSPSTSSILSLHSRRL  402



>gb|KDP38537.1| hypothetical protein JCGZ_04462 [Jatropha curcas]
Length=431

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 99/164 (60%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP SS     NP F    +G DFI N++IP +DFA+VH YPDQWL N + E +  F
Sbjct  238  EGFYGPTSSSKQQYNPNF---QIGTDFIANNQIPGIDFATVHSYPDQWLPNSNTEGQESF  294

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +HI D   +L KPV+F EFG S+    ++  +RD+ F  I   IY SAR   + 
Sbjct  295  LNNWLNNHIQDAQNILHKPVLFAEFGKSSRTAAYN--QRDQLFTTIYSAIYSSARGGGAA  352

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ + EGM+ + D + +V  E PST  +I + S +L ++
Sbjct  353  AGGMFWQLMTEGMDSFRDGYEVVFSENPSTASIIVDQSQKLNKI  396



>ref|XP_006473535.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Citrus sinensis]
Length=425

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 96/164 (59%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP SS+    NP F    +G DFI N++IP +DFA++H YPDQWL + S E +  F
Sbjct  232  EGFYGPSSSEKQQYNPNF---QVGTDFIANNQIPGIDFATLHSYPDQWLPSSSDESQTSF  288

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +HI D    L+KP++  EFG S   K     +RD+ F  +   IY SAR   + 
Sbjct  289  LNNWLYNHIQDAQDTLRKPILLAEFGKSL--KTSGANQRDQLFDTVYSAIYSSARSGGAA  346

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ   EG++ Y D + ++  E PST  +IT+ S +L R+
Sbjct  347  VGGMFWQLFTEGLDSYRDGYEVIFSENPSTATIITDQSQKLNRI  390



>ref|XP_011083658.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Sesamum indicum]
Length=425

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 102/164 (62%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG   +     NP+F    +G DFI N++I  +DFA+VH YPDQWL +QS E ++ F
Sbjct  256  EGFYGQSDAHEQQNNPQF---QVGTDFITNNRISDIDFATVHSYPDQWLTSQSDEAQLLF  312

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL SHI D   VL+KPV+F EFG S+++  +D  KRD  F ++   IY SA      
Sbjct  313  LNDWLNSHIQDAQTVLQKPVLFAEFGKSSKDAGYDTYKRDDLFNMVYSAIYSSAGSGGVA  372

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ L EGM+D++D + IV  E PST  LI + S +L ++
Sbjct  373  AGGLFWQLLTEGMDDFSDGYEIVFSENPSTASLIADQSQKLNKI  416



>ref|XP_010921182.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X3 
[Elaeis guineensis]
Length=432

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 100/169 (59%), Gaps = 0/169 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + + + +NP  +A  +GADFIRN +   +DFAS H+YPD W+ N   +  + F
Sbjct  240  EGFYGPSTPERLQLNPNTFAGQVGADFIRNHRALGIDFASAHMYPDSWVSNSISDAHIQF  299

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +H  D + VL  PV+F EFGLS+++ +F+   RDKF   +      S RR  SG
Sbjct  300  VKTWMQNHTDDAENVLGMPVVFGEFGLSSKDDKFNLTFRDKFINTVFATQLNSLRRGGSG  359

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLS  507
            AG   WQ   EG +  +D + +VP + PST  +++ HS RL   +   S
Sbjct  360  AGCLLWQLFPEGTDYMDDGYAVVPSKSPSTSSILSLHSRRLQLFNSRCS  408



>ref|XP_010029765.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Eucalyptus grandis]
 gb|KCW56722.1| hypothetical protein EUGRSUZ_I02413 [Eucalyptus grandis]
Length=427

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 103/164 (63%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + +   +NP F   D+G DFI N++IP +DFA+ H YPDQW+ + + + ++ F
Sbjct  239  EGFYGQSTPQRKRLNPGF---DIGTDFIANNRIPGIDFATAHSYPDQWVSSSNDQYQLSF  295

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +HI D   +L+KP++ TEFG S ++  F   +RD+ F ++   +Y SA+R  + 
Sbjct  296  LNNWLNTHIQDAQYILRKPILLTEFGKSQKDHGFSTYQRDQLFNMVYYKVYASAKRGGAA  355

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AGS FWQ L EGM+ + D + +V  + PST  +I   S +L ++
Sbjct  356  AGSLFWQLLTEGMDSFRDGYEVVLNQSPSTANIIAYQSHKLYQI  399



>ref|XP_010926118.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 [Elaeis guineensis]
Length=430

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 100/164 (61%), Gaps = 4/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  S++    NP F    +G DFI N++IP +DFA++H YPDQWL + + + ++ F
Sbjct  236  EGFYGTSSAEK-QFNPGF---QVGTDFISNNQIPGIDFATIHSYPDQWLSDTNDQAQLAF  291

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + KWL SHI D   VL+KP++ TEFG S ++  +   +RD  F  +   IY SAR   + 
Sbjct  292  LNKWLDSHIQDARNVLRKPLLLTEFGKSWKDPGYSSSQRDALFNTVYSKIYWSARTGGAT  351

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ L EGM+ Y D + ++  E PST  +IT +  RL  L
Sbjct  352  AGGLFWQLLTEGMDSYRDGYEVILNEAPSTSNMITAYCHRLRYL  395



>ref|XP_009406291.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 103/161 (64%), Gaps = 4/161 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  S +  S NP F    +G DFI N++IP +DFA+VH YPDQW+ + +   ++ F
Sbjct  236  EGFYGESSPQKQS-NPGF---QVGTDFISNNQIPGIDFATVHSYPDQWIPDSNDRSQLSF  291

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            ++ WL  H+HD   VL+KP++ TEFG S ++  F  ++RD  F+ +   +Y SAR   + 
Sbjct  292  LKNWLDIHLHDACDVLQKPLLVTEFGKSCKDPGFSNDERDAMFRTVYSKVYLSARTGGAT  351

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            AGS FWQ LA+GM+ Y D + ++  E PST ++IT  S +L
Sbjct  352  AGSLFWQLLAQGMDSYRDGYEVILGESPSTTRVITLQSHKL  392



>ref|XP_004232427.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Solanum lycopersicum]
Length=434

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 104/164 (63%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + +  ++NP F   D+G DFI N++IP +DFA+VH YPDQW+ N + + ++ F
Sbjct  239  EGFYGQTTPQRRNLNPNF---DIGTDFIANNRIPGIDFATVHAYPDQWVTNSNDQGQLSF  295

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL SHI D   +L+KP++ TEFG S+++  F   +RD  +  +   IY SA+R  + 
Sbjct  296  LNNWLDSHIQDAQYILRKPLLITEFGKSSKDSGFSSYQRDLLYNTVYYKIYSSAKRGGAA  355

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ L+EGM  + D + I+  + PST  LI + S +L ++
Sbjct  356  AGGLFWQLLSEGMNSFGDGYEIILSQNPSTANLIAQQSHKLYQI  399



>ref|XP_010686734.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Beta vulgaris 
subsp. vulgaris]
Length=431

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 102/164 (62%), Gaps = 1/164 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFY    S  V+ NP  WAA LG DFI+NS +  +DFASVH YPD W+ + +   K+ F
Sbjct  266  EGFYVAAESSGVT-NPGEWAASLGTDFIQNSAVDGIDFASVHAYPDSWMPHANATTKLDF  324

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V +WL SHI  G  +LKKPV+FTE G     K       D   +++ D IY+SA++  +G
Sbjct  325  VFQWLDSHISFGVNILKKPVLFTEVGYPLHVKGEGGGYGDTLLRIVYDRIYESAKKGGAG  384

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+  WQ L E ME+Y D F +V W+ PSTY+LI E SCRL  +
Sbjct  385  AGALIWQLLVEEMEEYGDRFSLVAWKYPSTYKLIVEQSCRLKSI  428



>ref|XP_010921180.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Elaeis guineensis]
Length=476

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 100/169 (59%), Gaps = 0/169 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + + + +NP  +A  +GADFIRN +   +DFAS H+YPD W+ N   +  + F
Sbjct  284  EGFYGPSTPERLQLNPNTFAGQVGADFIRNHRALGIDFASAHMYPDSWVSNSISDAHIQF  343

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +H  D + VL  PV+F EFGLS+++ +F+   RDKF   +      S RR  SG
Sbjct  344  VKTWMQNHTDDAENVLGMPVVFGEFGLSSKDDKFNLTFRDKFINTVFATQLNSLRRGGSG  403

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLS  507
            AG   WQ   EG +  +D + +VP + PST  +++ HS RL   +   S
Sbjct  404  AGCLLWQLFPEGTDYMDDGYAVVPSKSPSTSSILSLHSRRLQLFNSRCS  452



>gb|KCW46727.1| hypothetical protein EUGRSUZ_K00550, partial [Eucalyptus grandis]
Length=373

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 99/163 (61%), Gaps = 2/163 (1%)
 Frame = +1

Query  4    GFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGFV  183
            GFYG         NP      +G DFI N+++P VDF+++H+YPDQWL N S +++  F 
Sbjct  212  GFYGQSVPGKQQNNPG--GQLIGTDFISNTQVPQVDFSTIHLYPDQWLPNPSEKDQDAFA  269

Query  184  RKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSGA  363
             KW+  HI D + +L KP++  EFG S+++  +  EKRD +F  + D IY SA    S A
Sbjct  270  DKWVQDHIQDSNTILNKPIILGEFGKSSKSSGYTIEKRDSYFGRLYDAIYASASNQGSCA  329

Query  364  GSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            G  FWQ LA+GM+++ND +G++  + PST  +I   S R+  L
Sbjct  330  GGLFWQVLAQGMDNFNDGYGVILEQSPSTASVIAHQSRRMLAL  372



>gb|KCW46726.1| hypothetical protein EUGRSUZ_K00548, partial [Eucalyptus grandis]
Length=380

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 99/164 (60%), Gaps = 2/164 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG         NP   +  +G DFI N+++P VDFA++H+YPDQW+ + S  E+V F
Sbjct  217  EGFYGQSVPGKQQNNPG--SVLVGTDFISNNQVPQVDFATIHLYPDQWMPSASEGEQVAF  274

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW+  HI D + +LKKP++  EFG S+ +  +  EKRD +F  + D IY SA    SG
Sbjct  275  ADKWVQVHIQDSNTILKKPIILGEFGKSSNSSGYSVEKRDSYFGRLYDAIYTSASNQGSG  334

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+ FWQ   +GM+ + D + ++  + PST  +I   S R++ L
Sbjct  335  AGALFWQLFVQGMDSFGDGYVVILKQSPSTASVIARQSRRMSAL  378



>gb|EEC71222.1| hypothetical protein OsI_03157 [Oryza sativa Indica Group]
Length=432

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 101/162 (62%), Gaps = 3/162 (2%)
 Frame = +1

Query  1    EGFYGPKS-SKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYG  S S+  +VNP  +   LG DFI N+++P +DFA+VH YPDQWL  +  + ++G
Sbjct  247  EGFYGASSPSRIAAVNPSGY--QLGTDFIANNQVPGIDFATVHSYPDQWLSGKDDQAQLG  304

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            F+ +WL +HI D   VL+KP++  EFG S ++  +   +RD  +  +   IY+SARR  +
Sbjct  305  FMGRWLDAHIADAQAVLRKPLLIAEFGKSWKDPGYSSGQRDALYGTVYAKIYESARRGGA  364

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
              G  FWQ L  GM+ Y D + +V  E PST  +IT +S RL
Sbjct  365  TVGGLFWQLLVPGMDSYRDGYEVVFGETPSTTGVITTNSRRL  406



>gb|KHN29491.1| Mannan endo-1,4-beta-mannosidase 6 [Glycine soja]
Length=462

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 103/174 (59%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +   +NP  +A  +G DFIRN  +  VDFASVH+YPD W+  Q  +  + F
Sbjct  272  EGFYGPSTPQRTQLNPNTYATQVGTDFIRNHLVLGVDFASVHMYPDSWISQQIADTHIPF  331

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +HI D ++ L  PV+F EFG+S+++  ++   RD     +   I  S ++  SG
Sbjct  332  VKSWMEAHIEDAERYLGMPVVFAEFGVSSKDPGYNSSYRDTVISTVYSTILNSTKKGGSG  391

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDY  522
            AGS  WQF  +G ++ +D + IV  + PST  +I   S RLA  +   +T+ ++
Sbjct  392  AGSLLWQFFPDGTDNMDDGYAIVLSKSPSTSSIIQLQSTRLALFNSLCNTKCNW  445



>ref|XP_009762330.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
sylvestris]
Length=434

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 106/173 (61%), Gaps = 3/173 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + +  ++NP F   D+G DFI N++IP +DFA+ H YPDQW+ N + + ++ F
Sbjct  239  EGFYGQSTPQRRTLNPNF---DIGTDFIANNRIPGIDFATAHAYPDQWITNSNDQAQLSF  295

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL SHI D   +L+KP++ TEFG S ++  F   +RD  +  +   IY SA+R  + 
Sbjct  296  LNNWLNSHIQDAQYILRKPLLITEFGKSWKDSGFSSYQRDLLYNTVYYKIYSSAKRGGAA  355

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKD  519
            AG  FWQ L+EGM+ + D + IV  + PST  LI + S +L ++    S  ++
Sbjct  356  AGGLFWQLLSEGMDSFRDGYEIVLSQSPSTANLIAQQSHKLYQIRKIFSRMRN  408



>sp|Q0JKM9.2|MAN1_ORYSJ RecName: Full=Mannan endo-1,4-beta-mannosidase 1; AltName: Full=Beta-mannanase 
1; AltName: Full=Endo-beta-1,4-mannanase 1; 
AltName: Full=OsMAN1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB91747.1| putative (1-4)-beta-mannan endohydrolase [Oryza sativa Japonica 
Group]
 gb|EAZ12991.1| hypothetical protein OsJ_02911 [Oryza sativa Japonica Group]
Length=432

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 101/162 (62%), Gaps = 3/162 (2%)
 Frame = +1

Query  1    EGFYGPKS-SKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVG  177
            EGFYG  S S+  +VNP  +   LG DFI N+++P +DFA+VH YPDQWL  +  + ++G
Sbjct  247  EGFYGASSPSRIAAVNPSGY--QLGTDFIANNQVPGIDFATVHSYPDQWLSGKDDQAQLG  304

Query  178  FVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLS  357
            F+ +WL +HI D   VL+KP++  EFG S ++  +   +RD  +  +   IY+SARR  +
Sbjct  305  FMGRWLDAHIADAQAVLRKPLLIAEFGKSWKDPGYSSGQRDALYGTVYAKIYESARRGGA  364

Query  358  GAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
              G  FWQ L  GM+ Y D + +V  E PST  +IT +S RL
Sbjct  365  TVGGLFWQLLVPGMDSYRDGYEVVFGETPSTTGVITTNSRRL  406



>ref|XP_009416732.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 101/164 (62%), Gaps = 4/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG +SS     NP F    +G DFI N++IP +DFA++H YPDQWL N   + ++ F
Sbjct  232  EGFYG-ESSPQKQANPGF---QVGTDFITNNQIPGIDFATLHSYPDQWLPNSDDQSQLAF  287

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL  HI D   VL+KP++ TEFG S+++  F  E+RD  F  +   IY SA    + 
Sbjct  288  LNNWLDVHIEDARDVLRKPLLVTEFGKSSKDPGFSSEQRDAMFGAVYSKIYSSASSGGAT  347

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AGS FWQ +A+GM+ Y D + +V  E PST ++IT  S +L  L
Sbjct  348  AGSCFWQLMAQGMDSYRDGYEVVLSEAPSTTRIITVQSRQLRYL  391



>ref|XP_010038519.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Eucalyptus 
grandis]
Length=403

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 99/164 (60%), Gaps = 2/164 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG         NP   +  +G DFI N+++P VDFA++H+YPDQW+ + S  E+V F
Sbjct  240  EGFYGQSVPGKQQNNPG--SVLVGTDFISNNQVPQVDFATIHLYPDQWMPSASEGEQVAF  297

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              KW+  HI D + +LKKP++  EFG S+ +  +  EKRD +F  + D IY SA    SG
Sbjct  298  ADKWVQVHIQDSNTILKKPIILGEFGKSSNSSGYSVEKRDSYFGRLYDAIYTSASNQGSG  357

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG+ FWQ   +GM+ + D + ++  + PST  +I   S R++ L
Sbjct  358  AGALFWQLFVQGMDSFGDGYVVILKQSPSTASVIARQSRRMSAL  401



>ref|XP_003534636.2| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Glycine max]
Length=489

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 103/174 (59%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +   +NP  +A  +G DFIRN  +  VDFASVH+YPD W+  Q  +  + F
Sbjct  299  EGFYGPSTPQRTQLNPNTYATQVGTDFIRNHLVLGVDFASVHMYPDSWISQQIADTHIPF  358

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +HI D ++ L  PV+F EFG+S+++  ++   RD     +   I  S ++  SG
Sbjct  359  VKSWMEAHIEDAERYLGMPVVFAEFGVSSKDPGYNSSYRDTVISTVYSTILNSTKKGGSG  418

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDY  522
            AGS  WQF  +G ++ +D + IV  + PST  +I   S RLA  +   +T+ ++
Sbjct  419  AGSLLWQFFPDGTDNMDDGYAIVLSKSPSTSSIIQLQSTRLALFNSLCNTKCNW  472



>ref|XP_010038521.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Eucalyptus 
grandis]
Length=402

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 99/163 (61%), Gaps = 2/163 (1%)
 Frame = +1

Query  4    GFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGFV  183
            GFYG         NP      +G DFI N+++P VDF+++H+YPDQWL N S +++  F 
Sbjct  241  GFYGQSVPGKQQNNPG--GQLIGTDFISNTQVPQVDFSTIHLYPDQWLPNPSEKDQDAFA  298

Query  184  RKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSGA  363
             KW+  HI D + +L KP++  EFG S+++  +  EKRD +F  + D IY SA    S A
Sbjct  299  DKWVQDHIQDSNTILNKPIILGEFGKSSKSSGYTIEKRDSYFGRLYDAIYASASNQGSCA  358

Query  364  GSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            G  FWQ LA+GM+++ND +G++  + PST  +I   S R+  L
Sbjct  359  GGLFWQVLAQGMDNFNDGYGVILEQSPSTASVIAHQSRRMLAL  401



>ref|XP_010035363.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Eucalyptus 
grandis]
 gb|KCW46729.1| hypothetical protein EUGRSUZ_K00551 [Eucalyptus grandis]
Length=402

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 101/164 (62%), Gaps = 2/164 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG        +NP      +G DFI N+++P VDFA++H+YP+QWL + S  E+  F
Sbjct  240  EGFYGQSVPGKQQINPG--GLLIGTDFISNNQLPQVDFATMHLYPEQWLPSASEGEQAAF  297

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+  HI D + +L KP++  EFG S+ +  +   KRD +F  + D IY SA +  S 
Sbjct  298  VDKWVQVHIQDSNTILNKPIILGEFGKSSNSSGYSLAKRDSYFGRLYDAIYTSASKQGSC  357

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ LA+GM+D++D + ++  + PST  +I + S +++ L
Sbjct  358  AGGLFWQLLAQGMDDFSDGYEVILEQSPSTASVIAQQSRKMSSL  401



>ref|XP_011085841.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Sesamum 
indicum]
Length=400

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 107/165 (65%), Gaps = 3/165 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    +    NP +   ++G DFI N++IP +DFA++H+YPDQW+   + E +  F
Sbjct  238  EGFYGESMPEKKQNNPGY---EVGTDFIANNRIPQIDFATIHLYPDQWVSGSNDEAQNEF  294

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ +HI+D   +++KP++ +EFG S+ +  +  E RD++F +I + +Y  ARR    
Sbjct  295  VEKWIQAHINDSKSIIRKPLVVSEFGKSSRSSGYTVEARDRYFGLIFNRVYGCARRRGPC  354

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
             G+ FWQ +AEGME+++D + +V  + P+T  +I + S R++ L+
Sbjct  355  GGALFWQVMAEGMENWSDGYEVVLEQSPTTVGVINQQSRRISSLN  399



>ref|XP_004495835.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Cicer arietinum]
Length=401

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 106/165 (64%), Gaps = 2/165 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG     ++  NP   +  +G DFI N+++P +DFA++H+YPDQWL+  +   +  F
Sbjct  238  EGFYGETMPPNMHFNPN--SLQIGTDFISNNQVPEIDFATIHLYPDQWLQGSNETTQSAF  295

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ +HI D + +L KP++ TEFG+S+++  +   KRD ++  I + IY+SA R  S 
Sbjct  296  VDKWIEAHIQDSNTILVKPILVTEFGMSSKSPGYSIGKRDSYYNKIYNDIYRSAIRGGSC  355

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
            AG  FWQ +++GM +  D + ++  E PST  LI + S ++++++
Sbjct  356  AGGLFWQLMSQGMGNMGDGYEVIFEETPSTALLIKQQSLKMSKIN  400



>ref|XP_009619497.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 106/173 (61%), Gaps = 3/173 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + +  ++NP F   D+G DFI N++IP +DFA+ H YPDQW+ N + + ++ F
Sbjct  239  EGFYGQSTPQRRNLNPSF---DIGTDFIANNRIPGIDFATAHAYPDQWITNSNDQAQLSF  295

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL SHI D   +L+KP++ TEFG S ++  F   +RD  +  +   IY SA+R  + 
Sbjct  296  LNHWLNSHIQDAQYILRKPLLITEFGKSWKDSGFSSYQRDLLYNTVYYKIYSSAKRGGAA  355

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKD  519
            AG  FWQ L+EGM+ + D + IV  + PST  LI + S +L ++    S  ++
Sbjct  356  AGGLFWQLLSEGMDSFRDGYEIVLNQNPSTANLIAQQSHKLYQIRKIFSRMRN  408



>gb|KEH23282.1| mannan endo-1,4-beta-mannosidase [Medicago truncatula]
Length=458

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 104/174 (60%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + + +  NP  +A  +G DFIRN ++  VDFASVH+Y D W+  Q  +  + F
Sbjct  268  EGFYGPSTPQRLQFNPNTYAQQVGTDFIRNHQVLGVDFASVHMYADSWVSPQIADTHISF  327

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +HI D +K L  PV+F+EFG+S+++  ++   RD     +   +  S ++  SG
Sbjct  328  VKSWMDAHIEDAEKYLGMPVVFSEFGVSSKDPGYNSTYRDTLISTVYSAVLNSTKKGGSG  387

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDY  522
            AGS  WQ   EG ++ +D + IV  + PST  ++T  S RLA  +   ST+ ++
Sbjct  388  AGSLLWQVFPEGTDNMDDGYAIVFSKSPSTSSIVTLQSTRLALFNSVCSTRCNW  441



>gb|KEH23283.1| mannan endo-1,4-beta-mannosidase [Medicago truncatula]
Length=457

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 104/174 (60%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + + +  NP  +A  +G DFIRN ++  VDFASVH+Y D W+  Q  +  + F
Sbjct  267  EGFYGPSTPQRLQFNPNTYAQQVGTDFIRNHQVLGVDFASVHMYADSWVSPQIADTHISF  326

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +HI D +K L  PV+F+EFG+S+++  ++   RD     +   +  S ++  SG
Sbjct  327  VKSWMDAHIEDAEKYLGMPVVFSEFGVSSKDPGYNSTYRDTLISTVYSAVLNSTKKGGSG  386

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDY  522
            AGS  WQ   EG ++ +D + IV  + PST  ++T  S RLA  +   ST+ ++
Sbjct  387  AGSLLWQVFPEGTDNMDDGYAIVFSKSPSTSSIVTLQSTRLALFNSVCSTRCNW  440



>ref|XP_010679767.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Beta vulgaris 
subsp. vulgaris]
Length=431

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 97/161 (60%), Gaps = 3/161 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    + +  NP     ++G DFI N++IP +DFA+VH YPDQWL N + + ++ F
Sbjct  243  EGFYGSSHPEKLHNNPNL---NIGTDFIANNQIPGIDFATVHAYPDQWLSNINAQSELAF  299

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V  WL SHI D   +L KP++  EFG S ++  F+  +RD+ F  +   IY SA+R  + 
Sbjct  300  VNNWLTSHIEDSQNILHKPLLLAEFGKSEKDPGFNTYQRDQLFASVYSKIYSSAKRGGAA  359

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            AG  FWQ L EG+E Y D + IV  + PST   I + S +L
Sbjct  360  AGGLFWQLLTEGIESYGDGYAIVLSKNPSTASTIAQQSRKL  400



>emb|CBI18021.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 93/161 (58%), Gaps = 0/161 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP +   V VNP  +A  +G DFIRN  +  VDFASVH+YPD W+     +  + F
Sbjct  218  EGFYGPSTPDKVQVNPNTYAQQVGTDFIRNHLVLGVDFASVHIYPDSWISQSITDAHLDF  277

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
             R W+ +HI D +K L  PV+F EFG+S+E+  ++   RD     +  ++  S R+  SG
Sbjct  278  TRSWMQAHIEDSEKYLGMPVVFAEFGVSSEDDGYNSSFRDTLISTVYKVLLNSTRKGGSG  337

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            AGS  WQ   +G +  +D + IV  + PST  +I   S RL
Sbjct  338  AGSLLWQLFPDGTDYMDDGYAIVLSKSPSTSNIIALQSTRL  378



>gb|ABF69949.1| (1-4)-beta-mannan endohydrolase (mannan endo-1,4-beta-mannosidase), 
putative [Musa acuminata]
Length=428

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 101/164 (62%), Gaps = 4/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG +SS     NP F    +G DFI N++IP +DFA++H YPDQWL N   + ++ F
Sbjct  234  EGFYG-ESSPQKQANPGF---QVGTDFIANNQIPGIDFATLHSYPDQWLPNSDDQSQLAF  289

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL  HI D   VL+KP++ TEFG S+++  F  E+RD  F  +   IY SA    + 
Sbjct  290  LNNWLDVHIEDARFVLRKPLLVTEFGKSSKDPGFSSEQRDAMFGAVYSKIYSSASSGGAT  349

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AGS FWQ +A+GM+ Y D + +V  E PST ++IT  S +L  L
Sbjct  350  AGSCFWQLMAQGMDSYRDGYEVVLSEAPSTTRIITVQSRQLRYL  393



>ref|XP_009394803.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 99/164 (60%), Gaps = 4/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  SS     NP     ++G DFI N++IP +DFA++H YPDQWL N   + ++ F
Sbjct  236  EGFYG-SSSPHKRFNPGL---EIGTDFIANNEIPNIDFATIHSYPDQWLSNADEQSQLAF  291

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL  HI D   V++KP++ TEFG S ++  F   +RD  FK +   IY SAR   S 
Sbjct  292  LSNWLGVHIRDARNVIRKPLLITEFGKSWKDPGFSIYQRDTLFKTVYSKIYWSARTGGSA  351

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ L++GM+ Y D + IV  E  ST Q+IT+ S +L  L
Sbjct  352  AGGLFWQLLSQGMDSYGDGYQIVMSEGTSTAQIITQQSRQLRYL  395



>dbj|BAD17132.1| putative (1-4)-beta-mannan endohydrolase [Oryza sativa Japonica 
Group]
 dbj|BAD17320.1| putative (1-4)-beta-mannan endohydrolase [Oryza sativa Japonica 
Group]
Length=398

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 96/164 (59%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    K+   NP +    +G DFI N+ +P VDFA++H YPDQW+   S +E+V F
Sbjct  237  EGFYGESMHKNF--NPGY---TVGTDFIANNLVPAVDFATIHSYPDQWVSGASSDEQVAF  291

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +RKW+  HI D   VL+KP++ TEFG S  +  +    RD +F+ + D +Y SAR   + 
Sbjct  292  MRKWMADHIRDSAAVLRKPLLVTEFGWSARSNGYTVAARDAYFRTVYDAVYASAREGGAC  351

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ +A GME + D + +V     ST  ++     R+A L
Sbjct  352  AGGLFWQVMAPGMESWTDGYEVVLERSKSTADVVAHQCARIAGL  395



>gb|KHN43366.1| Mannan endo-1,4-beta-mannosidase 1 [Glycine soja]
Length=345

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 101/164 (62%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG         NP +    +G DFI N+++P +DF ++H+YPDQW+ N +   K  F
Sbjct  184  EGFYGESMPDKKQFNPGY---QVGTDFISNNQVPEIDFTTIHLYPDQWVSNSNESAKDDF  240

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ +HI D + +L KP++FTEFG S+++  +  +KRD +F+ I + I+ SA      
Sbjct  241  VSKWVQAHIQDSNDILGKPILFTEFGKSSKSLGYSVDKRDNYFEKIYNFIFNSASNGGPC  300

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ + +GM+D +D   I+  E PST  +IT+ S +++ L
Sbjct  301  AGGLFWQLMTQGMDDLHDGNEIICDENPSTANVITQQSKKMSNL  344



>ref|XP_009602297.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
tomentosiformis]
Length=419

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 98/164 (60%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG   ++    NP F    +G DFI N++IP +DFA+VH YPDQWL  Q  E ++ F
Sbjct  235  EGFYGHSDAQKQQYNPNFL---VGTDFIANNQIPEIDFATVHSYPDQWLTGQDGEAQLNF  291

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL  HI D   +LKKP++F EFG + +   F  E+RD  F  +   IY SA+   + 
Sbjct  292  LNDWLNVHIQDAQSILKKPLIFAEFGKTYKGAGFTAEQRDIVFNTVYSSIYWSAKGGGAA  351

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ LAEGM+ Y D + I+  E PS  ++I + S RL ++
Sbjct  352  AGGLFWQLLAEGMDSYRDGYEIIFSESPSVSEIILQQSQRLNKI  395



>ref|NP_001048226.2| Os02g0766900 [Oryza sativa Japonica Group]
 sp|Q6Z310.2|MAN9_ORYSJ RecName: Full=Putative mannan endo-1,4-beta-mannosidase 9; AltName: 
Full=Beta-mannanase 9; AltName: Full=Endo-beta-1,4-mannanase 
9; AltName: Full=OsMANP; AltName: Full=OsMan9; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|EAY87657.1| hypothetical protein OsI_09068 [Oryza sativa Indica Group]
 gb|EAZ24735.1| hypothetical protein OsJ_08506 [Oryza sativa Japonica Group]
 dbj|BAF10140.2| Os02g0766900 [Oryza sativa Japonica Group]
Length=407

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 96/164 (59%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    K+   NP +    +G DFI N+ +P VDFA++H YPDQW+   S +E+V F
Sbjct  246  EGFYGESMHKNF--NPGY---TVGTDFIANNLVPAVDFATIHSYPDQWVSGASSDEQVAF  300

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +RKW+  HI D   VL+KP++ TEFG S  +  +    RD +F+ + D +Y SAR   + 
Sbjct  301  MRKWMADHIRDSAAVLRKPLLVTEFGWSARSNGYTVAARDAYFRTVYDAVYASAREGGAC  360

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ +A GME + D + +V     ST  ++     R+A L
Sbjct  361  AGGLFWQVMAPGMESWTDGYEVVLERSKSTADVVAHQCARIAGL  404



>ref|XP_009365529.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Pyrus x bretschneideri]
Length=429

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 100/164 (61%), Gaps = 5/164 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + K    NP  +   +G DFI N++IP +DFA+VH YPDQWL   S+E++V F
Sbjct  236  EGFYGSSNPKK---NPNNYP--IGTDFIANNQIPDIDFATVHAYPDQWLTGSSYEDQVSF  290

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+  HI D   +LKKPV+F EFG S +   +   +RD+ F V+   IY SAR   + 
Sbjct  291  LNSWVSGHIQDAQNILKKPVLFAEFGRSLKESGYTTSQRDRMFTVVYLGIYSSARGGGAA  350

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
             G  FWQ LAEGM+++ D +G+V  E  ST  LI E S +L  +
Sbjct  351  VGGLFWQLLAEGMDNFQDGYGVVLSESSSTVGLIAEESRKLNEI  394



>ref|XP_002273230.2| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Vitis vinifera]
Length=471

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 93/161 (58%), Gaps = 0/161 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP +   V VNP  +A  +G DFIRN  +  VDFASVH+YPD W+     +  + F
Sbjct  281  EGFYGPSTPDKVQVNPNTYAQQVGTDFIRNHLVLGVDFASVHIYPDSWISQSITDAHLDF  340

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
             R W+ +HI D +K L  PV+F EFG+S+E+  ++   RD     +  ++  S R+  SG
Sbjct  341  TRSWMQAHIEDSEKYLGMPVVFAEFGVSSEDDGYNSSFRDTLISTVYKVLLNSTRKGGSG  400

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            AGS  WQ   +G +  +D + IV  + PST  +I   S RL
Sbjct  401  AGSLLWQLFPDGTDYMDDGYAIVLSKSPSTSNIIALQSTRL  441



>ref|XP_007140064.1| hypothetical protein PHAVU_008G081200g [Phaseolus vulgaris]
 gb|ESW12058.1| hypothetical protein PHAVU_008G081200g [Phaseolus vulgaris]
Length=462

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 102/174 (59%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +    NP  +A  +G DFIRN +   VDFASVH+Y D W+  Q  +  + F
Sbjct  272  EGFYGPSTPQRTQFNPNTYATQVGTDFIRNHQALGVDFASVHIYADSWISQQIADSHLSF  331

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            ++ W+ +HI D +K L  PV+F EFG+S+++  ++   RD     + + I  S ++  SG
Sbjct  332  IKSWMEAHIEDAEKHLGMPVVFAEFGVSSKDPGYNSSYRDTVISSVYNTILNSTKKGGSG  391

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDY  522
            AGS  WQF  +G ++ +D + IV  + PST  +I   S RLA  +   +T+ ++
Sbjct  392  AGSLLWQFFPDGTDNMDDGYAIVLSKSPSTSSIIQLQSTRLALFNSLCNTKCNW  445



>gb|KHG22102.1| Mannan endo-1,4-beta-mannosidase 7 -like protein [Gossypium arboreum]
Length=434

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 106/173 (61%), Gaps = 3/173 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + +   +NP     D+G DFI N++IP +DFA+VH YPDQWL + S + ++ F
Sbjct  239  EGFYGQSTPQKKRLNPSL---DIGTDFIANNQIPGIDFATVHSYPDQWLSSSSEQYQLSF  295

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +HI D    L+KP++  EFG S ++  F+  +RD+ F ++ + IY SA+     
Sbjct  296  LNNWLDAHIRDARIALRKPILLAEFGKSWKDPGFNTYQRDQLFNIVYNKIYWSAKTGGPA  355

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKD  519
            +G  FWQ LA+GME + D + I+  ER ST  +I + S +L ++    + +++
Sbjct  356  SGGLFWQLLAQGMESFRDGYEIILSERSSTANVIAQQSHKLDQIRKIFTRRRN  408



>ref|XP_008648425.1| PREDICTED: LOW QUALITY PROTEIN: putative mannan endo-1,4-beta-mannosidase 
5 [Zea mays]
Length=495

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 96/165 (58%), Gaps = 3/165 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP S   +  NP  +A  +G DFIRN ++  VDFASVH+YPD W+   + E ++ F
Sbjct  291  EGFYGPSSPSRLPANPNAYAGQVGTDFIRNHRVLGVDFASVHIYPDTWMPGATLEARLWF  350

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKE---FDPEKRDKFFKVILDMIYKSARRN  351
            V  W+ +HI D D  L  PV+FTEFG ST       F+   RD+F + +   +  S RR 
Sbjct  351  VDSWMEAHIADADGTLGMPVVFTEFGASTTKARSGCFNATTRDQFIQAVYARLLNSTRRG  410

Query  352  LSGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLA  486
             +GAG+  WQ L  G +  +D +G+V     +T ++I+ HS  LA
Sbjct  411  GAGAGALLWQMLPLGTDYMDDGYGVVLPRAAATARIISAHSRDLA  455



>ref|XP_009785219.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
sylvestris]
Length=419

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 99/164 (60%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG   ++    NP F    +G DFI N++IP +DFA+VH YPDQWL  Q  E ++ F
Sbjct  235  EGFYGHSDAQKQQNNPNFL---VGTDFIANNQIPEIDFATVHSYPDQWLTGQDDEAQLNF  291

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL  HI D   +LKKP++F EFG + +   F PE+RD  F  +   IY SA+   + 
Sbjct  292  LNDWLNVHIQDAQSILKKPLIFAEFGKTYKGAGFTPEQRDIVFNTVYSSIYWSAKGGGAA  351

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ L+EGM+ Y D + I+  E PS  ++I + S RL ++
Sbjct  352  AGGLFWQLLSEGMDLYRDGYEIIFSESPSVSEIILQQSQRLNKI  395



>gb|AFY10517.1| endo-beta-1,4-mannanase, partial [Sisymbrium officinale]
Length=299

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 98/164 (60%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  S +S ++NP       G DFI N++IP +DF +VH YPD+W  + S + ++ F
Sbjct  108  EGFYGQSSPQSKTLNP---PGQFGTDFIANNRIPGIDFVTVHCYPDEWFIDASEQSQMEF  164

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            + KWL +HI D   VL KP++  EFG ST+   + P +RD  F  +   IY SA+R  + 
Sbjct  165  LNKWLDAHIQDAQNVLHKPIILAEFGKSTKKTGYTPAQRDMVFNTVYGKIYGSAKRGGAA  224

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ L  GM+++ D +GI+  +  ST  LI + S +L  +
Sbjct  225  AGGLFWQLLGNGMDNFQDGYGIILDQSSSTVNLIAQQSRKLTLI  268



>ref|XP_006373633.1| hypothetical protein POPTR_0016s01650g [Populus trichocarpa]
 gb|ERP51430.1| hypothetical protein POPTR_0016s01650g [Populus trichocarpa]
Length=286

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 87/147 (59%), Gaps = 2/147 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  ++    VNP  WAA LG+DFI NS I  +DFASVH YPD W+ +   EEK  +
Sbjct  90   EGFYGLNTTNKSEVNPGIWAASLGSDFIPNSAISNIDFASVHAYPDSWIPHAGLEEKTSY  149

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SHI DGD  L+KPV+F E G S    E     RD   K + D IY+SA++    
Sbjct  150  LSHWVDSHISDGDIALRKPVLFKEVGSSRHVDEKGVFDRDVLLKTVYDKIYESAKKRR--  207

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWER  441
            AG+F WQ L EG++ Y D   I+   R
Sbjct  208  AGAFIWQLLVEGVDGYTDKTTIISKRR  234



>gb|KDO64139.1| hypothetical protein CISIN_1g012093mg [Citrus sinensis]
Length=416

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 97/171 (57%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP +      NP  +A  +G DFIRN +   VDFASVH+Y D W+     +  + F
Sbjct  226  EGFYGPSAPDRAKFNPNSYATQVGTDFIRNHQTLGVDFASVHIYADSWISQTISDAHLQF  285

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
             + W+ +HI D +K L+ PV+FTEFG+S ++  ++   RD     +   +  S ++  SG
Sbjct  286  TKSWMEAHIEDAEKYLRMPVLFTEFGVSAKDTGYNTSFRDTLISSVYKTLLNSTKKGGSG  345

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQ  513
            AGS  WQ   +G +  ND + IV  + PST  +I+ HS R+A  +   ST+
Sbjct  346  AGSLLWQLFPDGTDYMNDGYAIVLSKSPSTSNIISLHSTRIATFNSLCSTK  396



>gb|KDO64137.1| hypothetical protein CISIN_1g012093mg [Citrus sinensis]
Length=426

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 97/171 (57%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP +      NP  +A  +G DFIRN +   VDFASVH+Y D W+     +  + F
Sbjct  236  EGFYGPSAPDRAKFNPNSYATQVGTDFIRNHQTLGVDFASVHIYADSWISQTISDAHLQF  295

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
             + W+ +HI D +K L+ PV+FTEFG+S ++  ++   RD     +   +  S ++  SG
Sbjct  296  TKSWMEAHIEDAEKYLRMPVLFTEFGVSAKDTGYNTSFRDTLISSVYKTLLNSTKKGGSG  355

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQ  513
            AGS  WQ   +G +  ND + IV  + PST  +I+ HS R+A  +   ST+
Sbjct  356  AGSLLWQLFPDGTDYMNDGYAIVLSKSPSTSNIISLHSTRIATFNSLCSTK  406



>ref|XP_006340651.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Solanum tuberosum]
Length=433

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 105/164 (64%), Gaps = 4/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG ++++  ++NP F   D+G DFI N++IP +DFA+ H YPDQW+ N + + ++ F
Sbjct  239  EGFYG-QTTQRRNLNPNF---DIGTDFIANNRIPGIDFATAHAYPDQWVTNSNDQGQLSF  294

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL SHI D   +L+KP++ TEFG S+++  F   +RD  +  +   IY SA+R  + 
Sbjct  295  LNNWLDSHIQDAQYILRKPLLITEFGKSSKDSGFSSYQRDLLYNTVYYKIYSSAKRGGAA  354

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ L+EGM  + D + I+  + PST  LI + S +L ++
Sbjct  355  AGGLFWQLLSEGMNSFGDGYEIILSQNPSTANLIAQQSHKLYQI  398



>ref|XP_003552321.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Glycine max]
Length=462

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 101/174 (58%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +    NP  +A  +G DFIRN  +  VDFASVH+Y D W+  Q  +  + F
Sbjct  272  EGFYGPSTPQRTQFNPNTYATQVGTDFIRNHLVLGVDFASVHIYADSWISQQIADTHIPF  331

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            ++ W+ +HI D +K L  PV+F EFG+S+++  ++   RD     +   I  S ++  SG
Sbjct  332  IKSWMEAHIEDAEKYLGMPVVFAEFGVSSKDPGYNSSYRDTVISTVYSTILNSTKKGGSG  391

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDY  522
            AGS  WQF  +G ++ +D + IV  + PST  +I   S RLA  +   +T+ ++
Sbjct  392  AGSLLWQFFPDGTDNMDDGYAIVLSKSPSTSGIIQLQSTRLALFNSLCNTKCNW  445



>ref|XP_003612065.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES95023.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=438

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 99/161 (61%), Gaps = 2/161 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + +    NP     ++G DFI N++IP +DFA+VH YPDQW+++ + ++++ F
Sbjct  241  EGFYGQSTPQRTKFNPTI--NNIGTDFIANNRIPGIDFATVHCYPDQWVQSSNEQDQLSF  298

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +H  D    LKKP++  EFG S ++  F   +RD+ F  +   IY SA+R    
Sbjct  299  LNNWLSAHFLDAQYALKKPILVAEFGKSFKDSGFSSNQRDQLFNTVYYKIYASAKRGGPA  358

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRL  483
            +G+ FWQ L EGME ++D +GI+  +  ST  +I + S +L
Sbjct  359  SGALFWQLLTEGMESFDDGYGILLGQSTSTANVIAQQSHKL  399



>gb|KDO64138.1| hypothetical protein CISIN_1g012093mg [Citrus sinensis]
Length=471

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 97/171 (57%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP +      NP  +A  +G DFIRN +   VDFASVH+Y D W+     +  + F
Sbjct  281  EGFYGPSAPDRAKFNPNSYATQVGTDFIRNHQTLGVDFASVHIYADSWISQTISDAHLQF  340

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
             + W+ +HI D +K L+ PV+FTEFG+S ++  ++   RD     +   +  S ++  SG
Sbjct  341  TKSWMEAHIEDAEKYLRMPVLFTEFGVSAKDTGYNTSFRDTLISSVYKTLLNSTKKGGSG  400

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQ  513
            AGS  WQ   +G +  ND + IV  + PST  +I+ HS R+A  +   ST+
Sbjct  401  AGSLLWQLFPDGTDYMNDGYAIVLSKSPSTSNIISLHSTRIATFNSLCSTK  451



>ref|XP_006429615.1| hypothetical protein CICLE_v10011654mg [Citrus clementina]
 ref|XP_006481219.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Citrus sinensis]
 gb|ESR42855.1| hypothetical protein CICLE_v10011654mg [Citrus clementina]
Length=471

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 97/171 (57%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP +      NP  +A  +G DFIRN +   VDFASVH+Y D W+     +  + F
Sbjct  281  EGFYGPSAPDRAKFNPNSYATQVGTDFIRNHQTLGVDFASVHIYADSWISQTISDAHLQF  340

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
             + W+ +HI D +K L+ PV+FTEFG+S ++  ++   RD     +   +  S ++  SG
Sbjct  341  TKSWMEAHIEDAEKYLRMPVLFTEFGVSAKDTGYNTSFRDTLISSVYKTLLNSTKKGGSG  400

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQ  513
            AGS  WQ   +G +  ND + IV  + PST  +I+ HS R+A  +   ST+
Sbjct  401  AGSLLWQLFPDGTDYMNDGYAIVLSKSPSTSNIISLHSTRIATFNSLCSTK  451



>ref|XP_006481220.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X2 
[Citrus sinensis]
Length=457

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 97/171 (57%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP +      NP  +A  +G DFIRN +   VDFASVH+Y D W+     +  + F
Sbjct  267  EGFYGPSAPDRAKFNPNSYATQVGTDFIRNHQTLGVDFASVHIYADSWISQTISDAHLQF  326

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
             + W+ +HI D +K L+ PV+FTEFG+S ++  ++   RD     +   +  S ++  SG
Sbjct  327  TKSWMEAHIEDAEKYLRMPVLFTEFGVSAKDTGYNTSFRDTLISSVYKTLLNSTKKGGSG  386

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQ  513
            AGS  WQ   +G +  ND + IV  + PST  +I+ HS R+A  +   ST+
Sbjct  387  AGSLLWQLFPDGTDYMNDGYAIVLSKSPSTSNIISLHSTRIATFNSLCSTK  437



>gb|ACU19893.1| unknown [Glycine max]
Length=462

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 100/174 (57%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +    NP  +A  +G DFIRN  +  VDFASVH+Y D W   Q  +  + F
Sbjct  272  EGFYGPSTPQRTQFNPNTYATQVGTDFIRNHLVLGVDFASVHIYADSWFSQQIADTHIPF  331

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            ++ W+ +HI D +K L  PV+F EFG+S+++  ++   RD     +   I  S ++  SG
Sbjct  332  IKSWMEAHIEDAEKYLGMPVVFAEFGVSSKDPGYNSSYRDTVISTVYSTILNSTKKGGSG  391

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDY  522
            AGS  WQF  +G ++ +D + IV  + PST  +I   S RLA  +   +T+ ++
Sbjct  392  AGSLLWQFFPDGTDNMDDGYAIVLSKSPSTSGIIQLQSTRLALFNSLCNTKCNW  445



>ref|XP_009410508.1| PREDICTED: mannan endo-1,4-beta-mannosidase 8 [Musa acuminata 
subsp. malaccensis]
Length=432

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 95/165 (58%), Gaps = 0/165 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + + + +NP   A D G DFIRN ++  VDFASVHVY D WL +      + F
Sbjct  254  EGFYGPSTPERLQLNPNTCAGDAGTDFIRNHRVAGVDFASVHVYSDTWLPDPDSNAHLQF  313

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            VR W+  H+ D +K+L  PV+F EFG+S +++ F+   R+ F + + D +  S  R   G
Sbjct  314  VRAWMHQHMDDAEKLLGMPVVFGEFGVSVKDERFESRFRETFMETVYDTLLSSRMRRDVG  373

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
             G   WQ   EG E  +D + +V  + PST  ++++HS  L   H
Sbjct  374  GGCLVWQLFPEGTEHMDDGYAVVLADSPSTLDMLSQHSRNLQTHH  418



>ref|XP_009395690.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=432

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 102/176 (58%), Gaps = 3/176 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  SS     NP      +G DFI N++IP +DFA++HVYPDQWL   + + ++ F
Sbjct  236  EGFYGA-SSPQKQFNPRL--LQVGTDFIANNRIPNIDFATIHVYPDQWLSASNDQSQLAF  292

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+  HI D    L+KP++ TEFG S+++  F   +RD  FK +   IY SAR   S 
Sbjct  293  LSNWIDVHIRDARDALRKPLLVTEFGKSSKDPGFSVGQRDALFKTVYSKIYWSARSGGSA  352

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLK  528
            AG FFWQ L+EGM  Y D + IV  E  ST ++I   S +L  L    + Q++  K
Sbjct  353  AGGFFWQLLSEGMGSYGDGYEIVLSEGSSTARIIALQSRQLRYLGKWYARQRNVAK  408



>ref|XP_006841534.1| hypothetical protein AMTR_s00003p00158370 [Amborella trichopoda]
 gb|ERN03209.1| hypothetical protein AMTR_s00003p00158370 [Amborella trichopoda]
Length=427

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 105/165 (64%), Gaps = 3/165 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  S +    NP +    +G DFI N++IP +DFA++H YPDQW+   S + ++ F
Sbjct  242  EGFYGDSSPQREQFNPGY---KVGTDFISNNQIPGIDFATIHAYPDQWISGSSDQAQLSF  298

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            ++ W+ +HI D + VLKKP++FTEFG S++ + + P  RD  F  + + IY SAR   +G
Sbjct  299  LQSWVQAHIEDSNTVLKKPMLFTEFGKSSKTQGYTPGLRDTLFAAVYNSIYTSARSGGAG  358

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
            AG  FWQ L + M+++ D + ++  E PST  +I + S +++ L+
Sbjct  359  AGGLFWQLLDKDMDNFRDGYEVIMAESPSTANVIAQQSHKVSSLN  403



>gb|ACN78662.1| endo-beta-mannanase [Actinidia arguta]
Length=433

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 103/164 (63%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  + +  S+NP F   ++G DFI N+++P +DFA+VH YPDQWL + + + ++ F
Sbjct  238  EGFYGQTTPQRKSLNPGF---NIGTDFIANNRVPWIDFATVHSYPDQWLTSSNEQNQLSF  294

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL +HI D   VL+KP++ TEFG S ++  +   +RD  F  +   IY SA+R  + 
Sbjct  295  LNNWLDTHIQDAQFVLRKPLLLTEFGKSWKDPGYSTYQRDLLFNTVYYKIYSSAKRGGAA  354

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ L EGM+ + D + IV  E PST  +I + S RL ++
Sbjct  355  AGGLFWQLLTEGMDSFRDGYDIVLSESPSTANVIAQQSHRLYQI  398



>ref|XP_006373632.1| hypothetical protein POPTR_0016s01650g [Populus trichocarpa]
 gb|ERP51429.1| hypothetical protein POPTR_0016s01650g [Populus trichocarpa]
Length=285

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 87/147 (59%), Gaps = 2/147 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG  ++    VNP  WAA LG+DFI NS I  +DFASVH YPD W+ +   EEK  +
Sbjct  89   EGFYGLNTTNKSEVNPGIWAASLGSDFIPNSAISNIDFASVHAYPDSWIPHAGLEEKTSY  148

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ SHI DGD  L+KPV+F E G S    E     RD   K + D IY+SA++    
Sbjct  149  LSHWVDSHISDGDIALRKPVLFKEVGSSRHVDEKGVFDRDVLLKTVYDKIYESAKKR--R  206

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWER  441
            AG+F WQ L EG++ Y D   I+   R
Sbjct  207  AGAFIWQLLVEGVDGYTDKTTIISKRR  233



>ref|XP_004492573.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Cicer arietinum]
Length=463

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 103/181 (57%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + + +  NP  +A  +G DFIRN ++  VDFASVH+Y D W+  Q  +  + F
Sbjct  273  EGFYGPSTPQRLQFNPNTYAQQVGTDFIRNHQVLGVDFASVHMYADSWISTQIADTHLPF  332

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +HI D +K L  PV+F+EFG+S+++  ++   RD     +   I  S ++  SG
Sbjct  333  VKSWMEAHIEDAEKYLGMPVIFSEFGISSKDPGYNSTYRDTLINTVYSSILNSTKKGGSG  392

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYLKSLCS  540
            AGS  WQ   EG ++ +D + IV  + PST  +++  S RL   +           SLCS
Sbjct  393  AGSLLWQVFPEGTDNMDDGYAIVLSKSPSTSSIVSLQSYRLGLFN-----------SLCS  441

Query  541  S  543
            S
Sbjct  442  S  442



>gb|KDP21853.1| hypothetical protein JCGZ_00640 [Jatropha curcas]
Length=464

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 97/169 (57%), Gaps = 0/169 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +    NP  +A  +G DFIRN +   VDFASVH+Y D W+     +  + F
Sbjct  274  EGFYGPSAPERTQFNPNSYATQVGTDFIRNHQTLGVDFASVHIYADSWISQTISDAHIEF  333

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
             + W+ +HI D +K L+ PV+F EFG+S ++  ++   RD  F  +   +  S ++  SG
Sbjct  334  TKSWMEAHIEDAEKYLRMPVIFAEFGVSAKDPGYNSSFRDTLFNTVYKTLLNSTKKGGSG  393

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLS  507
            AGS  WQ   +G +  +D + IV  + PST  +I+ HS RLA L+   S
Sbjct  394  AGSLLWQLFPDGTDYMDDGYAIVISKAPSTSNIISLHSTRLAILNSMCS  442



>emb|CDP07490.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 106/175 (61%), Gaps = 3/175 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP +++   +NP F A   G DFI +++I  +DFA+VH YPD WL  QS E ++ F
Sbjct  240  EGFYGPSNAQKQHLNPNFQA---GTDFIASNQIKDIDFATVHSYPDAWLAGQSEEAQLSF  296

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  WL SHI D +K+L+KP++FTEFG S+++  F+  +RD  F  +   IY SA    + 
Sbjct  297  LINWLQSHIQDAEKILQKPLLFTEFGKSSKDPGFNMNQRDLLFNTVYSTIYSSASGGGAA  356

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQKDYL  525
            AG  FWQFL EGM+   D + ++  E  ST  +I + S RL ++    S   + L
Sbjct  357  AGGLFWQFLTEGMDPLRDGYEVILSESSSTASIIVQQSRRLNKIRRMYSRNSNVL  411



>ref|XP_010444793.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Camelina sativa]
Length=434

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 102/166 (61%), Gaps = 5/166 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEE--KV  174
            EGFYG  S +S ++NP       G DFI N++IP +DFA+VH YPD+W  + S  E  K+
Sbjct  240  EGFYGQSSPQSKTLNPP---GQFGTDFIANNRIPGIDFATVHSYPDEWFTDASASEQSKM  296

Query  175  GFVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNL  354
             F+ KWL +HI D   VL+KP++  EFG ST+ + + P +RD  F  +   IY+SA+R  
Sbjct  297  DFLNKWLDAHIQDAQNVLRKPIIVAEFGKSTKKQGYSPAERDIVFNTVYGKIYESAKRGG  356

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            + AG  FWQ L  GM+++ D +GI+  +  ST  +I + S +L  +
Sbjct  357  AAAGGLFWQLLGNGMDNFQDGYGIILNQSSSTVNVIAQQSRKLTLI  402



>ref|XP_010484638.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Camelina 
sativa]
Length=434

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 101/166 (61%), Gaps = 5/166 (3%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEE--KV  174
            EGFYG  S +S ++NP       G DFI N++IP +DF +VH YPD+W  + S  E  K+
Sbjct  240  EGFYGQSSPQSTTLNP---PGQFGTDFIANNRIPGIDFVTVHSYPDEWFTDASASEQSKM  296

Query  175  GFVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNL  354
             F+ KWL +HI D   VL+KP++  EFG ST+ + + P +RD  F  +   IY+SA+R  
Sbjct  297  DFLNKWLNAHIQDAQNVLRKPIIVAEFGKSTKKQGYSPAERDIVFNTVYGKIYESAKRGG  356

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            + AG  FWQ L  GM+++ D +GI+  +  ST  +I + S +L  +
Sbjct  357  AAAGGLFWQLLGNGMDNFQDGYGIILNQSSSTVNVIAQQSRKLTLI  402



>emb|CAC51690.3| endo-beta-1,4-mannanase [Lactuca sativa]
Length=410

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 104/165 (63%), Gaps = 3/165 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    +    NP +   ++G DFI N+ +  VDFA++H+YPDQW+   S E +  F
Sbjct  236  EGFYGESMPEKKQNNPGY---EVGTDFITNNGVNNVDFATIHMYPDQWVPGASDEARAKF  292

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ +HI D D +L+KP++  EFG S+ +  +  E RD++F  I +  Y+SAR   S 
Sbjct  293  VEKWINAHIEDCDSILRKPLLIAEFGKSSWSSGYTVEARDEYFGGIFNTAYESARNRGSC  352

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
            +G+ FWQ +AEGM+++ D + +V  + PST  +I + S R++ L+
Sbjct  353  SGTTFWQVMAEGMDNWGDGYQVVLDQNPSTAAIIAKQSQRISSLN  397



>ref|XP_006841527.1| hypothetical protein AMTR_s00003p00152240 [Amborella trichopoda]
 gb|ERN03202.1| hypothetical protein AMTR_s00003p00152240 [Amborella trichopoda]
Length=427

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 105/165 (64%), Gaps = 3/165 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EG+YG  S +    NP +    +G DFI N++IP +DFA++H YPDQW+   S + ++ F
Sbjct  242  EGYYGDSSPQRQQFNPGY---KVGTDFIFNNQIPGIDFATIHAYPDQWIPGSSDQAQLSF  298

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            ++ W+ +HI D + VLKKP++FTEFG S++ + + P  RD  F  + + IY SAR   +G
Sbjct  299  LQSWVQAHIEDSNTVLKKPMLFTEFGKSSKTQGYTPGLRDTLFATVYNSIYTSARSGGAG  358

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
            AG  FWQ L + M+++ D + ++  E PST  +I + S +L+ L+
Sbjct  359  AGGLFWQLLDKDMDNFRDGYDVIMAESPSTANVIAQQSHKLSSLN  403



>ref|XP_010522867.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 isoform X3 [Tarenaya 
hassleriana]
Length=373

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 99/164 (60%), Gaps = 4/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    + +  NP       G+DF+ N+ IP +DFA++H+YPD WL  Q+  +++GF
Sbjct  205  EGFYGKSRPERMIYNPN--TGITGSDFLSNNLIPDIDFATIHIYPDSWLPQQT--DQIGF  260

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ +HIHD D +LKKP++  EFG S+    F  +KR+ FF+ I  MIY+SAR   SG
Sbjct  261  VDKWVRAHIHDCDTLLKKPLVIAEFGKSSMASGFSLDKRNMFFRRIYRMIYESARAGSSG  320

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AG  FWQ    G     D + +   E  ST ++I + S +L+ L
Sbjct  321  AGGIFWQLSTRGTGKLGDGYEVFLEEGSSTARVIADQSTKLSSL  364



>ref|XP_001762204.1| predicted protein [Physcomitrella patens]
 gb|EDQ72996.1| predicted protein [Physcomitrella patens]
Length=392

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 90/144 (63%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EG+Y   S    S NP  ++  +G DFIR+ ++P +DFA+ H YPDQWL    F+    F
Sbjct  215  EGYYATDSVGCRSSNPNSYSGTVGTDFIRHHQLPYIDFATAHAYPDQWLSAGDFDATQDF  274

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
              +W+ +HI D ++VL+ PV+F EFGLS +   F  +KRD FF ++ D +Y+SA +  +G
Sbjct  275  FDRWVRAHIVDAERVLRMPVIFAEFGLSDKKPGFTEQKRDAFFGIVYDQVYQSALKRGAG  334

Query  361  AGSFFWQFLAEGMEDYNDDFGIVP  432
            +G+  WQ L   M D+ND +G+ P
Sbjct  335  SGALMWQLLPLEMSDWNDGYGLAP  358



>gb|KEH17803.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=465

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 96/169 (57%), Gaps = 0/169 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +    NP  +A  +G DFIRN ++  VDFAS H+YPD W+     +  + F
Sbjct  275  EGFYGPSTPQRFQFNPNSYAQQVGTDFIRNHQVLGVDFASAHIYPDSWISQSVADSHIPF  334

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +HI D +K L  PV+F EFG+S ++  ++   RD     +   I  S ++  SG
Sbjct  335  VKSWMEAHIDDAEKYLGMPVVFGEFGVSAKDPGYNSTYRDTLINTVYKTILNSTKKGGSG  394

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLS  507
            AGS  WQF  +G +  +D + IV  + PST  +I+  S RLA  +   S
Sbjct  395  AGSLLWQFFPDGTDYMDDGYAIVLSKAPSTSSMISLQSTRLALFNSLCS  443



>ref|XP_003626672.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
Length=462

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 96/169 (57%), Gaps = 0/169 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +    NP  +A  +G DFIRN ++  VDFAS H+YPD W+     +  + F
Sbjct  272  EGFYGPSTPQRFQFNPNSYAQQVGTDFIRNHQVLGVDFASAHIYPDSWISQSVADSHIPF  331

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +HI D +K L  PV+F EFG+S ++  ++   RD     +   I  S ++  SG
Sbjct  332  VKSWMEAHIDDAEKYLGMPVVFGEFGVSAKDPGYNSTYRDTLINTVYKTILNSTKKGGSG  391

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLS  507
            AGS  WQF  +G +  +D + IV  + PST  +I+  S RLA  +   S
Sbjct  392  AGSLLWQFFPDGTDYMDDGYAIVLSKAPSTSSMISLQSTRLALFNSLCS  440



>gb|EYU45779.1| hypothetical protein MIMGU_mgv1a020287mg [Erythranthe guttata]
Length=392

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 101/165 (61%), Gaps = 3/165 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    +    NP +   ++G DFI N+ +P VDF ++H+YPDQW+   + E +  F
Sbjct  223  EGFYGESMPEKKQNNPGY---EVGTDFIANNLVPHVDFTTIHLYPDQWVPGSNDEVQAEF  279

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V KW+ +HI D   V+ KP+M TEFG S+ +  ++ + RD +F  I D +YK AR     
Sbjct  280  VHKWIQTHIEDSKLVIGKPIMVTEFGKSSRSSGYNVQARDNYFSSIFDSVYKCARTGGPC  339

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLH  495
             G+ FWQ +A+GM D++D + +V  + PST  +I++ S  ++ L+
Sbjct  340  GGALFWQVMAQGMGDWSDGYDVVLEQSPSTVGVISQQSREISSLN  384



>gb|AET01148.2| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=462

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 96/169 (57%), Gaps = 0/169 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +    NP  +A  +G DFIRN ++  VDFAS H+YPD W+     +  + F
Sbjct  272  EGFYGPSTPQRFQFNPNSYAQQVGTDFIRNHQVLGVDFASAHIYPDSWISQSVADSHIPF  331

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +HI D +K L  PV+F EFG+S ++  ++   RD     +   I  S ++  SG
Sbjct  332  VKSWMEAHIDDAEKYLGMPVVFGEFGVSAKDPGYNSTYRDTLINTVYKTILNSTKKGGSG  391

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLS  507
            AGS  WQF  +G +  +D + IV  + PST  +I+  S RLA  +   S
Sbjct  392  AGSLLWQFFPDGTDYMDDGYAIVLSKAPSTSSMISLQSTRLALFNSLCS  440



>ref|XP_007134569.1| hypothetical protein PHAVU_010G058300g [Phaseolus vulgaris]
 gb|ESW06563.1| hypothetical protein PHAVU_010G058300g [Phaseolus vulgaris]
Length=438

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 99/172 (58%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +   +NP  +A  +G DFIRN ++  VDFASVH+YPD W+     +  + F
Sbjct  248  EGFYGPSTPQRYQLNPNAFAQQVGTDFIRNHQVLGVDFASVHIYPDSWISQSIADSHLPF  307

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            ++ W+ +HI D +K L  PV+F EFG+S +   F+   RD     +   I  S ++  SG
Sbjct  308  IKSWMEAHIEDAEKYLGMPVVFGEFGVSAKAPGFNSSYRDNLVNTVYKTILNSTKKGGSG  367

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQK  516
            AGS  WQ   +G +  +D + IV  + PST  +I+  S RLA L   L ++K
Sbjct  368  AGSLVWQLFPDGTDYMDDGYAIVLSKSPSTSSIISLQSTRLA-LFNSLCSKK  418



>gb|KHN42134.1| Mannan endo-1,4-beta-mannosidase 6 [Glycine soja]
Length=407

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 99/172 (58%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +    NP  +A ++G DFIRN ++  VDFASVH+YPD W+     +  + F
Sbjct  217  EGFYGPSTPQKYQFNPNSYAHEVGTDFIRNHQVLGVDFASVHIYPDSWISQSVADSHLPF  276

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            ++ W+ +HI D +K L  PV+F EFG+S +   ++   RD     +   I  S ++  SG
Sbjct  277  IKTWMEAHIEDAEKYLGMPVVFAEFGVSAKAPGYNSTYRDNLINTVYKTILNSTKKGGSG  336

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQK  516
            AGS  WQ   +G +  +D + IV  + PST  +I+  S RLA L   L ++K
Sbjct  337  AGSLVWQLFPDGTDYMDDGYAIVLSKSPSTSSIISLQSTRLA-LFNSLCSKK  387



>ref|XP_006836841.1| hypothetical protein AMTR_s00099p00070100 [Amborella trichopoda]
 gb|ERM99694.1| hypothetical protein AMTR_s00099p00070100 [Amborella trichopoda]
Length=419

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 101/169 (60%), Gaps = 6/169 (4%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYG    +  ++NP +    +G DFI N+ +  VDFA++H YPD WL  QS E ++ F
Sbjct  240  EGFYGDTMPQEKAINPGY---QVGTDFITNNLVREVDFATIHAYPDIWLSGQSDEAQLAF  296

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +++W+ SH  D  +VLKKP++F EFG S ++  ++   RD F   I   IY+ AR   + 
Sbjct  297  MQRWMQSHWRDSKRVLKKPLVFAEFGKSKKDPGYNIGARDSFLNSIYRNIYQLARSGGTI  356

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCR---LARLHG  498
             G   WQ +AEGME + D + IV  + PSTY +I+  S +   L RLHG
Sbjct  357  GGGLIWQLMAEGMESFYDGYEIVLSQSPSTYGVISGQSHKMSALGRLHG  405



>ref|XP_010061294.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Eucalyptus 
grandis]
Length=426

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 102/164 (62%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFY   S++    NP F    +G DFI N++IP +DFA+VH YPDQWL + S   ++ F
Sbjct  241  EGFYAQSSAQKQQNNPSFL---VGTDFIENNQIPGIDFATVHSYPDQWLSDPSVGNQISF  297

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            +  W+ +HI D   VL KP++F EFG+S+++  ++  +RD+FF  +   IY SAR   + 
Sbjct  298  LSNWVNTHIQDAQNVLHKPLLFAEFGISSKDSGYNQNERDQFFDTVYSAIYSSARGGGAA  357

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
            AGS FWQ L  GM+ Y D + IV  E PST  +I + S +L ++
Sbjct  358  AGSMFWQLLTVGMDSYRDGYEIVLSESPSTASVIAQQSQKLNKI  401



>ref|XP_007134568.1| hypothetical protein PHAVU_010G058300g [Phaseolus vulgaris]
 gb|ESW06562.1| hypothetical protein PHAVU_010G058300g [Phaseolus vulgaris]
Length=462

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 99/172 (58%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +   +NP  +A  +G DFIRN ++  VDFASVH+YPD W+     +  + F
Sbjct  272  EGFYGPSTPQRYQLNPNAFAQQVGTDFIRNHQVLGVDFASVHIYPDSWISQSIADSHLPF  331

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            ++ W+ +HI D +K L  PV+F EFG+S +   F+   RD     +   I  S ++  SG
Sbjct  332  IKSWMEAHIEDAEKYLGMPVVFGEFGVSAKAPGFNSSYRDNLVNTVYKTILNSTKKGGSG  391

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQK  516
            AGS  WQ   +G +  +D + IV  + PST  +I+  S RLA L   L ++K
Sbjct  392  AGSLVWQLFPDGTDYMDDGYAIVLSKSPSTSSIISLQSTRLA-LFNSLCSKK  442



>gb|AET01118.2| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=445

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 96/169 (57%), Gaps = 0/169 (0%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +    NP  +A  +G DFIRN ++  VDFAS H+YPD W+     +  + F
Sbjct  255  EGFYGPSTPQRFQFNPNSYAQQVGTDFIRNHQVLGVDFASAHIYPDSWISQSVADSHIPF  314

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            V+ W+ +HI D +K L  PV+F EFG+S ++  ++   RD     +   I  S ++  SG
Sbjct  315  VKSWMEAHIDDAEKYLGMPVVFGEFGVSAKDPGYNSTYRDTLINTVYKTILNSTKKGGSG  374

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLS  507
            AG+  WQF  +G +  +D + IV  + PST  +I+  S RLA  +   S
Sbjct  375  AGTLLWQFFPDGTDYMDDGYAIVLSKAPSTSSMISLQSTRLALFNSLCS  423



>ref|XP_006444660.1| hypothetical protein CICLE_v10020376mg [Citrus clementina]
 gb|ESR57900.1| hypothetical protein CICLE_v10020376mg [Citrus clementina]
 gb|KDO86723.1| hypothetical protein CISIN_1g015179mg [Citrus sinensis]
Length=412

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 98/166 (59%), Gaps = 4/166 (2%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWL--RNQSFEEKV  174
            EGFYG    +    NP      +G DFI N++IP VDFA++H+YP+QWL   N S E ++
Sbjct  245  EGFYGESVPERQKYNPN--NTPVGTDFITNNQIPDVDFATIHIYPEQWLPPGNTSDEIQL  302

Query  175  GFVRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNL  354
             FV +W+ +HI D D +LKKP++  EFG S +   +  +KR+ +F+ + D IY  A+   
Sbjct  303  AFVNRWIQAHIQDSDSILKKPILIGEFGKSYKYPGYSEQKRNSYFQKVYDAIYDCAKSKG  362

Query  355  SGAGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARL  492
               G  FWQ + +GM ++ D + +V    PST  +I + S RLA L
Sbjct  363  PCGGGLFWQLMTQGMTNFGDGYEVVLESSPSTANIINQQSLRLAVL  408



>ref|XP_003522088.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Glycine max]
Length=438

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 99/172 (58%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    EGFYGPKSSKSVSVNPEFWAADLGADFIRNSKIPTVDFASVHVYPDQWLRNQSFEEKVGF  180
            EGFYGP + +    NP  +A ++G DFIRN ++  VDFASVH+YPD W+     +  + F
Sbjct  248  EGFYGPSTPQKYQFNPNSYAHEVGTDFIRNHQVLGVDFASVHIYPDSWISQSVADSHLPF  307

Query  181  VRKWLVSHIHDGDKVLKKPVMFTEFGLSTENKEFDPEKRDKFFKVILDMIYKSARRNLSG  360
            ++ W+ +HI D +K L  PV+F EFG+S +   ++   RD     +   I  S ++  SG
Sbjct  308  IKTWMEAHIEDAEKYLGMPVVFAEFGVSAKAPGYNSTYRDNLINTVYKTILNSTKKGGSG  367

Query  361  AGSFFWQFLAEGMEDYNDDFGIVPWERPSTYQLITEHSCRLARLHGPLSTQK  516
            AGS  WQ   +G +  +D + IV  + PST  +I+  S RLA L   L ++K
Sbjct  368  AGSLVWQLFPDGTDYMDDGYAIVLSKSPSTSSIISLQSTRLA-LFNSLCSKK  418



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1309270154804