BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c40241_g1_i1 len=793 path=[1:0-792]

Length=793
                                                                      Score     E

ref|XP_009630064.1|  PREDICTED: CASP-like protein 1E2 isoform X1        189   5e-56   
ref|XP_006342777.1|  PREDICTED: CASP-like protein 5-like                184   9e-54   
ref|XP_009803956.1|  PREDICTED: CASP-like protein 1E1                   182   5e-53   
ref|XP_004229217.1|  PREDICTED: CASP-like protein 1E2                   181   1e-52   
emb|CDO98909.1|  unnamed protein product                                172   4e-49   
ref|XP_002276206.1|  PREDICTED: CASP-like protein 1E2                   165   2e-46   Vitis vinifera
gb|EYU45581.1|  hypothetical protein MIMGU_mgv1a023532mg                160   1e-44   
ref|XP_002311845.2|  integral membrane family protein                   159   3e-44   Populus trichocarpa [western balsam poplar]
gb|KDP40019.1|  hypothetical protein JCGZ_02017                         154   2e-42   
ref|XP_011013341.1|  PREDICTED: CASP-like protein 1E1                   154   3e-42   
ref|XP_007035490.1|  CASP-like protein, putative                        156   3e-42   
ref|XP_008340843.1|  PREDICTED: CASP-like protein VIT_05s0020g01820     152   1e-41   
ref|XP_009352216.1|  PREDICTED: CASP-like protein VIT_05s0020g01820     152   1e-41   
ref|XP_010683571.1|  PREDICTED: CASP-like protein 1E1                   152   2e-41   
ref|XP_010036826.1|  PREDICTED: CASP-like protein 1E1                   152   2e-41   
ref|XP_009369107.1|  PREDICTED: CASP-like protein VIT_05s0020g01820     150   4e-41   
ref|XP_010036836.1|  PREDICTED: CASP-like protein 1E1                   148   6e-40   
ref|NP_001239666.1|  CASP-like protein 1E1                              147   1e-39   
ref|XP_010036846.1|  PREDICTED: CASP-like protein 1E1                   146   2e-39   
ref|XP_002516873.1|  conserved hypothetical protein                     145   6e-39   Ricinus communis
ref|XP_002268702.1|  PREDICTED: CASP-like protein 1E1                   145   1e-38   Vitis vinifera
ref|XP_003546096.2|  PREDICTED: CASP-like protein 6-like                144   3e-38   
ref|XP_004486055.1|  PREDICTED: CASP-like protein 5-like                143   3e-38   
emb|CAN69352.1|  hypothetical protein VITISV_023954                     143   6e-38   Vitis vinifera
ref|XP_010105029.1|  hypothetical protein L484_008470                   142   1e-37   
ref|XP_010105028.1|  hypothetical protein L484_008469                   142   2e-37   
ref|XP_003609584.1|  hypothetical protein MTR_4g118810                  140   5e-37   
ref|XP_007147871.1|  hypothetical protein PHAVU_006G161900g             142   8e-37   
ref|XP_006414479.1|  hypothetical protein EUTSA_v10026349mg             139   8e-37   
gb|KHN33122.1|  CASP-like protein 6                                     140   1e-36   
ref|NP_567473.1|  uncharacterized protein                               139   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67044.1|  unknown                                                 137   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154230.1|  hypothetical protein PHAVU_003G101200g             137   1e-35   
ref|NP_193297.1|  uncharacterized protein                               137   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449918.1|  PREDICTED: CASP-like protein 1E2                   136   1e-35   
ref|XP_011090846.1|  PREDICTED: CASP-like protein 1E2                   138   1e-35   
ref|XP_006284585.1|  hypothetical protein CARUB_v10005811mg             136   2e-35   
gb|AFK48170.1|  unknown                                                 136   2e-35   
ref|XP_008458485.1|  PREDICTED: CASP-like protein 6 isoform X1          136   2e-35   
emb|CDY22743.1|  BnaA08g05730D                                          136   2e-35   
ref|XP_010434940.1|  PREDICTED: CASP-like protein 1E2                   136   2e-35   
ref|XP_009107849.1|  PREDICTED: CASP-like protein At4g15630             135   3e-35   
ref|NP_001236009.1|  CASP-like protein 1E2                              135   3e-35   
ref|XP_009136705.1|  PREDICTED: CASP-like protein At4g15630             135   5e-35   
emb|CDX90578.1|  BnaA03g42030D                                          135   5e-35   
ref|XP_006285126.1|  hypothetical protein CARUB_v10006465mg             135   6e-35   
ref|XP_002870225.1|  integral membrane family protein                   134   8e-35   
ref|XP_010548921.1|  PREDICTED: CASP-like protein 1E2                   134   1e-34   
ref|XP_011071478.1|  PREDICTED: CASP-like protein 1E2                   134   1e-34   
ref|XP_007050797.1|  CASP protein GSVIVT01010992001, putative           134   1e-34   
emb|CBI26107.3|  unnamed protein product                                132   1e-34   
emb|CDY09075.1|  BnaC08g10290D                                          134   1e-34   
emb|CDY09749.1|  BnaC07g33120D                                          133   2e-34   
ref|XP_010440273.1|  PREDICTED: CASP-like protein 1E1                   133   3e-34   
ref|XP_010440274.1|  PREDICTED: CASP-like protein 1E2                   133   4e-34   
ref|XP_002870224.1|  integral membrane family protein                   132   5e-34   
ref|XP_008390727.1|  PREDICTED: CASP-like protein VIT_05s0020g01820     132   1e-33   
ref|XP_008438806.1|  PREDICTED: CASP-like protein 6                     131   1e-33   
ref|XP_004134189.1|  PREDICTED: CASP-like protein 6-like                130   1e-33   
ref|XP_008223107.1|  PREDICTED: CASP-like protein POPTRDRAFT_820934     131   2e-33   
ref|XP_004150813.1|  PREDICTED: CASP-like protein 6-like                131   2e-33   
ref|XP_010524513.1|  PREDICTED: CASP-like protein 1E2                   131   2e-33   
gb|EYU43899.1|  hypothetical protein MIMGU_mgv1a014325mg                131   2e-33   
ref|XP_010449916.1|  PREDICTED: CASP-like protein 1E1                   130   3e-33   
ref|XP_006444237.1|  hypothetical protein CICLE_v10023477mg             130   3e-33   
ref|XP_004508611.1|  PREDICTED: CASP-like protein 6-like                130   5e-33   
gb|KDO87387.1|  hypothetical protein CISIN_1g036940mg                   129   8e-33   
ref|XP_010666393.1|  PREDICTED: CASP-like protein 1E1                   128   2e-32   
ref|XP_008804584.1|  PREDICTED: CASP-like protein 6                     128   2e-32   
ref|XP_003593986.1|  hypothetical protein MTR_2g020060                  127   6e-32   
ref|XP_007225861.1|  hypothetical protein PRUPE_ppa011729mg             126   2e-31   
ref|XP_010904767.1|  PREDICTED: CASP-like protein 1E1                   124   6e-31   
ref|XP_008799284.1|  PREDICTED: CASP-like protein VIT_05s0020g01820     124   9e-31   
ref|XP_006419657.1|  hypothetical protein CICLE_v10005989mg             123   1e-30   
gb|KDO75081.1|  hypothetical protein CISIN_1g029843mg                   123   2e-30   
gb|AIC33063.1|  integral membrane family protein                        123   3e-30   
ref|XP_009791544.1|  PREDICTED: CASP-like protein 1E2                   122   8e-30   
gb|KCW58540.1|  hypothetical protein EUGRSUZ_H01205                     122   9e-30   
ref|XP_010326606.1|  PREDICTED: CASP-like protein 1E1                   121   9e-30   
ref|XP_004136057.1|  PREDICTED: CASP-like protein VIT_07s0104g013...    122   9e-30   
gb|KDP28089.1|  hypothetical protein JCGZ_13860                         121   1e-29   
ref|XP_010941794.1|  PREDICTED: CASP-like protein 1E2                   121   1e-29   
ref|XP_003554500.1|  PREDICTED: CASP-like protein VIT_07s0104g013...    120   2e-29   
ref|XP_004134188.1|  PREDICTED: CASP-like protein 6-like                120   2e-29   
ref|XP_008451440.1|  PREDICTED: CASP-like protein VIT_07s0104g01350     120   2e-29   
dbj|BAJ98797.1|  predicted protein                                      120   2e-29   
gb|KGN57071.1|  hypothetical protein Csa_3G151490                       120   3e-29   
ref|XP_009629411.1|  PREDICTED: CASP-like protein 1E2 isoform X2        120   3e-29   
gb|KFK24376.1|  hypothetical protein AALP_AAs45452U000200               119   4e-29   
ref|XP_008438805.1|  PREDICTED: CASP-like protein 5                     119   5e-29   
ref|XP_009629410.1|  PREDICTED: CASP-like protein 1E2 isoform X1        120   1e-28   
gb|AFK37260.1|  unknown                                                 117   3e-28   
ref|XP_006359447.1|  PREDICTED: CASP-like protein VIT_07s0104g013...    117   3e-28   
ref|XP_003625864.1|  hypothetical protein MTR_7g108130                  116   6e-28   
ref|XP_003567679.1|  PREDICTED: CASP-like protein 1E1                   117   6e-28   
ref|XP_010245394.1|  PREDICTED: CASP-like protein 1E1                   115   1e-27   
ref|XP_010434939.1|  PREDICTED: CASP-like protein 1E1                   115   2e-27   
ref|XP_003521533.1|  PREDICTED: CASP-like protein VIT_07s0104g013...    115   2e-27   
ref|XP_010245385.1|  PREDICTED: CASP-like protein 1E2                   113   1e-26   
ref|XP_007163061.1|  hypothetical protein PHAVU_001G202900g             112   2e-26   
ref|XP_010241324.1|  PREDICTED: CASP-like protein 1E1                   110   2e-25   
ref|XP_004494327.1|  PREDICTED: CASP-like protein VIT_07s0104g013...    109   2e-25   
ref|XP_002457829.1|  hypothetical protein SORBIDRAFT_03g014480          110   2e-25   Sorghum bicolor [broomcorn]
ref|NP_001130820.1|  CASP-like protein 1E1                              107   2e-24   Zea mays [maize]
ref|XP_004968732.1|  PREDICTED: CASP-like protein Sb03g014480-like      108   2e-24   
gb|ACG42009.1|  plant integral membrane protein TIGR01569 contain...    107   4e-24   Zea mays [maize]
emb|CBI32262.3|  unnamed protein product                                104   5e-24   
ref|XP_004298101.1|  PREDICTED: CASP-like protein 6-like              99.0    5e-22   
ref|XP_009393233.1|  PREDICTED: CASP-like protein 5                   99.8    1e-21   
gb|EPS67385.1|  hypothetical protein M569_07390                       96.3    3e-21   
gb|KHG07086.1|  CASP-like protein                                     94.7    2e-20   
ref|XP_008458486.1|  PREDICTED: CASP-like protein RCOM_0680180 is...  94.0    8e-20   
sp|A9P0A6.1|CSPL5_PICSI  RecName: Full=CASP-like protein 1U1; Sho...  91.7    1e-18   Picea sitchensis
ref|XP_010026145.1|  PREDICTED: CASP-like protein 1E1                 89.0    3e-18   
ref|NP_001043031.1|  Os01g0363300                                     90.1    5e-18   Oryza sativa Japonica Group [Japonica rice]
sp|B8A7Z5.1|CSPLB_ORYSI  RecName: Full=CASP-like protein 1E1; Sho...  90.1    5e-18   Oryza sativa Indica Group [Indian rice]
sp|Q1EPG6.2|CSPL2_MUSAC  RecName: Full=CASP-like protein 1D1; Sho...  89.4    6e-18   Musa acuminata [banana]
ref|XP_004173447.1|  PREDICTED: CASP-like protein 6-like              87.0    6e-18   
ref|XP_011096730.1|  PREDICTED: CASP-like protein 1B2                 87.4    3e-17   
ref|XP_009353886.1|  PREDICTED: CASP-like protein POPTRDRAFT_823125   87.0    3e-17   
gb|KHN43548.1|  CASP-like protein                                     86.7    4e-17   
ref|XP_006664182.1|  PREDICTED: CASP-like protein Os12g0610800-like   85.5    1e-16   
ref|XP_008351606.1|  PREDICTED: CASP-like protein POPTRDRAFT_823125   85.5    1e-16   
ref|XP_006836401.1|  hypothetical protein AMTR_s00092p00142720        85.5    2e-16   
ref|XP_003630011.1|  hypothetical protein MTR_8g089300                85.1    2e-16   
sp|A2ZMM4.1|CSPL5_ORYSI  RecName: Full=CASP-like protein 1B1; Sho...  84.7    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_009399245.1|  PREDICTED: CASP-like protein MA4_106O17.52       84.7    2e-16   
ref|NP_001067249.1|  Os12g0610800                                     84.7    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007035489.1|  CASP-like protein RCOM_0679870, putative         84.3    3e-16   
gb|EPS74593.1|  hypothetical protein M569_00163                       84.3    3e-16   
ref|XP_008383356.1|  PREDICTED: CASP-like protein POPTRDRAFT_823125   84.3    3e-16   
gb|EEE53590.1|  hypothetical protein OsJ_36834                        84.7    4e-16   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99368.1|  plant integral membrane protein TIGR01569 contain...  85.1    4e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006855416.1|  hypothetical protein AMTR_s00057p00159510        83.6    5e-16   
ref|XP_007022941.1|  CASP-like protein, putative                      83.6    6e-16   
ref|XP_003563200.1|  PREDICTED: CASP-like protein 1D1                 83.2    8e-16   
gb|EPS73422.1|  hypothetical protein M569_01338                       82.8    1e-15   
sp|Q1EPG7.1|CSPL1_MUSAC  RecName: Full=CASP-like protein 1E1; Sho...  82.8    1e-15   Musa acuminata [banana]
ref|XP_009362157.1|  PREDICTED: CASP-like protein 9                   82.4    1e-15   
gb|KDP34883.1|  hypothetical protein JCGZ_09171                       82.4    2e-15   
ref|XP_004293719.1|  PREDICTED: CASP-like protein POPTRDRAFT_8231...  82.0    2e-15   
ref|XP_002870226.1|  integral membrane family protein                 82.0    2e-15   
gb|AAG40073.2|AF324722_1  AT4g15610                                   81.3    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567472.1|  uncharacterized protein                             81.6    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006645889.1|  PREDICTED: CASP-like protein Os01g0363300-like   80.5    5e-15   
gb|KGN47206.1|  hypothetical protein Csa_6G200310                     79.0    6e-15   
ref|XP_008225695.1|  PREDICTED: CASP-like protein POPTRDRAFT_823125   80.5    6e-15   
gb|KDO75080.1|  hypothetical protein CISIN_1g029779mg                 80.5    7e-15   
ref|XP_010245386.1|  PREDICTED: CASP-like protein 1D1                 80.5    8e-15   
ref|XP_009136704.1|  PREDICTED: CASP-like protein ARALYDRAFT_915236   80.1    8e-15   
ref|XP_010030740.1|  PREDICTED: CASP-like protein 1B2                 80.1    1e-14   
ref|XP_009399244.1|  PREDICTED: CASP-like protein MA4_106O17.50       79.7    1e-14   
ref|XP_006284566.1|  hypothetical protein CARUB_v10005787mg           79.3    2e-14   
ref|XP_009419511.1|  PREDICTED: CASP-like protein MA4_106O17.52       79.3    2e-14   
dbj|BAF46307.1|  integral membrane family protein                     78.2    2e-14   Ipomoea nil [qian niu]
ref|XP_002312755.2|  hypothetical protein POPTR_0008s20950g           79.0    2e-14   Populus trichocarpa [western balsam poplar]
sp|A2PZE5.2|CSPL1_IPONI  RecName: Full=CASP-like protein IN26; Al...  78.6    3e-14   Ipomoea nil [qian niu]
ref|NP_001151672.1|  CASP-like protein 1D1                            78.6    4e-14   Zea mays [maize]
ref|XP_007214738.1|  hypothetical protein PRUPE_ppa025143mg           78.2    4e-14   
emb|CDY09750.1|  BnaC07g33110D                                        77.8    5e-14   
ref|XP_006844552.1|  hypothetical protein AMTR_s00016p00178190        77.4    5e-14   
tpg|DAA39419.1|  TPA: membrane protein 4                              77.8    6e-14   
ref|XP_006414480.1|  hypothetical protein EUTSA_v10026308mg           77.4    8e-14   
ref|XP_006419661.1|  hypothetical protein CICLE_v10005986mg           77.0    1e-13   
ref|XP_006489150.1|  PREDICTED: CASP-like protein RCOM_0679870-like   76.6    1e-13   
ref|XP_011013338.1|  PREDICTED: CASP-like protein 1D1                 76.6    1e-13   
ref|XP_011040570.1|  PREDICTED: CASP-like protein 1B1                 76.6    1e-13   
ref|XP_006419662.1|  hypothetical protein CICLE_v10006955mg           75.5    2e-13   
ref|XP_003531310.1|  PREDICTED: CASP-like protein 9-like              76.3    2e-13   
gb|KHN48115.1|  CASP-like protein 9                                   76.3    2e-13   
ref|XP_004154154.1|  PREDICTED: CASP-like protein 9-like              76.3    2e-13   
gb|EMT33640.1|  hypothetical protein F775_13108                       74.7    3e-13   
ref|XP_006489266.1|  PREDICTED: CASP-like protein RCOM_0679870-like   75.5    3e-13   
ref|XP_010453663.1|  PREDICTED: casparian strip membrane protein 5    75.1    5e-13   
ref|XP_010420188.1|  PREDICTED: casparian strip membrane protein ...  75.1    5e-13   
ref|XP_010492362.1|  PREDICTED: casparian strip membrane protein ...  74.7    5e-13   
ref|XP_011011053.1|  PREDICTED: CASP-like protein 1B2                 74.7    7e-13   
ref|XP_009763390.1|  PREDICTED: CASP-like protein 1                   74.7    7e-13   
emb|CDX69534.1|  BnaA10g18830D                                        74.3    7e-13   
ref|XP_006468217.1|  PREDICTED: CASP-like protein POPTRDRAFT_8109...  74.3    8e-13   
ref|XP_010546916.1|  PREDICTED: CASP-like protein 1D2                 74.7    8e-13   
ref|XP_010548920.1|  PREDICTED: CASP-like protein 1D1                 74.3    9e-13   
gb|KDO75960.1|  hypothetical protein CISIN_1g047574mg                 73.6    1e-12   
ref|XP_006467803.1|  PREDICTED: CASP-like protein POPTRDRAFT_8109...  73.6    1e-12   
ref|XP_008459066.1|  PREDICTED: CASP-like protein POPTRDRAFT_798217   74.3    1e-12   
ref|XP_010904768.1|  PREDICTED: CASP-like protein 1E1                 73.9    1e-12   
ref|XP_009794323.1|  PREDICTED: casparian strip membrane protein ...  73.6    1e-12   
ref|XP_008799290.1|  PREDICTED: CASP-like protein MA4_106O17.52       73.9    1e-12   
ref|NP_001059526.1|  Os07g0442900                                     73.9    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ03696.1|  hypothetical protein OsI_25828                        73.9    1e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001241476.1|  CASP-like protein 1B1                            73.6    1e-12   
ref|XP_006407952.1|  hypothetical protein EUTSA_v10021548mg           73.6    2e-12   
ref|XP_004233676.1|  PREDICTED: casparian strip membrane protein ...  73.6    2e-12   
ref|XP_010904772.1|  PREDICTED: CASP-like protein 1D1                 73.6    2e-12   
ref|XP_002516872.1|  conserved hypothetical protein                   73.6    2e-12   Ricinus communis
emb|CDP12619.1|  unnamed protein product                              74.3    2e-12   
ref|XP_003609582.1|  hypothetical protein MTR_4g118800                73.2    2e-12   
ref|XP_002317067.1|  integral membrane family protein                 73.2    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_007046043.1|  Casparian strip membrane protein 5, putative...  73.9    2e-12   
ref|XP_006338436.1|  PREDICTED: casparian strip membrane protein ...  73.2    2e-12   
ref|XP_011090848.1|  PREDICTED: CASP-like protein 1                   73.6    2e-12   
ref|XP_004488207.1|  PREDICTED: CASP-like protein 9-like              73.2    2e-12   
ref|XP_006844549.1|  hypothetical protein AMTR_s00016p00177260        72.8    2e-12   
emb|CDO98910.1|  unnamed protein product                              73.6    2e-12   
ref|XP_007046042.1|  Casparian strip membrane protein 5, putative...  73.2    2e-12   
gb|EMT27366.1|  hypothetical protein F775_32968                       72.8    3e-12   
ref|XP_009339377.1|  PREDICTED: CASP-like protein POPTRDRAFT_810994   71.6    3e-12   
ref|XP_002300491.2|  hypothetical protein POPTR_0001s43290g           72.8    3e-12   Populus trichocarpa [western balsam poplar]
gb|KHG20748.1|  CASP-like protein                                     72.8    3e-12   
ref|XP_004233179.1|  PREDICTED: CASP-like protein 1B2                 72.4    3e-12   
ref|XP_009624212.1|  PREDICTED: CASP-like protein 1B2                 72.8    4e-12   
ref|XP_010024567.1|  PREDICTED: CASP-like protein 1                   72.4    5e-12   
ref|NP_187290.1|  uncharacterized protein                             72.0    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154229.1|  hypothetical protein PHAVU_003G101100g           72.0    6e-12   
gb|KEH16769.1|  CASP POPTRDRAFT-like protein                          72.0    6e-12   
gb|EMT22194.1|  hypothetical protein F775_09434                       72.0    6e-12   
ref|XP_006844548.1|  hypothetical protein AMTR_s00016p00176090        71.6    6e-12   
dbj|BAK00793.1|  predicted protein                                    71.6    6e-12   
ref|XP_003528452.1|  PREDICTED: CASP-like protein POPTRDRAFT_7589...  71.2    6e-12   
ref|XP_010449919.1|  PREDICTED: CASP-like protein 1D1                 71.6    6e-12   
ref|XP_008799291.1|  PREDICTED: CASP-like protein POPTRDRAFT_820933   71.6    7e-12   
gb|KDP40020.1|  hypothetical protein JCGZ_02018                       71.6    7e-12   
emb|CBI26108.3|  unnamed protein product                              70.9    8e-12   
ref|NP_197033.1|  casparian strip membrane protein 5                  71.2    8e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440275.1|  PREDICTED: CASP-like protein 1D1                 71.6    8e-12   
ref|XP_002276229.1|  PREDICTED: CASP-like protein 1D1                 71.6    9e-12   Vitis vinifera
ref|XP_011017493.1|  PREDICTED: casparian strip membrane protein 5    71.2    1e-11   
ref|XP_003579154.1|  PREDICTED: CASP-like protein 1B1                 71.2    1e-11   
ref|XP_009121585.1|  PREDICTED: casparian strip membrane protein ...  71.2    1e-11   
ref|XP_009609035.1|  PREDICTED: casparian strip membrane protein ...  70.9    1e-11   
ref|XP_008799287.1|  PREDICTED: CASP-like protein MA4_106O17.50 i...  71.2    1e-11   
ref|XP_010434941.1|  PREDICTED: CASP-like protein 1D1                 71.2    1e-11   
ref|XP_008799285.1|  PREDICTED: CASP-like protein MA4_106O17.50 i...  71.2    1e-11   
gb|EMS67341.1|  hypothetical protein TRIUR3_17102                     70.9    1e-11   
gb|KDO77548.1|  hypothetical protein CISIN_1g029003mg                 70.9    2e-11   
ref|XP_011071479.1|  PREDICTED: CASP-like protein 1                   70.9    2e-11   
ref|XP_008371694.1|  PREDICTED: CASP-like protein POPTRDRAFT_810994   70.1    2e-11   
ref|XP_009352921.1|  PREDICTED: CASP-like protein POPTRDRAFT_810994   69.3    2e-11   
ref|XP_008799288.1|  PREDICTED: CASP-like protein MA4_106O17.50       70.5    2e-11   
ref|XP_002276662.1|  PREDICTED: CASP-like protein 1B2                 70.5    2e-11   Vitis vinifera
ref|XP_009385516.1|  PREDICTED: CASP-like protein VIT_17s0000g00560   70.1    2e-11   
sp|A7QC16.2|CSPL1_VITVI  RecName: Full=CASP-like protein 1B2; Sho...  70.1    3e-11   Vitis vinifera
ref|XP_009758573.1|  PREDICTED: CASP-like protein 1B2                 70.5    3e-11   
ref|XP_010241335.1|  PREDICTED: CASP-like protein 1D1                 70.1    3e-11   
ref|XP_010904769.1|  PREDICTED: CASP-like protein 1E1                 70.1    3e-11   
gb|KDO82981.1|  hypothetical protein CISIN_1g044764mg                 69.7    3e-11   
gb|KFK30020.1|  hypothetical protein AALP_AA7G207300                  68.6    3e-11   
ref|XP_006353028.1|  PREDICTED: CASP-like protein POPTRDRAFT_7982...  69.7    4e-11   
sp|P0DI35.1|CASP1_LACSI  RecName: Full=Casparian strip membrane p...  69.7    4e-11   
ref|XP_002884576.1|  integral membrane family protein                 69.7    4e-11   
ref|XP_006448804.1|  hypothetical protein CICLE_v10016765mg           69.3    5e-11   
ref|XP_003542918.1|  PREDICTED: CASP-like protein 7-like isoform X1   69.3    5e-11   
ref|XP_006468390.1|  PREDICTED: CASP-like protein POPTRDRAFT_7982...  69.3    5e-11   
ref|XP_006438724.1|  hypothetical protein CICLE_v10033634mg           68.9    6e-11   
gb|ABF69991.1|  hypothetical protein MA4_106O17.52                    69.7    6e-11   Musa acuminata [banana]
ref|XP_004296796.1|  PREDICTED: CASP-like protein 7-like              68.9    7e-11   
ref|XP_006306344.1|  hypothetical protein CARUB_v10012228mg           68.9    8e-11   
ref|XP_008383741.1|  PREDICTED: CASP-like protein POPTRDRAFT_810994   67.8    8e-11   
ref|XP_008225093.1|  PREDICTED: CASP-like protein POPTRDRAFT_758901   68.2    9e-11   
gb|KHG04935.1|  CASP-like protein                                     67.8    9e-11   
emb|CDY31439.1|  BnaC03g63850D                                        68.6    9e-11   
ref|XP_004508310.1|  PREDICTED: CASP-like protein 7-like              68.2    1e-10   
ref|XP_007138545.1|  hypothetical protein PHAVU_009G218200g           68.6    1e-10   
emb|CDX76993.1|  BnaC04g37880D                                        68.2    1e-10   
ref|XP_004295628.1|  PREDICTED: CASP-like protein POPTRDRAFT_8109...  67.8    1e-10   
ref|XP_009129665.1|  PREDICTED: CASP-like protein At3g06390           68.2    1e-10   
ref|XP_007025630.1|  CASP-like protein POPTRDRAFT_758901              67.4    1e-10   
ref|XP_009609007.1|  PREDICTED: casparian strip membrane protein ...  68.2    1e-10   
ref|XP_006400049.1|  hypothetical protein EUTSA_v10015485mg           67.8    1e-10   
ref|XP_006482625.1|  PREDICTED: casparian strip membrane protein ...  67.8    1e-10   
gb|KDO72617.1|  hypothetical protein CISIN_1g045471mg                 67.8    2e-10   
gb|EYU34055.1|  hypothetical protein MIMGU_mgv1a020210mg              67.8    2e-10   
gb|KFK38097.1|  hypothetical protein AALP_AA3G069100                  68.2    2e-10   
ref|XP_011086074.1|  PREDICTED: CASP-like protein 1C1 isoform X1      67.0    2e-10   
ref|NP_001148957.1|  casparian strip membrane protein 1               67.8    2e-10   Zea mays [maize]
ref|XP_002511115.1|  conserved hypothetical protein                   67.4    2e-10   Ricinus communis
ref|XP_010666392.1|  PREDICTED: CASP-like protein Ni6                 67.4    2e-10   
ref|XP_006857311.1|  hypothetical protein AMTR_s00067p00068460        67.4    2e-10   
ref|XP_010088133.1|  hypothetical protein L484_013577                 67.0    3e-10   
ref|XP_004304287.1|  PREDICTED: CASP-like protein 1-like              67.0    3e-10   
gb|KHN03390.1|  CASP-like protein 8                                   67.4    3e-10   
ref|XP_010904771.1|  PREDICTED: CASP-like protein 1D1                 67.4    3e-10   
ref|XP_008438804.1|  PREDICTED: CASP-like protein VIT_05s0020g01830   67.0    3e-10   
ref|XP_009369105.1|  PREDICTED: CASP-like protein POPTRDRAFT_820933   67.0    3e-10   
ref|XP_003546558.1|  PREDICTED: CASP-like protein 9-like              67.0    3e-10   
gb|KHN45566.1|  CASP-like protein 9                                   67.0    3e-10   
gb|EYU19080.1|  hypothetical protein MIMGU_mgv1a024780mg              66.6    4e-10   
ref|XP_010904770.1|  PREDICTED: CASP-like protein 1E1                 67.0    4e-10   
emb|CDY05260.1|  BnaC05g45430D                                        67.0    4e-10   
ref|XP_004956013.1|  PREDICTED: CASP-like protein Sb02g009660-like    66.6    4e-10   
ref|XP_006657652.1|  PREDICTED: CASP-like protein Os07g0442900-like   67.0    4e-10   
ref|XP_006398066.1|  hypothetical protein EUTSA_v10001033mg           66.6    4e-10   
gb|AFK39780.1|  unknown                                               66.6    4e-10   
ref|XP_008390731.1|  PREDICTED: CASP-like protein VIT_05s0020g01830   66.6    4e-10   
emb|CDY49491.1|  BnaC07g18080D                                        66.6    5e-10   
gb|AFK37802.1|  unknown                                               66.2    5e-10   
gb|EYU27969.1|  hypothetical protein MIMGU_mgv1a015260mg              65.9    5e-10   
ref|XP_009352214.1|  PREDICTED: CASP-like protein VIT_05s0020g01830   66.6    5e-10   
ref|XP_010042237.1|  PREDICTED: casparian strip membrane protein ...  66.2    5e-10   
ref|XP_010066899.1|  PREDICTED: casparian strip membrane protein ...  66.2    5e-10   
ref|NP_001237481.1|  CASP-like protein 1D1                            66.2    5e-10   
ref|XP_008459331.1|  PREDICTED: CASP-like protein 1                   66.6    5e-10   
gb|KFK30943.1|  hypothetical protein AALP_AA6G047600                  65.9    6e-10   
ref|XP_010458896.1|  PREDICTED: casparian strip membrane protein 6    66.6    6e-10   
gb|KHN12189.1|  CASP-like protein 1                                   66.2    6e-10   
ref|XP_010476448.1|  PREDICTED: casparian strip membrane protein ...  66.6    6e-10   
ref|XP_010495793.1|  PREDICTED: casparian strip membrane protein ...  66.6    6e-10   
gb|EYU43898.1|  hypothetical protein MIMGU_mgv1a025880mg              66.2    6e-10   
ref|NP_001236648.1|  CASP-like protein 7                              66.2    6e-10   
ref|XP_004141446.1|  PREDICTED: casparian strip membrane protein ...  66.2    6e-10   
gb|KDP27167.1|  hypothetical protein JCGZ_19866                       65.9    6e-10   
ref|XP_002529882.1|  conserved hypothetical protein                   66.2    6e-10   
ref|XP_002869933.1|  integral membrane family protein                 66.2    7e-10   
ref|XP_010439581.1|  PREDICTED: CASP-like protein 1B2                 66.2    7e-10   
ref|XP_007213108.1|  hypothetical protein PRUPE_ppa023491mg           65.5    7e-10   
ref|XP_006413870.1|  hypothetical protein EUTSA_v10026298mg           65.9    8e-10   
ref|XP_004975856.1|  PREDICTED: casparian strip membrane protein ...  65.9    9e-10   
ref|XP_010245909.1|  PREDICTED: casparian strip membrane protein ...  66.2    9e-10   
ref|XP_010449173.1|  PREDICTED: CASP-like protein 1B2                 65.9    9e-10   
sp|A7R333.1|CSPLB_VITVI  RecName: Full=CASP-like protein 1C1; Sho...  65.1    9e-10   
gb|EYU43392.1|  hypothetical protein MIMGU_mgv1a026498mg              65.1    9e-10   
ref|XP_006417050.1|  hypothetical protein EUTSA_v10008800mg           65.9    9e-10   
ref|XP_007225850.1|  hypothetical protein PRUPE_ppa011684mg           65.9    9e-10   
ref|NP_001238662.1|  CASP-like protein 1D2                            65.9    1e-09   
sp|P0DH82.1|CSPL1_MARPO  RecName: Full=CASP-like protein 2U1; Sho...  65.9    1e-09   
ref|XP_002280714.1|  PREDICTED: CASP-like protein 1F1                 65.5    1e-09   
ref|XP_004490091.1|  PREDICTED: CASP-like protein MTR_5g041900-like   65.5    1e-09   
ref|XP_009337529.1|  PREDICTED: CASP-like protein POPTRDRAFT_823430   65.1    1e-09   
gb|KDP20967.1|  hypothetical protein JCGZ_21438                       65.1    1e-09   
ref|XP_004229219.1|  PREDICTED: CASP-like protein 1                   65.5    1e-09   
ref|XP_002311310.2|  hypothetical protein POPTR_0008s08820g           65.1    1e-09   
ref|XP_011086075.1|  PREDICTED: CASP-like protein 1C1 isoform X2      63.9    1e-09   
ref|XP_009108468.1|  PREDICTED: CASP-like protein ARALYDRAFT_492822   65.5    1e-09   
ref|XP_010464210.1|  PREDICTED: CASP-like protein 1D2                 65.5    1e-09   
ref|XP_010441874.1|  PREDICTED: CASP-like protein 1B1                 65.1    1e-09   
ref|XP_004159824.1|  PREDICTED: CASP-like protein 8-like              65.1    1e-09   
sp|A7PHN8.2|CSPL4_VITVI  RecName: Full=CASP-like protein 1F1; Sho...  65.5    2e-09   
ref|XP_010481689.1|  PREDICTED: CASP-like protein 1B1                 65.1    2e-09   
ref|NP_192263.1|  uncharacterized protein                             64.7    2e-09   
ref|XP_010672773.1|  PREDICTED: casparian strip membrane protein ...  65.1    2e-09   
emb|CDP00357.1|  unnamed protein product                              64.7    2e-09   
ref|XP_002443527.1|  hypothetical protein SORBIDRAFT_08g021090        65.1    2e-09   
ref|XP_010036808.1|  PREDICTED: CASP-like protein 1D1                 65.5    2e-09   
ref|XP_003556790.1|  PREDICTED: CASP-like protein 2-like              64.7    2e-09   
ref|XP_004516297.1|  PREDICTED: casparian strip membrane protein ...  65.1    2e-09   
ref|XP_010550038.1|  PREDICTED: casparian strip membrane protein ...  64.7    2e-09   
gb|KHN03003.1|  CASP-like protein 7                                   65.1    2e-09   
ref|XP_010029309.1|  PREDICTED: casparian strip membrane protein 1    64.7    2e-09   
emb|CDX76458.1|  BnaA08g09420D                                        65.1    2e-09   
gb|KHN25032.1|  CASP-like protein 2                                   64.7    2e-09   
ref|XP_011098776.1|  PREDICTED: casparian strip membrane protein ...  64.7    2e-09   
ref|XP_009419512.1|  PREDICTED: CASP-like protein MA4_106O17.50       65.1    2e-09   
ref|XP_010551838.1|  PREDICTED: casparian strip membrane protein ...  64.7    2e-09   
sp|Q20BM9.1|CSPL1_PANGI  RecName: Full=CASP-like protein 1            63.9    2e-09   
sp|P0DI33.1|CASP1_PANVG  RecName: Full=Casparian strip membrane p...  64.3    3e-09   
ref|XP_010486147.1|  PREDICTED: CASP-like protein 1D2                 64.7    3e-09   
ref|XP_008223106.1|  PREDICTED: CASP-like protein POPTRDRAFT_820933   64.7    3e-09   
ref|XP_009121772.1|  PREDICTED: CASP-like protein ARALYDRAFT_327471   63.9    3e-09   
sp|P0DI34.1|CASP2_PANVG  RecName: Full=Casparian strip membrane p...  64.3    3e-09   
ref|XP_007147869.1|  hypothetical protein PHAVU_006G161700g           64.7    3e-09   
ref|XP_010431136.1|  PREDICTED: CASP-like protein 1C1                 63.9    3e-09   
ref|XP_010271592.1|  PREDICTED: casparian strip membrane protein ...  64.7    3e-09   
ref|XP_009606201.1|  PREDICTED: casparian strip membrane protein 2    63.9    4e-09   
ref|XP_007159387.1|  hypothetical protein PHAVU_002G234000g           63.5    4e-09   
ref|XP_002874862.1|  integral membrane family protein                 63.5    4e-09   
ref|XP_009101697.1|  PREDICTED: CASP-like protein At5g44550           63.9    4e-09   
ref|XP_006431199.1|  hypothetical protein CICLE_v10013539mg           63.9    4e-09   
gb|EYU26727.1|  hypothetical protein MIMGU_mgv1a013858mg              64.3    4e-09   
ref|XP_010024568.1|  PREDICTED: CASP-like protein 1                   63.9    4e-09   
ref|XP_006396581.1|  hypothetical protein EUTSA_v10029027mg           63.2    4e-09   
gb|KFK28670.1|  hypothetical protein AALP_AA7G030900                  63.5    5e-09   
ref|XP_002892791.1|  integral membrane family protein                 64.3    5e-09   
emb|CDY49020.1|  BnaAnng10140D                                        63.5    5e-09   
ref|XP_010439402.1|  PREDICTED: CASP-like protein 1D2                 63.9    5e-09   
gb|EAZ11885.1|  hypothetical protein OsJ_01759                        63.2    5e-09   
emb|CDX70605.1|  BnaC03g06890D                                        63.5    6e-09   
ref|XP_009596742.1|  PREDICTED: CASP-like protein 1                   63.5    6e-09   
ref|XP_006361147.1|  PREDICTED: casparian strip membrane protein ...  63.9    6e-09   
ref|XP_010494485.1|  PREDICTED: CASP-like protein 1B1                 63.5    6e-09   
ref|XP_002523839.1|  conserved hypothetical protein                   63.9    6e-09   
ref|XP_008663281.1|  PREDICTED: casparian strip membrane protein 2    63.2    7e-09   
ref|XP_002305799.1|  hypothetical protein POPTR_0004s04330g           62.4    8e-09   
ref|XP_006288774.1|  hypothetical protein CARUB_v10002095mg           62.8    8e-09   
ref|XP_007153553.1|  hypothetical protein PHAVU_003G045200g           62.8    9e-09   
ref|XP_010675484.1|  PREDICTED: CASP-like protein 1B2                 63.2    9e-09   
ref|XP_002517919.1|  conserved hypothetical protein                   62.4    9e-09   
ref|XP_009602468.1|  PREDICTED: casparian strip membrane protein ...  62.8    9e-09   
gb|KDO75079.1|  hypothetical protein CISIN_1g040189mg                 61.6    1e-08   
emb|CDP02251.1|  unnamed protein product                              62.8    1e-08   
ref|XP_002461872.1|  hypothetical protein SORBIDRAFT_02g009660        63.2    1e-08   
gb|AFK45120.1|  unknown                                               62.8    1e-08   
sp|D2KQI6.1|CSPL1_BETVM  RecName: Full=CASP-like protein Ni6; Alt...  62.8    1e-08   
ref|XP_010258674.1|  PREDICTED: CASP-like protein 1B2                 62.8    1e-08   
gb|KHN01253.1|  CASP-like protein 1                                   62.4    1e-08   
ref|NP_193772.1|  uncharacterized protein                             62.8    1e-08   
ref|XP_004965049.1|  PREDICTED: casparian strip membrane protein ...  62.4    1e-08   
ref|XP_011043373.1|  PREDICTED: CASP-like protein 1C2                 62.0    1e-08   
ref|XP_008386322.1|  PREDICTED: CASP-like protein POPTRDRAFT_823430   62.4    1e-08   
ref|NP_172868.1|  uncharacterized protein                             62.8    1e-08   
gb|AFW85233.1|  membrane protein 2                                    62.4    2e-08   
gb|EYU43016.1|  hypothetical protein MIMGU_mgv1a014654mg              62.0    2e-08   
ref|XP_006285194.1|  hypothetical protein CARUB_v10006548mg           62.4    2e-08   
ref|XP_004963150.1|  PREDICTED: CASP-like protein Sb08g021090-like    63.2    2e-08   
ref|XP_002453543.1|  hypothetical protein SORBIDRAFT_04g007720        62.0    2e-08   
gb|AAM63034.1|  unknown                                               62.4    2e-08   
ref|XP_002436759.1|  hypothetical protein SORBIDRAFT_10g008220        62.0    2e-08   
ref|XP_009123603.1|  PREDICTED: CASP-like protein At5g44550           62.0    2e-08   
emb|CDY63706.1|  BnaC02g47460D                                        62.0    2e-08   
ref|XP_008361038.1|  PREDICTED: casparian strip membrane protein ...  62.4    2e-08   
gb|KHG13245.1|  CASP-like protein                                     60.8    2e-08   
ref|XP_009760874.1|  PREDICTED: casparian strip membrane protein 2    62.0    2e-08   
sp|B9S8Z3.2|CASP4_RICCO  RecName: Full=Casparian strip membrane p...  62.0    2e-08   
ref|XP_006289591.1|  hypothetical protein CARUB_v10003142mg           62.0    2e-08   
emb|CDY14930.1|  BnaA02g22720D                                        62.0    2e-08   
ref|XP_010110215.1|  hypothetical protein L484_009820                 61.6    2e-08   
ref|XP_002519061.1|  conserved hypothetical protein                   61.2    2e-08   
ref|NP_199268.1|  uncharacterized protein                             62.0    2e-08   
ref|XP_008353263.1|  PREDICTED: CASP-like protein POPTRDRAFT_820933   60.8    3e-08   
gb|AAM64457.1|  unknown                                               61.6    3e-08   
ref|XP_011037328.1|  PREDICTED: CASP-like protein 1C3                 61.2    3e-08   
ref|XP_009789373.1|  PREDICTED: casparian strip membrane protein ...  62.0    3e-08   
ref|NP_001235823.1|  CASP-like protein 6                              61.2    3e-08   
sp|D7M7B3.2|CASP5_ARALL  RecName: Full=Casparian strip membrane p...  61.2    3e-08   
ref|XP_009610092.1|  PREDICTED: casparian strip membrane protein 1    61.2    4e-08   
ref|XP_003624429.1|  hypothetical protein MTR_7g083120                61.2    4e-08   
ref|XP_002446616.1|  hypothetical protein SORBIDRAFT_06g018970        61.2    4e-08   
ref|XP_009789554.1|  PREDICTED: casparian strip membrane protein ...  61.2    4e-08   
ref|XP_004241458.1|  PREDICTED: CASP-like protein 1F1                 60.8    4e-08   
ref|XP_002273638.1|  PREDICTED: casparian strip membrane protein 2    61.2    4e-08   
ref|XP_006851480.1|  hypothetical protein AMTR_s00040p00135930        61.6    4e-08   
emb|CDO99544.1|  unnamed protein product                              60.5    4e-08   
ref|XP_006377352.1|  hypothetical protein POPTR_0011s05180g           60.5    4e-08   
ref|XP_002863566.1|  predicted protein                                61.2    4e-08   
ref|XP_006655941.1|  PREDICTED: casparian strip membrane protein ...  60.8    4e-08   
gb|KFK31650.1|  hypothetical protein AALP_AA6G140800                  61.2    5e-08   
tpg|DAA39418.1|  TPA: hypothetical protein ZEAMMB73_672916            60.8    5e-08   
ref|XP_004951449.1|  PREDICTED: CASP-like protein Sb04g007720-like    60.8    5e-08   
sp|P0DI30.1|CASP2_TRIPD  RecName: Full=Casparian strip membrane p...  61.2    5e-08   
ref|XP_004293125.1|  PREDICTED: casparian strip membrane protein ...  61.2    5e-08   
ref|XP_003607732.1|  hypothetical protein MTR_4g081880                60.8    5e-08   
ref|XP_008353784.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...  60.5    5e-08   
ref|XP_006347351.1|  PREDICTED: CASP-like protein VIT_17s0000g005...  60.5    5e-08   
ref|XP_006366193.1|  PREDICTED: CASP-like protein VIT_11s0052g011...  60.8    5e-08   
gb|KHN29787.1|  CASP-like protein 9                                   60.1    5e-08   
ref|XP_009763947.1|  PREDICTED: casparian strip membrane protein 1    60.5    6e-08   
ref|XP_004233369.1|  PREDICTED: casparian strip membrane protein 1    60.5    6e-08   
ref|XP_004242111.1|  PREDICTED: casparian strip membrane protein ...  60.8    6e-08   
ref|XP_002522462.1|  conserved hypothetical protein                   60.1    7e-08   
ref|XP_008368681.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...  60.5    7e-08   
ref|XP_006344265.1|  PREDICTED: CASP-like protein SDM1_58t00016-like  60.5    7e-08   
ref|XP_008229074.1|  PREDICTED: casparian strip membrane protein ...  60.8    7e-08   
ref|XP_008339880.1|  PREDICTED: CASP-like protein 1                   60.5    7e-08   
ref|XP_008381244.1|  PREDICTED: CASP-like protein RCOM_1174750        60.1    7e-08   
ref|XP_010683143.1|  PREDICTED: casparian strip membrane protein 3    60.1    8e-08   
gb|EYU32920.1|  hypothetical protein MIMGU_mgv1a014795mg              60.1    9e-08   
ref|XP_007206803.1|  hypothetical protein PRUPE_ppa025691mg           60.5    9e-08   
ref|XP_009767267.1|  PREDICTED: casparian strip membrane protein 1    60.5    9e-08   
ref|XP_010915912.1|  PREDICTED: CASP-like protein 1F2                 60.1    9e-08   
sp|P0DI62.1|CASP1_CYNCS  RecName: Full=Casparian strip membrane p...  60.5    9e-08   
gb|EYU34054.1|  hypothetical protein MIMGU_mgv1a026542mg              59.7    1e-07   
sp|B9HQ42.2|CASP4_POPTR  RecName: Full=Casparian strip membrane p...  60.8    1e-07   
ref|XP_008652280.1|  PREDICTED: CASP-like protein 3                   60.1    1e-07   
gb|KDO75078.1|  hypothetical protein CISIN_1g043891mg                 60.1    1e-07   
ref|XP_007209668.1|  hypothetical protein PRUPE_ppa012166mg           59.7    1e-07   
emb|CDX78624.1|  BnaA03g05360D                                        59.7    1e-07   
gb|EMT22680.1|  hypothetical protein F775_30108                       60.1    1e-07   
ref|XP_009117933.1|  PREDICTED: CASP-like protein ARALYDRAFT_888790   59.7    1e-07   
ref|XP_003571714.1|  PREDICTED: CASP-like protein 2D1                 59.7    1e-07   
ref|XP_008811833.1|  PREDICTED: CASP-like protein Sb08g021090         59.7    1e-07   
dbj|BAJ85571.1|  predicted protein                                    60.1    1e-07   
dbj|BAJ84836.1|  predicted protein                                    60.1    1e-07   
ref|XP_010686498.1|  PREDICTED: CASP-like protein 1C1                 59.3    1e-07   
ref|XP_004237043.1|  PREDICTED: casparian strip membrane protein ...  59.3    1e-07   
ref|XP_002272783.1|  PREDICTED: CASP-like protein 1C2                 58.9    1e-07   
sp|A7PJ32.1|CSPL2_VITVI  RecName: Full=CASP-like protein 1C2; Sho...  58.9    2e-07   
ref|NP_563689.1|  uncharacterized protein                             58.9    2e-07   
ref|XP_009131457.1|  PREDICTED: casparian strip membrane protein ...  59.3    2e-07   
sp|P0DH81.1|CASP1_PICGL  RecName: Full=Casparian strip membrane p...  59.3    2e-07   
ref|XP_009341975.1|  PREDICTED: CASP-like protein RCOM_1174750        58.9    2e-07   
ref|XP_007032593.1|  Casparian strip membrane protein 5, putative     59.3    2e-07   
ref|XP_004134470.1|  PREDICTED: CASP-like protein VIT_05s0020g018...  58.5    2e-07   
ref|XP_010105026.1|  hypothetical protein L484_008467                 59.3    2e-07   
sp|P0DI57.1|CASP5_LOTJA  RecName: Full=Casparian strip membrane p...  59.3    2e-07   
ref|NP_001174676.1|  Os06g0231050                                     58.9    2e-07   
ref|XP_010457381.1|  PREDICTED: CASP-like protein 1C2                 58.9    2e-07   
gb|EYU28778.1|  hypothetical protein MIMGU_mgv1a014587mg              58.9    2e-07   
ref|XP_011089204.1|  PREDICTED: LOW QUALITY PROTEIN: casparian st...  59.3    2e-07   
ref|XP_006281139.1|  hypothetical protein CARUB_v10027171mg           59.3    2e-07   
ref|XP_010111509.1|  hypothetical protein L484_021334                 59.7    2e-07   
ref|XP_008229156.1|  PREDICTED: CASP-like protein RCOM_1174750        58.5    2e-07   
ref|XP_002991776.1|  hypothetical protein SELMODRAFT_272229           59.3    2e-07   
ref|XP_006376496.1|  integral membrane family protein                 58.5    2e-07   
ref|NP_001052990.2|  Os04g0460400                                     58.9    3e-07   
sp|P0DI54.1|CASP1_MALDO  RecName: Full=Casparian strip membrane p...  58.5    3e-07   
ref|XP_010667641.1|  PREDICTED: CASP-like protein 1B2                 58.5    3e-07   
ref|XP_003566190.1|  PREDICTED: CASP-like protein 1C1-1               58.2    3e-07   
ref|XP_002989705.1|  hypothetical protein SELMODRAFT_272089           58.9    3e-07   
ref|XP_007198888.1|  hypothetical protein PRUPE_ppa020481mg           58.2    3e-07   
dbj|BAJ88632.1|  predicted protein                                    58.5    3e-07   
sp|P0DI58.1|CSPL2_LOTJA  RecName: Full=CASP-like protein 2; Short...  58.5    3e-07   



>ref|XP_009630064.1| PREDICTED: CASP-like protein 1E2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009630065.1| PREDICTED: CASP-like protein 1E2 isoform X2 [Nicotiana tomentosiformis]
Length=193

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  72   ERGMEVGGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPT  251
            E    + GG  K + VA KQ +RW +FGLR LAF  TL AA+VLG+DKQT VVA+Q++PT
Sbjct  2    ETESNMNGGGRKVVGVANKQIIRWTDFGLRFLAFVLTLVAAIVLGVDKQTTVVAVQLVPT  61

Query  252  LPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDL  431
            LPA+N+  TA+W +MSAFVYFV+VNAIAC YAV+SLVL+   +G+K     SL++I+LDL
Sbjct  62   LPAINVRATAKWHHMSAFVYFVIVNAIACAYAVISLVLSLANRGKKKG--LSLMIILLDL  119

Query  432  VMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            + VALLFS GGAA AVGL+GYKGNSHVRW KVC+ F RFCGQV  
Sbjct  120  ITVALLFSGGGAALAVGLIGYKGNSHVRWTKVCDKFDRFCGQVAA  164



>ref|XP_006342777.1| PREDICTED: CASP-like protein 5-like [Solanum tuberosum]
Length=194

 Score =   184 bits (466),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 128/159 (81%), Gaps = 2/159 (1%)
 Frame = +3

Query  90   GGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNI  269
            GGG  KE+ +A KQ +RW +F LR LAF  TL AA+VLG+ KQ ++V +Q++PTLP +N+
Sbjct  9    GGGVAKEIGIANKQTIRWNDFVLRFLAFVLTLVAAIVLGVSKQNELVPVQLVPTLPPINV  68

Query  270  PVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALL  449
            P +A+W +MSAFVYFV+VNAIAC YAV+SLVL+   +G+  ++  SL +I+ DL+M+ALL
Sbjct  69   PASAKWSHMSAFVYFVIVNAIACAYAVISLVLSLANRGK--AKGLSLTIILFDLIMMALL  126

Query  450  FSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +SS GAA AVGL+GYKGN+HVRWNKVC+VFG+FCGQV  
Sbjct  127  YSSVGAAAAVGLIGYKGNTHVRWNKVCDVFGKFCGQVAA  165



>ref|XP_009803956.1| PREDICTED: CASP-like protein 1E1 [Nicotiana sylvestris]
Length=194

 Score =   182 bits (461),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 120/149 (81%), Gaps = 2/149 (1%)
 Frame = +3

Query  120  AKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMS  299
            A KQ++RW +FGLR LAF  TL AA+VLG+DKQT VVA+Q++PTLPA+N+  TA+W +MS
Sbjct  19   ANKQSIRWTDFGLRFLAFVLTLVAAIVLGVDKQTTVVAVQLVPTLPAINVRATAKWHHMS  78

Query  300  AFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGGAAFAV  479
            AFVYFVVVNAIAC YA +SLVL    +G+K     SL++I+LDL+ VALLFS GGAA AV
Sbjct  79   AFVYFVVVNAIACAYAAMSLVLLLANRGKKKG--LSLMIILLDLITVALLFSGGGAALAV  136

Query  480  GLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            GL+GYKGNSHVRW KVC+ F RFCGQV  
Sbjct  137  GLIGYKGNSHVRWIKVCDKFDRFCGQVAA  165



>ref|XP_004229217.1| PREDICTED: CASP-like protein 1E2 [Solanum lycopersicum]
Length=190

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = +3

Query  105  KELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIPVTAE  284
            KE+ VA KQ +RW +F LR LAF  TL AA+VLG+ KQ ++V +Q++PTLP +N+P +A+
Sbjct  10   KEIGVANKQTIRWNDFVLRFLAFVVTLVAAIVLGVSKQNELVPVQLVPTLPPINVPASAK  69

Query  285  WKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGG  464
            W +MSAFVYFV+VNAIAC YAV+SLVL+   KG+  ++  SL +I+ DL+M+ALL+SS G
Sbjct  70   WSHMSAFVYFVIVNAIACAYAVISLVLSLANKGK--TKGLSLTIILFDLIMMALLYSSVG  127

Query  465  AAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            AA AVGL+GYKGN+HVRWNKVC+VFG+FCGQV
Sbjct  128  AAAAVGLIGYKGNTHVRWNKVCDVFGKFCGQV  159



>emb|CDO98909.1| unnamed protein product [Coffea canephora]
Length=196

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = +3

Query  96   GQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIPV  275
            G+ KE+ VA K ++R ++  LR LAFA+TL AA+VLG+DKQTK+V+M ++ TLP + +PV
Sbjct  14   GRGKEVEVANKSSLRGSDVILRFLAFASTLVAAIVLGVDKQTKLVSMTVVSTLPPITVPV  73

Query  276  TAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFS  455
            TA+W YMSAFVYFVV N +AC YA +SL+L    +G K     +L++I LDLVMVALL S
Sbjct  74   TAKWHYMSAFVYFVVANVVACAYAALSLLLVLGNRGAKKG--LALMIITLDLVMVALLSS  131

Query  456  SGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             GGAA AVGL+GY+GNSHV+WNKVCNVFGRFC QV G
Sbjct  132  GGGAALAVGLIGYRGNSHVQWNKVCNVFGRFCNQVAG  168



>ref|XP_002276206.1| PREDICTED: CASP-like protein 1E2 [Vitis vinifera]
 sp|A7NW78.1|CSPL5_VITVI RecName: Full=CASP-like protein 1E2; Short=VvCASPL1E2 [Vitis 
vinifera]
Length=195

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 124/161 (77%), Gaps = 5/161 (3%)
 Frame = +3

Query  78   GMEVGGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLP  257
            GME    + KE+ V     +R  +  LR++A A TL AA++LG+DKQTKVV++Q++PTLP
Sbjct  11   GME---SKSKEVKVVTGGKLRPFDLVLRVVALALTLVAAVLLGVDKQTKVVSLQLLPTLP  67

Query  258  AMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVM  437
             M++PVTA+W+Y+SAFVYFVV NAIAC YA +SL+L SVG   K ++   L + V+DLVM
Sbjct  68   PMDVPVTAKWRYLSAFVYFVVSNAIACSYAALSLLL-SVGN-SKGNKGLGLAITVMDLVM  125

Query  438  VALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            VALLFSS GAA A+GL+GY+GNS VRW KVCNVFG+FC QV
Sbjct  126  VALLFSSNGAAGAIGLMGYEGNSRVRWGKVCNVFGKFCNQV  166



>gb|EYU45581.1| hypothetical protein MIMGU_mgv1a023532mg [Erythranthe guttata]
Length=201

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = +3

Query  105  KELAVAKKQ-NMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIPVTA  281
            KE AVAKK+ N R     LR+     +LAAA+VLG DKQT  VA++++P LPA+N+PVTA
Sbjct  24   KEWAVAKKRKNTRRWNLILRVAVVVLSLAAAVVLGFDKQTTTVALKLVPALPAVNVPVTA  83

Query  282  EWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSG  461
            EW ++S+FVYFVVVN+I C Y  +SL+L     G+K  R  S  ++V DL MVALLFSS 
Sbjct  84   EWHHLSSFVYFVVVNSIVCVYGAISLLLILASGGRKK-RFISATILVFDLTMVALLFSSI  142

Query  462  GAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            GAA AVGL+G +GNSH++WNKVCNVFGRFC Q G
Sbjct  143  GAALAVGLIGLEGNSHLQWNKVCNVFGRFCRQGG  176



>ref|XP_002311845.2| integral membrane family protein [Populus trichocarpa]
 sp|B9HMP6.2|CSPL7_POPTR RecName: Full=CASP-like protein 1E1; Short=PtCASPL1E1 [Populus 
trichocarpa]
 gb|EEE89212.2| integral membrane family protein [Populus trichocarpa]
Length=193

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 94/120 (78%), Gaps = 5/120 (4%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DKQTKVV ++I+ TLPA+N+PV+A+W Y+SAF Y V  NAIAC YA +SLVL   GK 
Sbjct  50   GVDKQTKVVPIKIVDTLPAINLPVSAKWHYLSAFTYSVASNAIACSYAALSLVLAVSGKK  109

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
               S     +VIVLDL+MVA+LFSS GAA A+GL+GY+GNSHVRW KVC+VFGRFC QV 
Sbjct  110  GIMS-----IVIVLDLLMVAMLFSSNGAALAIGLMGYQGNSHVRWTKVCHVFGRFCNQVA  164



>gb|KDP40019.1| hypothetical protein JCGZ_02017 [Jatropha curcas]
Length=184

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 94/118 (80%), Gaps = 5/118 (4%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G++KQ++VV ++++ +LP +NIPVTA+W ++SAFV+FVV NAIAC YA +SL+L   GK 
Sbjct  41   GVNKQSEVVPIKLVDSLPPLNIPVTAKWHHLSAFVFFVVSNAIACSYAAISLLLCFCGKK  100

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
               +     ++I LDL+MVALLFSS GA  A+GL+GYKGNSHVRWNKVCNVFGRFC Q
Sbjct  101  SMGA-----IIITLDLLMVALLFSSIGATTAIGLMGYKGNSHVRWNKVCNVFGRFCNQ  153



>ref|XP_011013341.1| PREDICTED: CASP-like protein 1E1 [Populus euphratica]
Length=192

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV + ++ TLPA+N+PV+A+W Y+SAF Y V  NAIAC YA +SLVL   GK 
Sbjct  49   GVAKQTKVVPITVVDTLPAINLPVSAKWHYLSAFTYSVASNAIACSYAALSLVLAVSGKK  108

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
               S     +VIVLDL+MVA+LFSS GAA A+GL+G++GNSHVRW KVCNVFGRFC QV 
Sbjct  109  GIMS-----IVIVLDLLMVAMLFSSNGAALAIGLMGFQGNSHVRWTKVCNVFGRFCKQVA  163



>ref|XP_007035490.1| CASP-like protein, putative [Theobroma cacao]
 gb|EOY06416.1| CASP-like protein, putative [Theobroma cacao]
Length=272

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G++KQTKVV +QI PTLP +NI   A W Y+SAFVY +V N IAC YA +S +L  +G  
Sbjct  125  GVNKQTKVVPIQIAPTLPPLNIEAQARWHYLSAFVYAMVSNIIACSYAAIS-ILMVMGTR  183

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +A  V+++LDLVMVALLFS+ GAAFA+GL+GYKGNSHVRWNKVCNVF +FC QV 
Sbjct  184  NAKKGLAQTVILLLDLVMVALLFSANGAAFAIGLMGYKGNSHVRWNKVCNVFDKFCNQVA  243



>ref|XP_008340843.1| PREDICTED: CASP-like protein VIT_05s0020g01820 [Malus domestica]
 ref|XP_008353234.1| PREDICTED: CASP-like protein VIT_05s0020g01820 [Malus domestica]
Length=194

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 92/117 (79%), Gaps = 2/117 (2%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
             KQT++V M++IPTLP ++IP TA+W Y+SAFVY VV + IAC YA  SLVL    +G+K
Sbjct  50   SKQTEIVTMKVIPTLPPIDIPATAKWHYLSAFVYLVVADVIACXYAAFSLVLLFANRGKK  109

Query  390  SSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            +     LVVIVLDL MVALLFS+ G+  A+GL+GY+GN+HV+WNKVCNVFG+FC QV
Sbjct  110  NR--LGLVVIVLDLTMVALLFSAIGSTGAIGLMGYQGNTHVQWNKVCNVFGKFCHQV  164



>ref|XP_009352216.1| PREDICTED: CASP-like protein VIT_05s0020g01820 [Pyrus x bretschneideri]
 ref|XP_009345799.1| PREDICTED: CASP-like protein VIT_05s0020g01820 [Pyrus x bretschneideri]
 ref|XP_009345805.1| PREDICTED: CASP-like protein VIT_05s0020g01820 [Pyrus x bretschneideri]
Length=195

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 120/163 (74%), Gaps = 6/163 (4%)
 Frame = +3

Query  78   GMEVGGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLP  257
            GME    Q KE+ +A ++     E  LR+LA   TL A++VLG+ KQT++V++++IPTLP
Sbjct  11   GME----QQKEVKIANQRGGVTRESILRILALVLTLTASIVLGVGKQTEIVSIKLIPTLP  66

Query  258  AMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVM  437
             +++P TA+W Y+SAFVY VV +AIAC YA  SLVL+   +G K+     LV+IVLDL M
Sbjct  67   PIDVPATAKWHYLSAFVYLVVADAIACTYAAFSLVLSFANRGTKNK--LGLVIIVLDLSM  124

Query  438  VALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            VALLFS+ G+A A+GL+GY+GN+ V+WNKVCNVFG+FC QV  
Sbjct  125  VALLFSAIGSAGAIGLMGYQGNTRVQWNKVCNVFGKFCHQVAA  167



>ref|XP_010683571.1| PREDICTED: CASP-like protein 1E1 [Beta vulgaris subsp. vulgaris]
Length=199

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 117/161 (73%), Gaps = 3/161 (2%)
 Frame = +3

Query  78   GMEVGGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLP  257
            GME    + K+  VA +    W E  LR+LA   TL AA++LGLDKQTK+V++ I P LP
Sbjct  12   GMEKTSKERKDGGVATR--FGWPEVVLRVLAMVLTLTAAILLGLDKQTKLVSVTITPDLP  69

Query  258  AMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVM  437
            A+N+PV A++ Y SA+VYFVV NAIAC +A VSL LT +  G     V+ L++IV DL+M
Sbjct  70   AINVPVIAKYHYASAYVYFVVGNAIACAFAAVSLALTFISNG-GGKIVSRLMIIVADLMM  128

Query  438  VALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            VALLFSS GAA  +GL+G KGNSH++W+KVC+VFGRFC QV
Sbjct  129  VALLFSSIGAATGIGLIGIKGNSHLQWHKVCDVFGRFCHQV  169



>ref|XP_010036826.1| PREDICTED: CASP-like protein 1E1 [Eucalyptus grandis]
Length=196

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DKQTK V +Q+ P LPA+N+PVTA+W+Y+SAFVYFVV NAIACGY+ +SL+L    K 
Sbjct  55   GVDKQTKTVPVQVSPALPALNVPVTAKWRYLSAFVYFVVANAIACGYSALSLLLLLANKA  114

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
             KS  +AS V I LD++MVALLFSS GAA AVG+LG +GNSHV+W KVCNVF +FC +V
Sbjct  115  GKSRTLASAVAI-LDIIMVALLFSSCGAATAVGVLGREGNSHVQWGKVCNVFDKFCDRV  172



>ref|XP_009369107.1| PREDICTED: CASP-like protein VIT_05s0020g01820 [Pyrus x bretschneideri]
Length=183

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 2/119 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQT++V M++IPTLP ++IP TA+W Y+SAFVY VV + IAC YA  SL L    +G
Sbjct  37   GVSKQTEIVTMKVIPTLPPIDIPATAKWHYLSAFVYLVVADVIACAYAAFSLGLLFANRG  96

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            +K+     LV+I+LDL MVALLFS+ G+  A+GL+GY+GN+HV+WNKVCNVFG+FC QV
Sbjct  97   KKNR--LGLVIIMLDLTMVALLFSAIGSTGAIGLMGYQGNTHVQWNKVCNVFGKFCHQV  153



>ref|XP_010036836.1| PREDICTED: CASP-like protein 1E1 [Eucalyptus grandis]
Length=196

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DKQTK V +Q+ P LPA+N+PVTA+W Y+SAFVYFVV NAIACGY+ +SL+L    K 
Sbjct  55   GVDKQTKTVPVQVSPALPALNVPVTAKWHYLSAFVYFVVANAIACGYSALSLLLLLANKA  114

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
             KS  +AS V I LD++MVALLFS  GAA AVG++G +GNSHV+W KVCNVF +FC +V
Sbjct  115  GKSRTLASAVAI-LDIIMVALLFSGCGAATAVGVIGREGNSHVQWGKVCNVFDKFCDRV  172



>ref|NP_001239666.1| CASP-like protein 1E1 [Glycine max]
 sp|C6TBD0.1|CSPL6_SOYBN RecName: Full=CASP-like protein 1E1; Short=GmCASPL1E1 [Glycine 
max]
 gb|ACU19132.1| unknown [Glycine max]
 gb|KHN03002.1| CASP-like protein 6 [Glycine soja]
Length=188

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 92/121 (76%), Gaps = 2/121 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
             +DKQTK+V +Q+  + P +N+P+TA+W  MSAFVYF+V NAIAC YA +SL+L  V +G
Sbjct  43   AVDKQTKLVPIQLSDSFPPLNVPLTAKWHQMSAFVYFLVTNAIACTYAAMSLLLALVNRG  102

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
             KS  + +L+  VLD  MVALLFS  GAA AVG+LGYKGNSHV WNKVCNVFG+FC Q+ 
Sbjct  103  -KSKGLWTLIA-VLDTFMVALLFSGNGAAAAVGILGYKGNSHVNWNKVCNVFGKFCDQMA  160

Query  564  G  566
             
Sbjct  161  A  161



>ref|XP_010036846.1| PREDICTED: CASP-like protein 1E1 [Eucalyptus grandis]
Length=182

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DKQTK V +Q+ P LPA N+PVTA+W Y SAFVYFVV NAIACGY+ +SL+L    K 
Sbjct  41   GVDKQTKTVPVQVSPALPARNVPVTAKWHYQSAFVYFVVANAIACGYSALSLLLLLANKA  100

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
             KS  +AS V I LD++MVALLFS  GAA AVG++G +GNSHV+W KVCNVF +FC +V
Sbjct  101  GKSRTLASAVAI-LDIIMVALLFSGCGAATAVGVIGREGNSHVKWGKVCNVFDKFCDRV  158



>ref|XP_002516873.1| conserved hypothetical protein [Ricinus communis]
 sp|B9RT04.1|CSPL9_RICCO RecName: Full=CASP-like protein 1E1; Short=RcCASPL1E1 [Ricinus 
communis]
 gb|EEF45487.1| conserved hypothetical protein [Ricinus communis]
Length=192

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 91/121 (75%), Gaps = 5/121 (4%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G++ QT+ V +Q+  ++P + +PV A+W Y+SAFV+FVV NAIAC YA +S++L+  GK 
Sbjct  49   GVNNQTETVPIQLTSSMPPLYVPVVAKWHYLSAFVFFVVSNAIACSYAAISVMLSFCGKK  108

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                     +++ LDL+MVALLFSS GAA A+G++GYKGNSHV+WNKVCNVFG+FC QV 
Sbjct  109  SMVP-----IILTLDLLMVALLFSSNGAATAIGVMGYKGNSHVKWNKVCNVFGKFCNQVA  163

Query  564  G  566
             
Sbjct  164  A  164



>ref|XP_002268702.1| PREDICTED: CASP-like protein 1E1 [Vitis vinifera]
 sp|A7PTY8.1|CSPL8_VITVI RecName: Full=CASP-like protein 1E1; Short=VvCASPL1E1 [Vitis 
vinifera]
Length=202

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 90/120 (75%), Gaps = 3/120 (3%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVL-TSVGK  380
            G+DKQTK++ + +I TLP++++PVTA+W  MSAFVY VV NAIAC YA +SLVL T +G+
Sbjct  53   GVDKQTKIIPLTLIKTLPSLHVPVTAKWSDMSAFVYLVVSNAIACSYAAISLVLVTMLGR  112

Query  381  GQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
              K  RV  L VIVLDL MV LLFS+ GAA AVG+LG  GNSHV W KVCNVF  FC  +
Sbjct  113  RGKGGRV--LAVIVLDLHMVGLLFSANGAATAVGVLGQYGNSHVEWKKVCNVFDSFCHHL  170



>ref|XP_003546096.2| PREDICTED: CASP-like protein 6-like [Glycine max]
Length=202

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G DKQT +V ++++ ++P + +PV A+W Y+SAFVY+V  NAIAC YA++SL+LT   + 
Sbjct  55   GTDKQTAIVPIKLVDSMPTLYVPVAAKWHYLSAFVYYVGANAIACAYAILSLLLTLANRR  114

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            +    + +L+  VLD VMVALLFS  GAA AVGLLG +GNSHV WNKVCN FG+FC QV
Sbjct  115  KGKGTMETLIT-VLDTVMVALLFSGNGAAMAVGLLGLQGNSHVHWNKVCNEFGKFCDQV  172



>ref|XP_004486055.1| PREDICTED: CASP-like protein 5-like [Cicer arietinum]
Length=193

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 110/164 (67%), Gaps = 2/164 (1%)
 Frame = +3

Query  75   RGMEVGGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTL  254
            + M     ++ E+ VAK       +  LRL A   TL A +V+G+DKQT +V ++   +L
Sbjct  7    KNMSHEDKEIGEVKVAKSAREGNCDLLLRLCALVLTLVATVVIGVDKQTTIVPIKFAESL  66

Query  255  PAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLV  434
            P + +PVTA+W YMSA+V+FVV N IACGYA  SL++T +  G KS  + +LV + LD++
Sbjct  67   PPLEVPVTAKWNYMSAYVFFVVANGIACGYATSSLLIT-LAMGHKSKYLVTLVSM-LDIL  124

Query  435  MVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            MVALLFSS GAA  VG++   GNSHVRWNKVCNVF +FC Q+  
Sbjct  125  MVALLFSSNGAALGVGVIAKLGNSHVRWNKVCNVFDKFCDQLAA  168



>emb|CAN69352.1| hypothetical protein VITISV_023954 [Vitis vinifera]
Length=202

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 89/120 (74%), Gaps = 3/120 (3%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVL-TSVGK  380
            G+DKQTK++ + +I TLP++++PVTA+W  MSAFVY VV NAI C YA +SLVL T +G+
Sbjct  53   GVDKQTKIIPLTLIKTLPSLHVPVTAKWSDMSAFVYLVVSNAIXCSYAAISLVLVTMLGR  112

Query  381  GQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
              K  RV  L VIVLDL MV LLFS+ GAA AVG+LG  GNSHV W KVCNVF  FC  +
Sbjct  113  RGKGGRV--LAVIVLDLHMVGLLFSANGAATAVGVLGQYGNSHVEWKKVCNVFDSFCHHL  170



>ref|XP_010105029.1| hypothetical protein L484_008470 [Morus notabilis]
 gb|EXC03138.1| hypothetical protein L484_008470 [Morus notabilis]
Length=189

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 120/160 (75%), Gaps = 5/160 (3%)
 Frame = +3

Query  78   GMEVGGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLP  257
            G E+GG   KE+ VA K+ +   E  LR+LA   TL+AA++LG+DKQ KVV +Q++ TLP
Sbjct  6    GNELGG---KEVKVANKRRIGACESVLRILALVLTLSAAVILGVDKQNKVVPVQVLETLP  62

Query  258  AMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVM  437
             +++PV+A+W Y+SAFVYFVV NAIAC YA +SLV     +  K   +  LVV+V+D+VM
Sbjct  63   PISVPVSAKWHYLSAFVYFVVANAIACLYAALSLVFLLANREGKG--ITGLVVVVVDVVM  120

Query  438  VALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            +ALLFSS GAA A+G+LG+KGNSHV+W KVCNVF +FC Q
Sbjct  121  MALLFSSNGAAAAIGVLGFKGNSHVQWEKVCNVFDKFCDQ  160



>ref|XP_010105028.1| hypothetical protein L484_008469 [Morus notabilis]
 gb|EXC03137.1| hypothetical protein L484_008469 [Morus notabilis]
Length=212

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 95/118 (81%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G++KQTKVV +++  TLP +++PV+A+W Y+SAF+YFVV NAIAC YAV+SLVL S+  G
Sbjct  67   GVNKQTKVVPVKVFDTLPPLSVPVSAKWHYLSAFMYFVVANAIACSYAVLSLVL-SLENG  125

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
              S+  + L++ V+D+VM  LLFS+ GAA +VGL+GY+GNSHV+W KVCNVF +FC Q
Sbjct  126  GGSNSSSGLIITVVDVVMTGLLFSANGAAASVGLIGYEGNSHVQWRKVCNVFHKFCVQ  183



>ref|XP_003609584.1| hypothetical protein MTR_4g118810 [Medicago truncatula]
 gb|AES91781.1| plant integral membrane protein [Medicago truncatula]
Length=200

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G DKQT +V ++++ +LP +N+ V+A+W Y+SAFVYF+V NAIAC Y  +S++LT + +G
Sbjct  53   GTDKQTTIVPIKVVDSLPPLNVAVSAKWHYLSAFVYFLVANAIACTYGAISMLLTLLNRG  112

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
             KS      ++ + D +MVALLFS  GAA A+G+LGY+GNSHVRW KVCNVF ++C QV
Sbjct  113  -KSKVFWGTLITIFDALMVALLFSGNGAATAIGVLGYQGNSHVRWKKVCNVFDKYCHQV  170



>ref|XP_007147871.1| hypothetical protein PHAVU_006G161900g [Phaseolus vulgaris]
 gb|ESW19865.1| hypothetical protein PHAVU_006G161900g [Phaseolus vulgaris]
Length=295

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 88/121 (73%), Gaps = 4/121 (3%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G DKQT +V ++++ ++P + +PV A+W Y+SAFVYFV  NAIAC YA +SL+LT +G  
Sbjct  151  GADKQTAIVPIKLVESMPPLYVPVAAKWHYLSAFVYFVGANAIACSYATLSLLLT-LGNR  209

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            +K       V+ V D VMVALLFSS GAA AVGLLG  GNSHV WNKVCN+FG+FC QV 
Sbjct  210  RKGMET---VITVFDTVMVALLFSSNGAAIAVGLLGLHGNSHVHWNKVCNLFGKFCDQVA  266

Query  564  G  566
             
Sbjct  267  A  267



>ref|XP_006414479.1| hypothetical protein EUTSA_v10026349mg [Eutrema salsugineum]
 gb|ESQ55932.1| hypothetical protein EUTSA_v10026349mg [Eutrema salsugineum]
Length=182

 Score =   139 bits (351),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV++++IPTLP +++  TA+  Y+SAFVY +  NAIACGY  +S+V+  + KG
Sbjct  39   GVSKQTKVVSIKVIPTLPPLDVSTTAKSTYLSAFVYNISANAIACGYTAISIVILIISKG  98

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++S  +  + V++ DLVMVALLFS  GAA A+GL+G KGN HV W KVCNVFG+FC Q
Sbjct  99   RRSKGLL-MAVLLGDLVMVALLFSGTGAAGAIGLMGLKGNKHVMWKKVCNVFGKFCHQ  155



>gb|KHN33122.1| CASP-like protein 6 [Glycine soja]
Length=201

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G DKQT +V ++++ ++P + +PV A+W Y+SAFVY+V  NAIAC YA++SL+LT   + 
Sbjct  55   GTDKQT-IVPIKLVDSMPTLYVPVAAKWHYLSAFVYYVGANAIACAYAILSLLLTLANRR  113

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            +    + +L+  VLD VMVALLFS  GAA AVGLLG +GNSHV WNKVCN FG+FC QV
Sbjct  114  KGKGTMETLIT-VLDTVMVALLFSGNGAAMAVGLLGLQGNSHVHWNKVCNEFGKFCDQV  171



>ref|NP_567473.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8L8Z1.2|CSPLO_ARATH RecName: Full=CASP-like protein 1E1; Short=AtCASPL1E1 [Arabidopsis 
thaliana]
 emb|CAB10341.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78605.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01183.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABI49468.1| At4g15630 [Arabidopsis thaliana]
 gb|AEE83630.1| uncharacterized protein AT4G15630 [Arabidopsis thaliana]
Length=190

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV +++IPTLP +N+  TA+  Y+SAFVY +  NAIACGY  +S+V+  + KG
Sbjct  47   GVAKQTKVVPIKLIPTLPPLNVSTTAKASYLSAFVYNISANAIACGYTAISIVIVMISKG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++S  +  + V++ DL+MVALLFSS GAA A+GL+G  GN HV W KVC VFG+FC Q
Sbjct  107  KRSKSLL-MAVLIGDLMMVALLFSSTGAAGAIGLMGRHGNKHVMWKKVCGVFGKFCNQ  163



>gb|AAM67044.1| unknown [Arabidopsis thaliana]
Length=190

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV +++IPTLP +N+  TA+  Y+SAFVY +  NAIACGY  +S+V+  + KG
Sbjct  47   GVAKQTKVVPIKLIPTLPPLNVSTTAKASYLSAFVYNISANAIACGYTAISIVIVMISKG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++S  +  + V++ DL+M+ALLFSS GAA A+GL+G  GN HV W KVC VFG+FC Q
Sbjct  107  KRSKSLL-MTVLIGDLMMMALLFSSTGAAGAIGLMGRHGNKHVMWKKVCGVFGKFCNQ  163



>ref|XP_007154230.1| hypothetical protein PHAVU_003G101200g [Phaseolus vulgaris]
 gb|ESW26224.1| hypothetical protein PHAVU_003G101200g [Phaseolus vulgaris]
Length=195

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
            DKQTKVV +Q+  +LP   +P+TA+W  MSA +YF+V NAIAC YA +SLVL  V +G+ 
Sbjct  52   DKQTKVVPIQLSDSLPPFYLPLTAKWHQMSAVLYFLVTNAIACTYAALSLVLALVNRGK-  110

Query  390  SSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             S+    V+ VLD  MVALLFS  GAA AVG+LGYKGNSHV W +VCNVF +FC Q+  
Sbjct  111  -SKGLWTVITVLDAFMVALLFSGNGAAAAVGVLGYKGNSHVNWKRVCNVFEKFCDQMAA  168



>ref|NP_193297.1| uncharacterized protein [Arabidopsis thaliana]
 sp|O23413.1|CSPLN_ARATH RecName: Full=CASP-like protein 1E2; Short=AtCASPL1E2 [Arabidopsis 
thaliana]
 emb|CAB10340.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78604.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAO22783.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42449.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83629.1| uncharacterized protein AT4G15620 [Arabidopsis thaliana]
Length=190

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV++++IPTLP ++I  TA+  Y+SAFVY + VNAIACGY  +S+ +  + +G
Sbjct  47   GVAKQTKVVSIKLIPTLPPLDITTTAKASYLSAFVYNISVNAIACGYTAISIAILMISRG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++S ++  +VV++ DLVMVALLFS  GAA A+GL+G  GN HV W KVC VFG+FC +
Sbjct  107  RRSKKLL-MVVLLGDLVMVALLFSGTGAASAIGLMGLHGNKHVMWKKVCGVFGKFCHR  163



>ref|XP_010449918.1| PREDICTED: CASP-like protein 1E2 [Camelina sativa]
Length=191

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 114/160 (71%), Gaps = 6/160 (4%)
 Frame = +3

Query  78   GMEVGGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLP  257
            GME+  G+ KE+  ++K      E  LR+LA   T+AAA VLG+ KQTKVV+ ++IPTLP
Sbjct  11   GMEMEKGR-KEINGSRK----GVELTLRVLALVLTMAAATVLGVAKQTKVVSFKLIPTLP  65

Query  258  AMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVM  437
             ++I  TA+  Y+SAFVY + VN IACGY V+SL +  + KG++S  +  + V++ DL+M
Sbjct  66   PLDITTTAKATYLSAFVYHISVNVIACGYTVISLAILMINKGRRSKGLL-MAVLLGDLLM  124

Query  438  VALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            VALLFS  GAA A+GL+G +GN HV WNKVC VFG+FC +
Sbjct  125  VALLFSGTGAAGAIGLMGLQGNKHVMWNKVCGVFGKFCHR  164



>ref|XP_011090846.1| PREDICTED: CASP-like protein 1E2 [Sesamum indicum]
Length=241

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 121/160 (76%), Gaps = 3/160 (2%)
 Frame = +3

Query  78   GMEVGGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLP  257
            G+E G        VA K+N+R  +  LR LA + +LAAA+VLG+DK++  VAM ++PTLP
Sbjct  55   GIESGSTNTTT-RVANKRNLRGWDLVLRFLALSLSLAAAVVLGVDKESTTVAMTLVPTLP  113

Query  258  AMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVM  437
            A+N+PVTA+W Y+SAFV+FVV NAIAC +A +SL+L    KG   ++  SL++++ DLVM
Sbjct  114  AVNVPVTAKWHYLSAFVFFVVANAIACAHAAISLLLALANKG--GNKGISLMIVLFDLVM  171

Query  438  VALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            VALLFSS GAA A+GL+GY+GNSHV+W KVCNVF +FC Q
Sbjct  172  VALLFSSFGAALAIGLMGYEGNSHVQWKKVCNVFDKFCNQ  211



>ref|XP_006284585.1| hypothetical protein CARUB_v10005811mg [Capsella rubella]
 gb|EOA17483.1| hypothetical protein CARUB_v10005811mg [Capsella rubella]
Length=190

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV +++IPTLP +++  TA+  Y+SAFVY V VNAIACGY  +S+V+  + KG
Sbjct  47   GVAKQTKVVPIKLIPTLPPLDVSTTAKASYLSAFVYNVSVNAIACGYTAISIVILMISKG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++S  +  + V++ DLVMVALLFS  GA+ A+GL+G +GN HV W KVC VFG+FC Q
Sbjct  107  KRSKGLL-MAVLIGDLVMVALLFSGTGASGAIGLMGKQGNDHVMWKKVCGVFGKFCNQ  163



>gb|AFK48170.1| unknown [Lotus japonicus]
Length=193

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+D  TKVV ++I+  LP +N+PV A+W Y+SAFVYF+V NAIA  Y   SLVL  + KG
Sbjct  48   GVDNHTKVVPIKILDGLPPVNVPVPAKWHYLSAFVYFLVANAIASTYGAFSLVLAIINKG  107

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            +  SR    ++ VLD +MVALLFS  GAA AVG+LGY GNSHV+W KVCNVF  FC Q
Sbjct  108  K--SRGLGSLITVLDALMVALLFSGNGAASAVGVLGYYGNSHVQWKKVCNVFDNFCHQ  163



>ref|XP_008458485.1| PREDICTED: CASP-like protein 6 isoform X1 [Cucumis melo]
Length=194

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DKQTK V +Q+  +LP +++PVTA W Y+S+FVYFVV NAIAC YA  SLVL+ + KG
Sbjct  47   GVDKQTKTVPLQLAASLPPLHVPVTARWHYLSSFVYFVVANAIACSYAAFSLVLSLLNKG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            +    + S  +IV+D++ VALLFS  GAA AVG +G++GNSH+ WNK+CNVFGRFCGQ
Sbjct  107  KSRGFIRS-AIIVMDILTVALLFSGFGAAAAVGAIGWRGNSHLNWNKMCNVFGRFCGQ  163



>emb|CDY22743.1| BnaA08g05730D [Brassica napus]
Length=190

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV++ +IPTLP +++  TA+  Y+SAFV+ +  NAIACGY  +S+ +  V KG
Sbjct  47   GVAKQTKVVSITLIPTLPPLDVSATAKASYLSAFVFNISANAIACGYTAISIAILMVSKG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            ++S  +  + V++ DLVM+ALLFSS GAA A+GL+G +GN HV W KVCNVFG+FC Q  
Sbjct  107  RRSKGLI-MAVLIGDLVMMALLFSSTGAAGAIGLMGVQGNKHVMWKKVCNVFGKFCHQTA  165

Query  564  G  566
             
Sbjct  166  A  166



>ref|XP_010434940.1| PREDICTED: CASP-like protein 1E2 [Camelina sativa]
Length=191

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV+ ++IPTLPA++I  TA+  Y+SAFVY + VN IACGY V+SL +  + KG
Sbjct  48   GVAKQTKVVSFKLIPTLPALDITTTAKATYLSAFVYHISVNVIACGYTVISLAILMINKG  107

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++S  +  + V++ DL+MVALLFS  GAA A+GL+G +GN HV W KVC VFG+FC +
Sbjct  108  RRSKGLL-MAVLLGDLLMVALLFSGTGAAGAIGLMGLQGNKHVMWKKVCGVFGKFCHR  164



>ref|XP_009107849.1| PREDICTED: CASP-like protein At4g15630 [Brassica rapa]
Length=193

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV++ +IPTLP +++  TA+  Y+SAFV+ +  NAIACGY  +S+ +  V KG
Sbjct  47   GVAKQTKVVSITLIPTLPPLDVSATAKASYLSAFVFNISANAIACGYTAISIAILMVSKG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            ++S  +  + V++ DLVM+ALLFSS GAA A+GL+G +GN HV W KVCNVFG+FC Q  
Sbjct  107  RRSKGLI-MAVLIGDLVMMALLFSSTGAAGAIGLMGVQGNKHVMWKKVCNVFGKFCHQTA  165

Query  564  G  566
             
Sbjct  166  A  166



>ref|NP_001236009.1| CASP-like protein 1E2 [Glycine max]
 sp|C6SZP8.1|CSPL5_SOYBN RecName: Full=CASP-like protein 1E2; Short=GmCASPL1E2 [Glycine 
max]
 gb|ACU14721.1| unknown [Glycine max]
 gb|KHN03389.1| CASP-like protein 5 [Glycine soja]
Length=187

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 93/121 (77%), Gaps = 2/121 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
             +DKQTKVV +Q+  +LP +++P+TA+W  MSA VYF+V NAIAC YAV+SL+L  V +G
Sbjct  42   AVDKQTKVVPIQLSDSLPPLDVPLTAKWHQMSAIVYFLVTNAIACTYAVLSLLLALVNRG  101

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
             KS  + +L+  VLD  MVALLFS  GAA AVG+LGYKGNSHV WNKVCNVFG+FC Q+ 
Sbjct  102  -KSKGLWTLIA-VLDAFMVALLFSGNGAAAAVGVLGYKGNSHVNWNKVCNVFGKFCDQMA  159

Query  564  G  566
             
Sbjct  160  A  160



>ref|XP_009136705.1| PREDICTED: CASP-like protein At4g15630 [Brassica rapa]
Length=190

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV++++IPTLP +++  TA+  Y+SAFVY +  NAIACGYA +S+ +  + KG
Sbjct  47   GVAKQTKVVSIKLIPTLPPLDVSTTAKASYLSAFVYNISANAIACGYAAISIAVLMICKG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++S  +  + V++ DLVMV LLFS  GAA A+GL+G +GN HV W KVCNVFG+FC Q
Sbjct  107  RRSKGLL-MAVLIGDLVMVGLLFSGTGAAGAIGLMGSQGNKHVMWKKVCNVFGKFCHQ  163



>emb|CDX90578.1| BnaA03g42030D [Brassica napus]
Length=190

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV++++IPTLP +++  TA+  Y+SAFVY +  NAIACGYA +S+ +  + KG
Sbjct  47   GVAKQTKVVSIKLIPTLPPLDVSTTAKASYLSAFVYNISANAIACGYAAISIAVLMICKG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++S  +  + V++ DLVMV LLFS  GAA A+GL+G +GN HV W KVCNVFG+FC Q
Sbjct  107  RRSKGLL-MAVLIGDLVMVGLLFSGTGAAGAIGLMGSQGNKHVMWKKVCNVFGKFCHQ  163



>ref|XP_006285126.1| hypothetical protein CARUB_v10006465mg [Capsella rubella]
 gb|EOA18024.1| hypothetical protein CARUB_v10006465mg [Capsella rubella]
Length=190

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV++++IPTLP ++I  TA+  Y+SAFVY + VNAIACGY V+S+ +  + KG
Sbjct  47   GVAKQTKVVSLKLIPTLPPVDITATAKATYLSAFVYHISVNAIACGYTVISIAILMISKG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++S  +  + V++ DL+MVALLFS  GAA A+GL+G +GN HV W KVC VFG+FC +
Sbjct  107  KRSKGLL-MAVLLGDLLMVALLFSGTGAAGAIGLMGLQGNKHVMWKKVCGVFGKFCHR  163



>ref|XP_002870225.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7MAF6.1|CSPL9_ARALL RecName: Full=CASP-like protein 1E2; Short=AlCASPL1E2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH46484.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=190

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV++++IP LP ++I  TA+  Y+SAFVY +  NAIACGY  +S+ +  + +G
Sbjct  47   GVAKQTKVVSIKLIPALPPLDITTTAKASYLSAFVYNISANAIACGYTAISIAILMISRG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++S ++  + V++ DLVMVALLFS  GAA A+GL+G +GN HV WNKVC VFG+FC +
Sbjct  107  RRSKKLL-MAVLLGDLVMVALLFSGTGAASAIGLMGLQGNKHVMWNKVCGVFGKFCHR  163



>ref|XP_010548921.1| PREDICTED: CASP-like protein 1E2 [Tarenaya hassleriana]
Length=189

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ K+TK+V+++++PTLPA+++  TA+  Y+SAFVY +  NAIACGY  VS ++  V +G
Sbjct  47   GVGKETKIVSVKLVPTLPAVDVSSTAKATYLSAFVYNISANAIACGYVAVSTLILMVTRG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            +  S+  + V++V DLVMVALLFS  GAA A+GL+G++GN HV WNKVCNVFG+FC  V
Sbjct  107  K--SKPLAAVLLVGDLVMVALLFSGTGAAGAIGLMGFQGNKHVMWNKVCNVFGKFCHTV  163



>ref|XP_011071478.1| PREDICTED: CASP-like protein 1E2 [Sesamum indicum]
Length=192

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 116/151 (77%), Gaps = 5/151 (3%)
 Frame = +3

Query  105  KELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIPVTAE  284
            KELAV++K   R  +  LR++A A +LAAA+VLGLDKQT  VA+ ++PTLP ++IPVTA+
Sbjct  17   KELAVSEKNKTRGWDLLLRVVAVAFSLAAAVVLGLDKQTATVALTLVPTLPPVDIPVTAK  76

Query  285  WKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGG  464
            W Y+SA VYFVV NA AC YA +SL+L S GK     RV +++V V DL++VALLFSS G
Sbjct  77   WHYLSASVYFVVANAAACAYAAISLLLLSGGK----RRVVTMIV-VFDLMIVALLFSSLG  131

Query  465  AAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            A  AVG++  KGN+HV+W+KVC+VFG+FC Q
Sbjct  132  AVAAVGVISLKGNAHVQWHKVCSVFGKFCNQ  162



>ref|XP_007050797.1| CASP protein GSVIVT01010992001, putative [Theobroma cacao]
 gb|EOX94954.1| CASP protein GSVIVT01010992001, putative [Theobroma cacao]
Length=186

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DK+TK +++ I  TLP +++PVTA+W YMSAFVYF++ NA+A  YA  SLV +   + 
Sbjct  40   GVDKETKTISVSITKTLPTLHVPVTAKWHYMSAFVYFLISNAVASLYAAASLVASMAVRT  99

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
             K    A++ +++LD+ ++ LLFSS GAA AVG+LG  GNSH RWNKVC +FG FC ++
Sbjct  100  SKEK--AAMALVILDMTIMGLLFSSNGAAIAVGVLGQYGNSHARWNKVCELFGGFCHEM  156



>emb|CBI26107.3| unnamed protein product [Vitis vinifera]
Length=127

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = +3

Query  261  MNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMV  440
            M++PVTA+W+Y+SAFVYFVV NAIAC YA +SL+L SVG   K ++   L + V+DLVMV
Sbjct  1    MDVPVTAKWRYLSAFVYFVVSNAIACSYAALSLLL-SVGN-SKGNKGLGLAITVMDLVMV  58

Query  441  ALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            ALLFSS GAA A+GL+GY+GNS VRW KVCNVFG+FC QV
Sbjct  59   ALLFSSNGAAGAIGLMGYEGNSRVRWGKVCNVFGKFCNQV  98



>emb|CDY09075.1| BnaC08g10290D [Brassica napus]
Length=190

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV++ +IPTLP +++  TA+  Y+SAFV+ +  NAIACGY  +S+ +  V KG
Sbjct  47   GVAKQTKVVSITLIPTLPPLDVSATAKASYLSAFVFNISANAIACGYTAISIAILMVSKG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++S  +  + V++ DLVM+ALLFSS GAA A+GL+G +GN HV W KVCNV G+FC Q
Sbjct  107  RRSKGLI-MAVLIGDLVMMALLFSSTGAAGAIGLMGVQGNKHVMWKKVCNVLGKFCHQ  163



>emb|CDY09749.1| BnaC07g33120D [Brassica napus]
Length=190

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV++++IPTLP +++  TA+  Y+SAFVY +  NAIACGY  +S+ +  + KG
Sbjct  47   GVAKQTKVVSIKLIPTLPPLDVSTTAKASYLSAFVYNISANAIACGYTAISIAVLMICKG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++S  +  + V++ DLVMV LLFS  GAA A+GL+G +GN HV W KVCNVFG+FC Q
Sbjct  107  RRSKGLL-MAVLIGDLVMVGLLFSGTGAAGAIGLMGSQGNKHVMWKKVCNVFGKFCHQ  163



>ref|XP_010440273.1| PREDICTED: CASP-like protein 1E1 [Camelina sativa]
Length=191

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV++++IPTLP +++  TA+  Y+SAFVY + VNAIACGY  +S+V+  + KG
Sbjct  48   GVAKQTKVVSLKVIPTLPPLDVSTTAKASYLSAFVYNISVNAIACGYTAISIVILMMSKG  107

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            ++S  +  + +++ DLVMVALLFS  GA+  +GL+G +GN HV W KVC VF +FC QV
Sbjct  108  RRSKGLL-MAILIGDLVMVALLFSGTGASGGIGLMGKQGNKHVMWKKVCGVFDKFCNQV  165



>ref|XP_010440274.1| PREDICTED: CASP-like protein 1E2 [Camelina sativa]
Length=191

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV+ ++IPTLP ++I  TA+  Y+SAFVY + VN IACGY V+SL +  + KG
Sbjct  48   GVAKQTKVVSFKLIPTLPPLDITTTAKATYLSAFVYHISVNVIACGYTVISLAILMINKG  107

Query  384  QKSSRVASLVVIVL-DLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            ++  R   L+ ++L DL+MVALLFS  GAA A+GL+G +GN HV W KVC VFG+FC +
Sbjct  108  RR--RKGLLMTVLLGDLLMVALLFSGTGAAGAIGLMGLQGNKHVMWKKVCGVFGKFCHR  164



>ref|XP_002870224.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7MAF5.1|CSPLA_ARALL RecName: Full=CASP-like protein 1E1; Short=AlCASPL1E1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH46483.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=190

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 106/152 (70%), Gaps = 3/152 (2%)
 Frame = +3

Query  108  ELAVAKKQN--MRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIPVTA  281
            E+   KK+N   +  E  +R+LA   T+ AA VLG+ KQT+VV +++IPTLP +N+  TA
Sbjct  13   EMEKGKKENGSRKGVEITMRVLALVLTMVAATVLGVAKQTEVVPIKLIPTLPPLNVATTA  72

Query  282  EWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSG  461
            +  Y+SAFVY +  NAIACGY  +S+++  + KG++ S+   + V++ DL+MVALL SS 
Sbjct  73   KASYLSAFVYNICANAIACGYTAISIMIVIISKGRR-SKCLLMAVLIGDLMMVALLCSST  131

Query  462  GAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            GAA A+GL+G  GN HV W KVC VFG+FC Q
Sbjct  132  GAAGAIGLMGRHGNKHVMWKKVCGVFGKFCNQ  163



>ref|XP_008390727.1| PREDICTED: CASP-like protein VIT_05s0020g01820 [Malus domestica]
Length=195

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 117/163 (72%), Gaps = 2/163 (1%)
 Frame = +3

Query  78   GMEVGGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLP  257
            G   G  Q KE+ +A ++     E  LR+LA   TL A++VLG+ KQT++V++++IPTLP
Sbjct  7    GSNSGMEQQKEVKIANQRGGGTRESILRILALVLTLTASIVLGVGKQTEIVSLKLIPTLP  66

Query  258  AMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVM  437
             +++P TA+W Y+SAFVY V  +AIAC YA  SLVL+   +G K+     LV+IVLDL M
Sbjct  67   PIDVPATAKWHYLSAFVYLVXADAIACAYAAFSLVLSFANRGTKNK--LXLVIIVLDLSM  124

Query  438  VALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            VALLFS+ G+A A+GL+GY+GN+ V+WNKVCNVFG+FC  V  
Sbjct  125  VALLFSAIGSAGAIGLMGYQGNTRVQWNKVCNVFGKFCHLVAA  167



>ref|XP_008438806.1| PREDICTED: CASP-like protein 6 [Cucumis melo]
Length=174

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DK+TKVV + I   LP   I V A+W+Y+SAFVYF   N IA  Y ++SL+LT   K 
Sbjct  27   GVDKETKVVPVTISSNLPPFPIVVVAKWRYLSAFVYFFATNVIASLYGLLSLMLTLSNK-  85

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
              S+ V +L+VIVLD V VALL S  GAA A+G++ Y+GNSHVRWNKVC++FG+FC QV 
Sbjct  86   NGSNNVLTLLVIVLDTVSVALLSSGAGAAMAIGVIAYEGNSHVRWNKVCDIFGKFCKQVA  145

Query  564  G  566
             
Sbjct  146  A  146



>ref|XP_004134189.1| PREDICTED: CASP-like protein 6-like [Cucumis sativus]
 ref|XP_004159822.1| PREDICTED: CASP-like protein 6-like [Cucumis sativus]
 gb|KGN57072.1| hypothetical protein Csa_3G151500 [Cucumis sativus]
Length=174

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 85/121 (70%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DK+TKVV + I   LP   I V A+W Y+SAFVY +  N IA  Y ++SL+LT   K 
Sbjct  27   GVDKETKVVPITISSNLPPFPIVVVAKWHYVSAFVYLLATNVIASSYGLLSLMLTLSNK-  85

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
             +S+ V +L++IVLD V VALL S  GAA A+G++GY+GNSHV WNKVC+ FGRFC QV 
Sbjct  86   NRSNNVLTLLIIVLDTVTVALLSSGTGAALAIGVMGYEGNSHVGWNKVCDTFGRFCKQVA  145

Query  564  G  566
             
Sbjct  146  A  146



>ref|XP_008223107.1| PREDICTED: CASP-like protein POPTRDRAFT_820934 [Prunus mume]
Length=199

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 99/118 (84%), Gaps = 2/118 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G++KQT++V+M+I+PTLP +++P TA+W Y+SAFVYFVV NAIAC YA  SLVL+ V +G
Sbjct  53   GVNKQTEIVSMKIVPTLPPIDLPATAKWHYLSAFVYFVVANAIACAYAAFSLVLSFVNRG  112

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
             KSS    LV+I+LDL+MVALLFS  GAA A+GL+GY+GNSHV+WNKVCNVFGRFC  
Sbjct  113  TKSS--LGLVIILLDLLMVALLFSCNGAAGAIGLMGYQGNSHVQWNKVCNVFGRFCNH  168



>ref|XP_004150813.1| PREDICTED: CASP-like protein 6-like [Cucumis sativus]
Length=195

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DKQTK+V +Q+  +LP +++PVTA W Y+SA VYFVV NAIAC YA  SLVL+ + K 
Sbjct  48   GVDKQTKMVPLQLATSLPPVHVPVTARWHYLSALVYFVVANAIACSYAAFSLVLSLLNK-  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
             KS       +IV+D++ VALLFS  GAA AVG +G +GNSH+ WNK+CNVFGRFCGQ
Sbjct  107  DKSRGFMRSAIIVMDILTVALLFSGFGAAAAVGAIGRQGNSHLNWNKICNVFGRFCGQ  164



>ref|XP_010524513.1| PREDICTED: CASP-like protein 1E2 [Tarenaya hassleriana]
Length=193

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 109/164 (66%), Gaps = 1/164 (1%)
 Frame = +3

Query  72   ERGMEVGGGQVKELAVAKKQNMR-WAEFGlrllafantlaaalvlGLDKQTKVVAMQIIP  248
            E   E G    +  +     N R W+E  +RLLA   TLA A++LG+ K+TK+V ++I+P
Sbjct  4    EEDREKGLNGTERGSDGHNNNGRVWSELVMRLLASVLTLATAVILGVSKETKIVPLKILP  63

Query  249  TLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLD  428
            TLP +++  TA+  Y SAFVY +  NAIACGYA V+  + +V +G+K  +  ++ +++ D
Sbjct  64   TLPPVHVSYTAKSTYQSAFVYNITANAIACGYAAVTTWILTVTRGKKKGKAVAVALLMGD  123

Query  429  LVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            LV VALLFS  GAA A+GL+G++GN HV WNKVCNVF  FC  V
Sbjct  124  LVTVALLFSGTGAAGAIGLMGFQGNKHVMWNKVCNVFHGFCRTV  167



>gb|EYU43899.1| hypothetical protein MIMGU_mgv1a014325mg [Erythranthe guttata]
Length=193

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = +3

Query  96   GQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIPV  275
            G V+   VA ++ MR  +  LR LA A TL AA+VLG+DKQ   VA+ ++PTLP +N+PV
Sbjct  12   GGVESGGVANRRKMRGCDVVLRFLALALTLTAAVVLGVDKQNTTVAVTLVPTLPPVNVPV  71

Query  276  TAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFS  455
            TA+W ++SAFV+FVV NAIAC +A +SL LT   +  K     +++V++ DLVMVALLFS
Sbjct  72   TAKWHHLSAFVFFVVANAIACAHAAISLALTLANRSGKKG--ITMIVVLFDLVMVALLFS  129

Query  456  SGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
              GAA ++G++G++GNSHV+W KVCNVFG+FC Q
Sbjct  130  GVGAAASIGVMGFEGNSHVQWKKVCNVFGKFCHQ  163



>ref|XP_010449916.1| PREDICTED: CASP-like protein 1E1 [Camelina sativa]
Length=191

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 88/119 (74%), Gaps = 1/119 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV ++I+P+LP +++  TA+  Y+SAFVY + VNAIACGY  +S+V+  + KG
Sbjct  48   GVAKQTKVVPLKILPSLPPLDVSTTAKASYLSAFVYNISVNAIACGYTAISIVILMMSKG  107

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            ++S  +  + +++ DLVMVALLFS  GA+  +GL+G +GN HV W KVC VF +FC QV
Sbjct  108  RRSKGLL-MAILIGDLVMVALLFSGTGASGGIGLMGKQGNKHVMWKKVCGVFDKFCNQV  165



>ref|XP_006444237.1| hypothetical protein CICLE_v10023477mg [Citrus clementina]
 gb|ESR57477.1| hypothetical protein CICLE_v10023477mg [Citrus clementina]
Length=199

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 89/117 (76%), Gaps = 4/117 (3%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLT-SVGK  380
            G+DK+TK+++  +  T+P++ + VTA+W++MSAFVYF+V NAIA  YA +SL  T ++ +
Sbjct  53   GVDKETKIISFTLAETMPSVQVSVTAKWQFMSAFVYFLVSNAIASSYAALSLAFTLAITR  112

Query  381  GQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFC  551
               +   A+L +I+LDL+ + LLFS+ GAA A+G++G KGNSHV WNKVCNVFG FC
Sbjct  113  FHNN---AALGLIMLDLITMGLLFSANGAAMAIGMIGLKGNSHVHWNKVCNVFGGFC  166



>ref|XP_004508611.1| PREDICTED: CASP-like protein 6-like [Cicer arietinum]
Length=187

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
             +  Q KVV  ++  +LP + +PV+A+W Y+SA+VYF+V NAIAC Y ++S++LT + +G
Sbjct  40   AMGNQNKVVPFKLSDSLPPIYVPVSAKWHYLSAYVYFMVANAIACIYGLISMLLTLLNRG  99

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFC  551
            +    + +L+  V D +MVALLFS  GAA  VGL+GYKGNSHVRW+KVCNVF +FC
Sbjct  100  KNKVLLGTLLT-VFDALMVALLFSGIGAAATVGLIGYKGNSHVRWDKVCNVFNKFC  154



>gb|KDO87387.1| hypothetical protein CISIN_1g036940mg [Citrus sinensis]
Length=199

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 89/117 (76%), Gaps = 4/117 (3%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLT-SVGK  380
            G+DK+T++++  +  T+P++ + VTA+W++MSAFVYF+V NAIA  YA +SL  T ++ +
Sbjct  53   GVDKETQIISFTLAETMPSVQVSVTAKWQFMSAFVYFLVSNAIASSYAALSLAFTLAITR  112

Query  381  GQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFC  551
               +   A+L +I+LDL+ + LLFS+ GAA A+G++G KGNSHV WNKVCNVFG FC
Sbjct  113  FHNN---AALGLIMLDLITMGLLFSANGAAMAIGMIGLKGNSHVHWNKVCNVFGGFC  166



>ref|XP_010666393.1| PREDICTED: CASP-like protein 1E1 [Beta vulgaris subsp. vulgaris]
Length=193

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DKQTK+V ++I   LPA N+PVTA+  Y+SAFVYFVV N+IAC +A +SL L  + KG
Sbjct  47   GIDKQTKIVPIKISTDLPAFNVPVTAKSSYVSAFVYFVVANSIACAFAALSLALAFMRKG  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +  L++IV+DL+M+ALLFS  GA  AVGL+G+KGNSH+ WNKVCNV+G+FC QV 
Sbjct  107  GGKG-IIRLIIIVVDLMMIALLFSGIGATGAVGLIGFKGNSHLMWNKVCNVYGKFCHQVM  165

Query  564  G  566
            G
Sbjct  166  G  166



>ref|XP_008804584.1| PREDICTED: CASP-like protein 6 [Phoenix dactylifera]
Length=199

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 101/151 (67%), Gaps = 2/151 (1%)
 Frame = +3

Query  99   QVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIPVT  278
            QVKE  V   + +R  +  LRL+A A TL AA V+G  +QTK V +Q+ PTLP + + V 
Sbjct  18   QVKEDGVGTPRTVRICDAVLRLVALAATLIAAAVIGTARQTKTVNIQVSPTLPPLPLTVA  77

Query  279  AEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSS  458
            A+  Y SAFVYF++ N IAC Y+ +SL  ++V +  KS+   SL +I  D+ MVALLFS 
Sbjct  78   AKTAYSSAFVYFLIANVIACVYSAISLATSTVKRDSKSNIGLSLSII--DIAMVALLFSG  135

Query  459  GGAAFAVGLLGYKGNSHVRWNKVCNVFGRFC  551
             GAA   GLLG  GNSHV+W KVCNVFG+FC
Sbjct  136  NGAALTFGLLGKHGNSHVQWQKVCNVFGKFC  166



>ref|XP_003593986.1| hypothetical protein MTR_2g020060 [Medicago truncatula]
 gb|AES64237.1| plant integral membrane protein [Medicago truncatula]
 gb|AFK33390.1| unknown [Medicago truncatula]
Length=189

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
            DKQT VV ++I  +LP +++PVTA+W+Y+SA+VYFVV N IA  YA +S V+ ++  G K
Sbjct  45   DKQTTVVPVKISDSLPPLDVPVTAKWQYVSAYVYFVVANFIAFAYATLSFVI-ALANGHK  103

Query  390  SSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            S ++   +V +LD +MVALLFS  GAA+A+G+L  KGNSHV WNKVC+VF +FC Q   
Sbjct  104  S-KLLVTLVTLLDAIMVALLFSGNGAAWAIGVLAEKGNSHVMWNKVCHVFDKFCNQAAA  161



>ref|XP_007225861.1| hypothetical protein PRUPE_ppa011729mg [Prunus persica]
 gb|EMJ27060.1| hypothetical protein PRUPE_ppa011729mg [Prunus persica]
Length=199

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 96/118 (81%), Gaps = 2/118 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQT++V+++IIPTLP +++P TA+W Y+SAFVYFVV NAIAC YA  SLVL+   +G
Sbjct  53   GVSKQTEIVSVKIIPTLPPIDLPATAKWHYLSAFVYFVVANAIACAYAAFSLVLSFANRG  112

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
             KSS    LV+I+LDL+MVALLFS  GAA A+GL+GY+GNSHV+W KVCNVFGRFC  
Sbjct  113  TKSS--LGLVIILLDLLMVALLFSCNGAATAIGLMGYQGNSHVQWKKVCNVFGRFCNH  168



>ref|XP_010904767.1| PREDICTED: CASP-like protein 1E1 [Elaeis guineensis]
Length=197

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 84/119 (71%), Gaps = 2/119 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTK V++Q+ PT P + + V A+  Y SAFVYF++ N IAC Y+ +SL  ++V + 
Sbjct  51   GVAKQTKTVSIQVSPTDPPVPVTVVAKTAYASAFVYFLIANVIACVYSAISLATSTVKRA  110

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
             KS+    L++ ++D+ MVALLFS  GAA   GLLG +GNSH++W KVCNVFG+FC  V
Sbjct  111  SKSN--LPLLLSIIDIAMVALLFSGNGAATTFGLLGVRGNSHLQWKKVCNVFGKFCLDV  167



>ref|XP_008799284.1| PREDICTED: CASP-like protein VIT_05s0020g01820 [Phoenix dactylifera]
Length=199

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTK V++Q+ PT P+M +PV A+  Y SAFVYF+V N IAC Y+ +SL +++  + 
Sbjct  53   GVAKQTKTVSIQLSPTGPSMPVPVVAKTAYSSAFVYFLVANVIACVYSAISLAISTAKRA  112

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFC  551
             +S+    L+  ++D+ MVALLFS  GAA   GLLG  GNSH++W KVCNVF +FC
Sbjct  113  SRSN--LPLLFSIVDIAMVALLFSGNGAAMTFGLLGAHGNSHLQWKKVCNVFEKFC  166



>ref|XP_006419657.1| hypothetical protein CICLE_v10005989mg [Citrus clementina]
 ref|XP_006489145.1| PREDICTED: CASP-like protein VIT_05s0020g01820-like isoform X1 
[Citrus sinensis]
 ref|XP_006489146.1| PREDICTED: CASP-like protein VIT_05s0020g01820-like isoform X2 
[Citrus sinensis]
 gb|ESR32897.1| hypothetical protein CICLE_v10005989mg [Citrus clementina]
Length=187

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQ KVV ++IIPTLP +N+ VTA+W+Y SAFV+ VV NAIAC YA +SL+L    K 
Sbjct  41   GVGKQNKVVPLKIIPTLPPVNVAVTAKWQYSSAFVFNVVSNAIACSYAAISLLLLLADK-  99

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
               ++  ++++++LDL MVALLFS+ GAA AVGL+GY+GNSHV+W KVC+VFG FC  V
Sbjct  100  -NGNKGLAMLILLLDLAMVALLFSANGAAGAVGLVGYQGNSHVQWRKVCDVFGEFCSHV  157



>gb|KDO75081.1| hypothetical protein CISIN_1g029843mg [Citrus sinensis]
Length=187

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 112/151 (74%), Gaps = 2/151 (1%)
 Frame = +3

Query  108  ELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIPVTAEW  287
            E+A   K+ + + +  LR+LA A TL AA+VLG+ KQT VV ++II TLP +N+ VTA+W
Sbjct  9    EVAGNYKRKLNYGDLSLRVLALALTLVAAIVLGVGKQTTVVPLKIIQTLPPVNVAVTAKW  68

Query  288  KYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGGA  467
            +Y SAFV+ VV NAIAC YA +SL+L    K    ++  ++++++LDL MVALLFS+ GA
Sbjct  69   QYSSAFVFNVVSNAIACSYAAISLLLVLADK--NGNKGLAMLILLLDLAMVALLFSANGA  126

Query  468  AFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            A AVGL+GY+GNSHV+W KVC+VFG FC  V
Sbjct  127  AGAVGLVGYQGNSHVQWRKVCDVFGEFCSHV  157



>gb|AIC33063.1| integral membrane family protein [Elaeis guineensis]
Length=197

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 83/119 (70%), Gaps = 2/119 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTK V++Q+ PT P + + V A+  Y SAFVYF++ N IAC Y+ +SL  ++V + 
Sbjct  51   GVAKQTKTVSIQVSPTDPPVPVTVVAKTAYASAFVYFLIANVIACVYSAISLATSTVKRA  110

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
             KS+    L++ ++D+ MVA LFS  GAA   GLLG +GNSH++W KVCNVFG+FC  V
Sbjct  111  SKSN--LPLLLSIIDIAMVAFLFSGNGAATTFGLLGVRGNSHLQWKKVCNVFGKFCLDV  167



>ref|XP_009791544.1| PREDICTED: CASP-like protein 1E2 [Nicotiana sylvestris]
 ref|XP_009791545.1| PREDICTED: CASP-like protein 1E2 [Nicotiana sylvestris]
Length=211

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 85/123 (69%), Gaps = 2/123 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G +K T+ VA+ ++  LP +++ +TA+W YMS+ VYFVVVNAIAC YA  S+   ++  G
Sbjct  58   GTNKDTQDVAITLVDGLPPLHLTLTAKWNYMSSTVYFVVVNAIACAYAATSMAFPALNMG  117

Query  384  --QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
              +++   +S++VI LDL MVALLFS+ GA+ A+G++   GNSH  W+KVC  F R+C Q
Sbjct  118  GSRRNWACSSMLVIALDLTMVALLFSANGASAAIGVIALNGNSHTHWHKVCYAFKRYCIQ  177

Query  558  VGG  566
             G 
Sbjct  178  GGA  180



>gb|KCW58540.1| hypothetical protein EUGRSUZ_H01205 [Eucalyptus grandis]
Length=207

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 86/121 (71%), Gaps = 2/121 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DK++K V++ I  +L  +++  TA+W+YMSAFVYF+V NA+AC YA  SLV  +V   
Sbjct  51   GVDKESKTVSVTISQSL-TLHVRATAKWQYMSAFVYFLVSNAVACSYAAASLVYVTVSGA  109

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
             +S++ A+L + VLD VM+ LL S+ GA+ A+G++   GNSHV+WNKVC+ F  +C Q+ 
Sbjct  110  ARSAK-ATLAINVLDTVMMGLLLSASGASAAIGVIAQHGNSHVQWNKVCHAFSSYCHQMA  168

Query  564  G  566
             
Sbjct  169  A  169



>ref|XP_010326606.1| PREDICTED: CASP-like protein 1E1 [Solanum lycopersicum]
Length=197

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G +K T+ VA+ ++  LP +++ +TA+W YMS+ VYFV VNAIAC YA +S+   S+  G
Sbjct  50   GSNKDTESVAISLVDGLPPLHLTLTAKWSYMSSTVYFVAVNAIACAYAAISMAFISLTGG  109

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            + S    S++V+ LDL MVALLFS+ GA+ ++GL+   GNSH +W+KVC  F R+C Q G
Sbjct  110  RNSK--GSILVVGLDLAMVALLFSANGASASIGLIALNGNSHTQWHKVCYAFKRYCIQGG  167



>ref|XP_004136057.1| PREDICTED: CASP-like protein VIT_07s0104g01350-like [Cucumis 
sativus]
 ref|XP_004160534.1| PREDICTED: CASP-like protein VIT_07s0104g01350-like [Cucumis 
sativus]
 gb|KGN44880.1| hypothetical protein Csa_7G394000 [Cucumis sativus]
Length=211

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
             +D ++K++++ +   LP ++   +A+W+YMSAF YFVV N IACGYA VSLV +   KG
Sbjct  65   AVDNESKIISVTLTKALPPIHFYASAKWQYMSAFKYFVVSNCIACGYAAVSLVYSMTTKG  124

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
             K     S+++I LDL+MV LLFS+ GAA A+G++G  GNSH+ W KVC  F  +C  
Sbjct  125  YKDDPTRSMLLISLDLIMVGLLFSADGAAAAIGVIGRDGNSHMHWIKVCGFFEGYCHH  182



>gb|KDP28089.1| hypothetical protein JCGZ_13860 [Jatropha curcas]
Length=183

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 81/120 (68%), Gaps = 2/120 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DK+T +V + I+ TLP + +P+TA+W+Y+SAFVY +V N IAC YA  SL+ T V   
Sbjct  30   GIDKETAIVPVTIVETLPPLQVPLTAKWQYVSAFVYLLVSNTIACSYAAGSLIYTMVAAR  89

Query  384  QK--SSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
             K   +   +LV+I+LD+ +  LL S+ GAA  + ++G  GNSH+ W KVC+V+  FC Q
Sbjct  90   SKKMDNGTGTLVIIILDMAITGLLLSANGAAIGIAVIGRFGNSHLNWKKVCHVYSDFCHQ  149



>ref|XP_010941794.1| PREDICTED: CASP-like protein 1E2 [Elaeis guineensis]
Length=199

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G  KQ K V +Q+ PTLP + +   A+  Y SAFVYF++ N IAC YA +SL  +++ + 
Sbjct  53   GTAKQVKTVNIQVAPTLPPLPVSAVAKTSYASAFVYFLIANVIACVYAAISLGTSTMKRA  112

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
             KS    SL +I  D+ MVALLFS  GAA   GLLG  GNSHV+W KVCNVF +FC  V 
Sbjct  113  SKSKLRLSLSII--DIAMVALLFSGNGAALTFGLLGKYGNSHVKWQKVCNVFDKFCLHVA  170



>ref|XP_003554500.1| PREDICTED: CASP-like protein VIT_07s0104g01350-like [Glycine 
max]
Length=196

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 85/121 (70%), Gaps = 8/121 (7%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGK-  380
            G+D +TKV+      +   M    TA+W+Y+SA V+F+V+NAIAC YA  SLV+T +G+ 
Sbjct  51   GVDNETKVI------SYAEMQFKATAKWEYVSAIVFFLVINAIACSYAAASLVITLMGRS  104

Query  381  -GQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
             G+K++ V  L +  LDLVM+ALLFS+ GAA AVG++  KGNSHV+W KVCNVF  +C  
Sbjct  105  SGRKNNDVTLLGLTALDLVMMALLFSANGAACAVGVIAQKGNSHVQWMKVCNVFDAYCRH  164

Query  558  V  560
            V
Sbjct  165  V  165



>ref|XP_004134188.1| PREDICTED: CASP-like protein 6-like [Cucumis sativus]
 ref|XP_004159823.1| PREDICTED: CASP-like protein 6-like [Cucumis sativus]
Length=189

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+ QTKVV + +    P ++    A+W Y+SAFVY +  N IAC Y+ +SL L    K 
Sbjct  43   GLNNQTKVVPLAVSLNSPPLDYTFIAKWHYLSAFVYLLATNIIACSYSFLSLFLLL--KN  100

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            +    +  L++IVLD VMVALLFS  GAA AVG++ Y+GN+HV+WNKVC+++GRFC QV 
Sbjct  101  KSKDNILGLLIIVLDTVMVALLFSGSGAAGAVGVIAYQGNTHVQWNKVCDIYGRFCKQVA  160

Query  564  G  566
             
Sbjct  161  A  161



>ref|XP_008451440.1| PREDICTED: CASP-like protein VIT_07s0104g01350 [Cucumis melo]
Length=211

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+D ++K++++ +   LP ++   +A+W+YMSAF YFVV N IAC YA VSLV +   +G
Sbjct  65   GVDNESKIISVTLTKALPPIHFYASAKWQYMSAFKYFVVSNCIACAYAAVSLVYSLTTRG  124

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
             K   + S+++I LDL+MV LLFS+ GAA A+G++G  GNSH+ W KVC  F  +C  
Sbjct  125  YKDDPMRSMLLISLDLIMVGLLFSADGAAAAIGVIGRDGNSHMHWIKVCGFFEGYCHH  182



>dbj|BAJ98797.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=200

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GLD+QT  V + I   LP + +PVTA+W Y SAFVYFVV NA+AC ++ V+L        
Sbjct  57   GLDRQTSTVQVTIADKLPPLQVPVTAKWSYSSAFVYFVVANAMACVFSAVALAACR----  112

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
               SR A   ++V DLV++ALLFS+ GAA   G+LG +GNSHVRW KVC+V+ +FCG+
Sbjct  113  ---SRSAVAPLMVGDLVVLALLFSAVGAAAEFGILGERGNSHVRWGKVCHVYSQFCGR  167



>gb|KGN57071.1| hypothetical protein Csa_3G151490 [Cucumis sativus]
Length=198

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+ QTKVV + +    P ++    A+W Y+SAFVY +  N IAC Y+ +SL L    K 
Sbjct  52   GLNNQTKVVPLAVSLNSPPLDYTFIAKWHYLSAFVYLLATNIIACSYSFLSLFLLL--KN  109

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            +    +  L++IVLD VMVALLFS  GAA AVG++ Y+GN+HV+WNKVC+++GRFC QV 
Sbjct  110  KSKDNILGLLIIVLDTVMVALLFSGSGAAGAVGVIAYQGNTHVQWNKVCDIYGRFCKQVA  169

Query  564  G  566
             
Sbjct  170  A  170



>ref|XP_009629411.1| PREDICTED: CASP-like protein 1E2 isoform X2 [Nicotiana tomentosiformis]
Length=215

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 84/122 (69%), Gaps = 2/122 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G +K T+ V + ++  LP +++ +TA+W YMS+ VYFVVVNAIAC YA  S+   ++  G
Sbjct  62   GTNKDTQDVPITLVDGLPPLHLTLTAKWNYMSSTVYFVVVNAIACAYAATSMAFPALNMG  121

Query  384  --QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
              +++   +S++VI LDL MVALLFS+ GA+ A+G++   GNSH  W+KVC  F R+C Q
Sbjct  122  GSRRNWTCSSMLVIALDLTMVALLFSANGASAAIGVIALNGNSHTHWHKVCYAFKRYCIQ  181

Query  558  VG  563
             G
Sbjct  182  GG  183



>gb|KFK24376.1| hypothetical protein AALP_AAs45452U000200 [Arabis alpina]
Length=187

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 86/118 (73%), Gaps = 3/118 (3%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTK+V++++IPTLP +++  TA+  Y+SAFVY +  NAIACGY  +S+V+  + KG
Sbjct  46   GVSKQTKIVSIKLIPTLPPLDVSTTAKSSYLSAFVYNMSTNAIACGYTAISIVILLMSKG  105

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            +++  +  L+  +   +MVAL FSS GAA A+GL+G +GN HV W KVC VFG+FC Q
Sbjct  106  RRNLLMLLLLGDL---LMVALQFSSTGAAGAIGLMGLQGNKHVMWKKVCGVFGKFCHQ  160



>ref|XP_008438805.1| PREDICTED: CASP-like protein 5 [Cucumis melo]
Length=203

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 2/121 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+ QTKVV + +    P ++    A+W Y+SAFVY +  N IAC Y+ VSL L      
Sbjct  57   GLNNQTKVVPLTVSLNTPPLDYTFIAKWHYLSAFVYLLATNIIACSYSFVSLFLLLKK--  114

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            +    +  L++IVLD VMVALLFS  GAA AVG++ Y+GNSHV+WNKVC+++GRFC QV 
Sbjct  115  KSKDNILGLLIIVLDTVMVALLFSGSGAAGAVGVIAYQGNSHVQWNKVCDIYGRFCKQVA  174

Query  564  G  566
             
Sbjct  175  A  175



>ref|XP_009629410.1| PREDICTED: CASP-like protein 1E2 isoform X1 [Nicotiana tomentosiformis]
Length=268

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 84/123 (68%), Gaps = 2/123 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G +K T+ V + ++  LP +++ +TA+W YMS+ VYFVVVNAIAC YA  S+   ++  G
Sbjct  115  GTNKDTQDVPITLVDGLPPLHLTLTAKWNYMSSTVYFVVVNAIACAYAATSMAFPALNMG  174

Query  384  --QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
              +++   +S++VI LDL MVALLFS+ GA+ A+G++   GNSH  W+KVC  F R+C Q
Sbjct  175  GSRRNWTCSSMLVIALDLTMVALLFSANGASAAIGVIALNGNSHTHWHKVCYAFKRYCIQ  234

Query  558  VGG  566
             G 
Sbjct  235  GGA  237



>gb|AFK37260.1| unknown [Medicago truncatula]
Length=191

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 85/119 (71%), Gaps = 7/119 (6%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G  K+TKV++        ++   VTA+W+YMSA V+F+V NAI C YA +S+V++++ + 
Sbjct  49   GFGKETKVISY------ASLQFKVTAKWEYMSAIVFFLVTNAIGCSYAAISMVVSTIAR-  101

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
               ++ A L++ +LDLV++ALLFS+ GAA AVG+LG KGNSHV+W KVCNVF  +C  +
Sbjct  102  TSGNKTALLIITLLDLVIMALLFSANGAAGAVGVLGQKGNSHVQWMKVCNVFDAYCRHM  160



>ref|XP_006359447.1| PREDICTED: CASP-like protein VIT_07s0104g01350-like [Solanum 
tuberosum]
Length=201

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTS-VGK  380
            G +K T+ VA+ ++  LP +++ +TA+W YMS+ VYFV VNA+AC YA +S+   + +G 
Sbjct  50   GSNKDTESVAISLVDGLPPLHLTLTAKWSYMSSTVYFVAVNAVACAYAAISMAFIALIGG  109

Query  381  GQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
             +  +   S++V+ LDL MVALLFS+ GA+ ++GL+   GNSH +W+KVC  F R+C Q 
Sbjct  110  SRGRNWKGSILVVALDLTMVALLFSANGASASIGLIALNGNSHTQWHKVCYAFKRYCIQG  169

Query  561  GG  566
            G 
Sbjct  170  GA  171



>ref|XP_003625864.1| hypothetical protein MTR_7g108130 [Medicago truncatula]
 gb|AES82082.1| plant integral membrane protein [Medicago truncatula]
Length=191

 Score =   116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 85/119 (71%), Gaps = 7/119 (6%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G  K+TKV++        ++   VTA+W+YMSA V+F+V NAI C YA +S+V++++ + 
Sbjct  49   GFGKETKVISY------ASLQFKVTAKWEYMSAIVFFLVTNAIGCSYAAISMVVSTIAR-  101

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
               ++ A L++ +LDLV++ALLFS+ GAA AVG+LG KGNSHV+W KVCNVF  +C  +
Sbjct  102  TSGNKTALLMITLLDLVIMALLFSANGAAGAVGVLGQKGNSHVQWMKVCNVFDAYCRHM  160



>ref|XP_003567679.1| PREDICTED: CASP-like protein 1E1 [Brachypodium distachyon]
Length=201

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+D+QT  V + I  TLP + +PVTA+  Y SAFVY VV NA+AC ++  SL        
Sbjct  58   GVDRQTTTVQVTIADTLPPLQVPVTAKSSYSSAFVYLVVANAMACVFSAASLAACR----  113

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
               SR A + V++ DLV++ALLFS+ GAA   G+LG +GNSHVRW KVC+V+GRFC +
Sbjct  114  ---SRSAVVPVMIGDLVVLALLFSAVGAAAEFGILGERGNSHVRWGKVCHVYGRFCER  168



>ref|XP_010245394.1| PREDICTED: CASP-like protein 1E1 [Nelumbo nucifera]
Length=190

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 15/166 (9%)
 Frame = +3

Query  78   GMEVG--GGQVKELAVAKKQN----MRWAEFGlrllafantlaaalvlGLDKQTKVVAMQ  239
            GMEV   GG+V      K +N    +R  EF LRLLAF  TL AA+V+G++K+TK+V   
Sbjct  3    GMEVAESGGKV-----VKAENPTTVIRLPEFLLRLLAFVTTLVAAIVMGVNKETKIVP--  55

Query  240  IIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI  419
             IP LP + + VTA+   +S  +YFVV NAIAC +   SL+L+ + K   ++  +  VVI
Sbjct  56   -IPDLPPLEVAVTAKSGLISTSIYFVVANAIACTHTAFSLLLSIIPKRVGTNGFSPAVVI  114

Query  420  VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
             LD++MV LL S  GAA A+G++ YKGNSH++WN+VC+VFG++C Q
Sbjct  115  -LDVIMVGLLLSGSGAASAIGVVAYKGNSHLKWNEVCSVFGKYCHQ  159



>ref|XP_010434939.1| PREDICTED: CASP-like protein 1E1 [Camelina sativa]
Length=191

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 88/119 (74%), Gaps = 1/119 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKVV ++++PTLP +++  TA+  Y+SAFVY + VNAIACGY  +S+V+  + KG
Sbjct  48   GVAKQTKVVPLKLLPTLPPLDVSTTAKASYLSAFVYNISVNAIACGYTAISIVIVMMSKG  107

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            ++S  +  + +++ DLVMVALLFS  GA+  +GL+G +GN HV W KVC VF +FC QV
Sbjct  108  RRSKGLL-MAILIGDLVMVALLFSGTGASGGIGLMGKQGNKHVMWKKVCGVFDKFCNQV  165



>ref|XP_003521533.1| PREDICTED: CASP-like protein VIT_07s0104g01350-like [Glycine 
max]
 gb|KHN28234.1| CASP-like protein [Glycine soja]
Length=193

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 81/120 (68%), Gaps = 7/120 (6%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+D +TKV+      +   M    TA+W+Y+SA V+F+V+NAIAC YA  SLV+T + + 
Sbjct  49   GVDNETKVI------SYAEMQFKATAKWEYVSAIVFFLVINAIACSYAAASLVITLMARS  102

Query  384  Q-KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
              + + V  L +  LDLVM+ALLFS+ GAA AVG++  KGNSHV+W KVCNVF  +C  V
Sbjct  103  NGRKNDVTLLGLTALDLVMMALLFSANGAACAVGVIAQKGNSHVQWMKVCNVFDAYCRHV  162



>ref|XP_010245385.1| PREDICTED: CASP-like protein 1E2 [Nelumbo nucifera]
Length=204

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 109/168 (65%), Gaps = 5/168 (3%)
 Frame = +3

Query  57   NIVL*ERGMEVGGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAM  236
            N V  + G+E GG   K   VA  + +R ++F LRLLA A TL AA V+G+ ++TKVV+ 
Sbjct  12   NTVEGKGGIESGG---KGTEVANPRGVRSSDFLLRLLALATTLVAATVMGVARETKVVSF  68

Query  237  QIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVV  416
             ++P L    I VTA+ +Y SA VYF+V NAIAC  A  +L L      Q  +   SL +
Sbjct  69   PLLPNLSPYKISVTAKSRYSSALVYFLVSNAIAC--AYAALSLLLSLAKQAGTDAFSLAI  126

Query  417  IVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            IVLD++MV LLFS  GAA A+G++GY+GNSH  W KVC+VFG +C QV
Sbjct  127  IVLDVMMVGLLFSGNGAAAAIGVVGYEGNSHANWQKVCDVFGTYCRQV  174



>ref|XP_007163061.1| hypothetical protein PHAVU_001G202900g [Phaseolus vulgaris]
 gb|ADV56684.1| nitrate, fromate, iron dehydrogenase [Phaseolus vulgaris]
 gb|ESW35055.1| hypothetical protein PHAVU_001G202900g [Phaseolus vulgaris]
Length=193

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 80/123 (65%), Gaps = 8/123 (7%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
             +D +TK++      +   M    TA+W+Y+SA V+FVV NAIAC YA  SLV+T + + 
Sbjct  48   AVDNETKLI------SYAEMQFKATAKWEYLSAMVFFVVSNAIACSYAAASLVITVMARN  101

Query  384  --QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
              ++ S V  LVV  LD+V++ALLFS+ GAA AVG++  KGN+H +W KVC+VF  +C  
Sbjct  102  SRRRKSDVTGLVVTALDVVLMALLFSANGAACAVGVIAQKGNTHAQWMKVCDVFDAYCRH  161

Query  558  VGG  566
            V  
Sbjct  162  VTA  164



>ref|XP_010241324.1| PREDICTED: CASP-like protein 1E1 [Nelumbo nucifera]
Length=199

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 105/158 (66%), Gaps = 0/158 (0%)
 Frame = +3

Query  93   GGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIP  272
            G +V+      + ++R ++F LRLLA   TL AA+++G+ ++TK+V   ++  +P   IP
Sbjct  13   GVEVEAKVANPRSSVRSSDFLLRLLAVVTTLVAAIIIGVARETKMVPFSLLSNVPPSYIP  72

Query  273  VTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLF  452
            +TA+  Y SAFV+F V NAIAC YA +SL+L    + + ++   +  +I LD++MV LLF
Sbjct  73   LTAKSHYSSAFVFFTVSNAIACAYAALSLLLLIAKRARGNAITLATTIISLDVIMVGLLF  132

Query  453  SSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            S  GAA A+GLLGY+GNSH  W KVCNVFG +C QV  
Sbjct  133  SGNGAAAAIGLLGYQGNSHANWQKVCNVFGTYCHQVAA  170



>ref|XP_004494327.1| PREDICTED: CASP-like protein VIT_07s0104g01350-like [Cicer arietinum]
Length=186

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 7/116 (6%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+ KQTKV+      +        TA+W+YMSA V+ +V NAI C YA +SLV++++ + 
Sbjct  45   GVGKQTKVI------SYADFQFKATAKWEYMSATVFLLVANAIGCSYAAISLVVSTMARS  98

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFC  551
               +++   ++ VLDL++VALLFS+ GAA AVG++G KGNSHV+W KVCNVF  +C
Sbjct  99   N-GNKMKLFMITVLDLIIVALLFSANGAASAVGVIGMKGNSHVQWMKVCNVFDAYC  153



>ref|XP_002457829.1| hypothetical protein SORBIDRAFT_03g014480 [Sorghum bicolor]
 sp|C5XKI6.1|CSPL6_SORBI RecName: Full=CASP-like protein 1E1; Short=SbCASPL1E1 [Sorghum 
bicolor]
 gb|EES02949.1| hypothetical protein SORBIDRAFT_03g014480 [Sorghum bicolor]
Length=222

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 79/118 (67%), Gaps = 7/118 (6%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+D+QT+ + + I   LP + +P+TA W Y SAFVYFVV NA+ C ++  +L        
Sbjct  79   GVDRQTRTIQITITDALPPLEVPLTANWSYSSAFVYFVVANAMVCLFSAAALAACR----  134

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
               SR A + V+V DL+ +ALL+S+ GAA   G+LG +GNSHVRW KVCNV+GRFC +
Sbjct  135  ---SRAAMVPVMVGDLLALALLYSAVGAAAEFGILGERGNSHVRWAKVCNVYGRFCDR  189



>ref|NP_001130820.1| CASP-like protein 1E1 [Zea mays]
 sp|B4FAP1.1|CSPL4_MAIZE RecName: Full=CASP-like protein 1E1; Short=ZmCASPL1E1 [Zea mays]
 gb|ACF79184.1| unknown [Zea mays]
 gb|ACG38784.1| plant integral membrane protein TIGR01569 containing protein 
[Zea mays]
 gb|ACL52969.1| unknown [Zea mays]
 tpg|DAA54557.1| TPA: membrane protein 5 [Zea mays]
Length=220

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+D+QT  + + +   LP + +P+TA W Y SAFVYFVV NA+ C ++  +L        
Sbjct  77   GVDRQTSTIRITVTDALPPLEVPLTANWSYSSAFVYFVVANAMVCLFSAAAL-------A  129

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
               SR A + V+V DL+ +ALL+S+ GAA   G+LG +GNSHVRW KVCNV+GRFC +
Sbjct  130  ACRSRAAMVPVMVGDLLALALLYSAVGAAAEFGILGERGNSHVRWPKVCNVYGRFCER  187



>ref|XP_004968732.1| PREDICTED: CASP-like protein Sb03g014480-like [Setaria italica]
Length=262

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+D+QT+ + + +  TLP + +PVTA+W Y SAFVYFVV NA+ C ++ ++L        
Sbjct  119  GVDRQTRTIQITLADTLPPLEVPVTAKWSYSSAFVYFVVANAMVCVFSALALATCR----  174

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
                R A + V+V DL+ +ALLFS+ GAA   G+LG +GNSHVRW KVCNV+G FC +
Sbjct  175  ---RRGAVVPVMVGDLLALALLFSAVGAAAEFGILGERGNSHVRWAKVCNVYGAFCER  229



>gb|ACG42009.1| plant integral membrane protein TIGR01569 containing protein 
[Zea mays]
Length=220

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+D+QT  + + +   LP + +P+TA W Y SAFVYFVV NA+ C ++  +L        
Sbjct  77   GVDRQTSTIRITVSDALPPLEVPLTANWSYSSAFVYFVVANAMVCLFSAAAL-------A  129

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
               SR A + V+V DL+ +ALL+S+ GAA   G+LG +GNSHVRW KVCNV+GRFC +
Sbjct  130  ACRSRAAMVPVMVGDLLALALLYSAVGAAAEFGILGERGNSHVRWPKVCNVYGRFCER  187



>emb|CBI32262.3| unnamed protein product [Vitis vinifera]
Length=134

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 65/90 (72%), Gaps = 3/90 (3%)
 Frame = +3

Query  294  MSAFVYFVVVNAIACGYAVVSLVL-TSVGKGQKSSRVASLVVIVLDLVMVALLFSSGGAA  470
            MSAFVY VV NAIAC YA +SLVL T +G+  K  RV  L VIVLDL MV LLFS+ GAA
Sbjct  1    MSAFVYLVVSNAIACSYAAISLVLVTMLGRRGKGGRV--LAVIVLDLHMVGLLFSANGAA  58

Query  471  FAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
             AVG+LG  GNSHV W KVCNVF  FC  +
Sbjct  59   TAVGVLGQYGNSHVEWKKVCNVFDSFCHHL  88



>ref|XP_004298101.1| PREDICTED: CASP-like protein 6-like [Fragaria vesca subsp. vesca]
Length=134

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +3

Query  309  YFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLL  488
            Y V  N IAC YA  SLVL+   +G K S +  + +IVLD++MV LLFS  GAA A+GL+
Sbjct  22   YLVAANIIACVYAAFSLVLSFANRGTKKSSL-EVFIIVLDMLMVGLLFSGIGAATAIGLI  80

Query  489  GYKGNSHVRWNKVCNVFGRFCGQV  560
            GY GNSHV+W+KVC VFGRFC QV
Sbjct  81   GYNGNSHVKWDKVCYVFGRFCHQV  104



>ref|XP_009393233.1| PREDICTED: CASP-like protein 5 [Musa acuminata subsp. malaccensis]
Length=197

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 81/115 (70%), Gaps = 2/115 (2%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKS  392
             +T+ V++++ PTLP + +PVTA+  Y SAFVYF+V NAIA  Y+  SL +  + +  +S
Sbjct  53   SETQTVSIEVAPTLPPLPVPVTAKASYSSAFVYFIVANAIAFAYSAWSLAVVVLKR--RS  110

Query  393  SRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            +R + L + +LD VMV LLFS  GAA A G+LG  GNSHV W KVCNVFGRFC Q
Sbjct  111  TRGSILPISILDAVMVGLLFSGNGAAAAFGVLGKYGNSHVGWTKVCNVFGRFCAQ  165



>gb|EPS67385.1| hypothetical protein M569_07390, partial [Genlisea aurea]
Length=113

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = +3

Query  303  FVYFVVVNAIACGYAVVSLVLT-SVGKGQKSSRVASLVVIVLDLVMVALLFSSGGAAFAV  479
            F YFVV+NAIA GYA +SLVLT S G  +K++   +++V + D+V    L ++ GAA A+
Sbjct  1    FRYFVVINAIATGYAAISLVLTLSNGWEKKTAAAVAVLVEIADVVAALFLSTAVGAAGAI  60

Query  480  GLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            GL+GY+GNSHV+W KVCNVFG+FCGQ
Sbjct  61   GLMGYQGNSHVQWKKVCNVFGKFCGQ  86



>gb|KHG07086.1| CASP-like protein [Gossypium arboreum]
Length=134

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
            DK+TK + + I  TLP +++PVTA+W YMSAFVYF V NAIA  YA  SLV +   +  K
Sbjct  42   DKETKTIPISITKTLPTLHVPVTAKWHYMSAFVYFFVSNAIAFSYAAASLVASMAVRTSK  101

Query  390  SSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLG  491
                  LVV++LD+ ++ LL S+ GAA AVG+LG
Sbjct  102  DK--TGLVVVILDMAIMGLLLSANGAAIAVGILG  133



>ref|XP_008458486.1| PREDICTED: CASP-like protein RCOM_0680180 isoform X2 [Cucumis 
melo]
Length=166

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 74/118 (63%), Gaps = 29/118 (25%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+DKQTK V +Q+  +LP +++PVTA W Y+S+FV F+                      
Sbjct  47   GVDKQTKTVPLQLAASLPPLHVPVTARWHYLSSFVGFI----------------------  84

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
                R A   +IV+D++ VALLFS  GAA AVG +G++GNSH+ WNK+CNVFGRFCGQ
Sbjct  85   ----RSA---IIVMDILTVALLFSGFGAAAAVGAIGWRGNSHLNWNKMCNVFGRFCGQ  135



>sp|A9P0A6.1|CSPL5_PICSI RecName: Full=CASP-like protein 1U1; Short=PsCASPL1U1 [Picea 
sitchensis]
 gb|ABK26317.1| unknown [Picea sitchensis]
Length=201

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 78/121 (64%), Gaps = 10/121 (8%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G +KQT +        LP +  P++A+++Y  AFV+FV+ NA+ACGY ++SL+ +  GK 
Sbjct  60   GTNKQTAI--------LPIVG-PLSAKYQYSPAFVFFVIANAVACGYTLLSLIFSITGKF  110

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
              S+ ++  ++ V DLVMVAL+ +   AA A+  +GYKGNSH +W KVC ++ RFC    
Sbjct  111  T-STPLSVFLLSVTDLVMVALVSAGVSAAAAIAYVGYKGNSHTQWGKVCGIYDRFCHHGA  169

Query  564  G  566
            G
Sbjct  170  G  170



>ref|XP_010026145.1| PREDICTED: CASP-like protein 1E1 [Eucalyptus grandis]
Length=136

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +3

Query  306  VYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGL  485
            +YF+V NA+AC YA  SLV  +V    +S++ A+L + VLD VM+ LL S+ GA+ A+G+
Sbjct  21   LYFLVSNAVACSYAAASLVYVTVSGAARSAK-ATLAINVLDTVMMGLLLSASGASAAIGV  79

Query  486  LGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +   GNSHV+WNKVC+ F  +C Q+  
Sbjct  80   IAQHGNSHVQWNKVCHAFSSYCHQMAA  106



>ref|NP_001043031.1| Os01g0363300 [Oryza sativa Japonica Group]
 sp|Q9ARX2.1|CSPL8_ORYSJ RecName: Full=CASP-like protein 1E1; Short=OsCASPL1E1 [Oryza 
sativa Japonica Group]
 dbj|BAB40002.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB61250.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04945.1| Os01g0363300 [Oryza sativa Japonica Group]
 dbj|BAG87420.1| unnamed protein product [Oryza sativa Japonica Group]
Length=215

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 71/119 (60%), Gaps = 12/119 (10%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTL-PAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQ  386
            D+Q+  V +     L P + +PVTA+W Y SAFVYFVV NA         +V        
Sbjct  73   DRQSTTVQIAAGEELAPPLRVPVTAKWTYSSAFVYFVVANA---------MVFAFSAAAL  123

Query  387  KSSRVASLVVIVL--DLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
             + R  S VV V+  DLV +ALLFS+ GAA   GLLG +GN+HVRW KVC+V+G FC +
Sbjct  124  AAVRRRSAVVPVMVGDLVAMALLFSAVGAAAQFGLLGERGNAHVRWAKVCDVYGPFCER  182



>sp|B8A7Z5.1|CSPLB_ORYSI RecName: Full=CASP-like protein 1E1; Short=OsCASPL1E1 [Oryza 
sativa Indica Group]
 gb|EEC70640.1| hypothetical protein OsI_01913 [Oryza sativa Indica Group]
Length=215

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 71/119 (60%), Gaps = 12/119 (10%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTL-PAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQ  386
            D+Q+  V +     L P + +PVTA+W Y SAFVYFVV NA         +V        
Sbjct  73   DRQSTTVQIAAGEQLAPPLRVPVTAKWTYSSAFVYFVVANA---------MVFAFSAAAL  123

Query  387  KSSRVASLVVIVL--DLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
             + R  S VV V+  DLV +ALLFS+ GAA   GLLG +GN+HVRW KVC+V+G FC +
Sbjct  124  AAVRRRSAVVPVMVGDLVAMALLFSAVGAAAQFGLLGERGNAHVRWAKVCDVYGPFCER  182



>sp|Q1EPG6.2|CSPL2_MUSAC RecName: Full=CASP-like protein 1D1; Short=MaCASPL1D1 [Musa acuminata]
Length=191

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
             KQT+ +   + P  PA  I   A++++  AF+Y +V  ++ C Y+++++V +       
Sbjct  45   SKQTESIPTSLPPPFPAF-ISRDAKFQHSPAFIYLLVALSVTCFYSIITMVASFAAITSP  103

Query  390  SSRVASLVVIVL-DLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            SS    L  +VL D VM  ++ S+ G A +V  LG KGNSHV WNKVCNV+ +FC  VG
Sbjct  104  SSSPRMLFHLVLSDAVMAGVMASAAGTAGSVAYLGLKGNSHVNWNKVCNVYDKFCRHVG  162



>ref|XP_004173447.1| PREDICTED: CASP-like protein 6-like, partial [Cucumis sativus]
Length=113

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 1/83 (1%)
 Frame = +3

Query  309  YFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLL  488
            YFVV NAIAC YA  SLVL+ + KG+    + S  +IV+D++ VALLFS  GAA AVG +
Sbjct  1    YFVVANAIACSYAAFSLVLSLLNKGKSRGFMRS-AIIVMDILTVALLFSGFGAAAAVGAI  59

Query  489  GYKGNSHVRWNKVCNVFGRFCGQ  557
            G +GNSH+ WNK+CNVFGRFCGQ
Sbjct  60   GRQGNSHLNWNKICNVFGRFCGQ  82



>ref|XP_011096730.1| PREDICTED: CASP-like protein 1B2 [Sesamum indicum]
Length=205

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 1/120 (1%)
 Frame = +3

Query  207  LDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQ  386
            L+KQTK + +  I T+P +   +TA++++  AFV+FV+ N  A  + ++ LV+  +G   
Sbjct  47   LNKQTKTIVVATIGTVP-IRATLTAKFQHTPAFVFFVIANGNASLHNLLMLVVGFMGPKW  105

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
                +A L + VLDL+ VA++     AA  +G LG  GNSH RWNK+C+ F  FC Q GG
Sbjct  106  NFKGLAHLAIPVLDLMNVAIVSGGASAAAFMGQLGRDGNSHARWNKICDKFDSFCDQGGG  165



>ref|XP_009353886.1| PREDICTED: CASP-like protein POPTRDRAFT_823125 [Pyrus x bretschneideri]
Length=192

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 73/122 (60%), Gaps = 2/122 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
             ++K+TK + +  + T P +++ +TA++ +  A VYFV+ N IA  + +  + +   G  
Sbjct  45   AINKETKSIVVATVGTTP-LSVTLTAKFHHTPANVYFVIANGIASFHNLFMMAVHFFGDH  103

Query  384  QKSSRVASLVVI-VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
                +   LV++ +LD++ VALL S  GAA  +  LG KGNSH RWNK+C+ F +FC   
Sbjct  104  TFKDKGLQLVIVAILDMMNVALLSSGDGAATFMAQLGKKGNSHARWNKICDKFEKFCDHA  163

Query  561  GG  566
            GG
Sbjct  164  GG  165



>gb|KHN43548.1| CASP-like protein [Glycine soja]
Length=182

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 69/119 (58%), Gaps = 18/119 (15%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G+D +TKV+      +   M    TA+W+Y+SA V  +       GY +          G
Sbjct  51   GVDNETKVI------SYAEMQFKATAKWEYVSAIVCII-------GYHI-----DGRSSG  92

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            +K++ V  L +  LDLVM+ALLFS+ GAA AVG++  KGNSHV+W KVCNVF  +C  V
Sbjct  93   RKNNDVTLLGLTALDLVMMALLFSANGAACAVGVIAQKGNSHVQWMKVCNVFDAYCRHV  151



>ref|XP_006664182.1| PREDICTED: CASP-like protein Os12g0610800-like [Oryza brachyantha]
Length=195

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 5/120 (4%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+KQ+    + I+ T P      TA++K   AFV+FV+ NAI  GY +V +V+  + + 
Sbjct  48   GLNKQSYTTVVAIVGTKPVTQT-FTAQFKDTPAFVFFVIANAIVSGYNLVVMVMRRLMQ-  105

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                R  SL+V +LD+V++ LL +    A ++  LG  GN H RWN +C+ FG FC + G
Sbjct  106  ---RRAQSLIVHLLDMVILTLLATGSATAASMAQLGKNGNLHARWNPICDKFGSFCNRGG  162



>ref|XP_008351606.1| PREDICTED: CASP-like protein POPTRDRAFT_823125 [Malus domestica]
Length=187

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = +3

Query  255  PAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLV  434
            P +++ +TA++++  A VYFV+ N IA  + V  +V+   G   K   +  ++V VLD++
Sbjct  57   PPISVTLTAKFQHNPANVYFVIANGIASLHNVFMIVVHFFGDKFKDKGLQLVMVAVLDMM  116

Query  435  MVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +VAL+ S  GAA  +  LG KGNSH RWNK+C+ F ++C + GG
Sbjct  117  IVALVSSGDGAATFMAELGKKGNSHARWNKICDKFEKYCDRAGG  160



>ref|XP_006836401.1| hypothetical protein AMTR_s00092p00142720 [Amborella trichopoda]
 gb|ERM99254.1| hypothetical protein AMTR_s00092p00142720 [Amborella trichopoda]
Length=205

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 73/126 (58%), Gaps = 9/126 (7%)
 Frame = +3

Query  207  LDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLV------LT  368
            L+KQT  V   ++   P +   VTA++    AFV+FVV NAIAC Y++V L+      + 
Sbjct  48   LNKQTSPVT--VVYNAPVLRF-VTAKFYQTHAFVFFVVANAIACLYSLVMLLVCLADLIR  104

Query  369  SVGKGQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRF  548
             +G     S+V  L+VIVLDLVMVAL+ +   AA +V  LG  GN H  W+K+C+ F  +
Sbjct  105  LLGNNSYVSKVHGLLVIVLDLVMVALVTAGASAATSVAELGKNGNKHANWSKICDKFETY  164

Query  549  CGQVGG  566
            C    G
Sbjct  165  CDHGAG  170



>ref|XP_003630011.1| hypothetical protein MTR_8g089300 [Medicago truncatula]
 gb|AET04487.1| CASP POPTRDRAFT-like protein [Medicago truncatula]
Length=194

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 91/165 (55%), Gaps = 5/165 (3%)
 Frame = +3

Query  72   ERGMEVGGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPT  251
            E  +E G   V E     K    W    LR++AF   ++A LV+ L+KQTK   +  I +
Sbjct  6    EEKIESGFNDVPE----TKPKKDWILLSLRVVAFLAAVSATLVMSLNKQTKTFVVATIGS  61

Query  252  LPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDL  431
             P + +P+TA++++  AFVYFVV N I   + +V + +  +G    +  +   ++ V D 
Sbjct  62   TP-ITVPLTAKFQHTPAFVYFVVPNGIVSLHNLVMIAMYILGPKFHNKGLQLALIAVFDT  120

Query  432  VMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            + +AL  S  GAA A+  LG  GNSH +WNK+C+ F  +C + GG
Sbjct  121  MALALASSGDGAATAMSELGRNGNSHAKWNKICDKFESYCNRGGG  165



>sp|A2ZMM4.1|CSPL5_ORYSI RecName: Full=CASP-like protein 1B1; Short=OsCASPL1B1 [Oryza 
sativa Indica Group]
 gb|EAY83858.1| hypothetical protein OsI_39078 [Oryza sativa Indica Group]
Length=195

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 68/120 (57%), Gaps = 5/120 (4%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+KQ+    + I+ T P      TA++K   AFV+FV+ NAIA GY ++ LV   + + 
Sbjct  48   GLNKQSYTTVVAIVGTRPVTQT-FTAKFKDTPAFVFFVIANAIASGYNLMVLVTRRILQ-  105

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                R  SL V +LD+V++ LL +    A ++  LG  GN H RWN +C+ FG FC   G
Sbjct  106  ---RRAQSLSVHLLDMVILTLLATGSATAASMAQLGKNGNLHARWNPICDKFGSFCNHGG  162



>ref|XP_009399245.1| PREDICTED: CASP-like protein MA4_106O17.52 [Musa acuminata subsp. 
malaccensis]
Length=191

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 2/120 (2%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
             KQT+ +   + P  PA  I   A++++  AF+Y +V  ++ C Y+++++V +       
Sbjct  45   SKQTESIPTSLPPPFPAF-ISRDAKFQHSPAFIYLLVALSVTCFYSIITMVASFAAISSP  103

Query  390  SSRVASLVVIVL-DLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            SS    L  +VL D VM  ++ S+ G A +V  LG KGNSHV WNKVCNV+ +FC  VG 
Sbjct  104  SSSPRMLFHLVLSDAVMAGVMASAAGTAGSVAYLGLKGNSHVNWNKVCNVYDKFCRHVGS  163



>ref|NP_001067249.1| Os12g0610800 [Oryza sativa Japonica Group]
 sp|Q0ILZ7.1|CSPL6_ORYSJ RecName: Full=CASP-like protein 1B1; Short=OsCASPL1B1 [Oryza 
sativa Japonica Group]
 sp|B8BMY7.1|CSPL6_ORYSI RecName: Full=CASP-like protein 1B2; Short=OsCASPL1B2 [Oryza 
sativa Indica Group]
 dbj|BAF30268.1| Os12g0610800 [Oryza sativa Japonica Group]
 gb|EEC69658.1| hypothetical protein OsI_39071 [Oryza sativa Indica Group]
Length=195

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 68/120 (57%), Gaps = 5/120 (4%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+KQ+    + I+ T P      TA++K   AFV+FV+ NAIA GY ++ LV   + + 
Sbjct  48   GLNKQSYTTVVAIVGTRPVTQT-FTAKFKDTPAFVFFVIANAIASGYNLMVLVTRRILQ-  105

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                R  SL V +LD+V++ LL +    A ++  LG  GN H RWN +C+ FG FC   G
Sbjct  106  ---RRAQSLSVHLLDMVILTLLATGSATAASMAQLGKNGNLHARWNPICDKFGSFCNHGG  162



>ref|XP_007035489.1| CASP-like protein RCOM_0679870, putative [Theobroma cacao]
 gb|EOY06415.1| CASP-like protein RCOM_0679870, putative [Theobroma cacao]
Length=196

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 71/119 (60%), Gaps = 4/119 (3%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVS-LVLTSVGKGQK  389
            KQT+VV +   PT+P + +P+ A++ +  A +YFV   ++   Y++++ L   SV     
Sbjct  52   KQTEVVPL---PTMPTVRLPLPAKFSHSPALIYFVAALSVTGLYSIITTLASISVALTPA  108

Query  390  SSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             S+   LV   LD+V V ++ S+ GAA  V  +G KGN+HV WNK+CN + +FC  VG 
Sbjct  109  YSKSFLLVFAFLDVVFVGIVASATGAAGGVAYIGLKGNNHVGWNKICNAYDKFCRHVGS  167



>gb|EPS74593.1| hypothetical protein M569_00163 [Genlisea aurea]
Length=200

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
            D++T+ V + + P LP +   VTA+++  S+ VYF+V N +A    V SL+++ V +G +
Sbjct  56   DQETEDVFVTLGPGLPGITAEVTAQFQASSSLVYFLVANGVAFVVTVFSLIVSIVNRGLR  115

Query  390  SSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
                 +L+ + LD V++A+LF+S GA   VGL+ Y G     W ++CNVF  FC Q
Sbjct  116  GG--LTLLNLSLDAVVLAVLFASLGAVVDVGLIAYNGLKAAEWERICNVFDEFCNQ  169



>ref|XP_008383356.1| PREDICTED: CASP-like protein POPTRDRAFT_823125 [Malus domestica]
 ref|XP_008349139.1| PREDICTED: CASP-like protein POPTRDRAFT_823125 [Malus domestica]
Length=192

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 74/122 (61%), Gaps = 2/122 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
             ++K+TK + +  + T P +++ +TA++++  A VYFV+ N IA  + +  + +   G  
Sbjct  45   AMNKETKSIVVATVGTTP-ISVTLTAKFQHTPANVYFVIANGIASFHNLFMMAVHFFGDH  103

Query  384  QKSSRVASLVVI-VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
                +   LV++ +LD+++VALL S  GAA  +  LG KGNSH  WNK+C+ F +FC   
Sbjct  104  TFKDKGLQLVMVAILDVMIVALLSSGDGAATFMAQLGKKGNSHAMWNKICDKFEKFCDHA  163

Query  561  GG  566
            GG
Sbjct  164  GG  165



>gb|EEE53590.1| hypothetical protein OsJ_36834 [Oryza sativa Japonica Group]
Length=255

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 68/120 (57%), Gaps = 5/120 (4%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+KQ+    + I+ T P      TA++K   AFV+FV+ NAIA GY ++ LV   + + 
Sbjct  108  GLNKQSYTTVVAIVGTRPVTQT-FTAKFKDTPAFVFFVIANAIASGYNLMVLVTRRILQ-  165

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                R  SL V +LD+V++ LL +    A ++  LG  GN H RWN +C+ FG FC   G
Sbjct  166  ---RRAQSLSVHLLDMVILTLLATGSATAASMAQLGKNGNLHARWNPICDKFGSFCNHGG  222



>gb|ABA99368.1| plant integral membrane protein TIGR01569 containing protein, 
expressed [Oryza sativa Japonica Group]
Length=278

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 68/120 (57%), Gaps = 5/120 (4%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+KQ+    + I+ T P      TA++K   AFV+FV+ NAIA GY ++ LV   + + 
Sbjct  131  GLNKQSYTTVVAIVGTRPVTQT-FTAKFKDTPAFVFFVIANAIASGYNLMVLVTRRILQ-  188

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                R  SL V +LD+V++ LL +    A ++  LG  GN H RWN +C+ FG FC   G
Sbjct  189  ---RRAQSLSVHLLDMVILTLLATGSATAASMAQLGKNGNLHARWNPICDKFGSFCNHGG  245



>ref|XP_006855416.1| hypothetical protein AMTR_s00057p00159510 [Amborella trichopoda]
 gb|ERN16883.1| hypothetical protein AMTR_s00057p00159510 [Amborella trichopoda]
Length=184

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = +3

Query  255  PAMNIPVTAEWKY--MSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLD  428
            P +  P+T E K+    AF+YFVV NA+AC Y++ + V++ V K   S ++    +   D
Sbjct  50   PLLPFPITQEAKFNQSPAFIYFVVANAVACAYSIFTAVVSGVSKKSPSDKLL-FHLPFFD  108

Query  429  LVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             V   ++ S+ GA+ A+  +G KGNSH  W  +C VFG+FC  VGG
Sbjct  109  AVFAGIVGSATGASAAIAYVGLKGNSHAMWPAICPVFGKFCRYVGG  154



>ref|XP_007022941.1| CASP-like protein, putative [Theobroma cacao]
 gb|EOY25563.1| CASP-like protein, putative [Theobroma cacao]
Length=195

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 73/120 (61%), Gaps = 1/120 (1%)
 Frame = +3

Query  207  LDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQ  386
            L+KQTK   +  + T P +N+ +TA++++  AFV+FVV N +A  + ++ +++   G   
Sbjct  49   LNKQTKTFVIATVGTTP-VNLTLTAKFQHTPAFVFFVVANGLASIHNLLMVMVDLFGSKV  107

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
                +   ++ +LD++ VAL+     AA  +  LG  GNSH RW+K+C+ FGRFC + GG
Sbjct  108  DYKGLRFAMIAILDMLNVALVSGGANAAAFMAELGKNGNSHARWDKICDRFGRFCDRGGG  167



>ref|XP_003563200.1| PREDICTED: CASP-like protein 1D1 [Brachypodium distachyon]
Length=198

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 69/120 (58%), Gaps = 4/120 (3%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLV--LTSVGKGQ  386
            KQT +V++ + P  P    PV A++K   A +Y +V   + C Y+++S    L S+    
Sbjct  53   KQTAIVSVVLTP--PFRLAPVAAQFKDSPALIYLLVALCVTCLYSLLSAACSLKSISMSS  110

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
              S     ++I+LD+   A++ S+ G A AV  +G KGNSH RWNK+CN++ +FC  VG 
Sbjct  111  VCSAKTLFLLILLDVFYAAIMASATGTAGAVAWVGLKGNSHTRWNKICNLYDKFCRHVGA  170



>gb|EPS73422.1| hypothetical protein M569_01338 [Genlisea aurea]
Length=189

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 69/116 (59%), Gaps = 2/116 (2%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
            D++T+ V + +   LP     VT +++  S+ +YF+V NA A    V +L+++   +G +
Sbjct  45   DQETEAVFLALGKGLPGFTADVTVQFQESSSLIYFLVANATAFVVTVATLIVSIANRGLR  104

Query  390  SSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
                 +L+ + LD V++A+LF+S GAA  VGL+ Y G    RW K+C+ F RFC Q
Sbjct  105  GG--LTLLNLSLDAVLLAVLFASLGAAVDVGLIAYNGLEAARWEKICHAFQRFCNQ  158



>sp|Q1EPG7.1|CSPL1_MUSAC RecName: Full=CASP-like protein 1E1; Short=MaCASPL1E1 [Musa acuminata]
 gb|ABF69990.1| hypothetical protein MA4_106O17.50 [Musa acuminata]
Length=201

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 72/122 (59%), Gaps = 3/122 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G  +QT  V      T    +I VT +  Y +A+VYFVV N +   Y+VVSLVL+ V K 
Sbjct  55   GAARQTTTVTGIDAETALLTSITVTVKSTYSAAYVYFVVANVLVFFYSVVSLVLSMVNKA  114

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVR-WNKVCNVFGRFCGQV  560
            + +S   SL   + DL+MV LLFSS GAA A+ ++  KG  ++  W+K+CN+FG  C +V
Sbjct  115  RLTSM--SLPFSIADLLMVVLLFSSNGAAAAISVVAEKGQQNLAGWDKICNLFGGLCARV  172

Query  561  GG  566
              
Sbjct  173  NA  174



>ref|XP_009362157.1| PREDICTED: CASP-like protein 9 [Pyrus x bretschneideri]
Length=185

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = +3

Query  255  PAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLV  434
            P +++ +TA++++  A VYFV+ N IA  + V  +V+   G   K   +  ++V VLD++
Sbjct  55   PPISVTLTAKFQHNPANVYFVIANGIASLHNVFMIVVHFFGDKFKDKGLQLVMVAVLDMM  114

Query  435  MVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +VAL+ S  GAA  +  LG KGNSH RW+K+C+ F ++C + GG
Sbjct  115  IVALVSSGDGAATFMAELGKKGNSHARWDKICDKFEKYCDRGGG  158



>gb|KDP34883.1| hypothetical protein JCGZ_09171 [Jatropha curcas]
Length=203

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 70/121 (58%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+K+TK + +  + + P +   +TA+++   AFV+FV+ N IA  + +V +     GK 
Sbjct  46   GLNKETKTIVVATVGSTP-LTATLTAKFQDTPAFVFFVIANGIATIHNLVMIAADICGKR  104

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +   ++ +LD++ VAL+     AA  +  LG  GNSH RWNK+C+ FG+FC   G
Sbjct  105  LDYKGLRLAIIAILDMMTVALVAGGVNAAVYMAELGKNGNSHARWNKICDKFGKFCDHGG  164

Query  564  G  566
            G
Sbjct  165  G  165



>ref|XP_004293719.1| PREDICTED: CASP-like protein POPTRDRAFT_823125-like [Fragaria 
vesca subsp. vesca]
Length=189

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 73/120 (61%), Gaps = 1/120 (1%)
 Frame = +3

Query  207  LDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQ  386
            L+K+TK + +  + T   +   +TA++++  A VYFVV NA+A  + ++ +++   G   
Sbjct  44   LNKETKTLVVATVGT-TQVKATLTAKFQHNPANVYFVVANAMASFHNLLMIIVHLCGGKF  102

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            K   +  +++ +LD++ VAL  S  GAA  +  LG  GNSH RWNK+C+ FG+FC   GG
Sbjct  103  KDKGLRLVMMAILDMMTVALASSGDGAATFMAQLGKNGNSHARWNKICDKFGKFCDHGGG  162



>ref|XP_002870226.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7MAF7.1|CSPL6_ARALL RecName: Full=CASP-like protein 1D1; Short=AlCASPL1D1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH46485.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=194

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLT-SVGKGQ  386
             KQTK +    IP  P + IP  A++    A +YFVV  ++AC Y++VS  +T S  K  
Sbjct  52   SKQTKNI---FIPGTP-IRIPA-AKFTNSPALIYFVVALSVACFYSIVSTFVTVSAFKKH  106

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
              S +  L + ++D VMV ++ S+ GA   V  LG KGN  VRW K+CN++ +FC  VGG
Sbjct  107  SCSAILLLNLAIMDAVMVGIVASATGAGGGVAYLGLKGNKEVRWGKICNIYDKFCRHVGG  166



>gb|AAG40073.2|AF324722_1 AT4g15610 [Arabidopsis thaliana]
 emb|CAB10339.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78603.1| hypothetical protein [Arabidopsis thaliana]
Length=146

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLT-SVGKGQ  386
             KQTK +    +P  P + IP  AE+    A +YFVV  ++AC Y++VS  +T S  K  
Sbjct  4    SKQTKNI---FLPGTP-IRIP-AAEFTNSPALIYFVVALSVACFYSIVSTFVTVSAFKKH  58

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
              S V  L + ++D VMV ++ S+ GA   V  LG KGN  VRW K+C+++ +FC  VGG
Sbjct  59   SCSAVLLLNLAIMDAVMVGIVASATGAGGGVAYLGLKGNKEVRWGKICHIYDKFCRHVGG  118



>ref|NP_567472.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9FE29.1|CSPLM_ARATH RecName: Full=CASP-like protein 1D1; Short=AtCASPL1D1 [Arabidopsis 
thaliana]
 gb|AAG41466.1|AF326884_1 unknown protein [Arabidopsis thaliana]
 gb|AAM44986.1| unknown protein [Arabidopsis thaliana]
 gb|AAM63654.1| unknown [Arabidopsis thaliana]
 dbj|BAE98620.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83628.1| uncharacterized protein AT4G15610 [Arabidopsis thaliana]
Length=193

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLT-SVGKGQ  386
             KQTK +    +P  P + IP  AE+    A +YFVV  ++AC Y++VS  +T S  K  
Sbjct  51   SKQTKNI---FLPGTP-IRIPA-AEFTNSPALIYFVVALSVACFYSIVSTFVTVSAFKKH  105

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
              S V  L + ++D VMV ++ S+ GA   V  LG KGN  VRW K+C+++ +FC  VGG
Sbjct  106  SCSAVLLLNLAIMDAVMVGIVASATGAGGGVAYLGLKGNKEVRWGKICHIYDKFCRHVGG  165



>ref|XP_006645889.1| PREDICTED: CASP-like protein Os01g0363300-like [Oryza brachyantha]
Length=180

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 61/100 (61%), Gaps = 11/100 (11%)
 Frame = +3

Query  264  NIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVL--DLVM  437
             +PVTA+W Y SAFV  VV N         ++V         + R  S VV V+  DLV 
Sbjct  57   RVPVTAKWTYSSAFVCLVVAN---------TMVFAFCAAALAACRRRSAVVPVMVGDLVA  107

Query  438  VALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            +ALLFS+ GAA   GLLG +GN+HVRW KVC+V+GRFC +
Sbjct  108  LALLFSAVGAAAQFGLLGERGNAHVRWAKVCDVYGRFCER  147



>gb|KGN47206.1| hypothetical protein Csa_6G200310 [Cucumis sativus]
Length=114

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +3

Query  318  VVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYK  497
            + NAIAC YA  SLVL+ + K  KS       +IV+D++ VALLFS  GAA AVG +G +
Sbjct  5    MANAIACSYAAFSLVLSLLNK-DKSRGFMRSAIIVMDILTVALLFSGFGAAAAVGAIGRQ  63

Query  498  GNSHVRWNKVCNVFGRFCGQ  557
            GNSH+ WNK+CNVFGRFCGQ
Sbjct  64   GNSHLNWNKICNVFGRFCGQ  83



>ref|XP_008225695.1| PREDICTED: CASP-like protein POPTRDRAFT_823125 [Prunus mume]
Length=191

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
             L+K+TK + +  I T P +   +TA++++  A V+FV+ N +A  + +  +++   G  
Sbjct  45   ALNKETKSLVVATIGTTP-VRATLTAKFQHNPANVFFVIANGMASLHNLSMILVHFFGDK  103

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
             K   +  ++V +LD++ V+L  S  GAA  +  LG  GNSH RWNK+C+ F +FC Q G
Sbjct  104  FKDRALRLVMVAILDMMTVSLASSGDGAATFMAQLGKNGNSHARWNKICDKFHKFCDQGG  163

Query  564  G  566
            G
Sbjct  164  G  164



>gb|KDO75080.1| hypothetical protein CISIN_1g029779mg [Citrus sinensis]
Length=188

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 74/119 (62%), Gaps = 7/119 (6%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLV--LTSVGKGQ  386
            KQT++V+   IP    + + V A++    AF+YFV   ++AC Y++++++  L+ V K  
Sbjct  45   KQTELVSPAGIP----IRVSVKAKFTDSPAFIYFVAALSVACLYSIITMLASLSVVSKPA  100

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
             + R+  L     D+VM+ ++ S+ GA+  VG +G KGNSH RW K+CNV+ ++C  +G
Sbjct  101  SAKRLL-LYFAFWDVVMLGIVASATGASGGVGYIGLKGNSHSRWTKICNVYDKYCRHIG  158



>ref|XP_010245386.1| PREDICTED: CASP-like protein 1D1 [Nelumbo nucifera]
Length=199

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 76/121 (63%), Gaps = 5/121 (4%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
             KQT++V ++++P +PA      A++ +  A +YFV   ++AC Y++++  LTS+G   K
Sbjct  55   SKQTELVPVRLLP-MPAFGYKA-AKFNHSPATIYFVAALSVACLYSIIT-TLTSLGAIWK  111

Query  390  S--SRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
               S+   L+++ +DL+M+ L+ S+ G A  V  +G KGNSHV W K+C+V+ +FC  V 
Sbjct  112  PCPSKKFFLLLVFMDLIMLGLVASATGTAGGVAYIGLKGNSHVGWTKICSVYDKFCHHVA  171

Query  564  G  566
             
Sbjct  172  S  172



>ref|XP_009136704.1| PREDICTED: CASP-like protein ARALYDRAFT_915236 [Brassica rapa]
 emb|CDX90580.1| BnaA03g42010D [Brassica napus]
Length=193

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = +3

Query  249  TLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLV--LTSVGKGQKSSRVASLVVIV  422
            T+P       A++ +  AF+YFVV  ++AC Y+++S +  L++  K    S +  L + +
Sbjct  58   TIPIFPFHTQAKFTHSPAFIYFVVALSVACFYSIISTLATLSAFKKPSSCSAILLLNLAI  117

Query  423  LDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +D VMV ++ S+ GA+  V  +G KGN +VRW K+C+++  FC  VGG
Sbjct  118  MDAVMVGIVASATGASGGVAYIGLKGNKNVRWRKICDLYDTFCHHVGG  165



>ref|XP_010030740.1| PREDICTED: CASP-like protein 1B2 [Eucalyptus grandis]
 gb|KCW88116.1| hypothetical protein EUGRSUZ_A00513 [Eucalyptus grandis]
Length=199

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 73/122 (60%), Gaps = 5/122 (4%)
 Frame = +3

Query  207  LDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGK--  380
            L+K+TK + +  I + P +N  +TA+++   AFV+FV+ N +A  + ++ +V+   G   
Sbjct  47   LNKETKTIVVATIGSTP-INATLTAKFQDTPAFVFFVIANGMASLHNLLMVVVEIWGHKF  105

Query  381  GQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
              K  R+A  ++ VLD++ VAL     GAA  +  LG KGNSH RWNK+C+ FG FC   
Sbjct  106  DYKGLRLA--MIAVLDMMTVALASGGDGAATFMAELGKKGNSHARWNKICDKFGTFCDHG  163

Query  561  GG  566
             G
Sbjct  164  AG  165



>ref|XP_009399244.1| PREDICTED: CASP-like protein MA4_106O17.50 [Musa acuminata subsp. 
malaccensis]
Length=201

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 71/122 (58%), Gaps = 3/122 (2%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G  +QT  V      T    +I VT +  Y +A+VYFVV N +   Y+VVSLVL+ V K 
Sbjct  55   GAARQTTTVTGIDAETALLTSITVTVKSTYSAAYVYFVVANVLVFFYSVVSLVLSMVNKA  114

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVR-WNKVCNVFGRFCGQV  560
            + +S   SL   + DL+MV LLFSS GAA A+ ++  KG  ++  W+K+CN+ G  C +V
Sbjct  115  RLTSM--SLPFSIADLLMVVLLFSSNGAAAAISVVAEKGQQNLAGWDKICNLVGGLCARV  172

Query  561  GG  566
              
Sbjct  173  NA  174



>ref|XP_006284566.1| hypothetical protein CARUB_v10005787mg [Capsella rubella]
 gb|EOA17464.1| hypothetical protein CARUB_v10005787mg [Capsella rubella]
Length=195

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 74/123 (60%), Gaps = 9/123 (7%)
 Frame = +3

Query  207  LDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQ  386
            L KQTK V    IP  P   IP TA++    A +YFVV  ++AC Y+++S  L +V   +
Sbjct  51   LSKQTKNV---FIPGTP-FRIP-TAKFTNSPALIYFVVALSVACFYSILS-TLATVSAFK  104

Query  387  KSSRVASLVVI---VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            K S  ++++++   ++D VMV ++ S+ GA   V  LG KGN  VRW K+C+V+ +FC  
Sbjct  105  KPSSCSAILLLNLAIMDAVMVGIVASATGAGGGVAYLGLKGNKEVRWVKICHVYDKFCRH  164

Query  558  VGG  566
            V G
Sbjct  165  VAG  167



>ref|XP_009419511.1| PREDICTED: CASP-like protein MA4_106O17.52 [Musa acuminata subsp. 
malaccensis]
Length=207

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 92/149 (62%), Gaps = 2/149 (1%)
 Frame = +3

Query  123  KKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSA  302
               N+ + +FGLRLL FA+ + A +V+   KQTK++++ + P+   + +   A++++  A
Sbjct  32   PPPNLFFLDFGLRLLLFASAVTALVVMVTSKQTKLISVTVAPSSQIL-VSRDAKFQHSPA  90

Query  303  FVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVL-DLVMVALLFSSGGAAFAV  479
            F+Y V   ++   Y++++++++       S    +L +++L D +M  ++ S+ G A +V
Sbjct  91   FIYLVAALSVTGLYSIITMLVSLFSIASPSPSPKTLFLLILFDTLMAGVMASATGNAGSV  150

Query  480  GLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
              +G KGNSHV WNK+CN++G+FC  VG 
Sbjct  151  AYIGLKGNSHVNWNKICNMYGKFCRHVGS  179



>dbj|BAF46307.1| integral membrane family protein [Ipomoea nil]
Length=152

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
             K+T+++++++ P  P   +P+TA++    AF+YFV   ++A  Y ++S + +      K
Sbjct  4    SKETELISVKLDP-FPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  62

Query  390  SSRVASLV--VIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +LV   I+LD+VM+ ++ ++ GAA  V  +G KGNSHV W KVCN +G+ C  +G
Sbjct  63   PGFCPALVSHFIILDVVMLGIVGTATGAAGGVAYIGLKGNSHVGWTKVCNKYGKLCTHLG  122



>ref|XP_002312755.2| hypothetical protein POPTR_0008s20950g [Populus trichocarpa]
 sp|B9HMP5.2|CSPLD_POPTR RecName: Full=CASP-like protein 1D1; Short=PtCASPL1D1 [Populus 
trichocarpa]
 gb|EEE90122.2| hypothetical protein POPTR_0008s20950g [Populus trichocarpa]
Length=196

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 76/120 (63%), Gaps = 7/120 (6%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLV--LTSVGKGQ  386
            KQTK+V    +P LP +++P+ A++    AF+YF+   ++A  Y +++ +  ++ V K  
Sbjct  53   KQTKIVP---VPGLP-ISVPLEAKFSDSPAFLYFISALSVAGLYGILTTLAAISIVLKPA  108

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             ++R   L   +LD++M+ ++ S+ GAA  V  +G KGNSHVRW KVCNV+ +FC  VG 
Sbjct  109  YATRFL-LHFALLDVLMLGIVASATGAAGGVAYVGLKGNSHVRWGKVCNVYDKFCQHVGS  167



>sp|A2PZE5.2|CSPL1_IPONI RecName: Full=CASP-like protein IN26; AltName: Full=CASP-like 
protein 1D1; Short=InCASPL1D1, partial [Ipomoea nil]
Length=195

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
             K+T+++++++ P  P   +P+TA++    AF+YFV   ++A  Y ++S + +      K
Sbjct  47   SKETELISVKLDP-FPPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIK  105

Query  390  SSRVASLV--VIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +LV   I+LD+VM+ ++ ++ GAA  V  +G KGNSHV W KVCN +G+ C  +G
Sbjct  106  PGFCPALVSHFIILDVVMLGIVGTATGAAGGVAYIGLKGNSHVGWTKVCNKYGKLCTHLG  165



>ref|NP_001151672.1| CASP-like protein 1D1 [Zea mays]
 sp|B6U361.1|CSPL3_MAIZE RecName: Full=CASP-like protein 1D1; Short=ZmCASPL1D1 [Zea mays]
 gb|ACG43794.1| plant integral membrane protein TIGR01569 containing protein 
[Zea mays]
Length=202

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 66/108 (61%), Gaps = 1/108 (1%)
 Frame = +3

Query  243  IPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIV  422
            +P +P + + + A++K   A +Y +V   + C Y+++S   TS+     SS   +L ++V
Sbjct  66   VPQIPGLVLSLPAKFKDSPALIYLLVALCVTCFYSLLSTAFTSLKLLFGSSPSRTLFLLV  125

Query  423  L-DLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            L D+   A++ S+ G+A  V  +G KGNSH  WNK+CN++G+FC  +G
Sbjct  126  LFDVFYAAIMASATGSAGGVAWIGLKGNSHTNWNKICNIYGKFCRHIG  173



>ref|XP_007214738.1| hypothetical protein PRUPE_ppa025143mg [Prunus persica]
 gb|EMJ15937.1| hypothetical protein PRUPE_ppa025143mg [Prunus persica]
Length=191

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 70/121 (58%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
             L+K+TK + +  I T P +   +TA++++  A V+FV+ N +A  + +  + +   G  
Sbjct  45   ALNKETKSLVVATIGTTP-VRATLTAKFQHNPANVFFVIANGMASLHNLSMITVHFFGDK  103

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
             K   +  ++V +LD++ V+L  S  GAA  +  LG  GNSH RWNK+C+ F +FC   G
Sbjct  104  FKDKALRLVMVAILDVMTVSLASSGDGAATFMAQLGKNGNSHARWNKICDKFHKFCDHGG  163

Query  564  G  566
            G
Sbjct  164  G  164



>emb|CDY09750.1| BnaC07g33110D [Brassica napus]
Length=193

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = +3

Query  249  TLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLV--LTSVGKGQKSSRVASLVVIV  422
            T+P       A++ +  AF+YFVV  ++AC Y+++S +  L++  K    S +  L + +
Sbjct  58   TIPIFPFHTQAKFTHSPAFIYFVVALSVACFYSIISTLATLSAFKKPSSCSAILLLNLAI  117

Query  423  LDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +D VMV ++ S+ GA+  V  +G KGN +V+W K+C+++  FC  VGG
Sbjct  118  MDAVMVGIVASATGASGGVAYIGLKGNKNVQWRKICDLYDTFCRHVGG  165



>ref|XP_006844552.1| hypothetical protein AMTR_s00016p00178190 [Amborella trichopoda]
 gb|ERN06227.1| hypothetical protein AMTR_s00016p00178190 [Amborella trichopoda]
Length=179

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = +3

Query  264  NIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVA  443
            N+P+TA++ Y  AF +FV+ N +A GYA +S+    +             + + DL+MV 
Sbjct  52   NMPITAKYSYSPAFSFFVIANGLAAGYAALSIPFVFILNNPSVDPRNHFFMFMFDLIMVC  111

Query  444  LLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            ++ S   AA AVG +G  GN H  W  +C+ F  FC QV 
Sbjct  112  VVISGSSAATAVGYIGRYGNDHSGWGAICDHFTTFCNQVN  151



>tpg|DAA39419.1| TPA: membrane protein 4 [Zea mays]
Length=203

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 69/119 (58%), Gaps = 4/119 (3%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKS  392
            KQT  V    +P +P + + + A++K   A +Y +V   + C Y+++S   TS+     S
Sbjct  60   KQTVRVP---VPQIPGLVLSLPAKFKDSPALIYLLVALCVTCFYSLLSTAFTSLKLLSGS  116

Query  393  SRVASLVVIVL-DLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            S   +L ++VL D+   A++ S+ G+A  V  +G KGNSH  WNK+CN++ +FC  +G 
Sbjct  117  SPSRTLFLLVLFDVFYAAIMASATGSAGGVAWIGLKGNSHTNWNKICNIYSKFCRHIGS  175



>ref|XP_006414480.1| hypothetical protein EUTSA_v10026308mg [Eutrema salsugineum]
 gb|ESQ55933.1| hypothetical protein EUTSA_v10026308mg [Eutrema salsugineum]
Length=194

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 72/113 (64%), Gaps = 6/113 (5%)
 Frame = +3

Query  237  QIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVV  416
            + IP  P + +P  A++ +  AF+YFVV  ++AC Y+++S  L +V   +K S  +++++
Sbjct  57   KTIPGTP-IRMP-DAKFTHSPAFIYFVVALSVACFYSILS-TLATVSALKKPSSCSAILL  113

Query  417  I---VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +   ++D VMV ++ S+ GA   V  +G KGN +VRW K+C+V+  FC  VGG
Sbjct  114  LNLAIMDAVMVGIVASATGAGGGVAYIGLKGNKNVRWGKICHVYDTFCRHVGG  166



>ref|XP_006419661.1| hypothetical protein CICLE_v10005986mg [Citrus clementina]
 gb|ESR32901.1| hypothetical protein CICLE_v10005986mg [Citrus clementina]
Length=188

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 71/120 (59%), Gaps = 7/120 (6%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLV--LTSVGKGQ  386
            KQT++V+   IP      + V A++    AF+YFV   ++AC Y++++++  L+ V K  
Sbjct  45   KQTELVSAPGIP----FRVSVKAKFTDSPAFIYFVAALSVACLYSIITMLASLSVVSKPA  100

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             + R+  L     D+VM+ ++ S+ GA+  V  +G KGN H RW K+CNV+ ++C  +G 
Sbjct  101  SAKRLL-LYFAFWDVVMLGIVASATGASGGVAYIGLKGNDHSRWTKICNVYDKYCRHIGS  159



>ref|XP_006489150.1| PREDICTED: CASP-like protein RCOM_0679870-like [Citrus sinensis]
Length=188

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 71/120 (59%), Gaps = 7/120 (6%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLV--LTSVGKGQ  386
            KQT++V    IP    + + V A++    AF+YFV   ++AC Y++++++  L+ V K  
Sbjct  45   KQTELVTPPGIP----IRVSVKAKFTDSPAFIYFVAALSVACLYSIITMLASLSVVSKPA  100

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             + R+  L     D+VM+ ++ S+ GA+  V  +G KGN H RW K+CNV+ ++C  +G 
Sbjct  101  SAKRLL-LYFAFWDVVMLGIVASATGASGGVAYIGLKGNDHSRWTKICNVYDKYCRHIGS  159



>ref|XP_011013338.1| PREDICTED: CASP-like protein 1D1 [Populus euphratica]
Length=196

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 70/120 (58%), Gaps = 7/120 (6%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKS  392
            KQT++V + + P    +  PV A++    AF+YF+   ++A  Y ++S  L S+    K 
Sbjct  53   KQTEIVRLPVFP----LGAPVEAKFSDSPAFIYFISALSVAGLYGILS-TLASIAVVLKP  107

Query  393  SRVASLVV--IVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +     ++   +LD++M+ ++ S+ G A  V  +G KGNSHVRW K+CNV+ +FC  VG 
Sbjct  108  AYATRFLLHFALLDVLMLGIVASATGTAGGVAYIGLKGNSHVRWGKMCNVYDKFCQHVGS  167



>ref|XP_011040570.1| PREDICTED: CASP-like protein 1B1 [Populus euphratica]
Length=195

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 70/121 (58%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
             L+K+TK + +  +   P + + +TA++++  AFV+FV+ NA+A  + +V +++   G+ 
Sbjct  44   ALNKETKTLVVATVGNTP-IKVTLTAKFQHTPAFVFFVIANAMASFHNLVMIMVEFCGQK  102

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +   +V +LD++ VAL+     AA  +  LG  GNSH RW+K+C+ F  FC   G
Sbjct  103  LDYKGLRLAMVAILDMMTVALVSGGASAAIFMADLGKNGNSHARWDKICDKFETFCDHGG  162

Query  564  G  566
             
Sbjct  163  A  163



>ref|XP_006419662.1| hypothetical protein CICLE_v10006955mg [Citrus clementina]
 gb|ESR32902.1| hypothetical protein CICLE_v10006955mg [Citrus clementina]
Length=148

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = +3

Query  252  LPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDL  431
            LP + + V A++ Y  AF+YFV   ++A  Y+++++ L S+   +  SR   L++   D+
Sbjct  16   LPFLTLRVPAKFNYSPAFIYFVAALSVAGLYSIIAM-LASISAIKNPSRKVLLMLAFWDV  74

Query  432  VMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            VM+ ++ S+  A+ AV  +G KGN H+ W K+CNVF +FC  +  
Sbjct  75   VMLGVVASATAASGAVAYIGLKGNDHIGWRKMCNVFDKFCRHIAS  119



>ref|XP_003531310.1| PREDICTED: CASP-like protein 9-like [Glycine max]
Length=194

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 90/165 (55%), Gaps = 5/165 (3%)
 Frame = +3

Query  81   MEVGGGQVKELAVA----KKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIP  248
            M    G   ELA +     K    W    LR++AF  T +A LV+  +KQTK + +  I 
Sbjct  1    MASENGDKLELAFSVVPDPKPKKDWVNLSLRVVAFLATASATLVMAFNKQTKSMVVATIG  60

Query  249  TLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLD  428
            T P + I +TA +++  AF +FV+VNAIA  Y +V + +  +G       +   ++ +LD
Sbjct  61   TNP-VTITLTAMFQHTPAFTFFVIVNAIASFYNMVVIGVEILGPQYDYKELRLGLIAILD  119

Query  429  LVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            ++ +AL  +  GAA  +  LG  GNSH RW+K+C+ F  +C + G
Sbjct  120  VMTMALAATGDGAATFMAELGRNGNSHARWDKICDKFEAYCNRGG  164



>gb|KHN48115.1| CASP-like protein 9 [Glycine soja]
Length=194

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 90/165 (55%), Gaps = 5/165 (3%)
 Frame = +3

Query  81   MEVGGGQVKELAVA----KKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIP  248
            M    G   ELA +     K    W    LR++AF  T +A LV+  +KQTK + +  I 
Sbjct  1    MASENGDKLELAFSVVPDPKPKKDWVNLSLRVVAFLATASATLVMAFNKQTKSMVVATIG  60

Query  249  TLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLD  428
            T P + I +TA  ++  AF++FV+VNAIA  Y +V + +  +G       +   ++ +LD
Sbjct  61   TNP-VTITLTAMLQHTPAFIFFVIVNAIASFYNMVVIGVEILGPQYDYKELRLGLIAILD  119

Query  429  LVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            ++ +AL  +  GAA  +  LG  GNSH RW+K+C+ F  +C + G
Sbjct  120  VMTMALAATGDGAATFMAELGRNGNSHARWDKICDKFEAYCNRGG  164



>ref|XP_004154154.1| PREDICTED: CASP-like protein 9-like [Cucumis sativus]
 ref|XP_004157749.1| PREDICTED: CASP-like protein 9-like [Cucumis sativus]
Length=208

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 85/158 (54%), Gaps = 3/158 (2%)
 Frame = +3

Query  93   GGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIP  272
            GG+   L + KK+N  W    LRL+A   T +A LV+ L+K+TK + +  I T P +   
Sbjct  20   GGEYNHLVMGKKRN--WGFVLLRLVASFATASATLVMALNKETKSIVVATIGTDP-LTAN  76

Query  273  VTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLF  452
            ++A + +  AF++FV+ N +A  +  + + L   G    S+     ++ +LD+  VAL  
Sbjct  77   LSAHFYHTPAFIFFVIANGMATLHNWMMIALHIFGPKFHSNGFRLPIISILDMTTVALAS  136

Query  453  SSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +  GAA  +  LG  GN H RWNK+C+ F  +C    G
Sbjct  137  AGDGAATFMAALGKNGNKHARWNKICDKFSTYCDHGAG  174



>gb|EMT33640.1| hypothetical protein F775_13108 [Aegilops tauschii]
Length=154

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 54/83 (65%), Gaps = 7/83 (8%)
 Frame = +3

Query  309  YFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLL  488
            YFVV NA+AC Y+ V+L           SR A   ++V DLV+ ALLFS+ GAA   G+L
Sbjct  46   YFVVANAMACVYSAVALAACR-------SRSAVAPLMVGDLVVQALLFSAVGAAAEFGIL  98

Query  489  GYKGNSHVRWNKVCNVFGRFCGQ  557
            G +GNSHVRW KVC+V+  FC +
Sbjct  99   GERGNSHVRWGKVCHVYSSFCER  121



>ref|XP_006489266.1| PREDICTED: CASP-like protein RCOM_0679870-like [Citrus sinensis]
Length=193

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = +3

Query  252  LPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDL  431
            LP + + V A++ Y  AF+YFV   ++A  Y+++++ L S+   +  SR   L++   D+
Sbjct  61   LPFLTLRVPAKFNYSPAFIYFVAALSVAGLYSIIAM-LASISAIKNPSRKVLLMLAFWDV  119

Query  432  VMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            VM+ ++ S+  A+ AV  +G KGN H+ W K+CNVF +FC  +  
Sbjct  120  VMLGVVASATAASGAVAYIGLKGNDHIGWRKMCNVFDKFCRHIAS  164



>ref|XP_010453663.1| PREDICTED: casparian strip membrane protein 5 [Camelina sativa]
Length=187

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 61/109 (56%), Gaps = 2/109 (2%)
 Frame = +3

Query  246  PTLPAMN--IPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI  419
             TLP     I   AE+  + A  +FVV NA+  GY ++SL L  V   +  ++ + +++I
Sbjct  52   ETLPFFTQFIRFQAEYNDLPALTFFVVANAVVSGYLILSLTLAFVHIVKSKTQNSRILLI  111

Query  420  VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            VLD+VM+ LL +   +A A+  L + GN+   WN +C  F  FC ++ G
Sbjct  112  VLDVVMLGLLTAGASSAAAIVYLAHNGNNKTNWNAICQQFNSFCERISG  160



>ref|XP_010420188.1| PREDICTED: casparian strip membrane protein 5-like [Camelina 
sativa]
Length=187

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 61/109 (56%), Gaps = 2/109 (2%)
 Frame = +3

Query  246  PTLPAMN--IPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI  419
             TLP     I   AE+  + A  +FVV NA+  GY ++SL L  V   +  ++ + +++I
Sbjct  52   ETLPFFTQFIRFQAEYNDLPALTFFVVANAVVSGYLILSLTLAFVHIVKSKTQNSRILLI  111

Query  420  VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            VLD+VM+ LL +   +A A+  L + GN+   WN +C  F  FC ++ G
Sbjct  112  VLDVVMLGLLTAGASSAAAIVYLAHNGNNKTNWNAICQQFNSFCERISG  160



>ref|XP_010492362.1| PREDICTED: casparian strip membrane protein 5-like [Camelina 
sativa]
Length=187

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 61/109 (56%), Gaps = 2/109 (2%)
 Frame = +3

Query  246  PTLPAMN--IPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI  419
             TLP     I   AE+  + A  +FVV NA+  GY ++SL L  V   +  ++ + +++I
Sbjct  52   ETLPFFTRFIRFQAEYSDLPALTFFVVANAVVSGYLILSLTLAFVHIVKSKTQNSRILLI  111

Query  420  VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            VLD+VM+ LL +   +A A+  L + GN+   WN +C  F  FC ++ G
Sbjct  112  VLDVVMLGLLTAGASSAAAIVYLAHNGNNKTNWNAICQQFNSFCERISG  160



>ref|XP_011011053.1| PREDICTED: CASP-like protein 1B2 [Populus euphratica]
 ref|XP_011016328.1| PREDICTED: CASP-like protein 1B2 [Populus euphratica]
Length=199

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 70/121 (58%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+K+TK + +  + + P +   +TA++++  AFV+FV+ N +A  + +V ++    G+ 
Sbjct  44   GLNKETKTLVVATVGSTP-IKASLTAKFQHTPAFVFFVIANGLASIHNLVMIMGDLFGQK  102

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +   ++ +LD++ VAL+     AA  +  LG  GNSH RWNK+C+ F  FC   G
Sbjct  103  LDYKGLRLAMIAILDMMTVALVSGGVSAAAFMAELGKNGNSHARWNKICDKFETFCDHGG  162

Query  564  G  566
            G
Sbjct  163  G  163



>ref|XP_009763390.1| PREDICTED: CASP-like protein 1 [Nicotiana sylvestris]
Length=201

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 76/121 (63%), Gaps = 9/121 (7%)
 Frame = +3

Query  213  KQTKVVAMQIIPT-LPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLV--LTSVGKG  383
            KQT     +++PT  P    P+ A++ +  A +YFV   ++A  +++++ +  L S+ K 
Sbjct  60   KQT-----EMVPTPFPPYRAPLPAKFNHSPALIYFVAAFSVAGFFSIITTLGSLYSLTKP  114

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
              S+++ S  +I+ D++++ ++ S+ GAA +V  +G KGN+HV W KVCN++G+FC  +G
Sbjct  115  GCSAKIISHFIII-DVLLLGIVASATGAAASVAYIGLKGNTHVGWGKVCNMYGKFCRYLG  173

Query  564  G  566
             
Sbjct  174  A  174



>emb|CDX69534.1| BnaA10g18830D [Brassica napus]
Length=187

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = +3

Query  246  PTLPAMN--IPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI  419
             TLP     I   AE+  +SA  +FV+ NA+  GY ++SL LT V   +  ++ + +++I
Sbjct  52   ETLPFFTQFIRFHAEYSDLSALTFFVIANAVVSGYLILSLPLTFVHIVKSKTQNSRVLLI  111

Query  420  VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +LD+ M+ LL +   +A A+  L +KGN++  W  +C  F  FC ++ G
Sbjct  112  ILDVAMLGLLTAGASSAAAIVYLAHKGNNNTNWFSICQQFNSFCERISG  160



>ref|XP_006468217.1| PREDICTED: CASP-like protein POPTRDRAFT_810994-like [Citrus sinensis]
Length=189

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 58/101 (57%), Gaps = 7/101 (7%)
 Frame = +3

Query  264  NIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVA  443
            N+  TA++     F YFVV  AIACGY +V L+L+S       S +  L+VI LD VM A
Sbjct  64   NLTFTAKFSNEPVFKYFVVAEAIACGYTLVVLILSS------RSLLWRLIVI-LDAVMTA  116

Query  444  LLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +L SS  AA A+  +G KGNSH  W  +C    +FC  V G
Sbjct  117  VLTSSISAALAIARVGKKGNSHAGWLPICGQVPKFCDHVTG  157



>ref|XP_010546916.1| PREDICTED: CASP-like protein 1D2 [Tarenaya hassleriana]
Length=204

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 1/99 (1%)
 Frame = +3

Query  267  IPVTAEWKYMSAFVYFVVVNAIACGYAVVS-LVLTSVGKGQKSSRVASLVVIVLDLVMVA  443
            +PV+AE+    AF+YFVV   IA  Y++VS L+  SV    + S   S+ +   D+V++ 
Sbjct  77   VPVSAEFNDSPAFIYFVVALVIASFYSLVSTLISISVLSRPEFSAQFSIFLSSFDVVILG  136

Query  444  LLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            +L S+ G A  V  +G +GN H+ WNK+CNV+ +FC  +
Sbjct  137  ILASATGTAGGVAYVGLRGNDHLGWNKICNVYDKFCRHI  175



>ref|XP_010548920.1| PREDICTED: CASP-like protein 1D1 [Tarenaya hassleriana]
Length=194

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 72/121 (60%), Gaps = 7/121 (6%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLV--LTSVGKG  383
             KQT++V    +P    +  P  A++    A +YFV   ++AC Y++VS +  L+++ K 
Sbjct  51   SKQTELVP---VPGT-RLRFPNPAKFTDSPALIYFVAALSVACFYSIVSTLASLSAISKP  106

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
              SS +  L + +LD++M+ ++ S+ GA   V  +G KGN HVRW K+CN++ +F   VG
Sbjct  107  SCSS-ILFLYLAILDVMMLGIVASATGAGGGVAYIGLKGNKHVRWGKICNIYDKFSRHVG  165

Query  564  G  566
            G
Sbjct  166  G  166



>gb|KDO75960.1| hypothetical protein CISIN_1g047574mg [Citrus sinensis]
Length=163

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 58/101 (57%), Gaps = 7/101 (7%)
 Frame = +3

Query  264  NIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVA  443
            N+  TA++     F YFVV  AIACGY +V L+L+S       S +  L+VI LD VM A
Sbjct  38   NLTFTAKFSNEPVFKYFVVAEAIACGYTLVVLILSS------RSLLWRLIVI-LDAVMTA  90

Query  444  LLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +L SS  AA A+  +G KGNSH  W  +C    +FC  V G
Sbjct  91   VLTSSISAALAIARVGKKGNSHAGWLPICGQVPKFCDHVTG  131



>ref|XP_006467803.1| PREDICTED: CASP-like protein POPTRDRAFT_810994-like [Citrus sinensis]
Length=161

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 58/101 (57%), Gaps = 7/101 (7%)
 Frame = +3

Query  264  NIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVA  443
            N+  TA++     F YFVV  AIACGY +V L+L+S       S +  L+VI LD VM A
Sbjct  36   NLTFTAKFSNEPVFKYFVVAEAIACGYTLVVLILSS------RSLLWRLIVI-LDAVMTA  88

Query  444  LLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +L SS  AA A+  +G KGNSH  W  +C    +FC  V G
Sbjct  89   VLTSSISAALAIARVGKKGNSHAGWLPICGQVPKFCDHVTG  129



>ref|XP_008459066.1| PREDICTED: CASP-like protein POPTRDRAFT_798217 [Cucumis melo]
 ref|XP_008459067.1| PREDICTED: CASP-like protein POPTRDRAFT_798217 [Cucumis melo]
Length=207

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 84/157 (54%), Gaps = 3/157 (2%)
 Frame = +3

Query  96   GQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIPV  275
            G+   LA+ KK+N  W    LRL+A   T +A LV+ L+K+TK + +  I T P +   +
Sbjct  20   GEYNHLAMEKKRN--WGFILLRLVASFATASATLVMALNKETKSIVVATIGTDP-LTATL  76

Query  276  TAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFS  455
            +A + +  AF++FVV N +A  +  + + L   G     +     ++ +LD+  VAL  +
Sbjct  77   SAHFYHTPAFIFFVVANGMATLHNWMMIALHIFGPKFHFNGFRLPIISILDMTTVALASA  136

Query  456  SGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
              GAA  +  LG  GN H RWNK+C+ F  +C    G
Sbjct  137  GDGAATFMAALGKNGNKHARWNKICDKFSTYCDHGAG  173



>ref|XP_010904768.1| PREDICTED: CASP-like protein 1E1 [Elaeis guineensis]
Length=195

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +3

Query  270  PVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALL  449
            P + + +Y SAFVY +VVN I   Y+++SL L  + +G   SR  ++ + + DLVMV LL
Sbjct  72   PGSIKSRYSSAFVYLIVVNVIVLIYSIISLALALLNRG--GSRRIAMHLSIADLVMVVLL  129

Query  450  FSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            FSS GAA A+ ++  KG     W K C V   FCG +
Sbjct  130  FSSTGAAAAISVVADKGLPRYAWPKFCYVLHTFCGHI  166



>ref|XP_009794323.1| PREDICTED: casparian strip membrane protein 3-like [Nicotiana 
sylvestris]
Length=184

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +3

Query  246  PTLPAMN--IPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI  419
             TLP+    I   AE+K +  F +FVV N I   Y  VSLVL+ +      +R+  +V+I
Sbjct  50   DTLPSFTEFIKFKAEYKDLPTFTFFVVANGIVSAYLAVSLVLSILHIVMSGARITRVVLI  109

Query  420  VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
              D VM+A L S   AA A+  L +KGN    W  +C  +  FC +  G
Sbjct  110  FFDTVMMAFLTSGASAAAAIVYLAHKGNERANWIAICQQYNSFCDRASG  158



>ref|XP_008799290.1| PREDICTED: CASP-like protein MA4_106O17.52 [Phoenix dactylifera]
Length=204

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 66/119 (55%), Gaps = 3/119 (3%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
             KQT+ +     P  P   +   A +K   A +Y +V  ++A  Y++++++ +     + 
Sbjct  59   SKQTRTLPANFAP--PFSFVTRDAYFKDSPALIYLLVALSVAGLYSIITILASGFAISRP  116

Query  390  SSRVASLV-VIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            S     L  +IV D +M A+L S+ G A +V  +G KGNSHV W K+CNV+G+FC  +G
Sbjct  117  SPSTKLLFHLIVFDALMAAILASATGTAGSVAYIGLKGNSHVGWTKICNVYGKFCRHIG  175



>ref|NP_001059526.1| Os07g0442900 [Oryza sativa Japonica Group]
 sp|Q6YT98.1|CSPL7_ORYSJ RecName: Full=CASP-like protein 1D1; Short=OsCASPL1D1 [Oryza 
sativa Japonica Group]
 dbj|BAC84694.1| integral membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF21440.1| Os07g0442900 [Oryza sativa Japonica Group]
 gb|EAZ39636.1| hypothetical protein OsJ_24066 [Oryza sativa Japonica Group]
 dbj|BAG93383.1| unnamed protein product [Oryza sativa Japonica Group]
Length=207

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNI-PVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
            KQT +V   I P  P   + PV A++ +  A +Y +      C Y++++  ++SV     
Sbjct  62   KQTVMVPFVIRP--PQFILAPVPAKYTHSPALIYLLAALCATCFYSLIT-AISSVRLLSS  118

Query  390  SSRVASLV--VIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            S+  A  +  +I+LD+   A++ S+ G A AV  +G KGNSH RWNK+CNV+G+FC  +G
Sbjct  119  SACSAKTLFYLILLDVFYAAVMASATGTAGAVAWVGLKGNSHTRWNKICNVYGKFCRHIG  178



>gb|EAZ03696.1| hypothetical protein OsI_25828 [Oryza sativa Indica Group]
Length=209

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 70/121 (58%), Gaps = 6/121 (5%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNI-PVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
            KQT ++   I P  P   + PV A++ +  A +Y +      C Y++++  ++SV     
Sbjct  64   KQTVMIPFVIRP--PQFILAPVPAKYTHSPALIYLLAALCATCFYSLIT-AISSVRLLSS  120

Query  390  SSRVASLV--VIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            S+  A  +  +I+LD+   A++ S+ G A AV  +G KGNSH RWNK+CNV+G+FC  +G
Sbjct  121  SACSAKTLFYLILLDVFYAAVMASATGTAGAVAWVGLKGNSHTRWNKICNVYGKFCRHIG  180

Query  564  G  566
             
Sbjct  181  S  181



>ref|NP_001241476.1| CASP-like protein 1B1 [Glycine max]
 sp|C6TG62.1|CSPL9_SOYBN RecName: Full=CASP-like protein 1B1; Short=GmCASPL1B1 [Glycine 
max]
 gb|ACU20814.1| unknown [Glycine max]
 gb|KHN06516.1| CASP-like protein 9 [Glycine soja]
Length=194

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 71/120 (59%), Gaps = 1/120 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
              +KQTK + +  I T P + I +TA +++  AF++FV+VNAIA  Y ++ + +  +G  
Sbjct  46   AFNKQTKGMVVATIGTNP-VTITLTAMFQHTPAFIFFVIVNAIASFYNLLVIGVEILGPQ  104

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +   ++ +LD++ +AL  +  GAA  +  LG  GNSH RW+K+C+ F  +C + G
Sbjct  105  YDYKGLRLGLIAILDVMTMALAATGDGAATFMAELGRNGNSHARWDKICDKFEAYCNRGG  164



>ref|XP_006407952.1| hypothetical protein EUTSA_v10021548mg [Eutrema salsugineum]
 gb|ESQ49405.1| hypothetical protein EUTSA_v10021548mg [Eutrema salsugineum]
Length=203

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 68/119 (57%), Gaps = 7/119 (6%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKS  392
             QT++  +   P+ PA   PV+A++    AF+YFVV   +A  YA++S  L S+    K 
Sbjct  64   DQTEMTQLPGAPS-PA---PVSAQFNDSPAFIYFVVALVVASFYALIS-TLISISLLLKP  118

Query  393  SRVA--SLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
              VA  S+ +  LD+VM+ +L S+ G A  V  +  KGN  + WNK+CNV+ +FC  + 
Sbjct  119  EFVAQFSIFLTSLDMVMLGILASATGTAGGVAYIALKGNEEIGWNKICNVYDKFCDYIA  177



>ref|XP_004233676.1| PREDICTED: casparian strip membrane protein 3-like [Solanum lycopersicum]
Length=182

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +3

Query  246  PTLPAMN--IPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI  419
             TLP+    I   AE+K +  F +FVV N I   Y  VSLVL+ +      +R+  +V+I
Sbjct  48   ETLPSFEQFIRFKAEYKDLPTFTFFVVANGIVSAYLAVSLVLSILHIVMSGARITRVVLI  107

Query  420  VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
              D VM+A L S   AA A+  L +KGN+   W  +C  +  FC +  G
Sbjct  108  FFDTVMMAFLTSGASAAAAIVYLAHKGNARANWIAICQHYNSFCDRASG  156



>ref|XP_010904772.1| PREDICTED: CASP-like protein 1D1 [Elaeis guineensis]
Length=192

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
             KQTK+V    +P    + +   A++ +  A +YFVV  ++A  ++V++ +++++   + 
Sbjct  48   SKQTKLVH---VPAPFPLYVVTHAKFNHSPALIYFVVAISVALLHSVLTGLISALPICKP  104

Query  390  SSRVASLVVIV-LDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +     L+V+  LD +++ ++ S+ GA  ++  +G+KGNSHVRWNK+CN++ +FC   G 
Sbjct  105  APEAKKLLVLAFLDSLILGVVASAMGAVASIAYIGFKGNSHVRWNKICNIYDKFCRYAGS  164



>ref|XP_002516872.1| conserved hypothetical protein [Ricinus communis]
 sp|B9RT03.1|CSPL5_RICCO RecName: Full=CASP-like protein 1D1; Short=RcCASPL1D1 [Ricinus 
communis]
 gb|EEF45486.1| conserved hypothetical protein [Ricinus communis]
Length=201

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 71/120 (59%), Gaps = 6/120 (5%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKS  392
            KQT++     +P +P + +PV A++ +  AF+YFV   ++AC Y++++  L S+G   K 
Sbjct  55   KQTELAP---VPGVPGLRVPVEAKFNHSPAFIYFVAALSVACLYSIIT-TLASLGVIAKP  110

Query  393  SRVASLVVI--VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
                  +    + D++M+ ++ ++ GAA  V  +G KGNSH RW K+CNV+  FC  VG 
Sbjct  111  IYATKFLFYYALWDVLMLGIVAAATGAAGGVAYIGLKGNSHTRWTKICNVYDTFCKHVGS  170



>emb|CDP12619.1| unnamed protein product [Coffea canephora]
Length=256

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 90/164 (55%), Gaps = 3/164 (2%)
 Frame = +3

Query  75   RGMEVGGGQVKELAVAKKQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTL  254
             G E G  Q   ++  K  +  W  F LRL AF  T++A +V+ ++KQT  V +  I   
Sbjct  61   EGAENGACQTPVVSANKAND--WLIFLLRLFAFFATVSATVVMAINKQTLTVVVATIGRT  118

Query  255  PAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLV  434
            P +   VTA++++  AFV+FV+ N +A  + ++ L++  +G       +  L++ +LD++
Sbjct  119  P-IQASVTAKFQHTPAFVFFVIANGLASIHNLLMLIVEFIGHKFDFKGLRYLLIPILDML  177

Query  435  MVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             VAL+     AA  +G L   GNS  +WNK+C+ F  +C   GG
Sbjct  178  NVALVSGGTSAAVFIGELARNGNSRAKWNKICDKFSTYCNHGGG  221



>ref|XP_003609582.1| hypothetical protein MTR_4g118800 [Medicago truncatula]
 gb|AES91779.1| plant integral membrane protein [Medicago truncatula]
 gb|AFK34574.1| unknown [Medicago truncatula]
Length=187

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 65/104 (63%), Gaps = 3/104 (3%)
 Frame = +3

Query  261  MNIPVTAEWKYMSAFVYFVVVNAIACGYAVVS--LVLTSVGKGQKSSRVASLVVIVLDLV  434
            + +P  A+++Y  AFVYFV   ++A  Y++++  + L+++ K    +++  L +I  D V
Sbjct  56   LPVPRPAKFRYSPAFVYFVAAFSVAGLYSIITTFISLSAIRKPNLKTKLL-LHLIFWDAV  114

Query  435  MVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            M+ +L S+ G A +V  LG KGN H  W+K+C+++ +FC  +G 
Sbjct  115  MLGILASATGTAGSVAYLGLKGNKHTDWHKICHIYDKFCRHIGA  158



>ref|XP_002317067.1| integral membrane family protein [Populus trichocarpa]
 sp|B9I0U9.1|CSPLB_POPTR RecName: Full=CASP-like protein 1B1; Short=PtCASPL1B1 [Populus 
trichocarpa]
 gb|EEE97679.1| integral membrane family protein [Populus trichocarpa]
Length=195

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 72/123 (59%), Gaps = 5/123 (4%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGK-  380
             L+K+TK + +  +   P + + +TA++++  AFV+FV+ N +A  + ++ +++   G+ 
Sbjct  44   ALNKETKTLVVATVGNTP-IKVTLTAKFQHTPAFVFFVIANGMASFHNLLMIMVELCGQK  102

Query  381  -GQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
               K  R+A  +V +LD++ VAL+     AA  +  LG  GNSH RW+K+C+ F  FC  
Sbjct  103  LDYKGMRLA--MVAILDMMTVALVSGGASAATFMAELGKNGNSHARWDKICDKFETFCDH  160

Query  558  VGG  566
             G 
Sbjct  161  GGA  163



>ref|XP_007046043.1| Casparian strip membrane protein 5, putative isoform 2 [Theobroma 
cacao]
 gb|EOY01875.1| Casparian strip membrane protein 5, putative isoform 2 [Theobroma 
cacao]
Length=234

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 63/113 (56%), Gaps = 7/113 (6%)
 Frame = +3

Query  237  QIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTS---VGKGQKSSRVAS  407
            + +P  P  +I + AE+  +  F +FV+ N++AC Y V+SL L+    +    KSSR+  
Sbjct  100  ETVPLFP-QSILLNAEYSDLPMFTFFVIANSVACAYLVLSLPLSFYHIIRTAAKSSRI--  156

Query  408  LVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             ++++ D VM+AL+ +    A A+  L +KGN++  W  +C  F  FC    G
Sbjct  157  -ILVMFDTVMLALVTAGASTAAAIVYLAHKGNANANWFAICQQFNSFCEHTSG  208



>ref|XP_006338436.1| PREDICTED: casparian strip membrane protein VIT_14s0108g01050-like 
[Solanum tuberosum]
Length=179

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +3

Query  246  PTLPAMN--IPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI  419
             TLP+    I   AE+K +  F +FVV N I   Y  VSLVL+ +      +R+  +V+I
Sbjct  45   ETLPSFEQFIRFKAEYKNLPTFTFFVVANGIVSAYLAVSLVLSILHIVMSGARITRVVLI  104

Query  420  VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
              D VM+A L S   AA A+  L +KGN+   W  +C  +  FC +  G
Sbjct  105  FFDTVMMAFLTSGASAAAAIVYLAHKGNASANWIAICQQYNSFCDRASG  153



>ref|XP_011090848.1| PREDICTED: CASP-like protein 1 [Sesamum indicum]
Length=210

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 71/120 (59%), Gaps = 7/120 (6%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGY-AVVSLV-LTSVGKGQ  386
            KQT+++ + I P L     P  A++ +  AF+YFV   ++A  Y A+ +L+ L ++ K  
Sbjct  64   KQTELIPIPIPPFL----TPRPAKFTHSPAFIYFVAALSVAGLYGAITTLISLFALRKPA  119

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
               R  S  VI  D++++ ++ ++ G A  V  +G KGN+HV+W K+C+++G FC  +G 
Sbjct  120  SYPRFLSHFVI-FDVLLLGIVAAATGTAGGVAYIGLKGNTHVQWRKICDIYGEFCRHIGA  178



>ref|XP_004488207.1| PREDICTED: CASP-like protein 9-like [Cicer arietinum]
Length=202

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 69/121 (57%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+KQTK + +  I + P +   ++A++    AFV+FV+ N  A  + ++ + +  +G  
Sbjct  49   GLNKQTKSLIVGTIGSTP-IRATLSAKFSQTPAFVFFVIANGNASLHNLLMISMDVLGPQ  107

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +   ++ +LD++ +AL  +  GAA  +  LG  GNSH RWNK+C+ F  +C + G
Sbjct  108  YNYKGLRLALIAILDMLTMALASAGDGAATFMSELGKNGNSHARWNKICDKFESYCNRGG  167

Query  564  G  566
            G
Sbjct  168  G  168



>ref|XP_006844549.1| hypothetical protein AMTR_s00016p00177260 [Amborella trichopoda]
 gb|ERN06224.1| hypothetical protein AMTR_s00016p00177260 [Amborella trichopoda]
Length=183

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 53/98 (54%), Gaps = 0/98 (0%)
 Frame = +3

Query  270  PVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALL  449
            P TA++ Y SA  +FVV N IA  Y+++SL    + K  + +      V  +DL+M+ LL
Sbjct  60   PFTAKYSYSSALRFFVVANGIAAAYSLISLPFVCLLKYPRCNPRFHFFVYTIDLMMLCLL  119

Query  450  FSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
             +   AA A+  +   G+ H  W  +CN F RFC + G
Sbjct  120  MAGLSAATAISYVAKNGDEHSGWLPICNTFHRFCSRTG  157



>emb|CDO98910.1| unnamed protein product [Coffea canephora]
Length=229

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 71/120 (59%), Gaps = 7/120 (6%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLT--SVGKGQ  386
            KQT++VA+      P    PV A++ +  A +YFV   ++A  Y ++S +L+  ++ K  
Sbjct  86   KQTELVAIP----FPPFRAPVPAKFNHSPALIYFVAALSVAGLYGIISTLLSVYALLKPD  141

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             S+R+ S +VI  D++++ ++ S+ GAA  V  +G KGNSHV W KVC+ +  FC  +  
Sbjct  142  WSTRLLSHLVI-FDVLLLGIVASATGAAGGVAYVGLKGNSHVGWRKVCDTYDVFCKHLAS  200



>ref|XP_007046042.1| Casparian strip membrane protein 5, putative isoform 1 [Theobroma 
cacao]
 gb|EOY01874.1| Casparian strip membrane protein 5, putative isoform 1 [Theobroma 
cacao]
Length=212

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 63/113 (56%), Gaps = 7/113 (6%)
 Frame = +3

Query  237  QIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLT---SVGKGQKSSRVAS  407
            + +P  P  +I + AE+  +  F +FV+ N++AC Y V+SL L+    +    KSSR+  
Sbjct  78   ETVPLFP-QSILLNAEYSDLPMFTFFVIANSVACAYLVLSLPLSFYHIIRTAAKSSRI--  134

Query  408  LVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             ++++ D VM+AL+ +    A A+  L +KGN++  W  +C  F  FC    G
Sbjct  135  -ILVMFDTVMLALVTAGASTAAAIVYLAHKGNANANWFAICQQFNSFCEHTSG  186



>gb|EMT27366.1| hypothetical protein F775_32968 [Aegilops tauschii]
Length=189

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 3/118 (3%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKS  392
            KQT++V + + P  P    PV A++K   A +Y +V   +   Y++V+   +       +
Sbjct  45   KQTEMVPLVLTP--PFRFGPVPAQFKDSPALIYLLVALCMTSLYSLVTAASSVKSMSSSA  102

Query  393  SRVASL-VVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            S    + V+I+LD+V   ++ S+ G A AV  +G KGNSH RWNK+CN++ +FC  +G
Sbjct  103  SCAKGIFVLILLDVVYAGIMASATGTAGAVAWVGLKGNSHTRWNKICNIYDKFCRHIG  160



>ref|XP_009339377.1| PREDICTED: CASP-like protein POPTRDRAFT_810994 [Pyrus x bretschneideri]
Length=138

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 7/100 (7%)
 Frame = +3

Query  261  MNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMV  440
            +N+   A++ +  AF YFV+V AI  GY ++ L+L+S G   +       +VI+LD+V  
Sbjct  11   LNLTFKAKYNHSPAFTYFVIVEAIVSGYNLIILLLSSKGSLWR-------MVIILDVVAA  63

Query  441  ALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
             LL SS  AA A+  +G KGN+H  W  +C    RFC  V
Sbjct  64   LLLTSSMSAALAIAQVGKKGNTHAGWLPICGQVSRFCNHV  103



>ref|XP_002300491.2| hypothetical protein POPTR_0001s43290g [Populus trichocarpa]
 sp|B9GIE4.3|CSPL5_POPTR RecName: Full=CASP-like protein 1B2; Short=PtCASPL1B2 [Populus 
trichocarpa]
 gb|EEE85296.2| hypothetical protein POPTR_0001s43290g [Populus trichocarpa]
Length=199

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 69/121 (57%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+K+TK + +  + + P +   + A++++  AFV+FV+ N +A  + +V ++    G+ 
Sbjct  44   GLNKETKTLVVATVGSTP-IKASLAAKFQHTPAFVFFVIANGLASIHNLVMIMGDLFGQK  102

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +   ++ +LD++ VAL+     AA  +  LG  GNSH RWNK+C+ F  FC   G
Sbjct  103  LDYKGLRLAMIAILDMMTVALVSGGVSAAAFMAELGKNGNSHARWNKICDKFETFCDHGG  162

Query  564  G  566
            G
Sbjct  163  G  163



>gb|KHG20748.1| CASP-like protein [Gossypium arboreum]
Length=206

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 87/152 (57%), Gaps = 11/152 (7%)
 Frame = +3

Query  126  KQNMRWAEFGlrllafantlaaalvlGLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAF  305
            KQ  RW   GLRLLAF    AA LV+ L+KQTK   +  I T P +N+ +TA++ +  AF
Sbjct  19   KQKRRWTLLGLRLLAFLAAAAATLVMVLNKQTKTFVVATIGTTP-VNLTLTAKFHHTPAF  77

Query  306  VYFVVVNAIACGYAVVSLVLTSVG-----KGQKSSRVASLVVIVLDLVMVALLFSSGGAA  470
            V+F + N +   + +V +++  +G     KG +   +ASL     D++ +AL+     AA
Sbjct  78   VFFAIANGLVSIHNLVMIMVDLLGSKFDYKGFQLPMIASL-----DMLNLALVSGGANAA  132

Query  471  FAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
              +  LG  GNSH RW+K+C+ FG +C +  G
Sbjct  133  AFMAELGKNGNSHARWDKICDKFGAYCDRGAG  164



>ref|XP_004233179.1| PREDICTED: CASP-like protein 1B2 [Solanum lycopersicum]
Length=195

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 67/119 (56%), Gaps = 5/119 (4%)
 Frame = +3

Query  207  LDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQ  386
            L+ Q K + +  I T P +   + A++++  AFV+FV+ N +   + ++ L    +G   
Sbjct  43   LNNQKKTIVVATIGTTP-IQATLNAKFQHTPAFVFFVIANGLVSLHNLLMLAFCFIGNKY  101

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFA--VGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
                +   V+ +LD++ VAL+  SGGA+ A  +G LG  GNSH RWNK+C+ F  FC  
Sbjct  102  DYKGLRFYVIGILDMINVALI--SGGASSAAFMGQLGRNGNSHARWNKICDKFYTFCNH  158



>ref|XP_009624212.1| PREDICTED: CASP-like protein 1B2 [Nicotiana tomentosiformis]
Length=215

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 63/115 (55%), Gaps = 1/115 (1%)
 Frame = +3

Query  207  LDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQ  386
            L+KQ K   +  I T P +   +TA++++  AFV+FV+ N +   + ++ L    VG   
Sbjct  61   LNKQQKTFVVATIGTTP-IQATLTAKFQHTPAFVFFVIANGLCSLHNLLMLAACFVGSKY  119

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFC  551
                +    + VLD++ VAL+     AA  +G LG  GNSH RWNK+C+ F  +C
Sbjct  120  DFKGLRFYTIGVLDMMNVALVSGGASAAAFMGQLGRDGNSHARWNKICDKFDTYC  174



>ref|XP_010024567.1| PREDICTED: CASP-like protein 1 [Eucalyptus grandis]
Length=206

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 66/122 (54%), Gaps = 8/122 (7%)
 Frame = +3

Query  207  LDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQ  386
              KQTKV+  +     P       A++    AF+YFV   ++AC Y++V+  L S+    
Sbjct  62   FSKQTKVLLRR-----PPSVAFAEAKFDNSPAFIYFVAALSVACLYSIVT-ALASISVVL  115

Query  387  KSSRVAS--LVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            K +  AS  L  +V D+VM+ L+ S+ G A  V  +G KGNSH RW K CNV+ +FC  +
Sbjct  116  KPAFSASFLLFFVVSDVVMLGLVASATGTAGGVAYIGLKGNSHERWEKFCNVYDKFCQHL  175

Query  561  GG  566
              
Sbjct  176  AA  177



>ref|NP_187290.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SQU2.1|CSPLD_ARATH RecName: Full=CASP-like protein 1D2; Short=AtCASPL1D2 [Arabidopsis 
thaliana]
 gb|AAF08575.1|AC011623_8 unknown protein [Arabidopsis thaliana]
 gb|AAO41998.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64140.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74385.1| uncharacterized protein AT3G06390 [Arabidopsis thaliana]
Length=199

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = +3

Query  270  PVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVA--SLVVIVLDLVMVA  443
            PV+AE+    AF+YFVV   +A  YA++S  L S+    K    A  S+ +  LD+VM+ 
Sbjct  75   PVSAEFNDSPAFIYFVVALVVASFYALIS-TLVSISLLLKPEFTAQFSIYLASLDMVMLG  133

Query  444  LLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            +L S+ G A  V  +  KGN  V WNK+CNV+ +FC  + 
Sbjct  134  ILASATGTAGGVAYIALKGNEEVGWNKICNVYDKFCRYIA  173



>ref|XP_007154229.1| hypothetical protein PHAVU_003G101100g [Phaseolus vulgaris]
 gb|ESW26223.1| hypothetical protein PHAVU_003G101100g [Phaseolus vulgaris]
Length=187

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 63/98 (64%), Gaps = 3/98 (3%)
 Frame = +3

Query  279  AEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVV--IVLDLVMVALLF  452
            A+++Y  AFVYFV   ++A  Y++++  L S+   +  +  A L++  I+LD++++ ++ 
Sbjct  62   AKFRYSPAFVYFVAALSVAGLYSIIT-TLASLYAIKNPALKAKLLLYFILLDVLILGIIA  120

Query  453  SSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            S+ G A  V  +G KGN HV WNK+CNV+ +FC  VG 
Sbjct  121  SATGTAGGVAYVGLKGNKHVNWNKICNVYDKFCKHVGA  158



>gb|KEH16769.1| CASP POPTRDRAFT-like protein [Medicago truncatula]
Length=201

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 66/120 (55%), Gaps = 1/120 (1%)
 Frame = +3

Query  207  LDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQ  386
            L+KQTK   +  +   P +   ++A++    AFV+FV+ N  A  + +V + L  +G   
Sbjct  48   LNKQTKSFVIGTVGNTP-LTATLSAKFNQTPAFVFFVIANGNASLHNLVMIALDILGPQY  106

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
                +   ++ +LD++ +AL  +  GAA  +  LG  GNSH RW+K+C+ F  +C + GG
Sbjct  107  DYKGLRLALIAILDMLTMALASAGDGAATFMSALGRNGNSHARWDKICDKFESYCNRGGG  166



>gb|EMT22194.1| hypothetical protein F775_09434 [Aegilops tauschii]
Length=196

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 4/120 (3%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL++Q+    + I+ T P +    TA++    AFVYFV+ N +A  Y +V L+   + + 
Sbjct  48   GLNRQSYTAVVAIVGTRP-LTQTFTAKFSDTPAFVYFVIANGVASLYNLVVLL---IRRC  103

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                R  +LVV  +D+V++ LL +    A ++  LG  GN H RWN +CN FG FC + G
Sbjct  104  LMQGRAHNLVVHRMDMVIMVLLATGAATAASMAELGKNGNLHTRWNPICNKFGSFCNRGG  163



>ref|XP_006844548.1| hypothetical protein AMTR_s00016p00176090 [Amborella trichopoda]
 gb|ERN06223.1| hypothetical protein AMTR_s00016p00176090 [Amborella trichopoda]
Length=181

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = +3

Query  267  IPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVAL  446
            +P+TA++ Y  AF +F   N+IA  Y+V+SL    + K Q S +     V +LDL+MV +
Sbjct  57   LPITAKYTYAPAFRFFTASNSIAFAYSVLSLTYLLLKKAQGSGQKIGFFVFLLDLIMVVV  116

Query  447  LFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFC  551
            + +    A A+  LG  GN H  W  +C  F  FC
Sbjct  117  VMAGSSGATAMAWLGKYGNPHTGWLPICGTFKSFC  151



>dbj|BAK00793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=189

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 67/118 (57%), Gaps = 3/118 (3%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKS  392
            KQT++V + + P  P    PV A++K   A +Y +V   +   Y++++   +       +
Sbjct  45   KQTEIVPLVLTP--PFRFGPVPAQFKDSPALIYLLVALCMTSLYSLLTAASSIKSMSSSA  102

Query  393  SRVASLVVIVL-DLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            S    L +++L D+V   ++ S+ G A AV  +G KGNSH RWNK+CN++ +FC  +G
Sbjct  103  SCAKGLFILILFDVVYAGIMASATGTAGAVAWVGLKGNSHTRWNKICNIYDKFCRHIG  160



>ref|XP_003528452.1| PREDICTED: CASP-like protein POPTRDRAFT_758901-like [Glycine 
max]
 gb|KHN07261.1| CASP-like protein [Glycine soja]
Length=160

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 13/104 (13%)
 Frame = +3

Query  264  NIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVL---TSVGKGQKSSRVASLVVIVLDLV  434
            N+  TA++    AF YFVV  AIACGY+++ L     TS+G+          +V++LD+V
Sbjct  38   NLTFTAKYSNDPAFKYFVVAEAIACGYSLILLFTCSQTSLGR----------LVLILDVV  87

Query  435  MVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +  LL SS  AA A+  +G KGN+H  W  +C    +FC  V G
Sbjct  88   IAMLLTSSVSAALAIAHVGKKGNTHAGWLPICGQVPKFCDHVTG  131



>ref|XP_010449919.1| PREDICTED: CASP-like protein 1D1 [Camelina sativa]
Length=195

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = +3

Query  264  NIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI---VLDLV  434
             IP TA++    A +YFVV  ++AC Y+++S  L +V   +K S  ++++++   ++D V
Sbjct  66   RIP-TAKFTNSPALIYFVVALSVACVYSILS-TLATVSAFKKPSSCSAILLLNLAIMDAV  123

Query  435  MVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            MV ++ S+ GA   V  LG KGN  VRW K+C+ + +FC  V G
Sbjct  124  MVGIVASATGAGGGVAYLGLKGNKQVRWVKICHAYDKFCRHVAG  167



>ref|XP_008799291.1| PREDICTED: CASP-like protein POPTRDRAFT_820933 [Phoenix dactylifera]
Length=196

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 76/123 (62%), Gaps = 11/123 (9%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVT--AEWKYMSAFVYFVVVNAIACGYAVVSLVLT--SVG  377
             KQTK+V + + P      IPV   A++ Y  A +YFV   ++A  ++V++ +++  S+ 
Sbjct  53   SKQTKLVNVPLYP------IPVIMHAKFNYSPALIYFVAAISLALLHSVLTGLVSALSIY  106

Query  378  KGQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQ  557
            K   ++++  LV+  LD +++ ++ S+ GA  ++  +G KGNSH+ W+KVCN++ +FC  
Sbjct  107  KPAPATKLL-LVLAFLDSLILGVVASATGAVASIAYIGLKGNSHIDWHKVCNIYDKFCRY  165

Query  558  VGG  566
            VG 
Sbjct  166  VGS  168



>gb|KDP40020.1| hypothetical protein JCGZ_02018 [Jatropha curcas]
Length=200

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 69/120 (58%), Gaps = 7/120 (6%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKS  392
            KQT+  +   +P LP   +PV A++ +  AF+Y V   ++AC Y++++  L S+G   K 
Sbjct  57   KQTEDAS---VPGLP-FRVPVEAKFNHSPAFIYLVAALSVACLYSIIT-TLASLGVIAKP  111

Query  393  SRVASLVV--IVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
                  ++   + D+V++ ++ ++ G A  V  +G KGNSH  W K+CNV+ +FC  VG 
Sbjct  112  IYATQFLLYYTIWDVVLLGIVAAATGTAGGVAYIGLKGNSHTGWIKICNVYDKFCRHVGS  171



>emb|CBI26108.3| unnamed protein product [Vitis vinifera]
Length=148

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  216  QTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSS  395
            QTK++A+  +P L    +   A+++   AF+YFV   ++   Y++++ + + +   + S 
Sbjct  6    QTKLIAVAGVPVL----VSNKAKFQNSPAFIYFVAALSVVGLYSIITTLASFIFISKPSC  61

Query  396  RVASLVVIVL-DLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
               +++ + + D++M+ L  S+ G A  V  +G KGNSHV WNKVCN + +FC  VGG
Sbjct  62   STKTILHLAIWDVLMLGLAASATGTAGGVAYVGLKGNSHVGWNKVCNTYDKFCRHVGG  119



>ref|NP_197033.1| casparian strip membrane protein 5 [Arabidopsis thaliana]
 sp|Q9LXF3.1|CASP5_ARATH RecName: Full=Casparian strip membrane protein 5; Short=AtCASP5 
[Arabidopsis thaliana]
 emb|CAB89339.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42012.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39953.1| At5g15290 [Arabidopsis thaliana]
 gb|AED92144.1| casparian strip membrane protein 5 [Arabidopsis thaliana]
 gb|AEJ82275.1| casparian strip protein 5 [Cloning vector pCASP5::CASP5:GFP]
 gb|AEJ82285.1| casparian strip protein 5 [Cloning vector p35S::CASP5:GFP]
Length=187

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 2/109 (2%)
 Frame = +3

Query  246  PTLPAMN--IPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI  419
             TLP     I   AE+  + A  +FVV NA+  GY ++SL L  V   ++ ++   +++I
Sbjct  52   ETLPFFTQFIRFQAEYNDLPALTFFVVANAVVSGYLILSLTLAFVHIVKRKTQNTRILLI  111

Query  420  VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +LD+ M+ LL S   +A A+  L + GN+   W  +C  F  FC ++ G
Sbjct  112  ILDVAMLGLLTSGASSAAAIVYLAHNGNNKTNWFAICQQFNSFCERISG  160



>ref|XP_010440275.1| PREDICTED: CASP-like protein 1D1 [Camelina sativa]
Length=195

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = +3

Query  264  NIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI---VLDLV  434
             IP TA++    A +YFVV  ++AC Y+++S  L +V   +K S  ++++++   ++D V
Sbjct  66   RIP-TAKFTNSPALIYFVVALSVACIYSILS-TLATVSAFKKPSSCSAILLLNLAIMDAV  123

Query  435  MVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            MV ++ S+ GA   V  LG KGN  VRW K+C+ + +FC  V G
Sbjct  124  MVGIVASATGAGGGVAYLGLKGNKQVRWVKICHAYDKFCRHVAG  167



>ref|XP_002276229.1| PREDICTED: CASP-like protein 1D1 [Vitis vinifera]
 sp|A7NW79.2|CSPL7_VITVI RecName: Full=CASP-like protein 1D1; Short=VvCASPL1D1 [Vitis 
vinifera]
Length=208

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  216  QTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSS  395
            QTK++A+  +P L    +   A+++   AF+YFV   ++   Y++++ + + +   + S 
Sbjct  66   QTKLIAVAGVPVL----VSNKAKFQNSPAFIYFVAALSVVGLYSIITTLASFIFISKPSC  121

Query  396  RVASLVVIVL-DLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
               +++ + + D++M+ L  S+ G A  V  +G KGNSHV WNKVCN + +FC  VGG
Sbjct  122  STKTILHLAIWDVLMLGLAASATGTAGGVAYVGLKGNSHVGWNKVCNTYDKFCRHVGG  179



>ref|XP_011017493.1| PREDICTED: casparian strip membrane protein 5 [Populus euphratica]
 ref|XP_011017501.1| PREDICTED: casparian strip membrane protein 5 [Populus euphratica]
Length=188

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = +3

Query  267  IPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVAL  446
            I + A++  + +  +FV+ N+I CGY V+S  L+     ++ +R+  +++++ D  MV L
Sbjct  62   IIIRAKYNDLPSLTFFVIANSIVCGYLVLSFPLSISHFIRREARITRIILVIFDTAMVEL  121

Query  447  LFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            L +   AA  V  L +KGN++  W  +C  F  FC ++ G
Sbjct  122  LTAGASAATVVVYLAHKGNANANWLAICQQFNNFCERISG  161



>ref|XP_003579154.1| PREDICTED: CASP-like protein 1B1 [Brachypodium distachyon]
Length=196

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 69/120 (58%), Gaps = 5/120 (4%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL++Q+    + I+ T P +    TA++K   AFVYFV+ NAIA  Y +V L +  + +G
Sbjct  49   GLNRQSYTAVVAIVGTKP-LTQTFTAQFKDTPAFVYFVIANAIASLYNLVVLAMRRLVQG  107

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                RV  LV+ + D+V++ LL +    A ++  LG  GN H  WN +C+ FG FC + G
Sbjct  108  ----RVQRLVLHMGDMVIMLLLATGAATAASMAELGKNGNLHAHWNPMCDKFGSFCNRGG  163



>ref|XP_009121585.1| PREDICTED: casparian strip membrane protein ARALYDRAFT_488377 
[Brassica rapa]
Length=187

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = +3

Query  246  PTLP--AMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI  419
             TLP  A  I   AE+  + A  +FV+ NA+  GY ++SL L  V   +  ++ + +++I
Sbjct  52   ETLPFFAQFIRFHAEYSDLPALTFFVIANAVVSGYLILSLPLAFVHIVKSKTQNSRVLLI  111

Query  420  VLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +LD+ M+ LL +   +A A+  L +KGN++  W  +C  F  FC ++ G
Sbjct  112  ILDVAMLGLLTAGASSAAAIVYLAHKGNNNTNWFSICQQFNSFCERISG  160



>ref|XP_009609035.1| PREDICTED: casparian strip membrane protein 3-like [Nicotiana 
tomentosiformis]
Length=186

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 56/108 (52%), Gaps = 2/108 (2%)
 Frame = +3

Query  249  TLPAMN--IPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIV  422
            TLP+    I   AE+K +  F +FVV N I   Y  VSLVL+ +      +R+  +V++ 
Sbjct  53   TLPSFTEFIRFKAEYKDLPTFTFFVVANGIVSAYLAVSLVLSILHIVMAGARITRVVLVF  112

Query  423  LDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             D VM++ L S   AA A+  L +KGN    W  +C  +  FC +  G
Sbjct  113  FDTVMMSFLTSGASAAAAIVYLAHKGNERANWIAICQQYNSFCDRASG  160



>ref|XP_008799287.1| PREDICTED: CASP-like protein MA4_106O17.50 isoform X2 [Phoenix 
dactylifera]
Length=199

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +3

Query  288  KYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGGA  467
            +Y SAFVYF+VVN I   Y+++SL +  + +G   SR  ++ + + DLVMV LLFS  GA
Sbjct  81   RYSSAFVYFIVVNVIVLIYSIISLAMALLNRG--GSRRIAMHLSIADLVMVVLLFSCNGA  138

Query  468  AFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            A A+ ++  KG     W K C    +FCG +
Sbjct  139  AAAISVVADKGLIRFAWPKFCYALHKFCGHI  169



>ref|XP_010434941.1| PREDICTED: CASP-like protein 1D1 [Camelina sativa]
Length=195

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = +3

Query  264  NIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVI---VLDLV  434
             IP TA +    A +YFVV  ++AC Y+++S V T V   +K S  ++++++   ++D V
Sbjct  66   RIP-TANFTNSPALIYFVVALSVACIYSILSTVAT-VSAFKKPSSCSAILLLNLAIMDAV  123

Query  435  MVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            MV ++ S+ GA   V  LG KGN  VRW K+C+ + +FC  V G
Sbjct  124  MVGIVASATGAGGGVAYLGLKGNKQVRWVKICHAYDKFCRHVAG  167



>ref|XP_008799285.1| PREDICTED: CASP-like protein MA4_106O17.50 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008799286.1| PREDICTED: CASP-like protein MA4_106O17.50 isoform X1 [Phoenix 
dactylifera]
Length=211

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +3

Query  288  KYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGGA  467
            +Y SAFVYF+VVN I   Y+++SL +  + +G   SR  ++ + + DLVMV LLFS  GA
Sbjct  93   RYSSAFVYFIVVNVIVLIYSIISLAMALLNRG--GSRRIAMHLSIADLVMVVLLFSCNGA  150

Query  468  AFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
            A A+ ++  KG     W K C    +FCG +
Sbjct  151  AAAISVVADKGLIRFAWPKFCYALHKFCGHI  181



>gb|EMS67341.1| hypothetical protein TRIUR3_17102 [Triticum urartu]
Length=189

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 70/119 (59%), Gaps = 5/119 (4%)
 Frame = +3

Query  213  KQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKS  392
            KQT++V + + P  P    PV A++K   A +Y +V   +   Y++++   TSV     S
Sbjct  45   KQTEMVPLVLTP--PFRFGPVPAQFKDSPALIYLLVALCMTSLYSLLTAA-TSVKSMSSS  101

Query  393  SRVAS--LVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
            +  A    V+I+LD+V   ++ S+ G A AV  +G KGNSH RWNK+CN++ +FC  +G
Sbjct  102  ASCAKGIFVLILLDVVYAGIMASATGTAGAVAWVGLKGNSHTRWNKICNIYDKFCRHIG  160



>gb|KDO77548.1| hypothetical protein CISIN_1g029003mg [Citrus sinensis]
Length=200

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 64/121 (53%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+K+TK   +  + T P +    +A++++  AFV+FV+ N +   + VV + +   GK 
Sbjct  45   GLNKETKTFVVATVGTTP-IKATFSAKFQHTPAFVFFVIANGLVSFHNVVMIAVNLFGKK  103

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +   ++ + DL+   L+ +    A  +  LG  GNSH RWNK+C+ F  FC   G
Sbjct  104  LDYKGLRLAMIAIFDLLNTVLVSAGVNGAVYMAELGKYGNSHARWNKICDRFKTFCDHGG  163

Query  564  G  566
            G
Sbjct  164  G  164



>ref|XP_011071479.1| PREDICTED: CASP-like protein 1 [Sesamum indicum]
Length=218

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 69/119 (58%), Gaps = 7/119 (6%)
 Frame = +3

Query  216  QTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLT--SVGKGQK  389
            QTK V +Q     P     + A++ +  AF+YFV   ++A  Y++++ +L+  ++ K   
Sbjct  76   QTKQVPLQ----FPPFQASLPAKFNHSPAFIYFVAALSVAGLYSIITTLLSFYALLKPGC  131

Query  390  SSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
              +V S  VI  D++++ ++ S+ GAA AV  +G +GNSH+ W K CNV+  FC  VG 
Sbjct  132  CPQVLSHFVI-FDVLLLGVVASATGAAGAVAYIGLRGNSHLGWKKACNVYDEFCKHVGS  189



>ref|XP_008371694.1| PREDICTED: CASP-like protein POPTRDRAFT_810994 [Malus domestica]
Length=164

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 56/102 (55%), Gaps = 7/102 (7%)
 Frame = +3

Query  261  MNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMV  440
            +N+   A++ +  AF YFV+V+AI  GY ++ L+L+S G   +        VI+LD+V  
Sbjct  37   LNLTFKAKYNHSPAFTYFVIVDAIISGYNLIILLLSSKGSLWRX-------VIILDVVAA  89

Query  441  ALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             LL SS  AA A+  +G KGN H  W  +C    +FC    G
Sbjct  90   LLLTSSMSAALAIAQVGKKGNXHAGWLPICGQVSKFCNHXTG  131



>ref|XP_009352921.1| PREDICTED: CASP-like protein POPTRDRAFT_810994 [Pyrus x bretschneideri]
Length=138

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 7/102 (7%)
 Frame = +3

Query  261  MNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMV  440
            +N+   A++     F+YFV+V AI  GY ++ L+L+S G   +       +VI+LD+V  
Sbjct  11   LNLTFKAKFSDSPTFMYFVIVEAIVSGYNLIILLLSSKGSLWR-------IVIILDVVAA  63

Query  441  ALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             LL SS  AA A+G +  KGN+H  W  +C    +FC  V G
Sbjct  64   LLLTSSMSAALAIGQVAKKGNTHAGWLPICGQVSKFCNHVNG  105



>ref|XP_008799288.1| PREDICTED: CASP-like protein MA4_106O17.50 [Phoenix dactylifera]
Length=199

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = +3

Query  291  YMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGGAA  470
            Y +A+VYF+V N +   Y ++SLV++   +    SR   L + + DL+MVALLFSS GAA
Sbjct  82   YSAAYVYFIVANVLVFVYTLISLVISLANR--SGSRSMELPLNIADLLMVALLFSSNGAA  139

Query  471  FAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
             A+ ++   G S + W K C    +FCG V  
Sbjct  140  IAIDIVAEHGQSRLGWGKFCGDVHKFCGHVAA  171



>ref|XP_002276662.1| PREDICTED: CASP-like protein 1B2 [Vitis vinifera]
 emb|CBI39011.3| unnamed protein product [Vitis vinifera]
Length=204

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+++TK + +  I T P +   + A++++  AFV+FVV N +A  Y +V L +   G+ 
Sbjct  49   GLNQETKTLLVGTIGTTP-IRATLKAKFQHTPAFVFFVVANGLASVYNLVMLGVDVFGRK  107

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +  +++ +LD+V+VA++ +   +A  +  LG  GNSH +WNK+C+ F  FC Q G
Sbjct  108  LDCKGLRLVIISILDMVIVAVVAAGASSAAFMAELGKNGNSHAKWNKICDKFESFCHQGG  167

Query  564  G  566
            G
Sbjct  168  G  168



>ref|XP_009385516.1| PREDICTED: CASP-like protein VIT_17s0000g00560 [Musa acuminata 
subsp. malaccensis]
Length=176

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 64/119 (54%), Gaps = 17/119 (14%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            G +KQT VVA             + A +++  AF +FVV NAIACGY+VVSL   S    
Sbjct  43   GFNKQTSVVA----------GFAIEASYRFSPAFKFFVVGNAIACGYSVVSLPFVS----  88

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
               + V    + + DL+ + LL ++  AA AVG +G  GN  + W KVC  + RFCG+ 
Sbjct  89   ---NLVEGCTLNLFDLMNLGLLMAAAAAASAVGYVGKHGNDEIGWAKVCPYYERFCGRT  144



>sp|A7QC16.2|CSPL1_VITVI RecName: Full=CASP-like protein 1B2; Short=VvCASPL1B2 [Vitis 
vinifera]
 emb|CAN76914.1| hypothetical protein VITISV_004162 [Vitis vinifera]
Length=204

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = +3

Query  204  GLDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKG  383
            GL+++TK + +  I T P +   + A++++  AFV+FVV N +A  Y +V L +   G+ 
Sbjct  49   GLNQETKTLLVGTIGTTP-IRATLKAKFQHTPAFVFFVVANGLASVYNLVMLGVDVFGRK  107

Query  384  QKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                 +  +++ +LD+V+VA++ +   +A  +  LG  GNSH +WNK+C+ F  FC Q G
Sbjct  108  LDCKGLRLVIISILDMVIVAVVAAGASSAAFMAELGKNGNSHAKWNKICDKFESFCHQGG  167

Query  564  G  566
            G
Sbjct  168  G  168



>ref|XP_009758573.1| PREDICTED: CASP-like protein 1B2 [Nicotiana sylvestris]
Length=214

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 1/120 (1%)
 Frame = +3

Query  207  LDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQ  386
            L+KQ K   +  I T P +   +TA++++  AFV+FV+ N +   + ++ L    +G   
Sbjct  60   LNKQKKTFVVATIGTTP-IQATLTAKFQHTPAFVFFVIANGLCSLHNLLMLAACFIGSKY  118

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
                +   V+ VLD++ VAL+     AA  +G LG  GNSH RW K+C+ F  +C    G
Sbjct  119  DFKGLRFYVIGVLDMMNVALVSGGASAAAFMGQLGKDGNSHARWKKICDKFDVYCSHGEG  178



>ref|XP_010241335.1| PREDICTED: CASP-like protein 1D1 [Nelumbo nucifera]
Length=204

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 74/121 (61%), Gaps = 5/121 (4%)
 Frame = +3

Query  210  DKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQK  389
             KQT+ + + ++P +PA  +   A++ +  AF+YFV   ++AC + ++S  LTS+    K
Sbjct  60   SKQTEFIPIPLLP-VPA-RVAKAAKFNHSPAFIYFVAALSVACLHGLIS-TLTSLATIWK  116

Query  390  SSRVASLVVIVL--DLVMVALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
                  L++ +   D++M+ L+ S+ G A +V  +G +GNS+V W+K+C+V+ +FC  +G
Sbjct  117  PCPSKKLLLHLAFSDVLMLGLVASATGTAGSVAYIGLRGNSNVGWSKICSVYDKFCRHIG  176

Query  564  G  566
             
Sbjct  177  S  177



>ref|XP_010904769.1| PREDICTED: CASP-like protein 1E1 [Elaeis guineensis]
Length=200

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query  291  YMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSSGGAA  470
            Y +A+VYF+V N +   Y ++SLV++   +    S +  L + + D++MV LLFSS GAA
Sbjct  83   YSAAYVYFIVANVLVFFYTLISLVISLANR--SGSSIMQLPLNIADILMVVLLFSSNGAA  140

Query  471  FAVGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
             A+ ++   G SH  W K C+ F +FC ++
Sbjct  141  IAIDIVAEHGQSHFGWAKFCDDFYKFCSRI  170



>gb|KDO82981.1| hypothetical protein CISIN_1g044764mg [Citrus sinensis]
Length=186

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 58/98 (59%), Gaps = 0/98 (0%)
 Frame = +3

Query  273  VTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLF  452
            V AE+    +F +FV+ N+I CGY  +S+ L+     + +++ + ++++V DLVM+ L+ 
Sbjct  63   VRAEYDDHPSFKFFVIANSIVCGYLAISVPLSIFHIIRTAAKKSRILLLVFDLVMLTLVT  122

Query  453  SSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            +   +A A+  L +KGN+   W   C +F  FC ++ G
Sbjct  123  AGASSATAIVYLAHKGNTSANWFAFCQLFDSFCERISG  160



>gb|KFK30020.1| hypothetical protein AALP_AA7G207300 [Arabis alpina]
Length=119

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +3

Query  309  YFVVVNAIACGYAVVSLVLT-SVGKGQKSSRVASLVVIVLDLVMVALLFSSGGAAFAVGL  485
            YFVV  ++AC Y+++S   T S  K   SS +  L + ++D++MV ++ S+ GA   V  
Sbjct  5    YFVVALSVACFYSILSTFATLSAIKKPSSSAILLLNLAIMDVLMVGIVASATGAGGGVAY  64

Query  486  LGYKGNSHVRWNKVCNVFGRFCGQVGG  566
            LG KGN  VRW K+C+++ +FC   GG
Sbjct  65   LGLKGNKDVRWRKICDIYDKFCRHTGG  91



>ref|XP_006353028.1| PREDICTED: CASP-like protein POPTRDRAFT_798217-like [Solanum 
tuberosum]
Length=199

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = +3

Query  207  LDKQTKVVAMQIIPTLPAMNIPVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQ  386
            L+ Q K   +  + T P +   + A++++  AFV+FV+ N +   + ++ L    +G   
Sbjct  43   LNNQKKTFVVATMGTTP-IQATLNAKFQHTPAFVFFVIANGLCSLHNLLMLAFCFIGSKY  101

Query  387  KSSRVASLVVIVLDLVMVALLFSSGGAAFA--VGLLGYKGNSHVRWNKVCNVFGRFCGQV  560
                +   V+ +LD++ VAL+  SGGA  A  +G LG  GNSH RWNK+C+ F  FC   
Sbjct  102  DYKGLRLYVIGILDMINVALI--SGGATSAAFMGQLGRDGNSHARWNKICDKFYTFCSHG  159

Query  561  GG  566
             G
Sbjct  160  EG  161



>sp|P0DI35.1|CASP1_LACSI RecName: Full=Casparian strip membrane protein 1; Short=LsCASP1 
[Lactuca saligna]
Length=192

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 0/96 (0%)
 Frame = +3

Query  279  AEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVGKGQKSSRVASLVVIVLDLVMVALLFSS  458
            AE+    +F  FV+VNAI C Y V++L L+ V   + ++R + +++I++D VM+ALL + 
Sbjct  65   AEYDDFRSFRLFVIVNAIVCAYFVLTLPLSIVHIMRSAARGSRILLIIMDTVMLALLTAG  124

Query  459  GGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVGG  566
              AA ++  L + GN+   W  VC  +G FC    G
Sbjct  125  ASAAASIVYLAHNGNTSTNWLPVCQQYGDFCQGASG  160



>ref|XP_002884576.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7L5G6.1|CSPLD_ARALL RecName: Full=CASP-like protein 1D2; Short=AlCASPL1D2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60835.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=200

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 61/101 (60%), Gaps = 5/101 (5%)
 Frame = +3

Query  270  PVTAEWKYMSAFVYFVVVNAIACGYAVVSLVLTSVG---KGQKSSRVASLVVIVLDLVMV  440
            PV+AE+    AF++FVV   +   YA++S  L S+    K + ++RV S+ +  LD+VM+
Sbjct  75   PVSAEFNDSPAFIFFVVALVVTSFYALMS-TLVSISLLLKPEFTARV-SVYLASLDMVML  132

Query  441  ALLFSSGGAAFAVGLLGYKGNSHVRWNKVCNVFGRFCGQVG  563
             +L S+ G A  V  +  KGN  V WNK+CNV+ +FC  + 
Sbjct  133  GILASATGTAGGVAYIALKGNKEVGWNKICNVYDKFCRYIA  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1450662993712