BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c40236_g1_i1 len=786 path=[764:0-785]

Length=786
                                                                      Score     E

ref|XP_006347977.1|  PREDICTED: uclacyanin-2-like                       178   1e-51   
ref|XP_004229737.1|  PREDICTED: uclacyanin-3-like                       176   8e-51   
ref|XP_009617784.1|  PREDICTED: uclacyanin-3-like                       166   5e-47   
ref|XP_009758781.1|  PREDICTED: uclacyanin-3-like                       162   1e-45   
ref|XP_004248538.1|  PREDICTED: mavicyanin-like                         156   2e-43   
ref|XP_006338895.1|  PREDICTED: blue copper protein-like                154   1e-42   
ref|XP_009797132.1|  PREDICTED: uclacyanin-3-like                       141   1e-37   
ref|XP_010052796.1|  PREDICTED: mavicyanin-like                         140   4e-37   
ref|XP_009604686.1|  PREDICTED: uclacyanin-3-like                       139   6e-37   
gb|ADV57638.1|  copper binding protein 3                                136   1e-35   
ref|XP_007052334.1|  Uclacyanin 3, putative                             130   3e-33   
ref|XP_009373210.1|  PREDICTED: uclacyanin-3                            129   4e-33   
ref|XP_008375772.1|  PREDICTED: uclacyanin-2                            127   2e-32   
ref|XP_004133765.1|  PREDICTED: blue copper protein-like                125   1e-31   
ref|XP_002272263.1|  PREDICTED: uclacyanin-3                            125   1e-31   Vitis vinifera
emb|CAN66310.1|  hypothetical protein VITISV_027162                     125   2e-31   Vitis vinifera
gb|KDP28869.1|  hypothetical protein JCGZ_14640                         125   2e-31   
ref|XP_011032393.1|  PREDICTED: mavicyanin-like                         125   4e-31   
ref|XP_002526464.1|  Uclacyanin-2 precursor, putative                   123   1e-30   Ricinus communis
ref|XP_008232494.1|  PREDICTED: uclacyanin-2-like                       122   4e-30   
ref|XP_007219192.1|  hypothetical protein PRUPE_ppa016927mg             122   4e-30   
ref|XP_006375159.1|  hypothetical protein POPTR_0014s04850g             120   1e-29   
ref|XP_010275467.1|  PREDICTED: uclacyanin-3-like                       120   2e-29   
ref|XP_010524439.1|  PREDICTED: uclacyanin-2                            120   3e-29   
gb|EPS65671.1|  hypothetical protein M569_09108                         117   5e-29   
ref|XP_008437773.1|  PREDICTED: basic blue protein                      116   3e-28   
ref|XP_010026035.1|  PREDICTED: blue copper protein                     117   3e-28   
ref|XP_004306982.1|  PREDICTED: uclacyanin-2-like                       117   4e-28   
ref|XP_002285736.1|  PREDICTED: blue copper protein-like                116   4e-28   Vitis vinifera
ref|XP_006445439.1|  hypothetical protein CICLE_v10022525mg             116   4e-28   
ref|XP_002302319.1|  plastocyanin-like domain-containing family p...    116   5e-28   Populus trichocarpa [western balsam poplar]
ref|XP_009602744.1|  PREDICTED: uclacyanin-3-like                       117   8e-28   
emb|CBI19206.3|  unnamed protein product                                116   1e-27   
gb|ABK92755.1|  unknown                                                 115   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_002302318.1|  plastocyanin-like domain-containing family p...    115   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011016865.1|  PREDICTED: blue copper protein-like                114   3e-27   
ref|XP_002513980.1|  Blue copper protein precursor, putative            113   6e-27   Ricinus communis
ref|XP_009763857.1|  PREDICTED: uclacyanin-3-like                       114   7e-27   
gb|KDP41427.1|  hypothetical protein JCGZ_15834                         113   1e-26   
ref|XP_011016866.1|  PREDICTED: blue copper protein-like                112   2e-26   
gb|AFK39061.1|  unknown                                                 111   4e-26   
ref|XP_003602846.1|  Blue copper protein                                111   4e-26   
gb|ACJ84190.1|  unknown                                                 111   4e-26   Medicago truncatula
gb|ACJ83835.1|  unknown                                                 111   4e-26   Medicago truncatula
gb|ACJ85992.1|  unknown                                                 111   4e-26   Medicago truncatula
ref|XP_010258754.1|  PREDICTED: uclacyanin-2-like                       110   5e-26   
ref|XP_010101008.1|  Blue copper protein                                111   5e-26   
ref|XP_003570004.1|  PREDICTED: mavicyanin                              111   7e-26   
ref|XP_007141217.1|  hypothetical protein PHAVU_008G177100g             111   8e-26   
ref|XP_010104273.1|  Blue copper protein                                110   1e-25   
gb|KHG05659.1|  Blue copper                                             110   1e-25   
gb|EMS47632.1|  Blue copper protein                                     110   1e-25   
ref|XP_009417598.1|  PREDICTED: blue copper protein-like                110   2e-25   
gb|ACJ83883.1|  unknown                                                 110   2e-25   Medicago truncatula
gb|AFK43360.1|  unknown                                                 110   2e-25   
ref|XP_007018694.1|  Cupredoxin superfamily protein, putative           109   2e-25   
ref|XP_010247016.1|  PREDICTED: uclacyanin-3                            110   2e-25   
ref|XP_004152622.1|  PREDICTED: blue copper protein-like                110   2e-25   
ref|XP_007226416.1|  hypothetical protein PRUPE_ppa023338mg             108   2e-25   
gb|EYU36477.1|  hypothetical protein MIMGU_mgv1a014161mg                109   2e-25   
ref|XP_006658198.1|  PREDICTED: blue copper protein-like                109   3e-25   
ref|XP_010035616.1|  PREDICTED: blue copper protein-like                110   3e-25   
ref|XP_008219351.1|  PREDICTED: blue copper protein                     108   4e-25   
dbj|BAJ90037.1|  predicted protein                                      108   4e-25   
gb|KDO59873.1|  hypothetical protein CISIN_1g043413mg                   108   5e-25   
ref|XP_006433913.1|  hypothetical protein CICLE_v10002591mg             108   5e-25   
ref|XP_010544564.1|  PREDICTED: uclacyanin-2                            108   5e-25   
ref|NP_001234979.1|  uncharacterized protein LOC100305666 precursor     108   6e-25   
ref|XP_009586697.1|  PREDICTED: blue copper protein-like                108   6e-25   
ref|XP_003529032.1|  PREDICTED: uclacyanin-2-like                       108   7e-25   
ref|XP_003521063.1|  PREDICTED: uclacyanin-2                            107   9e-25   
gb|EMS61517.1|  Early nodulin-like protein 2                            108   1e-24   
ref|XP_006473004.1|  PREDICTED: blue copper protein-like                107   1e-24   
ref|XP_006385823.1|  hypothetical protein POPTR_0003s15000g             107   1e-24   
gb|EMT26506.1|  Blue copper protein                                     105   1e-24   
ref|XP_008230134.1|  PREDICTED: blue copper protein                     108   2e-24   
ref|XP_006385822.1|  hypothetical protein POPTR_0003s15000g             107   2e-24   
emb|CAN61581.1|  hypothetical protein VITISV_008034                     107   2e-24   Vitis vinifera
ref|XP_011074212.1|  PREDICTED: blue copper protein                     107   2e-24   
ref|XP_006447468.1|  hypothetical protein CICLE_v10018339mg             107   2e-24   
ref|XP_006469730.1|  PREDICTED: early nodulin-20-like                   108   2e-24   
ref|XP_010522318.1|  PREDICTED: blue copper protein                     108   2e-24   
gb|KFK31132.1|  hypothetical protein AALP_AA6G072100                    108   2e-24   
dbj|BAK00577.1|  predicted protein                                      106   3e-24   
ref|XP_004287916.1|  PREDICTED: uncharacterized protein LOC101307724    107   3e-24   
gb|KHG25479.1|  Blue copper                                             106   3e-24   
ref|XP_010919749.1|  PREDICTED: blue copper protein-like                106   3e-24   
ref|XP_007018695.1|  Cupredoxin superfamily protein, putative           105   3e-24   
ref|XP_008466191.1|  PREDICTED: blue copper protein-like                106   3e-24   
ref|XP_004956416.1|  PREDICTED: blue copper protein-like                106   4e-24   
emb|CAC39044.1|  uclacyanin 3-like protein                              106   4e-24   Oryza sativa [red rice]
gb|KEH17865.1|  plastocyanin-like domain protein                        106   4e-24   
gb|ACU17256.1|  unknown                                                 106   4e-24   Glycine max [soybeans]
ref|XP_007216249.1|  hypothetical protein PRUPE_ppa017076mg             107   4e-24   
ref|NP_001236244.1|  uncharacterized protein LOC100306522 precursor     105   4e-24   
ref|XP_004237949.1|  PREDICTED: blue copper protein                     105   4e-24   
ref|XP_004487369.1|  PREDICTED: blue copper protein-like                107   5e-24   
ref|NP_001047603.2|  Os02g0653200                                       106   5e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009770624.1|  PREDICTED: blue copper protein-like                105   5e-24   
ref|XP_003602845.1|  Blue copper protein                                105   6e-24   
ref|XP_008798824.1|  PREDICTED: blue copper protein-like                105   6e-24   
ref|XP_004987264.1|  PREDICTED: uclacyanin-2-like                       105   6e-24   
ref|NP_001057157.1|  Os06g0218600                                       105   6e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002297929.1|  hypothetical protein POPTR_0001s11680g             105   7e-24   Populus trichocarpa [western balsam poplar]
gb|EAZ00173.1|  hypothetical protein OsI_22178                          105   8e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_011022375.1|  PREDICTED: stellacyanin-like                       105   8e-24   
sp|Q41001.1|BCP_PEA  RecName: Full=Blue copper protein; Flags: Pr...    105   9e-24   Pisum sativum [garden pea]
gb|KHN25766.1|  Early nodulin-like protein 1                            105   9e-24   
ref|XP_003540323.1|  PREDICTED: blue copper protein-like                105   9e-24   
ref|XP_008341968.1|  PREDICTED: blue copper protein-like                106   9e-24   
ref|XP_002448273.1|  hypothetical protein SORBIDRAFT_06g024270          105   1e-23   Sorghum bicolor [broomcorn]
gb|ACU23845.1|  unknown                                                 105   1e-23   Glycine max [soybeans]
ref|XP_009342269.1|  PREDICTED: blue copper protein                     105   1e-23   
ref|NP_001058695.1|  Os07g0105000                                       105   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008362376.1|  PREDICTED: blue copper protein-like                104   1e-23   
ref|XP_004515341.1|  PREDICTED: uclacyanin-2-like                       104   1e-23   
ref|XP_006659514.1|  PREDICTED: blue copper protein-like                104   2e-23   
ref|XP_010413579.1|  PREDICTED: uclacyanin-3-like                       103   2e-23   
ref|XP_009373387.1|  PREDICTED: blue copper protein-like                104   2e-23   
ref|XP_011026746.1|  PREDICTED: mavicyanin                              103   2e-23   
ref|NP_191587.1|  uclacyanin 3                                          104   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008373105.1|  PREDICTED: blue copper protein                     103   3e-23   
ref|XP_004136269.1|  PREDICTED: blue copper protein-like                103   4e-23   
ref|XP_010266815.1|  PREDICTED: blue copper protein-like                103   4e-23   
ref|XP_009391330.1|  PREDICTED: blue copper protein-like                103   4e-23   
ref|XP_006655916.1|  PREDICTED: blue copper protein-like                103   4e-23   
gb|KHG06922.1|  Blue copper                                             103   4e-23   
ref|XP_007136283.1|  hypothetical protein PHAVU_009G033500g             103   4e-23   
ref|XP_010512339.1|  PREDICTED: uclacyanin-3-like                       102   4e-23   
ref|XP_004299681.1|  PREDICTED: blue copper protein-like                103   5e-23   
gb|ACU19678.1|  unknown                                                 103   5e-23   Glycine max [soybeans]
ref|XP_003543376.1|  PREDICTED: blue copper protein-like                103   5e-23   
gb|KHN36563.1|  Early nodulin-like protein 1                            103   5e-23   
ref|NP_001152236.1|  blue copper protein precursor                      103   6e-23   Zea mays [maize]
ref|XP_007134460.1|  hypothetical protein PHAVU_010G049200g             102   6e-23   
ref|XP_007149946.1|  hypothetical protein PHAVU_005G112600g             103   6e-23   
ref|XP_003597041.1|  Blue copper protein                                103   7e-23   
gb|AFK47720.1|  unknown                                                 103   7e-23   
ref|XP_004953310.1|  PREDICTED: blue copper protein-like                102   8e-23   
ref|XP_004987263.1|  PREDICTED: uclacyanin-2-like                       102   9e-23   
ref|XP_006352033.1|  PREDICTED: early nodulin-20-like                   103   9e-23   
ref|XP_006578311.1|  PREDICTED: blue copper protein-like                103   1e-22   
ref|XP_002262831.1|  PREDICTED: mavicyanin                              102   1e-22   Vitis vinifera
ref|XP_006295902.1|  hypothetical protein CARUB_v10025032mg             103   1e-22   
gb|AFK38402.1|  unknown                                                 103   1e-22   
ref|XP_010469206.1|  PREDICTED: uclacyanin-3-like                       102   1e-22   
ref|XP_004501685.1|  PREDICTED: blue copper protein-like                102   1e-22   
emb|CAD41463.3|  OSJNBa0079A21.7                                        102   1e-22   Oryza sativa [red rice]
emb|CAH67255.1|  OSIGBa0101C23.7                                        102   1e-22   Oryza sativa [red rice]
ref|XP_010425458.1|  PREDICTED: mavicyanin-like                         101   1e-22   
gb|EAY95049.1|  hypothetical protein OsI_16864                          102   1e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001053468.1|  Os04g0545600                                       102   1e-22   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA36598.1|  TPA: hypothetical protein ZEAMMB73_027469              102   1e-22   
gb|ABN13629.1|  blue copper-like protein                                101   1e-22   Gossypium hirsutum [American cotton]
ref|XP_002515714.1|  Early nodulin 20 precursor, putative               103   2e-22   Ricinus communis
gb|KCW83086.1|  hypothetical protein EUGRSUZ_B00045                     101   2e-22   
ref|NP_001237874.1|  uncharacterized protein LOC100305865 precursor     100   2e-22   
ref|NP_001149787.1|  blue copper protein precursor                      101   2e-22   Zea mays [maize]
ref|XP_004251506.1|  PREDICTED: uclacyanin-3-like                       102   2e-22   
ref|XP_010506413.1|  PREDICTED: uclacyanin-2-like                       102   2e-22   
ref|XP_006647616.1|  PREDICTED: blue copper protein-like                102   2e-22   
ref|XP_010939704.1|  PREDICTED: blue copper protein-like                101   2e-22   
gb|AAM62707.1|  blue copper protein, putative                           101   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ABK26526.1|  unknown                                                 101   2e-22   Picea sitchensis
ref|XP_010909861.1|  PREDICTED: uclacyanin-2-like                       101   3e-22   
gb|KFK37280.1|  hypothetical protein AALP_AA4G236600                    101   3e-22   
ref|XP_006292167.1|  hypothetical protein CARUB_v10018373mg             101   3e-22   
ref|XP_002452820.1|  hypothetical protein SORBIDRAFT_04g033180          101   3e-22   Sorghum bicolor [broomcorn]
ref|XP_006397659.1|  hypothetical protein EUTSA_v10001642mg             101   3e-22   
ref|XP_008379599.1|  PREDICTED: blue copper protein-like                102   4e-22   
ref|XP_006291939.1|  hypothetical protein CARUB_v10018126mg             100   4e-22   
ref|XP_010514410.1|  PREDICTED: mavicyanin-like                         100   5e-22   
dbj|BAJ97976.1|  predicted protein                                      100   5e-22   
ref|XP_003602882.1|  Blue copper protein                                100   6e-22   
emb|CDX83667.1|  BnaC07g24070D                                          100   6e-22   
ref|XP_002877026.1|  hypothetical protein ARALYDRAFT_484503           99.8    6e-22   
ref|XP_006387434.1|  hypothetical protein POPTR_1040s00200g             100   7e-22   
ref|XP_010502682.1|  PREDICTED: mavicyanin-like                       99.8    7e-22   
ref|NP_191586.1|  cupredoxin superfamily protein                        100   8e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003602855.1|  Blue copper protein                                100   8e-22   
ref|NP_001238369.1|  uncharacterized protein LOC100306407 precursor     100   8e-22   
ref|XP_006848436.1|  hypothetical protein AMTR_s00013p00238100        99.4    9e-22   
ref|XP_009151984.1|  PREDICTED: mavicyanin                            99.8    9e-22   
ref|XP_010512340.1|  PREDICTED: uclacyanin-3-like                       100   9e-22   
ref|XP_002459207.1|  hypothetical protein SORBIDRAFT_02g000530        99.8    9e-22   Sorghum bicolor [broomcorn]
gb|KHN35486.1|  Blue copper protein                                     100   9e-22   
emb|CDY13690.1|  BnaA06g32330D                                        99.8    9e-22   
ref|XP_004168663.1|  PREDICTED: blue copper protein-like              99.4    1e-21   
ref|XP_004138792.1|  PREDICTED: blue copper protein-like              99.4    1e-21   
gb|KHN24517.1|  Blue copper protein                                   99.4    1e-21   
ref|XP_010469205.1|  PREDICTED: uclacyanin-3-like                       100   1e-21   
ref|NP_001149576.1|  blue copper protein precursor                    99.8    1e-21   Zea mays [maize]
ref|NP_001147368.1|  uclacyanin-2 precursor                           99.8    1e-21   Zea mays [maize]
ref|XP_010413578.1|  PREDICTED: uclacyanin-3-like                       100   1e-21   
ref|XP_006402599.1|  hypothetical protein EUTSA_v10006223mg             100   1e-21   
tpg|DAA59341.1|  TPA: uclacyanin-2                                    99.8    2e-21   
ref|XP_009132835.1|  PREDICTED: blue copper protein-like                100   2e-21   
ref|XP_009353238.1|  PREDICTED: blue copper protein-like                100   2e-21   
ref|XP_006395473.1|  hypothetical protein EUTSA_v10005008mg           98.6    2e-21   
gb|AAR15487.1|  Cu2+ plastocyanin-like                                99.0    2e-21   Arabidopsis arenosa
ref|NP_680152.1|  cupredoxin superfamily protein                      99.0    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180789.1|  uclacyanin 1                                          100   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003557700.1|  PREDICTED: blue copper protein-like              99.4    2e-21   
ref|XP_010675754.1|  PREDICTED: blue copper protein-like              99.0    2e-21   
dbj|BAF01024.1|  uclacyanin I - like predicted GPI-anchored protein     100   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006599708.1|  PREDICTED: blue copper protein-like              99.4    2e-21   
ref|XP_009341435.1|  PREDICTED: blue copper protein-like              99.8    2e-21   
gb|AAR15424.1|  Cu2+ plastocyanin-like                                99.0    2e-21   Sisymbrium irio
ref|XP_003602842.1|  Blue copper protein                              97.1    2e-21   
ref|XP_002309845.1|  UCLACYANIN 1 family protein                      99.8    2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006291852.1|  hypothetical protein CARUB_v10018027mg           99.0    2e-21   
ref|XP_010670421.1|  PREDICTED: basic blue protein-like               98.2    3e-21   
ref|XP_002887423.1|  hypothetical protein ARALYDRAFT_476354           98.2    3e-21   
ref|XP_006390684.1|  hypothetical protein EUTSA_v10019200mg           98.2    3e-21   
ref|XP_006653638.1|  PREDICTED: blue copper protein-like              98.6    3e-21   
ref|XP_010491367.1|  PREDICTED: stellacyanin-like                     98.6    3e-21   
ref|XP_006363305.1|  PREDICTED: blue copper protein-like              98.2    3e-21   
ref|XP_010510046.1|  PREDICTED: blue copper protein-like              99.8    3e-21   
gb|KFK34219.1|  hypothetical protein AALP_AA5G116200                  99.4    3e-21   
ref|XP_010106325.1|  Early nodulin-like protein 1                     98.6    3e-21   
gb|KFK33640.1|  hypothetical protein AALP_AA5G039900                  98.2    3e-21   
ref|XP_008441346.1|  PREDICTED: mavicyanin-like                       97.8    3e-21   
ref|XP_009130995.1|  PREDICTED: mavicyanin-like                       98.2    3e-21   
gb|AFK46705.1|  unknown                                               97.4    3e-21   
gb|KFK44343.1|  hypothetical protein AALP_AA1G245500                  99.8    4e-21   
ref|XP_010424736.1|  PREDICTED: mavicyanin-like                       98.2    4e-21   
ref|XP_010414015.1|  PREDICTED: blue copper protein-like              99.8    4e-21   
ref|XP_004973723.1|  PREDICTED: blue copper protein-like              97.8    4e-21   
emb|CDY04812.1|  BnaC05g17770D                                        97.8    4e-21   
gb|KFK41656.1|  hypothetical protein AALP_AA2G155800                  97.8    4e-21   
ref|XP_007151532.1|  hypothetical protein PHAVU_004G054700g           97.8    4e-21   
emb|CDY65457.1|  BnaC03g71950D                                        99.4    4e-21   
ref|XP_006653637.1|  PREDICTED: blue copper protein-like              96.3    5e-21   
ref|XP_006399230.1|  hypothetical protein EUTSA_v10014745mg           97.8    5e-21   
ref|XP_006295920.1|  hypothetical protein CARUB_v10025057mg           99.4    5e-21   
ref|XP_008444862.1|  PREDICTED: blue copper protein-like              98.6    5e-21   
ref|XP_002878327.1|  hypothetical protein ARALYDRAFT_486501           97.8    5e-21   
ref|XP_011101849.1|  PREDICTED: mavicyanin-like                       97.8    5e-21   
ref|XP_010508251.1|  PREDICTED: uclacyanin-2-like                     97.8    5e-21   
ref|NP_566810.1|  plastocyanin-like domain-containing protein         97.4    5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469615.1|  PREDICTED: blue copper protein                   99.0    6e-21   
ref|XP_008647896.1|  PREDICTED: blue copper protein isoform X1        98.2    6e-21   
ref|XP_010535292.1|  PREDICTED: blue copper protein                   97.4    6e-21   
ref|XP_009402874.1|  PREDICTED: mavicyanin-like                       97.8    7e-21   
ref|NP_001150898.1|  blue copper protein precursor                    97.1    7e-21   Zea mays [maize]
emb|CDY12217.1|  BnaC04g12470D                                        98.6    8e-21   
ref|XP_002873311.1|  hypothetical protein ARALYDRAFT_487581           97.4    8e-21   
ref|XP_010414849.1|  PREDICTED: blue copper protein-like              96.7    1e-20   
ref|XP_010471244.1|  PREDICTED: blue copper protein-like              96.7    1e-20   
ref|XP_002878326.1|  predicted protein                                96.3    1e-20   
ref|NP_177368.1|  plastocyanin-like domain-containing protein         96.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138849.1|  PREDICTED: uclacyanin-2                          97.1    1e-20   
emb|CDX81058.1|  BnaC03g03120D                                        96.7    1e-20   
gb|EYU40359.1|  hypothetical protein MIMGU_mgv1a014063mg              96.7    1e-20   
ref|XP_010497014.1|  PREDICTED: uclacyanin-3-like                     97.1    1e-20   
ref|XP_002879382.1|  hypothetical protein ARALYDRAFT_482160           97.8    1e-20   
ref|XP_009123120.1|  PREDICTED: blue copper protein                   96.3    2e-20   
gb|AAR15473.1|  Cu2+ plastocyanin-like                                96.3    2e-20   Olimarabidopsis pumila
emb|CDY19128.1|  BnaA04g18680D                                        97.8    2e-20   
ref|XP_008643784.1|  PREDICTED: blue copper protein isoform X1        97.1    2e-20   
ref|XP_008793738.1|  PREDICTED: blue copper protein-like              97.8    2e-20   
emb|CDY65237.1|  BnaC09g47900D                                        96.3    2e-20   
emb|CDY28484.1|  BnaC02g36760D                                        95.9    2e-20   
ref|XP_006416195.1|  hypothetical protein EUTSA_v10009689mg           95.9    2e-20   
ref|XP_010051204.1|  PREDICTED: uclacyanin-2-like                     97.4    2e-20   
ref|XP_008379120.1|  PREDICTED: mavicyanin                            95.5    2e-20   
ref|XP_011003250.1|  PREDICTED: uclacyanin-2-like                     97.4    2e-20   
ref|NP_001152678.1|  blue copper protein precursor                    96.3    2e-20   Zea mays [maize]
ref|XP_006410363.1|  hypothetical protein EUTSA_v10017076mg           97.4    2e-20   
emb|CDX70043.1|  BnaA10g23920D                                        95.9    3e-20   
gb|AFK40462.1|  unknown                                               96.7    3e-20   
ref|XP_009612608.1|  PREDICTED: uclacyanin-2-like                     97.4    3e-20   
gb|AFK34398.1|  unknown                                               95.9    3e-20   
ref|XP_010503741.1|  PREDICTED: uclacyanin-3-like                     96.3    3e-20   
emb|CDX95619.1|  BnaC03g25000D                                        95.9    3e-20   
ref|XP_009122335.1|  PREDICTED: blue copper protein                   96.3    3e-20   
gb|AFK41282.1|  unknown                                               96.3    3e-20   
ref|XP_010515443.1|  PREDICTED: uclacyanin-3-like                     96.3    3e-20   
emb|CDY42686.1|  BnaC04g22200D                                        95.5    3e-20   
ref|XP_009127911.1|  PREDICTED: blue copper protein-like              95.5    3e-20   
ref|XP_009143966.1|  PREDICTED: blue copper protein-like              97.1    3e-20   
ref|XP_009760606.1|  PREDICTED: mavicyanin-like                       95.5    3e-20   
ref|XP_006289951.1|  hypothetical protein CARUB_v10003579mg           95.5    4e-20   
ref|XP_004303985.1|  PREDICTED: blue copper protein-like              95.1    4e-20   
ref|XP_006827928.1|  hypothetical protein AMTR_s00008p00175510        95.1    4e-20   
ref|XP_008776471.1|  PREDICTED: uclacyanin-2-like                     95.1    4e-20   
ref|XP_010034982.1|  PREDICTED: blue copper protein                   95.1    4e-20   
gb|AAR13691.1|  Cu2+ plastocyanin-like protein                        95.1    4e-20   
emb|CDX71822.1|  BnaC08g30520D                                        93.6    5e-20   
emb|CDX96385.1|  BnaA07g29960D                                        94.7    5e-20   
ref|XP_004953983.1|  PREDICTED: blue copper protein-like              95.5    5e-20   
ref|XP_009386091.1|  PREDICTED: mavicyanin-like                       95.1    5e-20   
emb|CDX74686.1|  BnaA05g04320D                                        95.1    5e-20   
ref|XP_009129442.1|  PREDICTED: mavicyanin-like                       94.4    6e-20   
ref|XP_010528169.1|  PREDICTED: mavicyanin                            94.7    6e-20   
ref|NP_001237236.1|  uncharacterized protein LOC100306337 precursor   94.7    6e-20   
gb|AFK33414.1|  unknown                                               95.1    6e-20   
ref|XP_007152571.1|  hypothetical protein PHAVU_004G141300g           95.1    6e-20   
emb|CDY41179.1|  BnaA09g38360D                                        95.5    7e-20   
emb|CDX83413.1|  BnaA03g20930D                                        94.7    7e-20   
ref|XP_002509536.1|  Blue copper protein precursor, putative          94.0    8e-20   
emb|CDM84499.1|  unnamed protein product                              95.5    8e-20   
ref|XP_007161746.1|  hypothetical protein PHAVU_001G095100g           93.6    9e-20   
ref|XP_008652820.1|  PREDICTED: mavicyanin                            93.6    9e-20   
emb|CDY48260.1|  BnaC04g05190D                                        94.7    9e-20   
ref|XP_004964956.1|  PREDICTED: blue copper protein-like              94.7    1e-19   
ref|XP_009133689.1|  PREDICTED: uclacyanin-2-like                     94.4    1e-19   
gb|ACG34757.1|  blue copper protein precursor                         93.6    1e-19   
ref|XP_010518083.1|  PREDICTED: uclacyanin-2-like                     94.4    1e-19   
ref|XP_008240416.1|  PREDICTED: blue copper protein-like              94.4    1e-19   
ref|XP_007031840.1|  Cupredoxin superfamily protein                   94.4    1e-19   
ref|XP_009116712.1|  PREDICTED: uclacyanin-2-like                     95.1    1e-19   
ref|XP_004489604.1|  PREDICTED: blue copper protein-like              93.6    1e-19   
ref|XP_006295040.1|  hypothetical protein CARUB_v10024107mg           94.0    1e-19   
dbj|BAB90097.1|  putative uclacyanin 3                                95.1    1e-19   
ref|XP_010323477.1|  PREDICTED: stellacyanin-like                     92.4    1e-19   
gb|KDP46298.1|  hypothetical protein JCGZ_10138                       93.2    1e-19   
ref|XP_009143067.1|  PREDICTED: uclacyanin-2-like                     94.0    1e-19   
ref|XP_010513354.1|  PREDICTED: mavicyanin-like                       93.6    1e-19   
ref|XP_007038255.1|  Cupredoxin superfamily protein, putative         95.5    1e-19   
ref|XP_010109138.1|  Blue copper protein                              93.6    1e-19   
emb|CDX72879.1|  BnaC06g33270D                                        93.2    2e-19   
dbj|BAJ98291.1|  predicted protein                                    93.2    2e-19   
ref|XP_002452517.1|  hypothetical protein SORBIDRAFT_04g027290        94.4    2e-19   
ref|XP_011003937.1|  PREDICTED: mavicyanin                            93.2    2e-19   
ref|XP_007043352.1|  Uclacyanin 1, putative                           94.0    2e-19   
gb|EMT01699.1|  Blue copper protein                                   92.8    2e-19   
ref|NP_001168456.1|  uncharacterized protein LOC100382230 precursor   94.0    2e-19   
gb|EPS60310.1|  hypothetical protein M569_14493                       92.0    2e-19   
gb|KHF97412.1|  Blue copper                                           92.8    2e-19   
ref|XP_006660724.1|  PREDICTED: blue copper protein-like              92.4    2e-19   
ref|XP_006487069.1|  PREDICTED: mavicyanin-like                       93.2    2e-19   
ref|XP_010512729.1|  PREDICTED: mavicyanin-like                       93.2    2e-19   
ref|XP_010109549.1|  Blue copper protein                              94.0    2e-19   
ref|XP_009780504.1|  PREDICTED: blue copper protein-like              95.5    2e-19   
ref|XP_002298616.2|  hypothetical protein POPTR_0001s33960g           92.8    2e-19   
ref|XP_009417408.1|  PREDICTED: uclacyanin-2-like                     93.6    2e-19   
ref|XP_009417403.1|  PREDICTED: uclacyanin-2-like                     93.2    2e-19   
ref|XP_006644818.1|  PREDICTED: early nodulin-20-like                 94.0    3e-19   
ref|XP_009764625.1|  PREDICTED: uclacyanin-3-like                     94.4    3e-19   
ref|XP_009142282.1|  PREDICTED: uclacyanin-2-like                     93.2    3e-19   
ref|XP_010111589.1|  Blue copper protein                              92.8    3e-19   
ref|XP_010419426.1|  PREDICTED: mavicyanin-like                       92.8    3e-19   
ref|XP_009771215.1|  PREDICTED: stellacyanin-like                     92.4    3e-19   
ref|XP_008385439.1|  PREDICTED: blue copper protein-like              95.1    3e-19   
ref|XP_010545090.1|  PREDICTED: mavicyanin-like                       92.4    3e-19   
ref|XP_003576631.1|  PREDICTED: blue copper protein-like              92.0    3e-19   
ref|XP_004137571.1|  PREDICTED: early nodulin-55-2-like               93.2    3e-19   
ref|NP_001062071.1|  Os08g0482700                                     92.4    3e-19   
ref|XP_009367150.1|  PREDICTED: early nodulin-like protein 2          94.7    3e-19   
gb|AFK42629.1|  unknown                                               92.8    4e-19   
ref|XP_010506414.1|  PREDICTED: uclacyanin-2-like                     92.8    4e-19   
gb|KEH16093.1|  plastocyanin-like domain protein                      92.8    4e-19   
dbj|BAJ90875.1|  predicted protein                                    93.6    4e-19   
gb|AFK42126.1|  unknown                                               92.4    4e-19   
ref|XP_010428092.1|  PREDICTED: blue copper protein-like              92.0    4e-19   
ref|NP_001141279.1|  uncharacterized protein LOC100273368 precursor   92.4    4e-19   
ref|XP_008437239.1|  PREDICTED: chemocyanin-like                      92.8    4e-19   
ref|XP_003591647.1|  Blue copper protein                              92.0    4e-19   
gb|ACG33373.1|  blue copper protein precursor                         92.4    5e-19   
emb|CDX82167.1|  BnaC02g21230D                                        92.0    5e-19   
ref|XP_002876712.1|  hypothetical protein ARALYDRAFT_907902           92.0    5e-19   
ref|NP_001234429.1|  dicyanin precursor                               94.0    5e-19   
tpg|DAA36600.1|  TPA: blue copper protein                             92.4    5e-19   
ref|XP_009614877.1|  PREDICTED: basic blue protein-like               91.7    5e-19   
ref|XP_006826439.1|  hypothetical protein AMTR_s00004p00170860        92.8    5e-19   
ref|XP_002961322.1|  hypothetical protein SELMODRAFT_29265            89.7    5e-19   
ref|XP_002893232.1|  hypothetical protein ARALYDRAFT_472488           91.7    5e-19   
ref|XP_008337273.1|  PREDICTED: blue copper protein-like              94.4    5e-19   
ref|NP_173664.1|  plastocyanin-like domain-containing protein         91.7    6e-19   
ref|XP_009803778.1|  PREDICTED: basic blue protein-like               91.7    6e-19   
ref|XP_004231787.1|  PREDICTED: mavicyanin                            91.7    6e-19   
ref|XP_003609366.1|  Blue copper protein                              94.0    6e-19   
ref|XP_009368873.1|  PREDICTED: umecyanin-like                        92.0    6e-19   
dbj|BAJ90938.1|  predicted protein                                    92.0    7e-19   
ref|XP_004239759.1|  PREDICTED: stellacyanin-like                     91.7    7e-19   
ref|XP_002511023.1|  Blue copper protein precursor, putative          91.7    7e-19   
ref|XP_006338690.1|  PREDICTED: blue copper protein-like              91.3    7e-19   
ref|XP_002983241.1|  hypothetical protein SELMODRAFT_117792           89.7    8e-19   
gb|KCW46231.1|  hypothetical protein EUGRSUZ_K00120                   89.7    8e-19   
ref|XP_009105882.1|  PREDICTED: blue copper protein                   91.3    8e-19   
ref|XP_006302895.1|  hypothetical protein CARUB_v10021025mg           91.3    8e-19   
ref|XP_009593466.1|  PREDICTED: stellacyanin-like                     91.7    8e-19   
gb|KDO47972.1|  hypothetical protein CISIN_1g046887mg                 90.9    8e-19   
ref|XP_010931419.1|  PREDICTED: uclacyanin-3-like                     92.0    9e-19   
ref|XP_002303318.2|  hypothetical protein POPTR_0003s04580g           91.7    9e-19   
gb|ACR77748.1|  plastocyanin-like domain-containing protein           91.7    9e-19   
gb|EMS55483.1|  Blue copper protein                                   90.5    1e-18   
ref|XP_006422904.1|  hypothetical protein CICLE_v10030206mg           90.9    1e-18   
ref|XP_011098865.1|  PREDICTED: mavicyanin                            90.9    1e-18   
ref|XP_007155023.1|  hypothetical protein PHAVU_003G166700g           93.2    1e-18   
ref|XP_002460378.1|  hypothetical protein SORBIDRAFT_02g027260        90.5    1e-18   
ref|XP_010495316.1|  PREDICTED: blue copper protein                   91.3    1e-18   
ref|XP_002308977.2|  hypothetical protein POPTR_0006s06650g           90.5    1e-18   
ref|XP_003620297.1|  Blue copper protein                              91.3    1e-18   
ref|XP_011012945.1|  PREDICTED: chemocyanin-like                      91.3    1e-18   
ref|XP_003618846.1|  Plastocyanin-like domain-containing protein      90.5    1e-18   
ref|XP_010484775.1|  PREDICTED: mavicyanin-like                       90.9    2e-18   
gb|KDP22478.1|  hypothetical protein JCGZ_26309                       90.5    2e-18   
ref|XP_006659099.1|  PREDICTED: blue copper protein-like              90.5    2e-18   
ref|XP_009364009.1|  PREDICTED: flocculation protein FLO11-like i...  92.8    2e-18   
ref|XP_008652818.1|  PREDICTED: mavicyanin-like                       90.1    2e-18   
ref|XP_002448272.1|  hypothetical protein SORBIDRAFT_06g024260        90.9    2e-18   
ref|XP_009364008.1|  PREDICTED: uclacyanin-3-like isoform X1          92.8    2e-18   
ref|XP_010534088.1|  PREDICTED: blue copper protein-like              89.7    2e-18   
gb|AAC32039.1|  uclacyanin II                                         90.1    2e-18   
ref|XP_006360596.1|  PREDICTED: early nodulin-20-like                 91.7    2e-18   
ref|XP_009371662.1|  PREDICTED: mavicyanin                            90.1    2e-18   
ref|XP_007208915.1|  hypothetical protein PRUPE_ppa1027131mg          90.9    2e-18   
ref|XP_008341310.1|  PREDICTED: basic blue protein-like               89.7    3e-18   
emb|CAJ77497.1|  putative dicyanin blue copper protein precursor      89.4    3e-18   
ref|XP_010523261.1|  PREDICTED: stellacyanin                          90.1    3e-18   
ref|XP_006838549.1|  hypothetical protein AMTR_s00002p00202700        90.1    3e-18   
ref|XP_010413184.1|  PREDICTED: mavicyanin-like                       90.1    3e-18   
ref|XP_007155014.1|  hypothetical protein PHAVU_003G165800g           91.7    3e-18   
ref|XP_007013489.1|  Cupredoxin superfamily protein, putative iso...  90.1    3e-18   
ref|XP_002436721.1|  hypothetical protein SORBIDRAFT_10g007520        90.5    3e-18   
ref|XP_010454327.1|  PREDICTED: blue copper protein-like              90.1    4e-18   
gb|ABK26728.1|  unknown                                               89.7    4e-18   
ref|XP_011084101.1|  PREDICTED: blue copper protein-like              91.7    4e-18   
emb|CDP10432.1|  unnamed protein product                              91.7    4e-18   
ref|XP_004957076.1|  PREDICTED: blue copper protein-like              89.0    4e-18   
ref|XP_007155024.1|  hypothetical protein PHAVU_003G166800g           91.3    5e-18   
gb|KFK35457.1|  hypothetical protein AALP_AA5G286600                  89.4    5e-18   
ref|XP_008786863.1|  PREDICTED: stellacyanin-like                     89.4    5e-18   
ref|XP_004307775.1|  PREDICTED: early nodulin-like protein 1-like     89.0    5e-18   
ref|XP_009624895.1|  PREDICTED: mucin-2-like                          93.6    6e-18   
ref|XP_006588272.1|  PREDICTED: blue copper protein-like              89.7    6e-18   
ref|XP_002460376.1|  hypothetical protein SORBIDRAFT_02g027250        88.6    7e-18   
ref|XP_010473933.1|  PREDICTED: mavicyanin-like                       89.0    7e-18   
emb|CDX76688.1|  BnaC08g32740D                                        89.0    7e-18   
ref|XP_010521294.1|  PREDICTED: blue copper protein-like              87.4    7e-18   
ref|NP_001238405.1|  uncharacterized protein LOC100527593 precursor   89.4    8e-18   
ref|XP_006304237.1|  hypothetical protein CARUB_v10010418mg           88.6    8e-18   
ref|XP_008646293.1|  PREDICTED: blue copper protein-like              89.7    8e-18   
ref|XP_002274801.1|  PREDICTED: uclacyanin-3                          89.4    8e-18   
ref|XP_006358287.1|  PREDICTED: blue copper protein-like              90.5    9e-18   
ref|XP_006296353.1|  hypothetical protein CARUB_v10025525mg           88.6    9e-18   
emb|CDP20860.1|  unnamed protein product                              88.6    9e-18   
ref|XP_010468877.1|  PREDICTED: mavicyanin-like isoform X2            88.6    9e-18   
emb|CBI35287.3|  unnamed protein product                              89.0    9e-18   
ref|XP_003542629.1|  PREDICTED: blue copper protein-like              90.1    1e-17   
emb|CBI28975.3|  unnamed protein product                              89.0    1e-17   
ref|XP_010663957.1|  PREDICTED: blue copper protein-like              89.0    1e-17   
ref|XP_010468876.1|  PREDICTED: mavicyanin-like isoform X1            88.6    1e-17   
ref|XP_007013488.1|  Cupredoxin superfamily protein, putative iso...  89.7    1e-17   
ref|XP_002527195.1|  Cucumber peeling cupredoxin, putative            88.6    1e-17   
ref|XP_010418740.1|  PREDICTED: mavicyanin-like                       88.6    1e-17   
ref|XP_010258753.1|  PREDICTED: stellacyanin-like                     88.2    1e-17   
ref|XP_008241008.1|  PREDICTED: mavicyanin-like                       88.2    1e-17   
ref|XP_008455830.1|  PREDICTED: blue copper protein-like              89.4    1e-17   
ref|XP_010103730.1|  Blue copper protein                              89.4    1e-17   
ref|XP_008778314.1|  PREDICTED: mavicyanin-like                       87.8    1e-17   
gb|AAB47973.1|  blue copper-binding protein II                        88.2    2e-17   
ref|XP_006345914.1|  PREDICTED: blue copper protein-like              87.8    2e-17   
ref|XP_010248962.1|  PREDICTED: mavicyanin                            87.4    2e-17   
gb|EMS47867.1|  Blue copper protein                                   87.4    2e-17   
ref|XP_009612880.1|  PREDICTED: blue copper protein-like              89.7    2e-17   
ref|XP_002281286.1|  PREDICTED: mavicyanin                            87.8    2e-17   
gb|KHN00195.1|  Blue copper protein                                   87.4    2e-17   
ref|NP_182006.1|  uclacyanin 2                                        88.2    2e-17   
gb|KDO80195.1|  hypothetical protein CISIN_1g018026mg                 88.6    2e-17   
ref|XP_010513176.1|  PREDICTED: mavicyanin-like                       87.8    2e-17   
ref|XP_004970211.1|  PREDICTED: blue copper protein-like              89.0    2e-17   
ref|XP_010420862.1|  PREDICTED: blue copper protein-like              87.8    2e-17   
ref|XP_008231138.1|  PREDICTED: mavicyanin                            87.0    2e-17   
ref|NP_001063431.1|  Os09g0469300                                     86.7    2e-17   
ref|XP_008346622.1|  PREDICTED: umecyanin-like                        87.8    2e-17   
ref|XP_006490063.1|  PREDICTED: blue copper protein-like              88.2    2e-17   
gb|KDO40616.1|  hypothetical protein CISIN_1g039191mg                 88.2    2e-17   
ref|XP_008798641.1|  PREDICTED: umecyanin-like                        87.0    2e-17   
emb|CDP16681.1|  unnamed protein product                              87.0    2e-17   
gb|EMS67148.1|  Early nodulin-like protein 1                          87.0    3e-17   
ref|XP_010662600.1|  PREDICTED: mavicyanin-like                       86.7    3e-17   
gb|KDO55610.1|  hypothetical protein CISIN_1g030729mg                 87.0    3e-17   
ref|XP_006447099.1|  hypothetical protein CICLE_v10016947mg           87.0    3e-17   
ref|XP_004959522.1|  PREDICTED: blue copper protein-like              87.4    3e-17   
ref|XP_006837021.1|  hypothetical protein AMTR_s00098p00173330        87.4    3e-17   
ref|XP_004243830.1|  PREDICTED: uclacyanin-2-like                     88.6    3e-17   
ref|XP_004303303.1|  PREDICTED: cucumber peeling cupredoxin-like      87.0    3e-17   
ref|XP_008356719.1|  PREDICTED: early nodulin-like protein 2          88.6    3e-17   
ref|XP_006358288.1|  PREDICTED: blue copper protein-like              89.0    3e-17   
gb|KHN15076.1|  Blue copper protein                                   88.2    3e-17   
ref|XP_011076445.1|  PREDICTED: stellacyanin                          87.0    3e-17   
ref|XP_010247602.1|  PREDICTED: umecyanin-like                        86.7    3e-17   
emb|CAN70380.1|  hypothetical protein VITISV_002167                   86.3    3e-17   
ref|XP_006450890.1|  hypothetical protein CICLE_v10009575mg           87.0    3e-17   
gb|AAB34409.1|  umecyanin                                             85.1    4e-17   
sp|P42849.1|UMEC_ARMRU  RecName: Full=Umecyanin; Short=UMC            85.1    4e-17   
ref|XP_003549750.2|  PREDICTED: blue copper protein-like              87.8    4e-17   
ref|XP_006475877.1|  PREDICTED: blue copper protein-like              87.0    4e-17   
ref|XP_008786371.1|  PREDICTED: stellacyanin                          86.7    4e-17   
gb|EMT21332.1|  Blue copper protein                                   87.4    4e-17   
pdb|1X9R|A  Chain A, Umecyanin From Horse Raddish- Crystal Struct...  85.1    4e-17   
gb|ACG40270.1|  blue copper protein precursor                         86.3    4e-17   
gb|ABI96983.1|  phytocyanin-like arabinogalactan-protein              86.3    4e-17   
ref|XP_006450887.1|  hypothetical protein CICLE_v10008731mg           89.0    4e-17   
ref|XP_003575447.1|  PREDICTED: mavicyanin-like                       86.7    4e-17   
ref|XP_004287292.1|  PREDICTED: uncharacterized protein LOC101313542  88.6    4e-17   
ref|XP_010933589.1|  PREDICTED: stellacyanin                          86.7    4e-17   



>ref|XP_006347977.1| PREDICTED: uclacyanin-2-like [Solanum tuberosum]
Length=189

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            +H+VGG GGW+QSGDYTTWAA+ETFTVGD+LVFNYGGSHGVD +SKDDY+NCN GNA+ S
Sbjct  23   NHVVGGSGGWTQSGDYTTWAAAETFTVGDTLVFNYGGSHGVDVISKDDYENCNTGNAIES  82

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            ++DG TTIKLSK+GPMYF CP+FGHCQ+GMKL++NVQ
Sbjct  83   YSDGATTIKLSKSGPMYFSCPTFGHCQSGMKLSVNVQ  119



>ref|XP_004229737.1| PREDICTED: uclacyanin-3-like [Solanum lycopersicum]
Length=189

 Score =   176 bits (446),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            +H+VGG GGW+QSGDYTTWAA+ETFTVGD+L FNYGGSHGVD +SKDDY+NCN GNA+ S
Sbjct  23   NHVVGGSGGWTQSGDYTTWAAAETFTVGDTLEFNYGGSHGVDVISKDDYENCNTGNAIES  82

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            ++DGKTTIKLSK+GPMYF CP+FGHCQ+GMKL+INV
Sbjct  83   YSDGKTTIKLSKSGPMYFTCPTFGHCQSGMKLSINV  118



>ref|XP_009617784.1| PREDICTED: uclacyanin-3-like [Nicotiana tomentosiformis]
Length=194

 Score =   166 bits (421),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            +H+VGG GGWSQ+GDY+TWAA ETF VGD+L FNYGGSH VD +SKDDY+NCN GNAL S
Sbjct  23   NHVVGGSGGWSQTGDYSTWAAGETFNVGDTLEFNYGGSHSVDVISKDDYENCNTGNALES  82

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
             +DGKTTIKLSKAGPMYF C +FGHCQ+GMKLA++V+
Sbjct  83   HSDGKTTIKLSKAGPMYFTCSAFGHCQSGMKLAVDVK  119



>ref|XP_009758781.1| PREDICTED: uclacyanin-3-like [Nicotiana sylvestris]
Length=192

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQ-SGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            +H+VGG GGWSQ +GDY+TWAA ETF VGD+L FNYG SH VD +SKDDYDNCN GNAL 
Sbjct  23   NHVVGGSGGWSQTAGDYSTWAAGETFNVGDTLEFNYGASHSVDVISKDDYDNCNTGNALE  82

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            S++DGKTTIKLSKAGPMYF C +FGHCQ+GMKLA++V+
Sbjct  83   SYSDGKTTIKLSKAGPMYFTCSAFGHCQSGMKLAVDVK  120



>ref|XP_004248538.1| PREDICTED: mavicyanin-like [Solanum lycopersicum]
Length=163

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KDHIVGG  GWSQSGDY+TWA+++TF VGD+LVFNYGGSHGV+ VSKDDYDNCN GNAL 
Sbjct  21   KDHIVGGSDGWSQSGDYSTWASAQTFNVGDNLVFNYGGSHGVNIVSKDDYDNCNTGNALL  80

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            S+T G+ +I LS AG MYF+CP+  HC TGMKLAI V+
Sbjct  81   SYTGGQNSIPLSSAGDMYFVCPTLNHCDTGMKLAIKVE  118



>ref|XP_006338895.1| PREDICTED: blue copper protein-like [Solanum tuberosum]
Length=159

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KDHIVGG  GWSQSGDY+TWA+++TF+VGD+LVFNYGGSHGV+ VSKDDY+NCN GNAL 
Sbjct  21   KDHIVGGSDGWSQSGDYSTWASAQTFSVGDNLVFNYGGSHGVNVVSKDDYENCNTGNALL  80

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            ++T G+ +I LS +G MYF+CP+  HC TGMKLAI V+
Sbjct  81   TYTGGQNSIPLSSSGDMYFVCPTLNHCDTGMKLAIKVE  118



>ref|XP_009797132.1| PREDICTED: uclacyanin-3-like [Nicotiana sylvestris]
Length=163

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            K+HIVGG  GWSQS DY++WA+ ETF VGD+LVFNY GSHGVD V+KD YDNCN  NA++
Sbjct  21   KEHIVGGSNGWSQSVDYSSWASGETFNVGDTLVFNYDGSHGVDIVTKDGYDNCNTANAIK  80

Query  505  SFTDGKTTIKLSKAG-PMYFMCPSFGHCQTGMKLAINVQ  392
            SFTDG T I L+ +   +YF+CP   HC TGMKLAI VQ
Sbjct  81   SFTDGSTAITLASSPVDVYFVCPKLNHCATGMKLAIKVQ  119



>ref|XP_010052796.1| PREDICTED: mavicyanin-like [Eucalyptus grandis]
 gb|KCW76874.1| hypothetical protein EUGRSUZ_D01225 [Eucalyptus grandis]
Length=176

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+Q  +Y TWAAS+TF VGDSLVF Y   H VD+VSKDDYDNCN GNA++S+T 
Sbjct  28   VGDSSGWTQGTNYATWAASQTFNVGDSLVFTYTTLHSVDQVSKDDYDNCNTGNAIKSYTS  87

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G TTI LS AGPMYF+CP+ GHC +GMKLAI V
Sbjct  88   GSTTIPLSTAGPMYFICPTSGHCSSGMKLAITV  120



>ref|XP_009604686.1| PREDICTED: uclacyanin-3-like [Nicotiana tomentosiformis]
Length=166

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 1/99 (1%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            K+HIVGG  GWSQS DY++WA+ ETF VGD+LVFNY GSHGVD V+KD YDNCN  N ++
Sbjct  21   KEHIVGGSNGWSQSVDYSSWASGETFNVGDTLVFNYDGSHGVDIVTKDGYDNCNTANPIK  80

Query  505  SFTDGKTTIKLSKAG-PMYFMCPSFGHCQTGMKLAINVQ  392
            SF+DG TTI L+     +YF+CP   HC TGMKLAI VQ
Sbjct  81   SFSDGSTTITLATTPIDVYFVCPKLNHCDTGMKLAIRVQ  119



>gb|ADV57638.1| copper binding protein 3 [Gossypium hirsutum]
 gb|KHG05887.1| Blue copper [Gossypium arboreum]
Length=177

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            + + VG   GW+ +GDY +W   +TFTVGD+L+F YGGSH V+EVSK DYDNCN GNA++
Sbjct  20   EQYTVGDSSGWTTTGDYQSWVQGKTFTVGDTLLFTYGGSHSVEEVSKSDYDNCNTGNAIK  79

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S++DG T I LS  G MYF+CP+ GHC  GMKLAINV
Sbjct  80   SYSDGNTVITLSNPGAMYFICPTIGHCAGGMKLAINV  116



>ref|XP_007052334.1| Uclacyanin 3, putative [Theobroma cacao]
 gb|EOX96491.1| Uclacyanin 3, putative [Theobroma cacao]
Length=175

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+ +GDYTTW   +TF VGD+L+F Y  SH VDEVSK DY NCN+GN+L+S+
Sbjct  22   YTVGDSTGWTSTGDYTTWVQGKTFNVGDTLLFKYDSSHKVDEVSKSDYGNCNSGNSLKSY  81

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +DG T I LS AG MYF+CP+ GHC  GMKLAI+V
Sbjct  82   SDGNTVITLSTAGSMYFICPTVGHCAGGMKLAIDV  116



>ref|XP_009373210.1| PREDICTED: uclacyanin-3 [Pyrus x bretschneideri]
Length=176

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            HIVG   GWS S DY +WAAS +FTVGD+LVFNYG SH VD V++ DY +C++ N+L+++
Sbjct  22   HIVGDASGWSTSVDYDSWAASNSFTVGDTLVFNYGSSHKVDIVNQADYASCSSSNSLKTY  81

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             DG TTI LS+ GP YF+CPS GHC  GMKL++NV
Sbjct  82   DDGATTITLSQPGPAYFICPSAGHCANGMKLSVNV  116



>ref|XP_008375772.1| PREDICTED: uclacyanin-2 [Malus domestica]
Length=146

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            HIVG   GWS S DY +WAAS  FTVGD+LVFNYG SH VD V++ D+ +C++ N+L+++
Sbjct  22   HIVGDASGWSTSVDYDSWAASNAFTVGDTLVFNYGSSHKVDIVNQADFASCSSSNSLKTY  81

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             DG TTI LS+ GP YF+CPS GHC  GMKL++NV
Sbjct  82   DDGATTITLSQPGPAYFICPSAGHCGNGMKLSVNV  116



>ref|XP_004133765.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 ref|XP_004155201.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 gb|KGN56342.1| hypothetical protein Csa_3G116790 [Cucumis sativus]
Length=171

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D IVGG+ GWSQ  DY TWAA + F VGD+LVFNYGGSH VDEV + DY  C++ + ++S
Sbjct  22   DIIVGGNSGWSQGVDYDTWAAGQKFNVGDALVFNYGGSHSVDEVKEADYTACSSSSVIKS  81

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             T G T+I LS  GP YF+C + GHC +GMKL +NV
Sbjct  82   HTGGTTSIPLSAVGPRYFICSTIGHCASGMKLQVNV  117



>ref|XP_002272263.1| PREDICTED: uclacyanin-3 [Vitis vinifera]
 emb|CBI16675.3| unnamed protein product [Vitis vinifera]
Length=181

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++H VGG  GW    DY+TWA+ ETFTVGD LVF YG +H VDEVSK  YD+C   N  +
Sbjct  20   ENHTVGGSSGWDTGVDYSTWASGETFTVGDYLVFTYGSTHSVDEVSKSSYDSCATSNPTK  79

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            S+T G  TI L+ AG +YF+CP+ GHC  GMKLAI V+
Sbjct  80   SYTGGSNTIALTTAGSLYFLCPTTGHCSQGMKLAITVE  117



>emb|CAN66310.1| hypothetical protein VITISV_027162 [Vitis vinifera]
Length=181

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++H VGG  GW    DY+TWA+ ETFTVGD LVF YG +H VDEVSK  YD+C   N  +
Sbjct  20   ENHTVGGSSGWDTGVDYSTWASGETFTVGDYLVFTYGSTHSVDEVSKSSYDSCATSNPTK  79

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            S+T G  TI L+ AG +YF+CP+ GHC  GMKLAI V+
Sbjct  80   SYTGGSNTIALTTAGSLYFLCPTTGHCSQGMKLAITVE  117



>gb|KDP28869.1| hypothetical protein JCGZ_14640 [Jatropha curcas]
Length=192

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = -3

Query  679  HIVGGDGGWSQSG-DYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDDYDNCNAGNALR  506
            +IVG   GW+  G DY+TWA+ +TFTVGD+LVFNY GS H VDEVS+ DY++C++ NA+ 
Sbjct  23   YIVGDSSGWTNFGVDYSTWASGKTFTVGDTLVFNYDGSTHKVDEVSQSDYNSCSSSNAIE  82

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S  DG TTIKLSK G +YF+CP+ GHC  GMKLA+NV
Sbjct  83   SHDDGSTTIKLSKTGTIYFICPTAGHCSGGMKLAVNV  119



>ref|XP_011032393.1| PREDICTED: mavicyanin-like [Populus euphratica]
Length=193

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+  GDYTTWA+ +TFTVGDSL+F Y  +H V EVSKDDYD+C+A N L+++TD
Sbjct  26   VGDSSGWTTVGDYTTWASGKTFTVGDSLLFKYSSTHSVAEVSKDDYDSCSASNTLKTYTD  85

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G +T+ LS AG  YF+C + GHC  GMKLAI V
Sbjct  86   GSSTVPLSTAGQRYFICSTPGHCSGGMKLAITV  118



>ref|XP_002526464.1| Uclacyanin-2 precursor, putative [Ricinus communis]
 gb|EEF35855.1| Uclacyanin-2 precursor, putative [Ricinus communis]
Length=187

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSG-DYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            +H VGG  GW+  G DY+TWAA+ETFTVGD+LVF+YG +H V EVS+ DY++C++ NA+ 
Sbjct  21   EHDVGGSSGWTNFGVDYSTWAAAETFTVGDTLVFSYGTNHQVAEVSESDYNSCSSSNAIE  80

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + T G TT+ LSK G  +F+CP+ GHC +GMKLAINV
Sbjct  81   THTGGSTTVTLSKTGKRFFICPTGGHCGSGMKLAINV  117



>ref|XP_008232494.1| PREDICTED: uclacyanin-2-like [Prunus mume]
Length=188

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
             H VG   GW  + DY TWAAS+TFTVGD+L+F YG SH VD+V++  Y +C++ NA+ +
Sbjct  21   QHTVGDTDGWESNVDYVTWAASKTFTVGDTLLFTYGASHSVDQVNQAGYSSCSSSNAIGT  80

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             +DG T+I LS+AGP+YF+CP+ GHC +GMKL + V
Sbjct  81   HSDGNTSIPLSQAGPVYFICPTPGHCASGMKLTVTV  116



>ref|XP_007219192.1| hypothetical protein PRUPE_ppa016927mg [Prunus persica]
 gb|EMJ20391.1| hypothetical protein PRUPE_ppa016927mg [Prunus persica]
Length=188

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
             H VG   GW  + DY TWAAS+TFTVGD+L+F YG SH VD+V++  Y +C++ NA+ +
Sbjct  21   QHTVGDTAGWESNVDYVTWAASKTFTVGDTLLFTYGASHSVDQVNQAGYSSCSSSNAIGT  80

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             +DG T+I LS+AGP+YF+CP+ GHC +GMK+ + V
Sbjct  81   HSDGNTSIPLSQAGPVYFICPTPGHCASGMKVTVTV  116



>ref|XP_006375159.1| hypothetical protein POPTR_0014s04850g [Populus trichocarpa]
 gb|ERP52956.1| hypothetical protein POPTR_0014s04850g [Populus trichocarpa]
Length=192

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -3

Query  673  VGGDGGWSQS-GDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFT  497
            VG   GWS + GDYTTW + +TFTVGDSL+F Y  +H V EVSK DYD+C+  N  +++T
Sbjct  26   VGDSSGWSTTFGDYTTWVSGKTFTVGDSLLFKYSSTHTVAEVSKGDYDSCSTSNLGKTYT  85

Query  496  DGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            DG +T+ LS AGPMYF+CP+ GHC  GMKLAI V
Sbjct  86   DGSSTVPLSTAGPMYFICPTSGHCSGGMKLAITV  119



>ref|XP_010275467.1| PREDICTED: uclacyanin-3-like [Nelumbo nucifera]
Length=188

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            DH VG   GWSQ  DYTTWA+S TFTVGD+L F+Y G HGVD+V+K +YD+C A  AL+S
Sbjct  21   DHTVGDSSGWSQGVDYTTWASSNTFTVGDTLTFSYSGLHGVDQVTKTNYDSCTA-KALKS  79

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +  G   + L +AG  YF+CP+ GHC +GMKLAI V
Sbjct  80   YNSGSDKVTLDQAGDWYFICPTTGHCDSGMKLAITV  115



>ref|XP_010524439.1| PREDICTED: uclacyanin-2 [Tarenaya hassleriana]
Length=200

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG   GW+Q  DYTTW   +TF VGD L F YGG+H VD V+KD YDNC+A N+L+S
Sbjct  29   DYTVGDASGWTQGFDYTTWVRGKTFRVGDVLEFIYGGTHTVDVVNKDGYDNCDASNSLQS  88

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
             +DG T I L+  GPMYF+C + GHC  GMKLA+ VQ
Sbjct  89   SSDGDTKIPLNATGPMYFICATPGHCSGGMKLAVTVQ  125



>gb|EPS65671.1| hypothetical protein M569_09108, partial [Genlisea aurea]
Length=142

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VGG  GW+ + +Y  WAA +TF+ GDSLVFNYG SH V EVS+ DYDNCNAGNA+ + ++
Sbjct  11   VGGSSGWTLNYNYANWAAGQTFSSGDSLVFNYGPSHAVSEVSQSDYDNCNAGNAISTDSN  70

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
              T I L+  G  YF+CP+  HC  GMKLA++V 
Sbjct  71   SPTAISLTSPGTRYFICPTPTHCSQGMKLAVSVS  104



>ref|XP_008437773.1| PREDICTED: basic blue protein [Cucumis melo]
Length=169

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D IVGG  GW+Q  +Y TWA  + FTVGD+LVF+YGGSH VDEV++  Y  C++ + ++S
Sbjct  22   DIIVGGSSGWNQGFNYDTWATQQKFTVGDTLVFDYGGSHSVDEVNEASYTACSSSSVIKS  81

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             T G T+I LS  GP YF+C + GHC +GMKL +NV
Sbjct  82   HTGGTTSIPLSAVGPRYFICSTPGHCASGMKLQVNV  117



>ref|XP_010026035.1| PREDICTED: blue copper protein [Eucalyptus grandis]
 gb|KCW83087.1| hypothetical protein EUGRSUZ_B00045 [Eucalyptus grandis]
Length=195

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG  GGW    DYTTW + +TF VGDSLVFNYGG H VDEVSK DYD C A N + + 
Sbjct  26   YTVGDTGGWVMGTDYTTWTSGKTFLVGDSLVFNYGGGHTVDEVSKSDYDACTAANVISTD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TTI L  A   YF+C + GHC +GMKLA++V+
Sbjct  86   SSGATTIPLKTAATHYFICGAAGHCSSGMKLAVSVK  121



>ref|XP_004306982.1| PREDICTED: uclacyanin-2-like [Fragaria vesca subsp. vesca]
Length=203

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            DHIVG D GW+   DY TWA+ +TFTVGD+LVFN+  +H VDEVS  DY+ C++ N +++
Sbjct  22   DHIVGDDQGWNSGVDYETWASGKTFTVGDTLVFNFLSNHEVDEVSLADYNGCSSSNTIKN  81

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            +      I LSKAGP Y++CP+ GHC +GMKL +N
Sbjct  82   YDSSPAKITLSKAGPSYYICPTPGHCASGMKLLVN  116



>ref|XP_002285736.1| PREDICTED: blue copper protein-like [Vitis vinifera]
Length=187

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG   GW+   DY+TW + +TF VGD+LVFNYGG H VDEVS  DY  C  GNA+ S
Sbjct  24   DYTVGDSTGWTMGADYSTWTSGKTFVVGDTLVFNYGGGHTVDEVSASDYSTCTVGNAITS  83

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
             + G TTI L K G  YF+C   GHC +GMKLA+ V+
Sbjct  84   DSTGATTISLKKTGTHYFICGVIGHCGSGMKLAVTVE  120



>ref|XP_006445439.1| hypothetical protein CICLE_v10022525mg [Citrus clementina]
 ref|XP_006464835.1| PREDICTED: uclacyanin-2-like [Citrus sinensis]
 gb|ESR58679.1| hypothetical protein CICLE_v10022525mg [Citrus clementina]
 gb|KDO85490.1| hypothetical protein CISIN_1g030594mg [Citrus sinensis]
Length=175

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            ++ VG   GW+Q  DYT+W + +TF VGD LVFNYGG H VD VS+ DY+NC + NAL S
Sbjct  19   EYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYGGLHKVDRVSESDYNNCASSNALES  78

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
              DG T I L   G  YF+CP+ GHC  GMKLA+ V
Sbjct  79   HDDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVTV  114



>ref|XP_002302319.1| plastocyanin-like domain-containing family protein [Populus trichocarpa]
 gb|ABK92714.1| unknown [Populus trichocarpa]
 gb|EEE81592.1| plastocyanin-like domain-containing family protein [Populus trichocarpa]
Length=188

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 66/98 (67%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KDH VG   GW+   DY+TW + +TF+VGDSLVFNYGG H VDEVS  DY  C  GNA+ 
Sbjct  26   KDHTVGDSSGWAIGMDYSTWTSGKTFSVGDSLVFNYGGGHTVDEVSASDYSTCTTGNAIT  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            S + G TTI L  AG  YF+C   GHC +GMK+A+ V 
Sbjct  86   SDSSGATTIALKTAGTHYFICGVPGHCGSGMKVAVTVA  123



>ref|XP_009602744.1| PREDICTED: uclacyanin-3-like [Nicotiana tomentosiformis]
Length=227

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            +H VGG+GGWSQ  DY TWAASETF VGD+L+F+YG SH V EV+K +YD+C   NA+ +
Sbjct  24   NHTVGGNGGWSQGADYKTWAASETFLVGDNLIFSYGLSHDVLEVTKANYDSCATTNAIST  83

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
               G T I LS  G  YF+C + GHC +GMKL +N
Sbjct  84   NGGGMTVIALSSLGRRYFICGTGGHCASGMKLEVN  118



>emb|CBI19206.3| unnamed protein product [Vitis vinifera]
Length=206

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG   GW+   DY+TW + +TF VGD+LVFNYGG H VDEVS  DY  C  GNA+ S
Sbjct  43   DYTVGDSTGWTMGADYSTWTSGKTFVVGDTLVFNYGGGHTVDEVSASDYSTCTVGNAITS  102

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
             + G TTI L K G  YF+C   GHC +GMKLA+ V+
Sbjct  103  DSTGATTISLKKTGTHYFICGVIGHCGSGMKLAVTVE  139



>gb|ABK92755.1| unknown [Populus trichocarpa]
Length=188

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KDH VG   GW+   DY+TW + +TF+VGDSLVFNYGG H VDEV   DY  C  GNA+ 
Sbjct  26   KDHTVGDSSGWAIGMDYSTWTSGKTFSVGDSLVFNYGGGHTVDEVRASDYSTCTTGNAIT  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            S + G TTI L  AG  YF+C   GHC +GMK+A+ V 
Sbjct  86   SDSSGATTIALKTAGTHYFICGVPGHCGSGMKVAVTVA  123



>ref|XP_002302318.1| plastocyanin-like domain-containing family protein [Populus trichocarpa]
 gb|ABK93201.1| unknown [Populus trichocarpa]
 gb|EEE81591.1| plastocyanin-like domain-containing family protein [Populus trichocarpa]
Length=188

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KDH VG   GW+   DY+TW + +TF+VGDSLVFNYGG H VDEV   DY  C  GNA+ 
Sbjct  26   KDHTVGDSSGWAIGMDYSTWTSGKTFSVGDSLVFNYGGGHTVDEVRASDYSTCTTGNAIT  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            S + G TTI L  AG  YF+C   GHC +GMK+A+ V 
Sbjct  86   SDSSGATTIALKTAGTHYFICGVPGHCGSGMKVAVTVA  123



>ref|XP_011016865.1| PREDICTED: blue copper protein-like [Populus euphratica]
Length=189

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 66/98 (67%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KD+ VG   GW+   DY+TW + +TF+VGDSLVFNYGG H VDEVS  DY  C  GNA+ 
Sbjct  26   KDYTVGDSSGWAIGMDYSTWTSGKTFSVGDSLVFNYGGGHTVDEVSASDYKTCTTGNAIT  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            S + G TTI L  AG  YF+C   GHC +GMK+A+ V 
Sbjct  86   SDSSGATTIALKTAGTHYFICGVPGHCGSGMKVAVTVA  123



>ref|XP_002513980.1| Blue copper protein precursor, putative [Ricinus communis]
 gb|EEF48563.1| Blue copper protein precursor, putative [Ricinus communis]
Length=186

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ +G   GW+   DY+TW A +TF VGD+LVFNYGG H VDEVS  DY+ C  GN + S
Sbjct  22   DYTIGDTSGWTMGLDYSTWTAGKTFKVGDNLVFNYGGGHTVDEVSASDYNTCTVGNGITS  81

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
             + G TTI L  AG  YF+C   GHC +GMKLA+ V+
Sbjct  82   DSSGATTIALKTAGTHYFICGVVGHCGSGMKLAVTVK  118



>ref|XP_009763857.1| PREDICTED: uclacyanin-3-like [Nicotiana sylvestris]
Length=239

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            +H VGG+ GW Q  DY TWAASETF VGD+L+F+YG SH V EV+K +YD+C   NA+ +
Sbjct  24   NHTVGGNSGWRQGADYKTWAASETFLVGDNLIFSYGLSHDVLEVTKANYDSCETTNAIST  83

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
               G T I LS  G  YF+C + GHC +GMKL +N
Sbjct  84   NAGGMTVITLSSLGKRYFICGTGGHCASGMKLEVN  118



>gb|KDP41427.1| hypothetical protein JCGZ_15834 [Jatropha curcas]
Length=195

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DY+TW + +TF VGDSLVFNYGG H VDEVS  DY+ C  GNA+ S 
Sbjct  24   YTVGDTSGWTMGVDYSTWTSGKTFAVGDSLVFNYGGGHTVDEVSASDYNTCTVGNAITSD  83

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TT+ L  AG  Y++C   GHC +GMKLA+ V+
Sbjct  84   SSGATTVALKTAGTHYYICGVVGHCGSGMKLAVTVK  119



>ref|XP_011016866.1| PREDICTED: blue copper protein-like [Populus euphratica]
Length=189

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KD+ VG   GW+   DY+TW + +TF+VGDSLVFNYGG H VDEV   DY  C  GNA+ 
Sbjct  26   KDYTVGDSSGWAIGMDYSTWTSGKTFSVGDSLVFNYGGGHTVDEVRASDYSTCTTGNAIT  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            S + G TTI L  AG  YF+C   GHC +GMK+A+ V 
Sbjct  86   SDSSGATTIALKTAGTHYFICGVPGHCGSGMKVAVTVA  123



>gb|AFK39061.1| unknown [Lotus japonicus]
Length=182

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+   DY+TW + +TF VGDSLVFNYG  H VDEV + DY +C  GN+L + + 
Sbjct  28   VGDTSGWAAGADYSTWTSDKTFAVGDSLVFNYGAGHTVDEVKESDYKSCTTGNSLSTDSS  87

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            GKTTI L  AG  YF+C   GHC  GMKLA+ V+
Sbjct  88   GKTTIALKTAGTHYFICSVPGHCSGGMKLAVTVK  121



>ref|XP_003602846.1| Blue copper protein [Medicago truncatula]
 gb|AES73097.1| plastocyanin-like domain protein [Medicago truncatula]
Length=186

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VG   GW+   DY TWA+ +TF VGDSLVFNYG  H VDEV + DY +C  GN++ + 
Sbjct  26   HTVGDKSGWAIGSDYNTWASDKTFAVGDSLVFNYGAGHTVDEVKESDYKSCTTGNSISTD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TTI L KAG  YF+C   GHC  GMKL++ V+
Sbjct  86   SSGPTTIPLKKAGTHYFICAVPGHCTGGMKLSVKVK  121



>gb|ACJ84190.1| unknown [Medicago truncatula]
 gb|AFK47413.1| unknown [Medicago truncatula]
Length=187

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VG   GW+   DY TWA+ +TF VGDSLVFNYG  H VDEV + DY +C  GN++ + 
Sbjct  26   HTVGDKSGWAIGSDYNTWASDKTFAVGDSLVFNYGAGHTVDEVKESDYKSCTTGNSISTD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TTI L KAG  YF+C   GHC  GMKL++ V+
Sbjct  86   SSGPTTIPLKKAGTHYFICAVPGHCTGGMKLSVKVK  121



>gb|ACJ83835.1| unknown [Medicago truncatula]
Length=187

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VG   GW+   DY TWA+ +TF VGDSLVFNYG  H VDEV + DY +C  GN++ + 
Sbjct  26   HTVGDKSGWAIGSDYNTWASDKTFAVGDSLVFNYGAGHTVDEVKESDYKSCTTGNSISTD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TTI L KAG  YF+C   GHC  GMKL++ V+
Sbjct  86   SSGPTTIPLKKAGTHYFICAVPGHCTGGMKLSVKVK  121



>gb|ACJ85992.1| unknown [Medicago truncatula]
Length=187

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VG   GW+   DY TWA+ +TF VGDSLVFNYG  H VDEV + DY +C  GN++ + 
Sbjct  26   HTVGDKSGWAIGSDYNTWASDKTFAVGDSLVFNYGAGHTVDEVKESDYKSCTTGNSISTD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TTI L KAG  YF+C   GHC  GMKL++ V+
Sbjct  86   SSGPTTIPLKKAGTHYFICAVPGHCTGGMKLSVKVK  121



>ref|XP_010258754.1| PREDICTED: uclacyanin-2-like [Nelumbo nucifera]
Length=155

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -3

Query  655  WSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDGKTTIK  476
            WSQ  DY  WA+ +TF VGD+LVF+YGG H + EVSK DYD+CN GN +R  ++G   +K
Sbjct  27   WSQGVDYVKWASGKTFFVGDTLVFSYGGLHSLAEVSKSDYDSCNIGNYIRLSSNGNDVVK  86

Query  475  LSKAGPMYFMCPSFGHCQTGMKLAINV  395
            LS+ G  YF+CP+  HC  GMKLAI V
Sbjct  87   LSQPGQRYFLCPTSNHCDEGMKLAITV  113



>ref|XP_010101008.1| Blue copper protein [Morus notabilis]
 gb|EXB86656.1| Blue copper protein [Morus notabilis]
Length=197

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GWS   DY+TW + +TF VGDSLVFNYG SH VDEVS  DY +C  GNA+ S 
Sbjct  27   YTVGDTAGWSLGVDYSTWTSDKTFVVGDSLVFNYGSSHTVDEVSSTDYSSCAVGNAINSD  86

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TTI L  AG  YF+C    HC  GMKLA+ V+
Sbjct  87   SSGATTIPLKTAGTHYFVCGVTSHCSNGMKLAVTVK  122



>ref|XP_003570004.1| PREDICTED: mavicyanin [Brachypodium distachyon]
Length=201

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            DH VG   GW+   DYTTWA+ +TF VGD+LVF YG SH V EV   DY  C+A N+++S
Sbjct  24   DHTVGDSSGWASGVDYTTWASDKTFKVGDTLVFQYGASHNVAEVGSADYSACSASNSIQS  83

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            F+D  T I L+K G  YF+C   GHC  GMKLA+ V 
Sbjct  84   FSDQDTKITLTKPGTRYFICGVTGHCAGGMKLAVKVS  120



>ref|XP_007141217.1| hypothetical protein PHAVU_008G177100g [Phaseolus vulgaris]
 gb|ESW13211.1| hypothetical protein PHAVU_008G177100g [Phaseolus vulgaris]
Length=208

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VG   GW+  GDY+TWA+   F VGDSLVFNYG  H VDEV++ DY +C  GN+L + 
Sbjct  26   HTVGDTSGWTIGGDYSTWASGLKFRVGDSLVFNYGPGHTVDEVTESDYKSCTTGNSLSTD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TTI L  AG  +F+C + GHCQ GMKL I V+
Sbjct  86   SSGATTITLKTAGTHHFICAAPGHCQGGMKLTIKVK  121



>ref|XP_010104273.1| Blue copper protein [Morus notabilis]
 gb|EXB99558.1| Blue copper protein [Morus notabilis]
Length=183

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
             + VG   GW+   DY TW + +TF VGD+LVFNY  SH VDEV+++ Y++C++ N L+S
Sbjct  22   QYTVGDASGWNSGVDYATWTSDKTFRVGDTLVFNYDSSHTVDEVNENGYNDCSSANVLKS  81

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            +     TIKLSK G +YF+CP+ GHC  GMKL ++V+
Sbjct  82   YAGTTATIKLSKTGTVYFICPTPGHCSGGMKLKVDVK  118



>gb|KHG05659.1| Blue copper [Gossypium arboreum]
Length=192

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 62/98 (63%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KD+ VG   GW+   DY+TW   +TF VGDSLVFNY  SH VDEVS  DY  C  GNA+ 
Sbjct  24   KDYTVGDTSGWTTGVDYSTWTKDKTFKVGDSLVFNYPTSHTVDEVSSSDYSTCTVGNAIT  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            +   G TT+ L  AG  YF+C   GHC  GMKL++ V+
Sbjct  84   TDNSGATTVALKTAGTHYFICGVVGHCANGMKLSVKVE  121



>gb|EMS47632.1| Blue copper protein [Triticum urartu]
Length=206

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG   GW+   DY+TWA+ +TFTVGD+LVF YG SH V EV   DY  C+A N+++S
Sbjct  33   DYTVGDSSGWASGVDYSTWASDKTFTVGDTLVFQYGASHNVAEVGSSDYSACSATNSIQS  92

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            F+D  T I L+K G  YF+C   GHC  GMKLA+ V
Sbjct  93   FSDQDTKITLTKPGTRYFICGVSGHCSGGMKLAVKV  128



>ref|XP_009417598.1| PREDICTED: blue copper protein-like [Musa acuminata subsp. malaccensis]
Length=202

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYG-GSHGVDEVSKDDYDNCNAGNALR  506
            DH VGG  GW+   DYT W + +TF  GDSL FNYG G H VD+VS  DY +C+A NAL 
Sbjct  28   DHTVGGSTGWANGVDYTKWTSGKTFVAGDSLTFNYGAGVHTVDQVSATDYSSCSASNALS  87

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            +   G+TT+KLSKAG  YF+C    HC  GMK+A+ V+
Sbjct  88   TDGSGQTTVKLSKAGTYYFICGVASHCSNGMKIAVPVK  125



>gb|ACJ83883.1| unknown [Medicago truncatula]
 gb|AFK49416.1| unknown [Medicago truncatula]
 gb|KEH17866.1| plastocyanin-like domain protein [Medicago truncatula]
Length=199

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D  VG   GW+   DYT WA+ +TF VGD+LVF YG SH VDEV + DY +C + NA+++
Sbjct  23   DFTVGDANGWNLGVDYTKWASGKTFKVGDNLVFKYGSSHQVDEVDESDYKSCTSSNAIKN  82

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQT--GMKLAINV  395
            +  G + + L+KAG +YF+CP+ GHC +  GMKL +NV
Sbjct  83   YAGGNSKVPLTKAGKIYFICPTLGHCTSTGGMKLEVNV  120



>gb|AFK43360.1| unknown [Medicago truncatula]
Length=199

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D  VG   GW+   DYT WA+ +TF VGD+LVF YG SH VDEV + DY +C + NA+++
Sbjct  23   DFTVGDANGWNLGVDYTKWASGKTFKVGDNLVFKYGSSHQVDEVDESDYKSCTSSNAIKN  82

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQT--GMKLAINV  395
            +  G + + L+KAG +YF+CP+ GHC +  GMKL +NV
Sbjct  83   YAGGNSKVPLTKAGKIYFICPTLGHCTSTGGMKLEVNV  120



>ref|XP_007018694.1| Cupredoxin superfamily protein, putative [Theobroma cacao]
 gb|EOY15919.1| Cupredoxin superfamily protein, putative [Theobroma cacao]
Length=189

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG   GWS   DY+ W   +TF VGDSLVFNY  SH VDEVS+ DY  C  GNA+ +
Sbjct  25   DYTVGDTAGWSTGVDYSIWTQGKTFNVGDSLVFNYPTSHTVDEVSQSDYSTCTVGNAIST  84

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
               G TTI L  AG  YF+C   GHC  GMKLA+ V+
Sbjct  85   ENTGATTITLKTAGTHYFICGVIGHCGNGMKLAVTVE  121



>ref|XP_010247016.1| PREDICTED: uclacyanin-3 [Nelumbo nucifera]
Length=230

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D  VGG  GW  + D  TWAAS++F VGDSL+F Y   H V EV+K DYD+C++ N ++S
Sbjct  24   DLKVGGSSGWDTTTDLQTWAASQSFFVGDSLIFTYSSIHDVLEVTKADYDSCSSSNPIKS  83

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + DG TTI+LS     YF+C   GHC  GMKL +NV
Sbjct  84   YNDGNTTIQLSSPVKRYFICGKTGHCDQGMKLEVNV  119



>ref|XP_004152622.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 ref|XP_004162222.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 gb|KGN62713.1| hypothetical protein Csa_2G369150 [Cucumis sativus]
Length=208

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GWS   DY++W + +TF VGD+L+FNYGG H VDEVS  DY++C A N++ S 
Sbjct  28   YTVGDAAGWSTGVDYSSWTSGKTFVVGDTLMFNYGGGHTVDEVSGSDYNSCTASNSISSD  87

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TT+ L+K G  YF+C + GHC  GMKLA+ V 
Sbjct  88   STGATTVTLNKPGTHYFICGALGHCSNGMKLAVTVA  123



>ref|XP_007226416.1| hypothetical protein PRUPE_ppa023338mg, partial [Prunus persica]
 gb|EMJ27615.1| hypothetical protein PRUPE_ppa023338mg, partial [Prunus persica]
Length=167

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DY+TW + +TF VGDSLVFNYG  H VDEVS  DY  C  GN++ S 
Sbjct  6    YTVGDSSGWTSGVDYSTWTSGKTFAVGDSLVFNYGSGHTVDEVSGSDYKTCTVGNSITSD  65

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + G TTI L  AG  YF+C   GHC  GMK+++NV
Sbjct  66   SSGATTIPLKAAGTRYFICAVVGHCGMGMKVSVNV  100



>gb|EYU36477.1| hypothetical protein MIMGU_mgv1a014161mg [Erythranthe guttata]
Length=198

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GWS   DYTTW + +TF VGD+LVFNY   H VDEVS +DY +C  GNA+ + 
Sbjct  30   YTVGEASGWSIGADYTTWTSDKTFAVGDTLVFNYAPGHTVDEVSANDYKSCTTGNAIATD  89

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TT+ L  AGP YF+C   GHC  GMKLA+ V 
Sbjct  90   SSGATTVALKAAGPHYFICGVPGHCGGGMKLAVTVA  125



>ref|XP_006658198.1| PREDICTED: blue copper protein-like [Oryza brachyantha]
Length=192

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VGG+G W  +G+Y  W+AS+ F+ GDS++F Y  SH V EVSK DYD C+  NA+ S+
Sbjct  25   HPVGGNGAWDTTGNYNAWSASQKFSQGDSILFTYPPSHDVLEVSKADYDACSPANAVASY  84

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            T G +TIKL+  G  YF+C   GHC  GMKL + V
Sbjct  85   TGGSSTIKLAAPGKRYFICGLPGHCAAGMKLEVTV  119



>ref|XP_010035616.1| PREDICTED: blue copper protein-like [Eucalyptus grandis]
Length=248

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            +++VGG +GGW  + D  TWA+S+TF VGD+L F Y   H V EV+K DYD+C A +A++
Sbjct  25   NYVVGGLNGGWDTNTDQATWASSQTFLVGDNLTFQYSPGHDVSEVTKADYDSCQATSAIQ  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            ++T G T I L+  G  YF+C S GHC  GMKL IN
Sbjct  85   TYTSGSTVIPLTSPGKRYFICSSPGHCAAGMKLQIN  120



>ref|XP_008219351.1| PREDICTED: blue copper protein [Prunus mume]
Length=189

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DY+TW + +TF VGDSL FNYG  H VDEVS  DY  C  GN++ S 
Sbjct  28   YTVGDSSGWTSGVDYSTWTSGKTFAVGDSLAFNYGSGHTVDEVSGSDYKTCTVGNSITSD  87

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + G TTI L  AG  YF+C   GHC  GMKL++NV
Sbjct  88   SSGATTIPLKAAGTRYFICAVVGHCGMGMKLSVNV  122



>dbj|BAJ90037.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=198

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGG-WSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            DH VGG G  WS SG Y +W+A + F+ GDSLVF+Y  +H V EVSK DYD C A   + 
Sbjct  26   DHPVGGSGATWSTSGGYDSWSAKQKFSPGDSLVFSYSPAHDVVEVSKADYDACTASKVVA  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S+T G T +KL+ AG  YF+C   GHC  GMKL +NV
Sbjct  86   SYTGGSTKVKLTTAGKRYFICSIAGHCDAGMKLQVNV  122



>gb|KDO59873.1| hypothetical protein CISIN_1g043413mg, partial [Citrus sinensis]
Length=185

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++ VGG +GGW  + D  TWA S+ F VGD+L+F Y  SH V EVSK DYD+C   N ++
Sbjct  24   NYTVGGPNGGWDTATDLRTWATSQKFLVGDNLIFQYPSSHDVTEVSKPDYDSCQTSNKIK  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+TDG T I LS  G  YF+C + GHC  GMK+ I+
Sbjct  84   SYTDGNTVIPLSSPGKRYFICGAPGHCTVGMKVGID  119



>ref|XP_006433913.1| hypothetical protein CICLE_v10002591mg [Citrus clementina]
 gb|ESR47153.1| hypothetical protein CICLE_v10002591mg [Citrus clementina]
 gb|KDO81064.1| hypothetical protein CISIN_1g029725mg [Citrus sinensis]
Length=189

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+   DY+TW + +TF VGDSLVFNYG  H VDEVS  DY++C  GNA+ S + 
Sbjct  29   VGESSGWTMGTDYSTWTSGKTFAVGDSLVFNYGSGHTVDEVSGSDYNSCTVGNAITSDSS  88

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G TTI L  AG  YF+C   GHC +GMKLA+ V
Sbjct  89   GATTITLKTAGTHYFICGVPGHCGSGMKLAVTV  121



>ref|XP_010544564.1| PREDICTED: uclacyanin-2 [Tarenaya hassleriana]
Length=174

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 62/98 (63%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            + ++VG   GW Q  DYT W   +TF VGD L F Y  SH VD V+KD YDNC+  N L 
Sbjct  28   ETYLVGDSSGWIQGFDYTAWTRGKTFKVGDVLEFKYRSSHTVDVVNKDSYDNCDTSNLLE  87

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
             F+ G T   L+  G +YF+C + GHCQ GMKLA+NVQ
Sbjct  88   KFSGGDTKYTLNATGAIYFICATPGHCQAGMKLAVNVQ  125



>ref|NP_001234979.1| uncharacterized protein LOC100305666 precursor [Glycine max]
 gb|ACU13471.1| unknown [Glycine max]
 gb|KHN26101.1| Blue copper protein [Glycine soja]
Length=204

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VG   GW+   DY+TWA+   F VGDSLVFNYG  H VDEV + DY +C  GN+L + 
Sbjct  26   HTVGDTSGWALGVDYSTWASGLKFKVGDSLVFNYGTGHTVDEVKESDYKSCTMGNSLSTD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + G TTI L  AG  YFMC + GHC  GMKLA+ V
Sbjct  86   SSGATTITLKTAGTHYFMCAAPGHCDGGMKLAVKV  120



>ref|XP_009586697.1| PREDICTED: blue copper protein-like [Nicotiana tomentosiformis]
Length=194

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DY+TWA  +TF VGDSL+FNY   H VDEVS  DY +C AGNA+ S 
Sbjct  26   YTVGDSAGWAMGVDYSTWATGKTFNVGDSLLFNYPSGHTVDEVSASDYQSCTAGNAITSD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
              G TTI L  AG  YF C + GHC  GMKLA+ V
Sbjct  86   KSGATTISLKTAGTHYFTCGAMGHCSGGMKLAVTV  120



>ref|XP_003529032.1| PREDICTED: uclacyanin-2-like [Glycine max]
Length=185

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            DH VG  GGW+   +Y TWA+ +TF +GD+LVF Y  +H VDEV +  Y++C++ N +++
Sbjct  23   DHEVGDTGGWALGVNYNTWASGKTFRIGDNLVFKYDSTHQVDEVDESGYNSCSSSNIIKN  82

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + DG T I+L+  G  YF+CP  GHC  GMKL INV
Sbjct  83   YKDGNTKIELTSTGKRYFLCPISGHCAGGMKLQINV  118



>ref|XP_003521063.1| PREDICTED: uclacyanin-2 [Glycine max]
Length=187

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            DH VG   GW+   +Y TWA+ +TFTVGD+LVF Y  +H VDEV +  Y++C++ N++++
Sbjct  23   DHEVGDTSGWALGVNYNTWASGKTFTVGDTLVFKYDSTHQVDEVDESGYNSCSSSNSIKN  82

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + DG + I+L+  G  YF+CP  GHC  GMKL INV
Sbjct  83   YQDGNSKIELTSPGKRYFLCPISGHCAGGMKLQINV  118



>gb|EMS61517.1| Early nodulin-like protein 2 [Triticum urartu]
Length=198

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGG-WSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            DH VGG G  W+ SG Y +W+  + F+ GDSLVF+Y  +H V EVSK DYD C A   + 
Sbjct  26   DHQVGGSGATWATSGGYDSWSGKQKFSPGDSLVFSYSPAHDVVEVSKADYDACTASKVVA  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             +T GKTT+KL+ AG  YF+C   GHC  GMKL +NV
Sbjct  86   RYTGGKTTVKLTTAGKRYFICSITGHCDAGMKLQVNV  122



>ref|XP_006473004.1| PREDICTED: blue copper protein-like [Citrus sinensis]
Length=189

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+   DY+TW + +TF VGDS+VFNYG  H VDEVS  DY++C  GNA+ S + 
Sbjct  29   VGESSGWTMGTDYSTWTSGKTFAVGDSIVFNYGSGHTVDEVSGSDYNSCTVGNAITSDSS  88

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G TTI L  AG  YF+C   GHC +GMKLA+ V
Sbjct  89   GATTITLKTAGTHYFICGVPGHCGSGMKLAVTV  121



>ref|XP_006385823.1| hypothetical protein POPTR_0003s15000g [Populus trichocarpa]
 gb|ERP63620.1| hypothetical protein POPTR_0003s15000g [Populus trichocarpa]
Length=174

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            ++VG + GW  S D  TWA  +TF VGD L+F Y  SH VDEV K+D+D+CN  N LR+F
Sbjct  15   YMVGDNSGWDISTDIDTWAQDKTFAVGDVLMFQYSSSHSVDEVKKEDFDSCNTTNVLRTF  74

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            T G TT+ L+  G  YF+C +  HC  GMKL +NV
Sbjct  75   TTGNTTVSLTNPGTRYFVCGNKLHCLGGMKLQVNV  109



>gb|EMT26506.1| Blue copper protein [Aegilops tauschii]
Length=134

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG   GW+   DY+TWA+ +TFTVGD+LVF YG SH V EV   DY  C+A N+++S
Sbjct  24   DYTVGDSSGWASGVDYSTWASDKTFTVGDTLVFQYGASHNVAEVGSSDYSACSATNSIQS  83

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            F+D  T + L+K G  YF+C   GHC  G+KLA  +
Sbjct  84   FSDQDTKVTLTKPGTRYFICGVSGHCSRGIKLARQI  119



>ref|XP_008230134.1| PREDICTED: blue copper protein [Prunus mume]
Length=244

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = -3

Query  670  GGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDG  491
            G +GGW  + D  TWA+S+TF VGD+L F Y  SH V EVSK DYD+C A N+++S++ G
Sbjct  30   GPNGGWDSTTDLQTWASSQTFLVGDNLNFQYAPSHDVVEVSKADYDSCQASNSIQSYSGG  89

Query  490  KTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
             TTI LS  G  YF+C + GHC  GMKL ++
Sbjct  90   STTIPLSSPGKRYFICGTTGHCSQGMKLEVD  120



>ref|XP_006385822.1| hypothetical protein POPTR_0003s15000g [Populus trichocarpa]
 gb|ERP63619.1| hypothetical protein POPTR_0003s15000g [Populus trichocarpa]
Length=183

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            ++VG + GW  S D  TWA  +TF VGD L+F Y  SH VDEV K+D+D+CN  N LR+F
Sbjct  24   YMVGDNSGWDISTDIDTWAQDKTFAVGDVLMFQYSSSHSVDEVKKEDFDSCNTTNVLRTF  83

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            T G TT+ L+  G  YF+C +  HC  GMKL +NV
Sbjct  84   TTGNTTVSLTNPGTRYFVCGNKLHCLGGMKLQVNV  118



>emb|CAN61581.1| hypothetical protein VITISV_008034 [Vitis vinifera]
Length=187

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG   GW+   DY+TW + +TF VGD+LV   GG H VDEVS  DY  C  GNA+ S
Sbjct  24   DYTVGDSTGWTMGADYSTWTSGKTFVVGDTLVQLLGGGHTVDEVSASDYSTCTVGNAITS  83

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
             + G TTI L K G  YF+C   GHC +GMKLA+ V+
Sbjct  84   DSTGATTISLKKTGTHYFICGVIGHCGSGMKLAVTVE  120



>ref|XP_011074212.1| PREDICTED: blue copper protein [Sesamum indicum]
Length=193

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+  GDY +WA  +TF VGD+LVFNY   H VDEVS +DY  C  GN+L S 
Sbjct  28   YTVGDSSGWAMGGDYGSWATDKTFAVGDTLVFNYAPGHTVDEVSANDYKTCTTGNSLSSD  87

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G T+I L  AG  YF+C   GHC  GMKLAI V 
Sbjct  88   SSGATSITLKSAGSHYFICGVPGHCSGGMKLAITVA  123



>ref|XP_006447468.1| hypothetical protein CICLE_v10018339mg [Citrus clementina]
 gb|ESR60708.1| hypothetical protein CICLE_v10018339mg [Citrus clementina]
Length=221

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++ VGG +GGW  + D  TWA S+ F VGD+L+F Y  SH V EVSK DYD+C   N ++
Sbjct  4    NYTVGGPNGGWDTATDLRTWATSQKFLVGDNLIFQYPSSHDVTEVSKPDYDSCQTSNKIQ  63

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S+TDG T I LS  G  YF+C + GHC  GMK+ I+ 
Sbjct  64   SYTDGNTVIPLSSPGKRYFICGAPGHCTVGMKVEIDA  100



>ref|XP_006469730.1| PREDICTED: early nodulin-20-like [Citrus sinensis]
Length=241

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++ VGG +GGW  + D  TWA S+ F VGD+L+F Y  SH V EVSK DYD+C   N ++
Sbjct  24   NYTVGGPNGGWDTATDLRTWATSQKFLVGDNLIFQYPSSHDVTEVSKPDYDSCQTSNKIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+TDG T I LS  G  YF+C + GHC  GMK+ I+
Sbjct  84   SYTDGNTVIPLSSPGKRYFICGAPGHCTVGMKVEID  119



>ref|XP_010522318.1| PREDICTED: blue copper protein [Tarenaya hassleriana]
Length=266

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDDYDNCNAGNALR  506
            DH +GG  GW+   D  TW+AS+TF VGD+LVF Y  + H V EVSK ++DNC A   L 
Sbjct  24   DHTIGGPSGWTMGSDLRTWSASQTFVVGDNLVFAYPSAFHDVVEVSKPEFDNCQAIKPLV  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +F++G T + L+  G  YF+C   GHC  GMKL +NV
Sbjct  84   TFSNGNTVVPLTSPGKRYFICGMPGHCTQGMKLEVNV  120



>gb|KFK31132.1| hypothetical protein AALP_AA6G072100 [Arabis alpina]
Length=260

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDDYDNCNAGNALR  506
            DH +GG  GW+ S +  TWAA++TF+VGD+LVF+Y  + H V EV+K ++D+C A N L 
Sbjct  25   DHTIGGPSGWTVSANLRTWAAAQTFSVGDNLVFSYPTAFHDVVEVTKPEFDSCQAVNPLT  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +F +G + + L+  G  YF+C S GHC +GMKL +NV
Sbjct  85   TFANGNSIVPLTTPGKRYFICGSPGHCSSGMKLEVNV  121



>dbj|BAK00577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=190

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG   GW+   DY+TWA+ +TF VGD+LVF YG SH V EV   DY  C+A N+++S
Sbjct  24   DYTVGDSSGWASGVDYSTWASDKTFIVGDTLVFQYGASHNVAEVGSSDYSACSATNSIQS  83

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            ++D  T I L+K G  YF+C   GHC  GMKLA+ V
Sbjct  84   YSDQDTKITLTKPGTRYFICGVSGHCAGGMKLAVKV  119



>ref|XP_004287916.1| PREDICTED: uncharacterized protein LOC101307724 [Fragaria vesca 
subsp. vesca]
Length=233

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -3

Query  670  GGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDG  491
            G +GGW  S D  TWA+S+TF VGD+L F Y  SH V EVSK DYD+C   N++++++ G
Sbjct  31   GPNGGWDASTDLQTWASSQTFLVGDNLNFQYSPSHNVLEVSKADYDSCQGSNSIQAYSGG  90

Query  490  KTTIKLSKAGPMYFMCPSFGHCQTGMKLAI  401
             TTI LS AG  YF+C + GHC  GMKL +
Sbjct  91   STTIPLSSAGKRYFICGTIGHCSQGMKLEV  120



>gb|KHG25479.1| Blue copper [Gossypium arboreum]
Length=175

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DY++WA  +TF VGDSLVFNY  SH V+EVS  DY  C  G A+ + 
Sbjct  27   YTVGDTSGWATGVDYSSWANDKTFKVGDSLVFNYPTSHTVEEVSSSDYSTCTVGKAISTD  86

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TTI L  AG  YF+C   GHC++GMKLAI V+
Sbjct  87   STGATTINLKTAGTHYFICGVAGHCESGMKLAIKVE  122



>ref|XP_010919749.1| PREDICTED: blue copper protein-like [Elaeis guineensis]
Length=186

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
             + VG   GW+   DY+TW + +TF VGD+L+F YG  H VDEVS+ DY  C+A N++++
Sbjct  21   QYTVGDSQGWTSGVDYSTWVSDKTFKVGDTLLFQYGFLHSVDEVSESDYKACSASNSIQT  80

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + D  T I LSKAG  YF+C + GHC  GMKLA+ V
Sbjct  81   YNDQNTKITLSKAGSRYFICGTPGHCTGGMKLAVTV  116



>ref|XP_007018695.1| Cupredoxin superfamily protein, putative [Theobroma cacao]
 gb|EOY15920.1| Cupredoxin superfamily protein, putative [Theobroma cacao]
Length=154

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW    DY  WA  + F VGD LVFNY   H VDEV ++DY+ C AGNAL +   
Sbjct  31   VGESTGWIPGVDYNAWAKGKNFKVGDRLVFNYPSGHTVDEVFENDYNTCTAGNALSTDNS  90

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G T+I L  AGP YFMC   GHC  GMKLA+NV
Sbjct  91   GSTSIPLLTAGPHYFMCGVVGHCGQGMKLAVNV  123



>ref|XP_008466191.1| PREDICTED: blue copper protein-like [Cucumis melo]
Length=199

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GWS   DY TWA+ +TF+VGD L FNY G H VDEVS +DY  C AGN++ S + 
Sbjct  29   VGDTAGWSLGVDYGTWASGKTFSVGDKLAFNYAGGHTVDEVSANDYKACAAGNSITSDSS  88

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            G TTI L   G  YF+C S GHC  GMKL++ V 
Sbjct  89   GSTTITLKTPGTHYFICSSMGHCDGGMKLSVTVA  122



>ref|XP_004956416.1| PREDICTED: blue copper protein-like [Setaria italica]
Length=179

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 63/98 (64%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KD+ VG   GW    DYT WA  + F+VGD+L F YG +H V EVS+ D+  C+A N LR
Sbjct  24   KDYTVGDSSGWKPGVDYTAWAKGKPFSVGDTLSFQYGAAHSVLEVSEADHSACSASNPLR  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            +  D  TTI L+K G  YF+C + GHC +GMKLA+ V 
Sbjct  84   THGDQSTTIPLTKPGTRYFICGTAGHCASGMKLAVTVS  121



>emb|CAC39044.1| uclacyanin 3-like protein [Oryza sativa]
Length=202

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG   GWS   DY TWA S+TF+VGDSLVF Y   H V EVS  DY  C+A N+++S
Sbjct  27   DYTVGDTSGWSSGVDYVTWAKSKTFSVGDSLVFQYSMMHTVAEVSSADYSACSASNSIQS  86

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            ++D  T I L+K G  YF+C + GHC  GMKLA+ V
Sbjct  87   YSDQNTKIALTKPGTRYFICGTSGHCSGGMKLAVMV  122



>gb|KEH17865.1| plastocyanin-like domain protein [Medicago truncatula]
Length=187

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D  VG   GW+Q  DYT WA+ +TF VGD+LVF YG  H V+EV +  Y +C+  N ++S
Sbjct  23   DFTVGDANGWTQGVDYTKWASGKTFKVGDNLVFKYGSFHQVNEVDESGYKSCSTSNTIKS  82

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQT--GMKLAINV  395
            + DG + + L+KAG +YF+CP+ GHC +  GMKL +NV
Sbjct  83   YDDGDSKVPLTKAGKIYFICPTPGHCTSTGGMKLEVNV  120



>gb|ACU17256.1| unknown [Glycine max]
Length=187

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            DH VG   GW+   +Y TWA+ +TF VGD+LVF Y  +H VDEV +  Y++C++ N++++
Sbjct  23   DHEVGDTSGWALGVNYNTWASGKTFAVGDTLVFKYDSTHQVDEVDESGYNSCSSSNSIKN  82

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + DG + I+L+  G  YF+CP  GHC  GMKL INV
Sbjct  83   YQDGNSKIELTSPGKRYFLCPISGHCAGGMKLQINV  118



>ref|XP_007216249.1| hypothetical protein PRUPE_ppa017076mg [Prunus persica]
 gb|EMJ17448.1| hypothetical protein PRUPE_ppa017076mg [Prunus persica]
Length=240

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -3

Query  670  GGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDG  491
            G +GGW  + D  TWA+S+TF VGD+L F Y  SH V EV K DYD+C A N+++S++ G
Sbjct  30   GPNGGWDSTTDLQTWASSQTFLVGDNLNFQYAPSHDVVEVPKADYDSCQASNSIQSYSGG  89

Query  490  KTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
             TTI LS  G  YF+C + GHC  GMKL ++
Sbjct  90   STTIPLSSPGKRYFICGTTGHCSQGMKLEVD  120



>ref|NP_001236244.1| uncharacterized protein LOC100306522 precursor [Glycine max]
 gb|ACU14731.1| unknown [Glycine max]
 gb|KHN08961.1| Blue copper protein [Glycine soja]
Length=168

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DY+TW   + F+VGDSL FNYG  H VDEV + DY +C AGN++ + 
Sbjct  26   YTVGDTSGWAIGTDYSTWTGDKIFSVGDSLAFNYGAGHTVDEVKESDYKSCTAGNSISTD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TTI L  AG  YF+C   GHC  GMKLA+ V+
Sbjct  86   SSGATTIALKSAGTHYFICSVPGHCSGGMKLAVTVK  121



>ref|XP_004237949.1| PREDICTED: blue copper protein [Solanum lycopersicum]
Length=180

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 60/97 (62%), Gaps = 0/97 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            K + VG   GW    DYTTWA+  T  VGDSLVFNY   H VDEVS  DY +C  GN++ 
Sbjct  21   KVYTVGDSSGWGLGVDYTTWASGITLNVGDSLVFNYPSGHTVDEVSSSDYSSCTTGNSIT  80

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S + G TTI L  AG  YF+C   GHC  GMKLA+ V
Sbjct  81   SDSSGATTIPLKTAGTHYFICGVMGHCSGGMKLAVTV  117



>ref|XP_004487369.1| PREDICTED: blue copper protein-like [Cicer arietinum]
Length=232

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            +HIVGG +GGW  S D  TWA+S+ F VG++L F Y  +H V EV+K DYD+C   N ++
Sbjct  24   NHIVGGPNGGWDTSTDLQTWASSQQFAVGNNLTFQYSPNHNVVEVTKADYDSCQQTNPIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+ DG TTI L+     YF+C + GHC  GMKL I+
Sbjct  84   SYNDGATTITLTSPVKRYFICGTIGHCSQGMKLEID  119



>ref|NP_001047603.2| Os02g0653200 [Oryza sativa Japonica Group]
 dbj|BAD24983.1| putative uclacyanin 3 [Oryza sativa Japonica Group]
 gb|EAY86924.1| hypothetical protein OsI_08309 [Oryza sativa Indica Group]
 gb|EAZ24035.1| hypothetical protein OsJ_07765 [Oryza sativa Japonica Group]
 dbj|BAF09517.2| Os02g0653200 [Oryza sativa Japonica Group]
Length=202

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG   GWS   DY TWA S+TF+VGDSLVF Y   H V EVS  DY  C+A N+++S
Sbjct  27   DYTVGDTSGWSSGVDYDTWAKSKTFSVGDSLVFQYSMMHTVAEVSSADYSACSASNSIQS  86

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            ++D  T I L+K G  YF+C + GHC  GMKLA+ V
Sbjct  87   YSDQNTKIALTKPGTRYFICGTSGHCSGGMKLAVTV  122



>ref|XP_009770624.1| PREDICTED: blue copper protein-like [Nicotiana sylvestris]
Length=192

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DY+TWA  +TF VGDSLVFNY   H VDEVS  DY +C AGNA+ S 
Sbjct  26   YTVGDSAGWAMGVDYSTWATGKTFNVGDSLVFNYPSGHTVDEVSASDYQSCTAGNAITSD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAI  401
              G TTI L  AG  YF C   GHC  GMKL++
Sbjct  86   QSGATTIPLKTAGTRYFTCGVMGHCSGGMKLSV  118



>ref|XP_003602845.1| Blue copper protein [Medicago truncatula]
 gb|AES73096.1| blue copper-like protein [Medicago truncatula]
Length=184

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            +HIVG   GW+   DY TW + +TF VGDSLVFNY   H VDEV + DY +C  GN++ +
Sbjct  25   NHIVGDGLGWTVGPDYNTWTSDKTFAVGDSLVFNYVAGHTVDEVKESDYKSCTTGNSIST  84

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
             + G TTI L +AG  YF+C   GHC  GMKL + V+
Sbjct  85   DSSGATTIPLKEAGTHYFICAIPGHCTFGMKLFVKVK  121



>ref|XP_008798824.1| PREDICTED: blue copper protein-like [Phoenix dactylifera]
Length=189

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            ++ VG   GW+   DY+TW + +TF VGD+L+F YG  H VDEVS+ DY  C+  N+++S
Sbjct  21   EYTVGDSQGWTSGVDYSTWVSDKTFKVGDTLLFQYGFLHSVDEVSESDYKACSTSNSMQS  80

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            F+D  T I LSK G  YF+C + GHC  GMKLA+ V
Sbjct  81   FSDQNTKITLSKPGTRYFICGTSGHCSGGMKLAVAV  116



>ref|XP_004987264.1| PREDICTED: uclacyanin-2-like [Setaria italica]
Length=199

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 60/97 (62%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSG-DYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            DH VGG G W  SG +Y  WAA +    GD++ F Y  SH V EV+K DYD C+  N ++
Sbjct  26   DHPVGGSGAWDASGTNYNAWAAKQPIKQGDTMSFQYSASHDVTEVTKADYDTCSGANPIK  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S+T G TTIKL+  G  YF+C   GHC  GMKL + V
Sbjct  86   SYTGGATTIKLTTPGKRYFICSVTGHCSAGMKLEVTV  122



>ref|NP_001057157.1| Os06g0218600 [Oryza sativa Japonica Group]
 dbj|BAD36102.1| putative blue copper protein [Oryza sativa Japonica Group]
 dbj|BAD37230.1| putative blue copper protein [Oryza sativa Japonica Group]
 dbj|BAF19071.1| Os06g0218600 [Oryza sativa Japonica Group]
 gb|EAZ36287.1| hypothetical protein OsJ_20609 [Oryza sativa Japonica Group]
 dbj|BAG96365.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93149.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96552.1| unnamed protein product [Oryza sativa Japonica Group]
Length=198

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNALRS  503
            + VG   GW+   DYTTWA+ + F +GD+LVFNY GG+H VDEVS  DY  C A NAL+S
Sbjct  25   YTVGDTSGWAMGADYTTWASDKKFKMGDTLVFNYAGGAHSVDEVSAADYAACTASNALQS  84

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             + G TT+ L  AG  YF+C   GHC  GMKL ++V
Sbjct  85   DSSGTTTVTLKTAGKHYFICGIAGHCSNGMKLVVDV  120



>ref|XP_002297929.1| hypothetical protein POPTR_0001s11680g [Populus trichocarpa]
 gb|EEE82734.1| hypothetical protein POPTR_0001s11680g [Populus trichocarpa]
Length=184

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            ++VG + GW  S D  TWA S+TF VGD L F Y  SH ++EV K+D+D+CN  N  R+F
Sbjct  24   YMVGDNSGWDISTDLDTWAQSKTFVVGDLLSFQYSSSHSLEEVKKEDFDSCNTTNVARTF  83

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            T+G TT+ L++ G  YF+C +  HC  GMKL +NV+
Sbjct  84   TNGNTTVPLTEPGTRYFVCGNQLHCLGGMKLQVNVE  119



>gb|EAZ00173.1| hypothetical protein OsI_22178 [Oryza sativa Indica Group]
Length=198

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNALRS  503
            + VG   GW+   DYTTWA+ + F +GD+LVFNY GG+H VDEVS  DY  C A NAL+S
Sbjct  25   YTVGDTSGWAMGADYTTWASDKKFKMGDTLVFNYAGGAHSVDEVSAADYAACTASNALQS  84

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             + G TT+ L  AG  YF+C   GHC  GMKL ++V
Sbjct  85   DSSGTTTVTLKTAGKHYFICGIAGHCSNGMKLVVDV  120



>ref|XP_011022375.1| PREDICTED: stellacyanin-like [Populus euphratica]
Length=183

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            ++VG + GW  S D  TWA  +TF VGD L+F Y  SH V+EV K+D+D+CN  N LR F
Sbjct  24   YMVGDNSGWDISTDIDTWAQDKTFAVGDLLMFQYSSSHSVEEVKKEDFDSCNMTNVLRKF  83

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            T G TT+ L+  G  YF+C +  HC  GMKL +NV
Sbjct  84   TTGNTTVSLTNPGTRYFVCGNKLHCLGGMKLQVNV  118



>sp|Q41001.1|BCP_PEA RecName: Full=Blue copper protein; Flags: Precursor [Pisum sativum]
 emb|CAA80963.1| blue copper protein [Pisum sativum]
 prf||2115352A blue Cu protein
Length=189

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYG-GSHGVDEVSKDDYDNCNAGNALRS  503
            + VG   GW   GDY+TWA+ +TF VGDSLVFNYG G+H VDEV + DY +C +GN++ +
Sbjct  27   YTVGDTSGWVIGGDYSTWASDKTFAVGDSLVFNYGAGAHTVDEVKESDYKSCTSGNSIST  86

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
             + G TTI L KAG  YF+C   GH   GMKL+I V+
Sbjct  87   DSTGATTIPLKKAGKHYFICGVPGHSTGGMKLSIKVK  123



>gb|KHN25766.1| Early nodulin-like protein 1 [Glycine soja]
Length=216

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGGD-GGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++IVGG  GGW  + +  +WA+S+ F+VGDSLVF Y  +H V EV+K DYD+C   N ++
Sbjct  24   NYIVGGPSGGWDTNSNLQSWASSQIFSVGDSLVFQYPPNHDVVEVTKADYDSCQPTNPIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+ DG TTI L+  G  YF+C + GHC  GMK+ I+
Sbjct  84   SYNDGATTIPLTLPGKRYFICGTIGHCSQGMKVEID  119



>ref|XP_003540323.1| PREDICTED: blue copper protein-like [Glycine max]
Length=216

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGGD-GGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++IVGG  GGW  + +  +WA+S+ F+VGDSLVF Y  +H V EV+K DYD+C   N ++
Sbjct  24   NYIVGGPSGGWDTNSNLQSWASSQIFSVGDSLVFQYPPNHDVVEVTKADYDSCQPTNPIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+ DG TTI L+  G  YF+C + GHC  GMK+ I+
Sbjct  84   SYNDGATTIPLTLPGKRYFICGTIGHCSQGMKVEID  119



>ref|XP_008341968.1| PREDICTED: blue copper protein-like [Malus domestica]
Length=239

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = -3

Query  679  HIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            ++VGG +G W  S D  TWA+ ++F VGD+L F Y  +H V EV K DYD+C A N+++S
Sbjct  26   YMVGGPNGAWDSSTDLQTWASLQSFLVGDNLNFQYSPNHDVIEVPKADYDSCQASNSIQS  85

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            +T G TTI LS  G  YF+C + GHC  GMKL +N
Sbjct  86   YTGGSTTIPLSSPGKRYFICGTIGHCSQGMKLEVN  120



>ref|XP_002448273.1| hypothetical protein SORBIDRAFT_06g024270 [Sorghum bicolor]
 gb|EES12601.1| hypothetical protein SORBIDRAFT_06g024270 [Sorghum bicolor]
Length=199

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KD+ VG   GW    DYT WA  + F +GD++ F Y  SH V EVS+ D+  C+A N LR
Sbjct  28   KDYTVGDSSGWKPGVDYTAWAKGKPFAIGDTISFQYSSSHSVLEVSEADHSACSASNPLR  87

Query  505  SFTDGK-TTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            S  DG+ TT+ L+KAG  YF+C + GHC +GMKLAI V 
Sbjct  88   SHRDGQSTTVPLTKAGTRYFICGAPGHCASGMKLAITVS  126



>gb|ACU23845.1| unknown [Glycine max]
Length=216

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGGD-GGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++IVGG  GGW  + +  +WA+S+ F+VGDSLVF Y  +H V EV+K DYD+C   N ++
Sbjct  24   NYIVGGPSGGWDTNSNLQSWASSQIFSVGDSLVFQYPPNHDVVEVTKADYDSCQPTNPIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+ DG TTI L+  G  YF+C + GHC  GMK+ I+
Sbjct  84   SYNDGATTIPLTLPGKRYFICGTIGHCSQGMKVEID  119



>ref|XP_009342269.1| PREDICTED: blue copper protein [Pyrus x bretschneideri]
Length=239

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = -3

Query  679  HIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            ++VGG +G W  S +  TWA+S++F VGD+L F Y  +H V EV K DYD+C A N+++S
Sbjct  26   YMVGGPNGAWDSSTNLQTWASSQSFLVGDNLNFQYSPNHDVIEVPKADYDSCQASNSIQS  85

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            +T G TTI LS  G  YF+C + GHC  GMKL +N
Sbjct  86   YTGGSTTIPLSSPGKRYFICGTIGHCSQGMKLEVN  120



>ref|NP_001058695.1| Os07g0105000 [Oryza sativa Japonica Group]
 dbj|BAC10370.1| uclacyanin 3-like protein-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD31933.1| uclacyanin 3-like protein-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD31115.1| uclacyanin 3-like protein-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF20609.1| Os07g0105000 [Oryza sativa Japonica Group]
 gb|EAZ02482.1| hypothetical protein OsI_24587 [Oryza sativa Indica Group]
 gb|EAZ38415.1| hypothetical protein OsJ_22793 [Oryza sativa Japonica Group]
Length=195

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VGG+G W  +G+Y  W+ S+ F+ GDS++F Y  SH V EV K  YD C+  NAL S+
Sbjct  28   HPVGGNGAWDTTGNYNAWSVSQKFSQGDSILFTYPSSHDVVEVPKASYDACSPANALASY  87

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            T G TT+KL   G  YF+C   GHC  GMKL + V
Sbjct  88   TGGSTTVKLDAPGKHYFICGVPGHCAAGMKLEVTV  122



>ref|XP_008362376.1| PREDICTED: blue copper protein-like [Malus domestica]
Length=181

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DYTTW + +TF VGDSLVFNYG  H VDEV+  DY  C  GN++ S 
Sbjct  24   YTVGDSSGWASGVDYTTWTSGKTFKVGDSLVFNYGSGHTVDEVTASDYKTCTVGNSITSD  83

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + G TTI L  AG   ++C + GHC  GMKL+++V
Sbjct  84   SSGATTILLKTAGTHNYICATIGHCGMGMKLSVSV  118



>ref|XP_004515341.1| PREDICTED: uclacyanin-2-like [Cicer arietinum]
Length=189

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D  VG   GW+Q  DYTTW + +TF VGD+LVF YG  H V+EV +  Y  C++ N ++ 
Sbjct  23   DFTVGDANGWTQGVDYTTWTSGKTFKVGDNLVFKYGSVHQVNEVDESGYKGCDSSNTIKK  82

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQT--GMKLAINV  395
            + DG + + LSK G +YF+CP+ GHC +  GMKL +NV
Sbjct  83   YEDGNSKVPLSKTGKIYFICPTPGHCTSTGGMKLEVNV  120



>ref|XP_006659514.1| PREDICTED: blue copper protein-like [Oryza brachyantha]
Length=176

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCN-AGNALRS  503
            H VGG  GWS    Y TWA+ +TF VGD LVFN+ G H V EV+K DY+ C+ +GN +  
Sbjct  27   HTVGGSAGWSTGQTYDTWASGQTFAVGDKLVFNFAGGHTVTEVTKSDYEACSVSGNPISD  86

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             T G  TI L+ AG  Y++C   GHC  GMKLAI V
Sbjct  87   TTTGPATIDLTSAGAHYYICTVAGHCTGGMKLAITV  122



>ref|XP_010413579.1| PREDICTED: uclacyanin-3-like [Camelina sativa]
Length=174

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG + GW+   +YTTW + +TF VGD+L F YG SH V  V K DYD C++    +SF++
Sbjct  27   VGDNAGWAAGVNYTTWVSGKTFRVGDTLEFKYGPSHSVSVVDKPDYDGCDSSRPTQSFSE  86

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
              T I L++ G ++F+CP+FGHC  GMKLA+ V
Sbjct  87   RDTKINLTRVGTIHFICPTFGHCLGGMKLAVPV  119



>ref|XP_009373387.1| PREDICTED: blue copper protein-like [Pyrus x bretschneideri]
Length=181

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DYTTW + +TF VGDSLVFNYG  H VDEV+  DY  C  GN++ S 
Sbjct  24   YTVGDSSGWASGVDYTTWTSGKTFKVGDSLVFNYGSGHTVDEVTASDYKTCTLGNSITSD  83

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + G TTI L  AG   ++C + GHC  GMKL++ V
Sbjct  84   SSGATTITLKTAGTHNYICATIGHCGMGMKLSVTV  118



>ref|XP_011026746.1| PREDICTED: mavicyanin [Populus euphratica]
Length=184

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            ++VG + GW  S D  TWA S+ F VGD L+F Y  SH ++EV K+D+D+CN  N  R+F
Sbjct  24   YMVGDNSGWDISTDLDTWAQSKKFVVGDLLLFQYSSSHSLEEVKKEDFDSCNTTNVARTF  83

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            T+G TT+ L++ G  YF+C +  HC  GMKL +NV+
Sbjct  84   TNGNTTVPLTEPGTRYFVCGNQLHCLGGMKLHVNVE  119



>ref|NP_191587.1| uclacyanin 3 [Arabidopsis thaliana]
 sp|Q96316.1|BCB3_ARATH RecName: Full=Uclacyanin-3; Short=Uclacyanin-III; AltName: Full=Blue 
copper-binding protein III; Short=BCB III; AltName: 
Full=Phytocyanin 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB07009.1| blue-copper binging protein III [Arabidopsis thaliana]
 gb|AAC32461.1| uclacyanin 3 [Arabidopsis thaliana]
 emb|CAB87865.1| uclacyanin 3 [Arabidopsis thaliana]
 gb|ABF19040.1| At3g60280 [Arabidopsis thaliana]
 gb|AEE80037.1| uclacyanin 3 [Arabidopsis thaliana]
Length=222

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+ + DYT W   +TF VGD+L F YG SH V  V K  YDNC++  A ++F D
Sbjct  26   VGDISGWTSNLDYTVWLTGKTFRVGDTLEFVYGLSHSVSVVDKAGYDNCDSSGATQNFAD  85

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G T I L+  G M+F+CP+FGHC+ GMKLA+ V
Sbjct  86   GDTKIDLTTVGTMHFLCPTFGHCKNGMKLAVPV  118



>ref|XP_008373105.1| PREDICTED: blue copper protein [Malus domestica]
Length=184

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DY+TW + +TF VGDSLVFNYG  H VDEV+  DY  C  GN++ S 
Sbjct  24   YTVGDSSGWASGVDYSTWTSGKTFKVGDSLVFNYGSGHTVDEVTDSDYKTCTVGNSITSD  83

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TTI L  AG   ++C S GHC  GMKL++ V 
Sbjct  84   SSGTTTIPLKTAGTHNYICGSVGHCTMGMKLSVTVA  119



>ref|XP_004136269.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 ref|XP_004172295.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 gb|KGN60237.1| hypothetical protein Csa_3G889930 [Cucumis sativus]
Length=195

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DY TWA+ +TF VGD L FNY G H VDEV  +DY  C AGN++ S 
Sbjct  27   YTVGDTAGWALGVDYVTWASGKTFGVGDKLAFNYAGGHTVDEVDPNDYKACAAGNSITSD  86

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G TTI L   G  YF+C S GHC  GMKL++ V 
Sbjct  87   SSGSTTITLKTPGTHYFICSSMGHCDGGMKLSVTVA  122



>ref|XP_010266815.1| PREDICTED: blue copper protein-like [Nelumbo nucifera]
Length=183

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNALRS  503
            + VG + GW+ + DY++W   +TF VGDSLVFNY GG H VDEVS+ DY +C  GNA+ S
Sbjct  26   YTVGDETGWTTNVDYSSWTKGKTFAVGDSLVFNYAGGGHTVDEVSQSDYTSCTVGNAISS  85

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             + GK+T  L   G  YF+C   GHC  GMKLA+ V
Sbjct  86   DSSGKSTYTLKTTGTHYFICGVLGHCGNGMKLAVTV  121



>ref|XP_009391330.1| PREDICTED: blue copper protein-like [Musa acuminata subsp. malaccensis]
Length=181

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNALR  506
            D+ VG   GW+   DY+ W   +TF  GD+L FNY  GSH VD+VS  DY +C+A NAL 
Sbjct  26   DYTVGDSTGWTSGFDYSKWTTGKTFVTGDTLTFNYIAGSHTVDQVSATDYSSCSASNALS  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + ++G+TT+ LSKAG  YF+C   GHC  GMK+A+ V
Sbjct  86   TDSNGQTTVTLSKAGTYYFICGVTGHCSNGMKVAVPV  122



>ref|XP_006655916.1| PREDICTED: blue copper protein-like [Oryza brachyantha]
Length=195

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNALRS  503
            + VG   GW+   DYTTWA+ +   VGD LVFNY GGSH VDEVS  DY +C+A NAL S
Sbjct  24   YTVGDTSGWAMGADYTTWASDKKLKVGDILVFNYAGGSHTVDEVSAADYASCSASNALAS  83

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
               G TT+ L  AG  YF+C   GHC  GMKL ++V
Sbjct  84   DGSGATTVTLKTAGKHYFICGVAGHCSNGMKLVVDV  119



>gb|KHG06922.1| Blue copper [Gossypium arboreum]
Length=172

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 58/95 (61%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DY+TW   +TF VGD+LVF Y   H VDEVS  DY  C  GNA+RS 
Sbjct  26   YTVGDTSGWTTGIDYSTWTQGKTFKVGDTLVFKYPTFHTVDEVSSSDYSTCTVGNAIRSD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
              G TT+ L  AG  YF+C   GHC  GMKLA+ V
Sbjct  86   NSGSTTVTLKAAGTHYFICGVVGHCGNGMKLAVKV  120



>ref|XP_007136283.1| hypothetical protein PHAVU_009G033500g [Phaseolus vulgaris]
 gb|ESW08277.1| hypothetical protein PHAVU_009G033500g [Phaseolus vulgaris]
Length=184

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VG   GW+   DY++W + +TF VGD+LVFNYG  H VDEV + DY +C AGN++ S 
Sbjct  26   HTVGDSSGWAIGADYSSWTSGKTFAVGDTLVFNYGAGHTVDEVKESDYKSCTAGNSISSD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G +TI L  AG  YF+C   GHC  GMKLA+ V+
Sbjct  86   SSGASTIALKTAGTHYFICSVPGHCSGGMKLAVTVK  121



>ref|XP_010512339.1| PREDICTED: uclacyanin-3-like [Camelina sativa]
Length=172

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG + GW+   +YTTW + +TF VGD+L F YG SH V  V K DYD C++    +SF++
Sbjct  27   VGDNAGWAAGVNYTTWVSGKTFRVGDTLEFKYGPSHSVSVVDKPDYDGCDSSRPTQSFSE  86

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
              T I L++ G ++F+CP+FGHC  GMKLA+ V
Sbjct  87   RDTKINLTRVGNIHFICPTFGHCLGGMKLAVPV  119



>ref|XP_004299681.1| PREDICTED: blue copper protein-like [Fragaria vesca subsp. vesca]
Length=190

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KD+ VG   GW+   DYTTW + +TF VGD+LVFNYG  H VDEVS  DY +C  GN++ 
Sbjct  25   KDYTVGDSSGWATGVDYTTWTSDKTFAVGDNLVFNYGSGHTVDEVSGTDYKSCTTGNSIT  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKL  407
            S + G TTI L  AG   F+C   GHC  GMKL
Sbjct  85   SDSSGATTIPLKTAGTHNFICGIVGHCGMGMKL  117



>gb|ACU19678.1| unknown [Glycine max]
Length=227

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++IVGG +GGW  + +  +WA+S+ F+VGDSLVF Y  +H V EV+K DYD+C   + ++
Sbjct  24   NYIVGGPNGGWDTNSNLQSWASSQIFSVGDSLVFQYPPNHDVVEVTKADYDSCQPTSPIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+ DG TTI L+  G  YF+C + GHC  GMK+ I+
Sbjct  84   SYNDGTTTIPLTSLGKRYFICGTIGHCSQGMKVEID  119



>ref|XP_003543376.1| PREDICTED: blue copper protein-like [Glycine max]
Length=227

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++IVGG +GGW  + +  +WA+S+ F+VGDSLVF Y  +H V EV+K DYD+C   + ++
Sbjct  24   NYIVGGPNGGWDTNSNLQSWASSQIFSVGDSLVFQYPPNHDVVEVTKADYDSCQPTSPIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+ DG TTI L+  G  YF+C + GHC  GMK+ I+
Sbjct  84   SYNDGTTTIPLTSLGKRYFICGTIGHCSQGMKVEID  119



>gb|KHN36563.1| Early nodulin-like protein 1 [Glycine soja]
Length=227

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++IVGG +GGW  + +  +WA+S+ F+VGDSLVF Y  +H V EV+K DYD+C   + ++
Sbjct  24   NYIVGGPNGGWDTNSNLQSWASSQIFSVGDSLVFQYPPNHDVVEVTKADYDSCQPTSPIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+ DG TTI L+  G  YF+C + GHC  GMK+ I+
Sbjct  84   SYNDGTTTIPLTSLGKRYFICGTIGHCSQGMKVEID  119



>ref|NP_001152236.1| blue copper protein precursor [Zea mays]
 gb|ACG46546.1| blue copper protein precursor [Zea mays]
Length=211

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNALRS  503
            + VG   GW+ +GDY TWA+ + F VGDSL F Y GG+H VDEVS  DY  C++ NAL +
Sbjct  28   YTVGDASGWTTTGDYATWASGKKFKVGDSLEFKYAGGAHTVDEVSAADYAACSSSNALST  87

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
             + G TT+ L  AG  YF+C   GHC +GMKLA++V 
Sbjct  88   DSAGATTVTLKTAGKHYFICGVAGHCSSGMKLAVDVA  124



>ref|XP_007134460.1| hypothetical protein PHAVU_010G049200g [Phaseolus vulgaris]
 gb|ESW06454.1| hypothetical protein PHAVU_010G049200g [Phaseolus vulgaris]
Length=179

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG   GWS   DY+TWA+ +TF VGD+LVFNY  SH VDE+ +  Y +C++ N +++
Sbjct  23   DYTVGDSSGWSSGVDYSTWASGKTFKVGDNLVFNYDSSHEVDEIDESGYSSCSSSNTIKN  82

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + DG + I LS  G  YF+CP  GHC  GMKL INV+
Sbjct  83   YKDGNSKIALSTTGKRYFLCPRPGHCAGGMKLQINVE  119



>ref|XP_007149946.1| hypothetical protein PHAVU_005G112600g [Phaseolus vulgaris]
 gb|ESW21940.1| hypothetical protein PHAVU_005G112600g [Phaseolus vulgaris]
Length=215

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++IVGG +GGW  + +  +WA+S+ F+VGDSLVF Y  +H V EV+K DYD+C   N ++
Sbjct  24   NYIVGGPNGGWDTNSNLQSWASSQIFSVGDSLVFQYPPNHDVVEVTKADYDSCQPTNPIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+ DG T I L+  G  YF+C + GHC  GMK+ ++
Sbjct  84   SYNDGATAIPLTSPGQRYFICGTIGHCSQGMKVEVD  119



>ref|XP_003597041.1| Blue copper protein [Medicago truncatula]
 gb|AES67292.1| plastocyanin-like domain protein [Medicago truncatula]
Length=228

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGGD-GGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            +HIVGG  GGW  + +  +W +S+ F+VGD+L+F Y  +H V EV+K DYD+C   N ++
Sbjct  24   NHIVGGPIGGWDTNSNLQSWTSSQQFSVGDNLIFQYPPNHDVVEVTKADYDSCQQTNPIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+ DG T+I L+  G  YF+C + GHC  GMK+ I+
Sbjct  84   SYNDGATSIPLTSTGKRYFICGTIGHCSQGMKVEID  119



>gb|AFK47720.1| unknown [Medicago truncatula]
Length=228

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGGD-GGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            +HIVGG  GGW  + +  +W +S+ F+VGD+L+F Y  +H V EV+K DYD+C   N ++
Sbjct  24   NHIVGGPIGGWDTNSNLQSWTSSQQFSVGDNLIFQYPPNHDVVEVTKADYDSCQQTNPIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+ DG T+I L+  G  YF+C + GHC  GMK+ I+
Sbjct  84   SYNDGATSIPLTSTGKRYFICGTIGHCSQGMKVEID  119



>ref|XP_004953310.1| PREDICTED: blue copper protein-like [Setaria italica]
Length=198

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D++VGG  GW+   DYTTWA  +TF+VGD+LVF Y   H V EVS  DY  C+A N+L+S
Sbjct  24   DYVVGGSSGWTSGVDYTTWAKGKTFSVGDNLVFQYSAMHTVAEVSSADYSACSASNSLQS  83

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMK  410
            ++D  T I L+  G  YF+C + GHC  GMK
Sbjct  84   YSDQNTKIALTAPGTRYFICGTPGHCSGGMK  114



>ref|XP_004987263.1| PREDICTED: uclacyanin-2-like [Setaria italica]
Length=205

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSG-DYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            DH VGG+G W  SG  Y  W+A++ F  GD++ F Y  SH V EV+K  YD C+  NA++
Sbjct  26   DHPVGGNGAWDASGTSYNAWSANQKFVQGDTIAFKYAASHDVTEVTKSGYDACSGANAVK  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKL  407
            S+T G TT+KL+  G  YF+C   GHC  GMK+
Sbjct  86   SYTGGATTVKLAAPGKRYFICSVPGHCAAGMKI  118



>ref|XP_006352033.1| PREDICTED: early nodulin-20-like [Solanum tuberosum]
Length=243

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGGDGG-WSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            +H VG   G W +S D TTWAASETF VGDSL+F Y  +H V EV K DYD+C   NA+ 
Sbjct  24   NHTVGAPKGRWDESTDLTTWAASETFLVGDSLIFVYSPNHDVLEVRKGDYDSCQTTNAIS  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            +   G T I LS  G  YF+C + GHC +GMKL +N
Sbjct  84   TNGGGMTIISLSSTGKRYFICGTGGHCASGMKLEVN  119



>ref|XP_006578311.1| PREDICTED: blue copper protein-like [Glycine max]
Length=223

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS--HGVDEVSKDDYDNCNAGNAL  509
            D+ VG   GW+   DY+TW   +TF +GDSLVF YGG   H VDEV + +Y +C AGN++
Sbjct  25   DYTVGDTSGWAIGADYSTWTGDKTFVIGDSLVFKYGGGGGHTVDEVKESEYKSCTAGNSI  84

Query  508  RSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
             + + G+TTI L  AG  YF+C   GHC  GMKL + V+
Sbjct  85   STDSSGETTITLKTAGTHYFICSVPGHCSGGMKLVVTVK  123



>ref|XP_002262831.1| PREDICTED: mavicyanin [Vitis vinifera]
 emb|CBI40050.3| unnamed protein product [Vitis vinifera]
Length=176

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDD-YDNCNAGNAL  509
             H+VGG  GW +S DY+ WA+ +TF VGD LVF Y  G H V E+  +  Y NC+ G+AL
Sbjct  25   QHVVGGSQGWDESSDYSKWASGQTFEVGDQLVFKYTPGLHSVVELPNESAYKNCDVGSAL  84

Query  508  RSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
             S   G   +KLSKAG  YF C + GHC  GMKL ++
Sbjct  85   NSMNSGNNVVKLSKAGTRYFACGTIGHCDQGMKLKVS  121



>ref|XP_006295902.1| hypothetical protein CARUB_v10025032mg [Capsella rubella]
 gb|EOA28800.1| hypothetical protein CARUB_v10025032mg [Capsella rubella]
Length=220

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VG   GW    DYT W   +TF VGD L F YG SH V+EV+K  YD+C  G  + + 
Sbjct  30   HTVGNANGWESGVDYTAWVTGKTFRVGDVLEFKYGPSHSVNEVNKAGYDSCG-GTPIDTH  88

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            TDG T I L   GP YF+CP+ GHC +GMKLA+ V
Sbjct  89   TDGDTKIDLETVGPKYFICPTAGHCVSGMKLAVTV  123



>gb|AFK38402.1| unknown [Medicago truncatula]
Length=228

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGGD-GGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            +HIVGG  GGW  + +  +W +S+ F+VGD+L+F Y   H V EV+K DYD+C   N ++
Sbjct  24   NHIVGGPIGGWDTNSNLQSWTSSQQFSVGDNLIFQYPPDHDVVEVTKADYDSCQQTNPIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S+ DG T+I L+  G  YF+C + GHC  GMK+ I+
Sbjct  84   SYNDGATSIPLTSTGKRYFICGTIGHCSQGMKVEID  119



>ref|XP_010469206.1| PREDICTED: uclacyanin-3-like [Camelina sativa]
Length=172

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG + GW+   +YTTW + +TF +GD+L F YG SH V  V K DYD C++    +SF++
Sbjct  27   VGDNAGWAGGVNYTTWVSGKTFRIGDTLEFKYGPSHSVSVVDKPDYDGCDSSRPTQSFSE  86

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
              T I L++ G ++F+CP+FGHC  GMKLA+ V
Sbjct  87   RDTKINLTRVGNIHFICPTFGHCLGGMKLAVPV  119



>ref|XP_004501685.1| PREDICTED: blue copper protein-like [Cicer arietinum]
Length=185

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DY++WA+ +TF VGDSLVFNYG  H VDEV + DY +C  GN++ + 
Sbjct  26   YTVGDTSGWAIGDDYSSWASDKTFAVGDSLVFNYGAGHTVDEVKESDYKSCKTGNSISTD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKL  407
            + G TTI L K+G  YF+C   GHC  GMKL
Sbjct  86   SSGATTIPLKKSGTHYFICAVPGHCIGGMKL  116



>emb|CAD41463.3| OSJNBa0079A21.7 [Oryza sativa Japonica Group]
 gb|EAZ31523.1| hypothetical protein OsJ_15663 [Oryza sativa Japonica Group]
Length=181

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNAL  509
            KD+ VG   GW+   DYT WA  +TF +GD+L+F Y    H V EVS+ D+ +C+A N L
Sbjct  24   KDYTVGDSSGWTTGVDYTAWARGKTFNIGDTLLFQYTSAGHSVVEVSEADHTSCSAANPL  83

Query  508  RSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            RS+ DG T + L+++G  YF+C S GHC  GMKL + V
Sbjct  84   RSYKDGTTIVTLTRSGTRYFICGSTGHCGAGMKLTVTV  121



>emb|CAH67255.1| OSIGBa0101C23.7 [Oryza sativa Indica Group]
Length=181

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNAL  509
            KD+ VG   GW+   DYT WA  +TF +GD+L+F Y    H V EVS+ D+ +C+A N L
Sbjct  24   KDYTVGDSSGWTTGVDYTAWARGKTFNIGDTLLFQYTSAGHSVVEVSEADHTSCSAANPL  83

Query  508  RSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            RS+ DG T + L+++G  YF+C S GHC  GMKL + V
Sbjct  84   RSYKDGTTIVTLTRSGTRYFICGSTGHCGAGMKLTVTV  121



>ref|XP_010425458.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=174

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNALR  506
             H++GG  GW QS D+ +WA+ ++F VGD LVF Y G H V E+ S+  Y +C+ G  + 
Sbjct  26   QHVIGGSQGWEQSVDFDSWASDQSFKVGDQLVFKYSGLHSVVELGSETAYKSCDVGTPVN  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S + G   +KLSK G  YF C + GHC+ GMK+ +NV
Sbjct  86   SLSSGNDVVKLSKTGTRYFACGTVGHCEQGMKIKVNV  122



>gb|EAY95049.1| hypothetical protein OsI_16864 [Oryza sativa Indica Group]
Length=181

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNAL  509
            KD+ VG   GW+   DYT WA  +TF +GD+L+F Y    H V EVS+ D+ +C+A N L
Sbjct  24   KDYTVGDSSGWTTGVDYTAWARGKTFNIGDTLLFQYTSAGHSVVEVSEADHTSCSAANPL  83

Query  508  RSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            RS+ DG T + L+++G  YF+C S GHC  GMKL + V
Sbjct  84   RSYKDGTTIVTLTRSGTRYFICGSTGHCGAGMKLTVTV  121



>ref|NP_001053468.1| Os04g0545600 [Oryza sativa Japonica Group]
 dbj|BAF15382.1| Os04g0545600 [Oryza sativa Japonica Group]
 dbj|BAG99604.1| unnamed protein product [Oryza sativa Japonica Group]
Length=191

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNAL  509
            KD+ VG   GW+   DYT WA  +TF +GD+L+F Y    H V EVS+ D+ +C+A N L
Sbjct  34   KDYTVGDSSGWTTGVDYTAWARGKTFNIGDTLLFQYTSAGHSVVEVSEADHTSCSAANPL  93

Query  508  RSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            RS+ DG T + L+++G  YF+C S GHC  GMKL + V
Sbjct  94   RSYKDGTTIVTLTRSGTRYFICGSTGHCGAGMKLTVTV  131



>tpg|DAA36598.1| TPA: hypothetical protein ZEAMMB73_027469 [Zea mays]
Length=188

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KD++VG   GW    DY  WA  + F +GD+L F Y  +H V EVS+ D+  C+A N LR
Sbjct  25   KDYMVGDSSGWKSGVDYAAWAKGKPFAIGDTLSFQYSSAHSVLEVSEADHGACSASNPLR  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S     TTI L+KAG  YF+C + GHC +GMK+AI V
Sbjct  85   SHQGQSTTIPLTKAGTRYFICGAPGHCASGMKVAITV  121



>gb|ABN13629.1| blue copper-like protein [Gossypium hirsutum]
Length=175

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+   D+++WA+ +TF VGDSLVFNY  SH V+EVS  DY  C  G A+ + + 
Sbjct  29   VGDASGWATGVDFSSWASDKTFKVGDSLVFNYPTSHTVEEVSSSDYSACTVGKAISTDST  88

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            G TTI L   G  YF+C   GHC+ GMKLA+ V+
Sbjct  89   GATTINLKTGGTHYFICGVAGHCENGMKLAVKVE  122



>ref|XP_002515714.1| Early nodulin 20 precursor, putative [Ricinus communis]
 gb|EEF46661.1| Early nodulin 20 precursor, putative [Ricinus communis]
Length=258

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = -3

Query  670  GGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDG  491
            G +GGW  S +   WAAS+ F+VGD+L+F YG +H + EVS+ DYD+C   NA++  +DG
Sbjct  29   GSNGGWDTSTNLQAWAASQLFSVGDNLIFQYGANHNLFEVSQADYDSCQTSNAIQGHSDG  88

Query  490  KTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             T I LS  G  YF+C + GHC  GMK+ I+V
Sbjct  89   STVIPLSSPGTRYFICGTPGHCTQGMKVEIDV  120



>gb|KCW83086.1| hypothetical protein EUGRSUZ_B00045 [Eucalyptus grandis]
Length=184

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 60/96 (63%), Gaps = 11/96 (11%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG  GGW    DYTTW + +TF VGDSLVFNYGG H VDEVSK DYD           
Sbjct  26   YTVGDTGGWVMGTDYTTWTSGKTFLVGDSLVFNYGGGHTVDEVSKSDYD-----------  74

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
              G TTI L  A   YF+C + GHC +GMKLA++V+
Sbjct  75   ASGATTIPLKTAATHYFICGAAGHCSSGMKLAVSVK  110



>ref|NP_001237874.1| uncharacterized protein LOC100305865 precursor [Glycine max]
 gb|ACU13756.1| unknown [Glycine max]
 gb|KHN24323.1| Blue copper protein [Glycine soja]
Length=162

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNAL  509
            + H+VGG  GW +S D+ +W + +TF VGD LVF Y   H V E+ S+ +Y NC+ GNA+
Sbjct  23   EQHVVGGSQGWDESTDFNSWVSGQTFKVGDQLVFKYSSLHSVVELGSESEYKNCDLGNAV  82

Query  508  RSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAI  401
             S + G   +KL+K G  YF C + GHC  GMK+ I
Sbjct  83   NSMSSGNDVVKLNKPGTRYFACGTMGHCDQGMKVKI  118



>ref|NP_001149787.1| blue copper protein precursor [Zea mays]
 gb|ACG36799.1| blue copper protein precursor [Zea mays]
Length=192

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KD++VG   GW    DY  WA  + F +GD+L F Y  +H V EVS+ D+  C+A N LR
Sbjct  25   KDYMVGDSSGWKSGVDYAAWAKGKPFAIGDTLSFQYSSAHSVLEVSEADHGACSASNPLR  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S     TTI L+KAG  YF+C + GHC +GMK+AI V
Sbjct  85   SHQGQSTTIPLTKAGTRYFICGAPGHCASGMKVAITV  121



>ref|XP_004251506.1| PREDICTED: uclacyanin-3-like [Solanum lycopersicum]
Length=232

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            +H VG   G W QS   TTWAASETF VGDSL+F Y  +H V EV K DYD+C   NA+ 
Sbjct  24   NHTVGAPQGRWDQSTGLTTWAASETFLVGDSLIFVYTPNHDVLEVRKSDYDSCQTTNAIS  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            +   G T I LS  G  YF+C + GHC +GMKL +N
Sbjct  84   TNGGGMTIISLSSTGKRYFICGTGGHCASGMKLEVN  119



>ref|XP_010506413.1| PREDICTED: uclacyanin-2-like [Camelina sativa]
Length=209

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG +  W+   DYT W   +TF VGD+L F YG SH VD V+K  YD+C+  +A  +F
Sbjct  29   YTVGDESQWASGVDYTAWVIGKTFRVGDTLEFKYGPSHSVDVVNKAGYDDCDGSSASENF  88

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +DG T I+L   G  YF+CP+ GHC +GMKLAI V
Sbjct  89   SDGDTKIELKTVGTKYFVCPTPGHCISGMKLAIPV  123



>ref|XP_006647616.1| PREDICTED: blue copper protein-like [Oryza brachyantha]
Length=204

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG   GW+   DY TWA  ++F+VGDSLVF Y   H V EVS  DY  C+A N+++S
Sbjct  26   DYTVGDTSGWTSGVDYGTWAKGKSFSVGDSLVFQYSMMHTVAEVSSADYSACSASNSIQS  85

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            ++D  T I L+K G  YF+C + GHC  GMKLA+ V 
Sbjct  86   YSDQNTKIALTKPGTRYFICGTSGHCSGGMKLAVTVS  122



>ref|XP_010939704.1| PREDICTED: blue copper protein-like [Elaeis guineensis]
Length=176

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYG-GSHGVDEVSKDDYDNCNAGNALRS  503
            + VG   GW+   DY+TW + +TF  GDSLVFNY  G+H V EVS  DYD+C+A NA+ S
Sbjct  26   YTVGDTSGWTSGVDYSTWTSGKTFAAGDSLVFNYASGAHTVTEVSSSDYDSCSASNAITS  85

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             ++G TTI+L   G  Y++C   GHC  GMKLA+ V
Sbjct  86   DSNGPTTIQLKTPGTHYYICAIPGHCSGGMKLAVAV  121



>gb|AAM62707.1| blue copper protein, putative [Arabidopsis thaliana]
Length=172

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNALR  506
             H++GG  GW QS D+ +W++ ++F VGD +VF Y G H V E+ S+  Y +C+ G ++ 
Sbjct  25   QHVIGGSQGWEQSVDFDSWSSDQSFKVGDQIVFKYSGLHSVVELGSETAYKSCDLGTSVN  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S + G   +KLSK G  YF+C + GHC+ GMK+ +NV
Sbjct  85   SLSSGNDVVKLSKTGTRYFVCGTVGHCEQGMKIKVNV  121



>gb|ABK26526.1| unknown [Picea sitchensis]
Length=187

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D+ VG    W+   DY TWA+ +TF VGD LVF Y   H V EVSK DYD C+  NA++S
Sbjct  30   DYTVGDTQQWNLGVDYGTWASGKTFAVGDKLVFAYSALHSVMEVSKADYDACSTSNAIKS  89

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +  G TT+ L  AG  YF+C + GHC  GMKL + V
Sbjct  90   YNGGSTTVTLDSAGAKYFVCGTAGHCSGGMKLGVTV  125



>ref|XP_010909861.1| PREDICTED: uclacyanin-2-like [Elaeis guineensis]
Length=188

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            K++ VG +G W Q+ +Y TWA+S TF  GDSL F YG +H V EV+K +YD+C+   A+ 
Sbjct  23   KNYDVGPNGQWDQTSNYATWASSITFVPGDSLTFKYGSTHDVVEVTKANYDSCSTSGAIS  82

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + T G T I L+  G  YF+C + GHC  GMK+ INV
Sbjct  83   THTGGNTVISLNSTGKRYFICGTPGHCAAGMKVEINV  119



>gb|KFK37280.1| hypothetical protein AALP_AA4G236600 [Arabis alpina]
Length=197

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VG   GW+ + DYT W   +TF VGD L F YG SH V+EV+K  YD+C  G  + + 
Sbjct  25   HTVGDAQGWASTVDYTVWLTGKTFRVGDKLQFTYGPSHSVNEVNKAGYDSCG-GTPISTD  83

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             DG T I L   G  YF+CP+ GHCQ+GMKLA+ V
Sbjct  84   NDGDTDIDLETVGTRYFICPTPGHCQSGMKLAVTV  118



>ref|XP_006292167.1| hypothetical protein CARUB_v10018373mg [Capsella rubella]
 gb|EOA25065.1| hypothetical protein CARUB_v10018373mg [Capsella rubella]
Length=207

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+   DYTTW   +TF VGD+L F YG SH V  V K  YD C++  A +SF D
Sbjct  27   VGDTSGWTSGIDYTTWVTGKTFRVGDTLEFIYGPSHSVSVVDKAGYDGCDSSGATQSFAD  86

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G T I L   G M+F+CPS GHC  GMKLA+ V
Sbjct  87   GNTKINLKTVGTMHFLCPSSGHCLGGMKLAVPV  119



>ref|XP_002452820.1| hypothetical protein SORBIDRAFT_04g033180 [Sorghum bicolor]
 gb|EES05796.1| hypothetical protein SORBIDRAFT_04g033180 [Sorghum bicolor]
Length=200

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KD+ VG   GW+   DYTTWA+ +TF VGD+LVF Y   H V EVS  D++ C+A NA++
Sbjct  23   KDYTVGDSSGWTSGVDYTTWASGKTFAVGDNLVFQYSMMHTVAEVSSADFNACSASNAIQ  82

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKL  407
            S++D  T I L+  G  YF+C + GHC  GMKL
Sbjct  83   SYSDQNTKIALTAPGTRYFICGTAGHCGNGMKL  115



>ref|XP_006397659.1| hypothetical protein EUTSA_v10001642mg [Eutrema salsugineum]
 gb|ESQ39112.1| hypothetical protein EUTSA_v10001642mg [Eutrema salsugineum]
Length=197

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 56/95 (59%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VG    W+   DY  W   +TF VGD+L F YG SH VD V K  YD C+  +A    
Sbjct  29   HTVGDASQWASGVDYADWVKGKTFRVGDTLEFKYGASHSVDVVDKAGYDGCDGSSASEKH  88

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +DG T I+L   GP YF+CP+ GHCQ GMKL + V
Sbjct  89   SDGDTDIELKTVGPKYFICPTPGHCQAGMKLEVTV  123



>ref|XP_008379599.1| PREDICTED: blue copper protein-like [Malus domestica]
Length=240

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = -3

Query  670  GGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDG  491
            G +G W  + D  TWA+S++F VGD+L F Y   H V EV K DYD+C A N+++S++ G
Sbjct  30   GPNGRWDSTTDLKTWASSQSFLVGDNLNFQYSTKHDVIEVPKADYDSCQARNSIQSYSGG  89

Query  490  KTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
             TTI LS  G  YF+C + GHC  GMKL +N
Sbjct  90   STTITLSSPGKRYFICGTTGHCSQGMKLEVN  120



>ref|XP_006291939.1| hypothetical protein CARUB_v10018126mg [Capsella rubella]
 gb|EOA24837.1| hypothetical protein CARUB_v10018126mg [Capsella rubella]
Length=171

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNALR  506
             H++GG  GW QS D+ +W++ ++F VGD LVF Y G H V E+ S+  Y +C+ G  + 
Sbjct  25   QHVIGGSQGWEQSVDFDSWSSDQSFKVGDQLVFKYSGLHSVVELGSETAYKSCDLGTPVN  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S + G   +KLSK G  YF C + GHC+ GMK+ +NV
Sbjct  85   SLSSGNDVVKLSKTGTRYFACGTVGHCEQGMKIKVNV  121



>ref|XP_010514410.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=173

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNALR  506
             H++GG  GW QS D+ +W++ ++F VGD LVF Y G H V E+ S+  Y +C+ G  + 
Sbjct  25   QHVIGGSQGWEQSVDFDSWSSDQSFKVGDQLVFKYSGLHSVVELGSETAYKSCDLGTPVN  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S + G   +KLSK G  YF C + GHC+ GMK+ +NV
Sbjct  85   SLSSGNDVVKLSKTGTRYFACGTVGHCEQGMKIKVNV  121



>dbj|BAJ97976.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96245.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=199

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNALRS  503
            + VG   GW+   DYTTWA+ +   VGDSLVFNY GG+H V EVS  DY +C+A NAL S
Sbjct  27   YTVGDSSGWTTGADYTTWASDKKIKVGDSLVFNYAGGAHNVAEVSAADYASCSAANALSS  86

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKL  407
               G TT+ L  AG  YF+C   GHC +GMKL
Sbjct  87   DGSGTTTVALKTAGKHYFICGVTGHCSSGMKL  118



>ref|XP_003602882.1| Blue copper protein [Medicago truncatula]
 gb|AES73133.1| plastocyanin-like domain protein [Medicago truncatula]
Length=218

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNALR  506
            +HIVG   GW+   DYTTWA+ +TF VGDSLVFNY  G H VDEV++ DY++C   N++ 
Sbjct  25   NHIVGDGLGWTVDSDYTTWASDKTFVVGDSLVFNYEAGWHTVDEVNESDYNSCTTRNSIS  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQT-GMKLAINVQ  392
            +   G TTI L KAG  YF+C    HC + GMKL++ VQ
Sbjct  85   TDGSGATTIPLKKAGTHYFICAVPVHCISGGMKLSVKVQ  123



>emb|CDX83667.1| BnaC07g24070D [Brassica napus]
Length=173

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNALR  506
             H++GG  GW QS D+ +W++ ++F VGD LVF Y G H V E+ S+  Y +C+ G  + 
Sbjct  25   QHVIGGSQGWEQSVDFDSWSSDKSFKVGDQLVFKYSGLHSVVELGSEAAYKSCDLGTPVN  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S + G   +KLSK G  YF C + GHCQ+GMK+ +NV
Sbjct  85   SLSSGNDVVKLSKTGTRYFACGTPGHCQSGMKVKVNV  121



>ref|XP_002877026.1| hypothetical protein ARALYDRAFT_484503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53285.1| hypothetical protein ARALYDRAFT_484503 [Arabidopsis lyrata subsp. 
lyrata]
Length=171

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNALR  506
             H++GG  GW QS D+ +W++ ++F VGD +VF Y G H V E+ S+  Y +C+ G ++ 
Sbjct  25   QHVIGGSQGWEQSVDFDSWSSDQSFKVGDQIVFKYSGLHSVVELGSETAYKSCDLGTSVN  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S + G   +KLSK G  YF C + GHC+ GMK+ +NV
Sbjct  85   SLSSGNDVVKLSKTGTRYFACGTVGHCEQGMKIKVNV  121



>ref|XP_006387434.1| hypothetical protein POPTR_1040s00200g [Populus trichocarpa]
 gb|ERP46348.1| hypothetical protein POPTR_1040s00200g [Populus trichocarpa]
Length=188

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 60/98 (61%), Gaps = 0/98 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            KDH VG   GW+   DY+TW + + F+VGDSLVFNYGG H VDEV   DY  C  GNA+ 
Sbjct  26   KDHTVGDSSGWAIGMDYSTWTSGKAFSVGDSLVFNYGGGHTVDEVRASDYSTCTTGNAIT  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            S + G   I L  AG  Y++C   G   +GMK+A+ V 
Sbjct  86   SDSSGVPPIALKTAGTHYYICGVPGTVGSGMKVAVTVA  123



>ref|XP_010502682.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=175

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNALR  506
             H++GG  GW QS D+ +W++ ++F VGD LVF Y G H V E+ S+  Y +C+ G  + 
Sbjct  25   QHVIGGSQGWEQSVDFDSWSSDQSFKVGDQLVFKYSGLHSVVELGSETAYKSCDLGTPVN  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S + G   +KLSK G  YF C + GHC+ GMK+ +NV
Sbjct  85   SLSSGNDVLKLSKTGTRYFACGTVGHCEQGMKIKVNV  121



>ref|NP_191586.1| cupredoxin superfamily protein [Arabidopsis thaliana]
 emb|CAB87864.1| stellacyanin (uclacyanin 3)-like protein [Arabidopsis thaliana]
 gb|AEE80036.1| cupredoxin superfamily protein [Arabidopsis thaliana]
Length=187

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG + GW+   +YT+W + +TF VGD+L F YG SH V  V+K DYD C      +SF+D
Sbjct  28   VGDNDGWTIGVEYTSWVSEKTFRVGDTLEFKYGPSHSVAVVNKADYDGCETSRPTQSFSD  87

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G T I L+K G ++F+C + GHC  GMKLA+ V
Sbjct  88   GDTKIDLTKVGAIHFLCLTPGHCSLGMKLAVQV  120



>ref|XP_003602855.1| Blue copper protein [Medicago truncatula]
 gb|AES73106.1| plastocyanin-like domain protein [Medicago truncatula]
Length=220

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNALR  506
            +HIVG   GW+   DYTTWA+ +TF VGDSLVFNY  G H VDEV + DY +C   N++ 
Sbjct  25   NHIVGDGLGWTVDSDYTTWASDKTFVVGDSLVFNYEAGWHTVDEVRESDYQSCTTRNSIS  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQT-GMKLAINVQ  392
            +   G TTI L KAG  YF+C    HC + GMKL++ VQ
Sbjct  85   TDGSGATTIPLKKAGTHYFICAVPVHCISGGMKLSVKVQ  123



>ref|NP_001238369.1| uncharacterized protein LOC100306407 precursor [Glycine max]
 gb|ACU14564.1| unknown [Glycine max]
Length=205

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VG   GW+   DY+TWA+     VGDSLVFNYG  H VDEV + DY +C  GN+L + 
Sbjct  26   HTVGDTSGWALGADYSTWASGLKLKVGDSLVFNYGAGHTVDEVKESDYKSCTTGNSLSTD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGM  413
            + G TTI L  AG  YF+C S GHC  GM
Sbjct  86   SSGTTTITLKTAGTHYFICASPGHCDGGM  114



>ref|XP_006848436.1| hypothetical protein AMTR_s00013p00238100 [Amborella trichopoda]
 gb|ERN10017.1| hypothetical protein AMTR_s00013p00238100 [Amborella trichopoda]
Length=173

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVS-KDDYDNCNAGNALR  506
            H VGG  GW  S D  +WA+++TF VGD LVF Y  G H V E++ K +YD C+  NAL 
Sbjct  28   HEVGGSQGWELSTDLDSWASAQTFRVGDQLVFKYTKGLHSVVELANKKEYDACDLSNALS  87

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S +DG   +KL K G  YF C + GHCQ GMKL + V
Sbjct  88   SLSDGSDVVKLDKPGHKYFTCGTMGHCQGGMKLKVKV  124



>ref|XP_009151984.1| PREDICTED: mavicyanin [Brassica rapa]
Length=187

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNALR  506
             H++GG  GW QS D+ +W++ ++F VGD LVF Y G H V E+ S+  Y +C+ G  + 
Sbjct  25   QHVIGGSQGWEQSVDFDSWSSDKSFKVGDQLVFKYSGLHSVVELGSEAAYKSCDLGTPVN  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S + G   +KLSK G  YF C + GHCQ+GMK+ +NV
Sbjct  85   SLSSGNDVVKLSKTGTRYFACGTPGHCQSGMKVKVNV  121



>ref|XP_010512340.1| PREDICTED: uclacyanin-3-like [Camelina sativa]
Length=222

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+   DYTTW   +TF VGD+L F YG SH V  V K  YD C++  + +SF D
Sbjct  26   VGDTSGWTSGIDYTTWVTGKTFRVGDTLEFIYGPSHSVSVVDKAGYDGCDSSGSTQSFAD  85

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G T I L   G  YF+CP+FGHC  GMKLA+ V
Sbjct  86   GDTKIDLKTVGTKYFLCPTFGHCLGGMKLAVLV  118



>ref|XP_002459207.1| hypothetical protein SORBIDRAFT_02g000530 [Sorghum bicolor]
 gb|EER95728.1| hypothetical protein SORBIDRAFT_02g000530 [Sorghum bicolor]
Length=194

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGD-YTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAG-NAL  509
            DH VGGDG W  SG+ Y  W+A +TF  GD+L F +  SH V EV+K  YD C+ G NA+
Sbjct  25   DHPVGGDGSWDASGNGYDAWSAKQTFKQGDTLSFKFASSHDVTEVTKAGYDACSGGSNAV  84

Query  508  RSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +S+T    T+KLS  G  YF+C   GHC  GMKL + V
Sbjct  85   KSYTGTSATVKLSAPGKRYFICSVPGHCAAGMKLEVTV  122



>gb|KHN35486.1| Blue copper protein [Glycine soja]
Length=205

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VG   GW+   DY+TWA+     VGDSLVFNYG  H VDEV + DY +C  GN+L + 
Sbjct  26   HTVGDTSGWALGADYSTWASGLKLKVGDSLVFNYGAGHTVDEVKESDYKSCTTGNSLSTD  85

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGM  413
            + G TTI L  AG  YF+C S GHC  GM
Sbjct  86   SSGTTTITLKTAGTHYFICASPGHCDGGM  114



>emb|CDY13690.1| BnaA06g32330D [Brassica napus]
Length=187

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNALR  506
             H++GG  GW QS D+ +W++ ++F VGD LVF Y G H V E+ S+  Y +C+ G  + 
Sbjct  25   QHVIGGSQGWEQSVDFDSWSSDKSFKVGDQLVFKYSGLHSVVELGSEAAYKSCDLGTPVN  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S + G   +KLSK G  YF C + GHCQ+GMK+ +NV
Sbjct  85   SLSSGNDVVKLSKTGTRYFACGTPGHCQSGMKVKVNV  121



>ref|XP_004168663.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 gb|KGN63174.1| Blue copper protein [Cucumis sativus]
Length=174

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDD-YDNCNAGNA  512
            + H+VGG  GW +S D+ +WA+S+TF VGD +VF Y  S H V E+S +  Y NC+ GN+
Sbjct  34   QRHMVGGSQGWQESVDFDSWASSQTFKVGDQIVFKYDSSLHSVVELSDESSYKNCDIGNS  93

Query  511  LRSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + S + G   IKL+K+G  YF C + GHC  GMK+ I +
Sbjct  94   IESKSSGNDAIKLTKSGTRYFACGTIGHCSQGMKVKIKI  132



>ref|XP_004138792.1| PREDICTED: blue copper protein-like [Cucumis sativus]
Length=170

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDD-YDNCNAGNA  512
            + H+VGG  GW +S D+ +WA+S+TF VGD +VF Y  S H V E+S +  Y NC+ GN+
Sbjct  34   QRHMVGGSQGWQESVDFDSWASSQTFKVGDQIVFKYDSSLHSVVELSDESSYKNCDIGNS  93

Query  511  LRSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + S + G   IKL+K+G  YF C + GHC  GMK+ I +
Sbjct  94   IESKSSGNDAIKLTKSGTRYFACGTIGHCSQGMKVKIKI  132



>gb|KHN24517.1| Blue copper protein [Glycine soja]
Length=171

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++H VGG  GW    +   W+++ TF VGD LVF+Y  +H V EV++ DYD C   NAL 
Sbjct  29   ENHTVGGASGWDLGSNIQAWSSTTTFNVGDDLVFSYTAAHDVMEVNQLDYDTCKIANALA  88

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            ++ +G+T I LS A   YF+C   GHCQ G+KL + +
Sbjct  89   TYDNGETVIHLSDAKTRYFVCGRMGHCQQGLKLQVQI  125



>ref|XP_010469205.1| PREDICTED: uclacyanin-3-like [Camelina sativa]
Length=208

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+   DYTTW   +TF VGD+L F YG SH V  V K  YD C +  A ++F D
Sbjct  26   VGDTSGWTSGIDYTTWVTGKTFRVGDTLEFIYGLSHSVSVVDKAGYDGCISSGATQNFAD  85

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G T I L   G M+F+CP+FGHC  GMKLA+ V
Sbjct  86   GDTKIDLKTVGTMHFLCPTFGHCLGGMKLAVPV  118



>ref|NP_001149576.1| blue copper protein precursor [Zea mays]
 gb|ACG35916.1| blue copper protein precursor [Zea mays]
Length=213

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNALRS  503
            + VG   GW+ +GDY TWA+ + F VGDSL F Y GG+H VDEVS  DY  C++ NAL +
Sbjct  30   YTVGDASGWTTTGDYATWASGKKFKVGDSLEFKYAGGAHTVDEVSAADYAACSSSNALST  89

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
             + G TT  L  AG  YF+C   GHC +GMKL ++V 
Sbjct  90   DSAGATTXTLKTAGKHYFICGVAGHCSSGMKLVVDVA  126



>ref|NP_001147368.1| uclacyanin-2 precursor [Zea mays]
 gb|ACG27122.1| uclacyanin-2 precursor [Zea mays]
Length=204

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGD--YTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNAL  509
            DH VGGDG W  SG   Y  W+A +TF  GD+L F +  SH V EVSK  YD C+  N +
Sbjct  30   DHPVGGDGSWDASGTTGYDAWSAKQTFKQGDTLSFKFAPSHDVTEVSKAGYDACSGSNPV  89

Query  508  RSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKL  407
            +S+T G  ++KLS  G  YF+C   GHC  GMKL
Sbjct  90   KSYTGGSASVKLSAPGKRYFICSVPGHCAAGMKL  123



>ref|XP_010413578.1| PREDICTED: uclacyanin-3-like [Camelina sativa]
Length=228

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+   DYTTW   +TF VGD+L F YG SH V  V K  YD C +  A ++F D
Sbjct  26   VGDTSGWTSGIDYTTWVTGKTFRVGDTLEFIYGLSHSVSVVDKAGYDGCVSSGATQNFAD  85

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G T I L   G M+F+CP+FGHC  GMKLA+ V
Sbjct  86   GDTKIDLKTVGTMHFLCPTFGHCLGGMKLAVPV  118



>ref|XP_006402599.1| hypothetical protein EUTSA_v10006223mg [Eutrema salsugineum]
 gb|ESQ44052.1| hypothetical protein EUTSA_v10006223mg [Eutrema salsugineum]
Length=226

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW    DYTTW + +TF VGD+L F YG +H V  V K D+D C++  A   F+D
Sbjct  25   VGDTSGWESGVDYTTWVSGKTFRVGDTLEFKYGPTHSVSVVDKADFDACDSSAATEVFSD  84

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G T+I L+  G ++F+CP+ GHC  GMKLAI V
Sbjct  85   GDTSIDLTGVGTIHFICPTPGHCLGGMKLAIPV  117



>tpg|DAA59341.1| TPA: uclacyanin-2 [Zea mays]
Length=205

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGD--YTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNAL  509
            DH VGGDG W  SG   Y  W+A +TF  GD+L F +  SH V EVSK  YD C+  N +
Sbjct  28   DHPVGGDGSWDASGTTGYDAWSAKQTFKQGDTLSFKFAPSHDVTEVSKAGYDACSGSNPV  87

Query  508  RSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKL  407
            +S+T G  ++KLS  G  YF+C   GHC  GMKL
Sbjct  88   KSYTGGSASVKLSAPGKRYFICSVPGHCAAGMKL  121



>ref|XP_009132835.1| PREDICTED: blue copper protein-like [Brassica rapa]
 emb|CDX84741.1| BnaA03g14890D [Brassica napus]
Length=257

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDDYDNCNAGNALR  506
            DH +GG  GW+   +  TWAA +TF VGD+LVF Y  + H V EV+K +YD+C A   L 
Sbjct  26   DHTIGGPSGWTVGANLKTWAAGQTFVVGDNLVFAYPSAFHDVVEVTKPEYDSCQAVKPLI  85

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +F +G + + L+  G  YF+C   GHC  GMKL +NV
Sbjct  86   TFANGNSIVPLTTPGKRYFICGMPGHCTQGMKLEVNV  122



>ref|XP_009353238.1| PREDICTED: blue copper protein-like [Pyrus x bretschneideri]
Length=240

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = -3

Query  670  GGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDG  491
            G +G W  + D  TWA+S +F VGD+L F Y  +H V EV K DYD+C A N+++S++ G
Sbjct  30   GPNGRWDSTTDLKTWASSHSFLVGDNLNFQYSPNHEVIEVPKADYDSCQARNSIQSYSGG  89

Query  490  KTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
             TTI LS  G  YF+C + GHC  GMKL ++
Sbjct  90   STTIPLSSPGKRYFICGTAGHCSQGMKLEVH  120



>ref|XP_006395473.1| hypothetical protein EUTSA_v10005008mg [Eutrema salsugineum]
 gb|ESQ32759.1| hypothetical protein EUTSA_v10005008mg [Eutrema salsugineum]
Length=175

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNALR  506
             H++GG  GW QS D+ +W++ ++F VGD LVF Y G H V E+ S+  Y +C+ G  + 
Sbjct  25   QHVIGGSQGWEQSVDFDSWSSDQSFKVGDQLVFKYSGLHSVVELGSETAYKSCDLGTPVN  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S + G   +KLSK G  YF C + GHC+ GMK+ +NV
Sbjct  85   SLSSGNDVVKLSKTGTRYFACGTPGHCEQGMKVKVNV  121



>gb|AAR15487.1| Cu2+ plastocyanin-like [Arabidopsis arenosa]
Length=192

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW  S D  TW + + F+ GD L+F Y  +H V EV+KD+Y NCN  +A+R+F
Sbjct  30   YFVGDSSGWDISSDLDTWTSGKRFSPGDVLMFQYSSTHSVYEVAKDNYQNCNTTDAIRTF  89

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            T+G TT+ LSK G  +F+C S  HC  GM+L ++V+
Sbjct  90   TNGNTTVALSKPGDRFFVCGSRLHCFAGMRLLVHVE  125



>ref|NP_680152.1| cupredoxin superfamily protein [Arabidopsis thaliana]
 gb|AAQ22659.1| At5g07475 [Arabidopsis thaliana]
 dbj|BAF00061.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91163.1| cupredoxin superfamily protein [Arabidopsis thaliana]
Length=192

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW  S D  +W + + F+ GD L+F Y  +H V EV+KD+Y NCN  +A+R+F
Sbjct  30   YFVGDSSGWDISSDLESWTSGKRFSPGDVLMFQYSSTHSVYEVAKDNYQNCNTTDAIRTF  89

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            T+G TT+ LSK G  +F+C +  HC  GM+L +NV+
Sbjct  90   TNGNTTVALSKPGNRFFVCGNRLHCFAGMRLLVNVE  125



>ref|NP_180789.1| uclacyanin 1 [Arabidopsis thaliana]
 gb|AAC32038.1| uclacyanin I [Arabidopsis thaliana]
 gb|AAC69948.1| putative uclacyanin I [Arabidopsis thaliana]
 gb|AEC08665.1| uclacyanin 1 [Arabidopsis thaliana]
Length=261

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDDYDNCNAGNALR  506
            DH +GG  GW+      TWAA +TF VGD+LVF+Y  + H V EV+K ++D+C A   L 
Sbjct  25   DHTIGGPSGWTVGASLRTWAAGQTFAVGDNLVFSYPAAFHDVVEVTKPEFDSCQAVKPLI  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +F +G + + L+  G  YF+C   GHC  GMKL +NV
Sbjct  85   TFANGNSLVPLTTPGKRYFICGMPGHCSQGMKLEVNV  121



>ref|XP_003557700.1| PREDICTED: blue copper protein-like [Brachypodium distachyon]
Length=205

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = -3

Query  679  HIVGGDG-GWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            H VGG G  W  SGDY TW+A + FT GDSLVF Y  SH V + +K  YD C+A +  +S
Sbjct  28   HPVGGAGKNWDTSGDYDTWSAQQKFTQGDSLVFTYPSSHDVVQTTKAGYDACSAASTDKS  87

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGM  413
            FT GKTTIKLS AG  YF+C   GHC  GM
Sbjct  88   FTGGKTTIKLSTAGKQYFICGVPGHCAAGM  117



>ref|XP_010675754.1| PREDICTED: blue copper protein-like [Beta vulgaris subsp. vulgaris]
Length=188

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW+   DY TW AS+ F VGDSLVFNYG  H VDEV + DY  C  GN++ + 
Sbjct  25   YTVGDTSGWAIGVDYGTWTASKKFVVGDSLVFNYGSGHTVDEVKQSDYTTCTIGNSITTD  84

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
              G T+I L   G  YF+C   GHC +GMK++++V
Sbjct  85   NKGTTSILLQTPGTHYFICGVIGHCGSGMKVSVDV  119



>dbj|BAF01024.1| uclacyanin I - like predicted GPI-anchored protein [Arabidopsis 
thaliana]
Length=261

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDDYDNCNAGNALR  506
            DH +GG  GW+      TWAA +TF VGD+LVF+Y  + H V EV+K ++D+C A   L 
Sbjct  25   DHTIGGPSGWTVGASLRTWAAGQTFAVGDNLVFSYPAAFHDVVEVTKPEFDSCQAVKPLI  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +F +G + + L+  G  YF+C   GHC  GMKL +NV
Sbjct  85   TFANGNSLVPLTTPGKRYFICGMPGHCSQGMKLEVNV  121



>ref|XP_006599708.1| PREDICTED: blue copper protein-like [Glycine max]
Length=214

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++H VGG  GW    +   W+++ TF VGD LVF+Y  +H V EV++ DYD C   NAL 
Sbjct  29   ENHTVGGASGWDLGSNIQAWSSTTTFNVGDDLVFSYTAAHDVMEVNQLDYDTCKIANALA  88

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            ++ +G+T I LS A   YF+C   GHCQ G+KL + +
Sbjct  89   TYDNGETVIHLSDAKTRYFVCGRMGHCQQGLKLQVQI  125



>ref|XP_009341435.1| PREDICTED: blue copper protein-like [Pyrus x bretschneideri]
Length=240

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = -3

Query  670  GGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDG  491
            G +G W  + D  TWA+S +F VGD+L F Y  +H V EV K DYD+C A N+++S++ G
Sbjct  30   GPNGRWDSTTDLKTWASSHSFLVGDNLNFQYSPNHEVIEVPKADYDSCQARNSIQSYSGG  89

Query  490  KTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
             TTI LS  G  YF+C + GHC  GMKL ++
Sbjct  90   STTIPLSSPGKRYFICGTAGHCSQGMKLEVH  120



>gb|AAR15424.1| Cu2+ plastocyanin-like [Sisymbrium irio]
Length=195

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW  S D  +W + + F VGD L+F Y  +H V EV+KD + NCN  + +R+F
Sbjct  30   YFVGDTSGWDISSDLESWTSGKRFAVGDVLMFQYSSTHSVYEVAKDKFQNCNTTDPIRTF  89

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            T+G TT+ LSK G  +F+C +  HC +GMKL +NV+
Sbjct  90   TNGNTTVALSKPGDRFFVCRNRLHCFSGMKLQVNVE  125



>ref|XP_003602842.1| Blue copper protein [Medicago truncatula]
 gb|AES73093.1| blue copper-like protein [Medicago truncatula]
Length=132

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW    +Y+ W + +TF VGDSLVF YG  H VDEV+  DY +C  GN + S 
Sbjct  27   YTVGDSLGWQIGVEYSKWTSEKTFVVGDSLVFLYGAIHTVDEVAASDYISCTTGNPISSD  86

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
              G+TTI L  AG  YF+  +FG C +GM+LA+ V+
Sbjct  87   NSGETTIALKTAGTHYFISATFGDCSSGMRLAVKVE  122



>ref|XP_002309845.1| UCLACYANIN 1 family protein [Populus trichocarpa]
 gb|EEE90295.1| UCLACYANIN 1 family protein [Populus trichocarpa]
Length=247

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = -3

Query  682  DHIVGG-DGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            ++ VGG +GGW  + +   WAAS  F VGD+L+F YG  H V+EVSK DYD+C   + L+
Sbjct  22   NYTVGGPNGGWDATTNLQAWAASNQFLVGDNLIFQYGLVHDVNEVSKADYDSCQITSPLK  81

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
            S++ G T I LS  G  YF C + GHC  GMKL I+
Sbjct  82   SYSGGTTVIPLSSPGKRYFTCATPGHCAGGMKLEID  117



>ref|XP_006291852.1| hypothetical protein CARUB_v10018027mg [Capsella rubella]
 gb|EOA24750.1| hypothetical protein CARUB_v10018027mg [Capsella rubella]
Length=208

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+   DYTTWA+ +TF VGD+L F Y  SH V  V K  +D C++    +SF+ 
Sbjct  27   VGDTAGWNSVVDYTTWASGKTFRVGDTLEFQYDPSHSVSVVDKAGFDGCDSTGETQSFSG  86

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G T I L+  G MYF+CPS GHC  GMKLA++V
Sbjct  87   GDTKINLTTVGTMYFLCPSPGHCLGGMKLAVSV  119



>ref|XP_010670421.1| PREDICTED: basic blue protein-like [Beta vulgaris subsp. vulgaris]
Length=177

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEV-SKDDYDNCNAGNAL  509
             H+VGG  GW +S DY +WA  +TF VGD+LVF Y  G H V E+ S+ +Y +C+  NA 
Sbjct  25   QHVVGGSDGWDESTDYNSWAKGQTFKVGDTLVFKYTPGLHNVAELGSESEYKSCDTSNAA  84

Query  508  RSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             S + G   +KL KAG  YF C + GHC  GMKL ++V
Sbjct  85   NSMSTGNDVVKLDKAGSRYFACGTAGHCSAGMKLKVDV  122



>ref|XP_002887423.1| hypothetical protein ARALYDRAFT_476354 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63682.1| hypothetical protein ARALYDRAFT_476354 [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = -3

Query  655  WSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDGKTTIK  476
            WS   DY++ A  ++F VGD++VFNYG  H VDEVS+ DY +C  GNA+ S + G T+I 
Sbjct  31   WSLGKDYSSLATGKSFAVGDTIVFNYGAGHTVDEVSESDYKSCTLGNAISSDSSGTTSIA  90

Query  475  LSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            L  +GP YF+C   GHC  GMKL++ V 
Sbjct  91   LKTSGPHYFICGIPGHCTGGMKLSVTVP  118



>ref|XP_006390684.1| hypothetical protein EUTSA_v10019200mg [Eutrema salsugineum]
 gb|ESQ27970.1| hypothetical protein EUTSA_v10019200mg [Eutrema salsugineum]
Length=182

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  655  WSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDGKTTIK  476
            WS   DY++ A  + F VGD++VFNYG  H VDEVS+ DY  C  GNA+ S + G TTI 
Sbjct  31   WSLGKDYSSLATGKPFAVGDTIVFNYGAGHTVDEVSESDYKGCKLGNAISSDSSGTTTIA  90

Query  475  LSKAGPMYFMCPSFGHCQTGMKLAINV  395
            L  +GP YF+C   GHC  GMKL++ V
Sbjct  91   LKTSGPHYFICGIPGHCTGGMKLSVTV  117



>ref|XP_006653638.1| PREDICTED: blue copper protein-like [Oryza brachyantha]
Length=195

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGG-SHGVDEVSKDDYDNCNAGNAL  509
            KD+ VG   GW    DYT WA  + F++GD+L+F Y G +H V EVS  D   C+A N L
Sbjct  25   KDYTVGDSSGWVPGVDYTAWAKGKKFSIGDTLLFQYNGRAHSVVEVSAADLSLCSASNPL  84

Query  508  RSFT--DGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            RS+   DG TTI L+K G  YF+C + GHC +GMKL + V+
Sbjct  85   RSYKSDDGITTITLTKPGARYFICGATGHCASGMKLTVTVE  125



>ref|XP_010491367.1| PREDICTED: stellacyanin-like [Camelina sativa]
Length=194

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW  S D  +W + + F+ GD L+F Y  +H V EV K++Y NCN+ +A+R+F
Sbjct  30   YFVGDSSGWDISSDLESWTSGKRFSSGDVLMFQYSSTHSVYEVDKNNYQNCNSTDAIRTF  89

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            T+G TT+ LSK G  +F+C +  HC +GM+L +NV+
Sbjct  90   TNGNTTVSLSKPGDRFFVCGNRLHCFSGMRLRVNVE  125



>ref|XP_006363305.1| PREDICTED: blue copper protein-like [Solanum tuberosum]
Length=182

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALR  506
            K + VG   GW    DYTTWA+  T  VGDSL FNY   H VDEVS  DY +C  GN++ 
Sbjct  21   KVYTVGDSSGWGLGVDYTTWASGTTLNVGDSLAFNYPSGHTVDEVSSSDYASCTTGNSIT  80

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKL  407
            S + G TTI L  AG  YF+C   GHC  GMKL
Sbjct  81   SDSSGATTIPLKTAGTHYFICGVMGHCGGGMKL  113



>ref|XP_010510046.1| PREDICTED: blue copper protein-like [Camelina sativa]
Length=262

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDDYDNCNAGNALR  506
            DH +GG  GW+      TWAA++TF VGD+LVF+Y  + H V EV+K ++D+C +   L 
Sbjct  25   DHTIGGPSGWTVGASLRTWAAAQTFAVGDNLVFSYPAAFHDVVEVTKPEFDSCQSVKPLI  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +F +G + + L+  G  YF+C   GHC  GMKL +NV
Sbjct  85   TFANGNSIVPLTTPGKRYFICGMPGHCSQGMKLEVNV  121



>gb|KFK34219.1| hypothetical protein AALP_AA5G116200 [Arabis alpina]
Length=229

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG   GW+   DYTTW   +TF VGD+L F YG SH V  V K  +D C+   A +SF+D
Sbjct  27   VGDTSGWTSGIDYTTWLTGKTFRVGDTLEFQYGLSHSVSVVGKAGFDGCDGSGATQSFSD  86

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G T I L+  G ++F+CP+ GHC +GMKLA+ V
Sbjct  87   GDTKISLTTVGTIHFLCPTPGHCLSGMKLAVPV  119



>ref|XP_010106325.1| Early nodulin-like protein 1 [Morus notabilis]
 gb|EXC10039.1| Early nodulin-like protein 1 [Morus notabilis]
Length=207

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            +H VGG  GW  + +   WA+  TF VGD LVF+Y   H V EV ++DY +C+  + +R+
Sbjct  31   NHTVGGVSGWDLTSNIQAWASQTTFHVGDYLVFSYTPVHDVLEVEEEDYKSCDISDPIRT  90

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + DG+T I L++ GP YF+C   GHC  G+KL  +V
Sbjct  91   YNDGETVIPLTQEGPRYFICGRQGHCSMGLKLEAHV  126



>gb|KFK33640.1| hypothetical protein AALP_AA5G039900 [Arabis alpina]
Length=181

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNALR  506
             H++GG  GW Q+ D+ +W++ ++F VGD LVF Y G H V E+ S+  Y +C+ G  + 
Sbjct  25   QHVIGGSQGWEQTIDFNSWSSDQSFKVGDQLVFKYSGLHSVVELGSETAYKSCDLGTPVN  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S + G   +KLSK G  YF C + GHC+ GMK+ +NV
Sbjct  85   SLSSGNDVVKLSKTGTRYFACGTPGHCEQGMKITVNV  121



>ref|XP_008441346.1| PREDICTED: mavicyanin-like [Cucumis melo]
Length=172

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDD-YDNCNAGNA  512
            + H+VGG  GW +S D+ +WA+S+TF VGD +VF Y  S H V E+ ++  Y NC+ GN+
Sbjct  32   QRHMVGGSQGWQESVDFDSWASSQTFKVGDQIVFKYDSSLHSVVELPEESSYKNCDIGNS  91

Query  511  LRSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + S + G   IKL+K+G  YF C + GHC  GMK+ I +
Sbjct  92   IESKSSGNDVIKLTKSGTRYFACGTIGHCSQGMKVKIKI  130



>ref|XP_009130995.1| PREDICTED: mavicyanin-like [Brassica rapa]
 emb|CDX78296.1| BnaA03g02080D [Brassica napus]
Length=194

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW  S D  +W   + F+VGD L+F Y  SH V EV+KD++ +CN  + +R+F
Sbjct  30   YFVGDTSGWDISSDLESWPLGKRFSVGDVLMFQYSSSHSVYEVAKDNFQSCNTTDPIRTF  89

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            T+G TT+ LSK G  +F+C +  HC  GM+L +NVQ
Sbjct  90   TNGNTTVALSKPGDRFFVCGNRLHCFAGMRLQVNVQ  125



>gb|AFK46705.1| unknown [Lotus japonicus]
Length=162

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYG-GSHGVDEV-SKDDYDNCNAGNA  512
            + H+VGG  GW QS D+ +W + +TF VGD LVF Y  G H V E+ S+ DY NC+ G+A
Sbjct  23   EQHVVGGSQGWDQSTDFNSWVSGKTFNVGDQLVFKYSSGLHSVVELGSESDYKNCDIGSA  82

Query  511  LRSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAI  401
            + + + G   +KLSK G  YF C + GHC  GMK+ I
Sbjct  83   VNTMSSGNDAVKLSKPGTRYFACGTSGHCSQGMKVKI  119



>gb|KFK44343.1| hypothetical protein AALP_AA1G245500 [Arabis alpina]
Length=280

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  655  WSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDGKTTIK  476
            WS   DYT  A  +TF VGD++VFNYG  H V+EVS++DY +C  GN++ S + G TTI 
Sbjct  14   WSLGTDYTPLATGKTFAVGDTIVFNYGAGHTVEEVSENDYKSCTLGNSITSDSSGTTTIA  73

Query  475  LSKAGPMYFMCPSFGHCQTGMKLAINV  395
            L   GP YF+C   GHC  GMKLA+ V
Sbjct  74   LKTTGPRYFICGIPGHCAGGMKLAVTV  100



>ref|XP_010424736.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=198

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW  S D  +W + + F+ GD L+F Y  +H V EV K++Y NCN+ +A+R+F
Sbjct  30   YFVGDSSGWDISSDLESWTSGKRFSPGDVLMFQYSSTHSVYEVDKNNYQNCNSTDAIRTF  89

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            T+G TT+ LSK G  +F+C +  HC  GM+L +NV+
Sbjct  90   TNGNTTVSLSKPGDRFFVCGNRLHCFAGMRLRVNVE  125



>ref|XP_010414015.1| PREDICTED: blue copper protein-like [Camelina sativa]
Length=261

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDDYDNCNAGNALR  506
            DH +GG  GW+      TWAA++TF VGD+LVF+Y  + H V EV+K ++D+C +   L 
Sbjct  25   DHTIGGPSGWTVGTSLRTWAAAQTFAVGDNLVFSYPATFHDVVEVTKPEFDSCQSVKPLI  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +F +G + + L+  G  YF+C   GHC  GMKL +NV
Sbjct  85   TFANGNSIVPLTTPGKRYFICGMPGHCSQGMKLEVNV  121



>ref|XP_004973723.1| PREDICTED: blue copper protein-like [Setaria italica]
Length=179

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYG-GSHGVDEVSKDDYDNCNAGNALRS  503
            + VG   GWS   DY+TW   + F+VGD LVF Y  G+H V  VSK DYD CN G+AL +
Sbjct  25   YTVGETQGWSLGVDYSTWVTGKNFSVGDKLVFTYATGNHDVLVVSKSDYDACNKGSALST  84

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             TDG TTI L  AG  Y++C    HC  GMKLA+NV
Sbjct  85   QTDGPTTITLDSAGDHYYICGIGTHCSGGMKLAVNV  120



>emb|CDY04812.1| BnaC05g17770D [Brassica napus]
Length=186

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -3

Query  655  WSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDGKTTIK  476
            WS   DYT  A   TF+VGD++VF+Y   H VDEVS++DY +C  GN++ S + G TTI 
Sbjct  27   WSLGTDYTLLATGNTFSVGDTIVFSYSAGHTVDEVSENDYKSCTLGNSIISDSSGTTTID  86

Query  475  LSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            L   GP YF+C   GHC TGMKLA+ V 
Sbjct  87   LKTTGPRYFICGIPGHCSTGMKLAVTVA  114



>gb|KFK41656.1| hypothetical protein AALP_AA2G155800 [Arabis alpina]
Length=178

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  655  WSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDGKTTIK  476
            WS   DYT+ A  + + VGD++VFNYG  H VDEVS+ DY +C  GNA+ S + G T+I 
Sbjct  29   WSLGKDYTSLATGKPYAVGDTMVFNYGAGHTVDEVSESDYKSCTVGNAISSDSSGTTSIA  88

Query  475  LSKAGPMYFMCPSFGHCQTGMKLAINV  395
            L  +GP YF+C   GHC  GMKL++ V
Sbjct  89   LKTSGPHYFICGIPGHCDGGMKLSVTV  115



>ref|XP_007151532.1| hypothetical protein PHAVU_004G054700g [Phaseolus vulgaris]
 gb|ESW23526.1| hypothetical protein PHAVU_004G054700g [Phaseolus vulgaris]
Length=186

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDD-YDNCNAGNALR  506
             H+VGG  GW QS D+ +W + +TF VGD LVF Y   H V E+ K+  Y NC+  + ++
Sbjct  24   QHVVGGSQGWDQSTDFNSWTSGQTFKVGDKLVFKYSSLHSVVELGKESAYKNCDISSPIQ  83

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            S ++G   +KL K G  YF C + GHC  GMK+ I +
Sbjct  84   SLSNGNDVVKLDKPGTRYFTCGTLGHCSQGMKMKITI  120



>emb|CDY65457.1| BnaC03g71950D [Brassica napus]
Length=255

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (62%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDDYDNCNAGNALR  506
            DH +GG  GW+   +  TWAA +TF VGD+LVF Y  + H V EV+K +YD+C A   L 
Sbjct  25   DHTIGGPRGWTVGANLKTWAAGQTFVVGDNLVFAYPSAFHDVVEVTKPEYDSCQAVKPLI  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             F +G + + L+  G  YF+C   GHC  GMKL +NV
Sbjct  85   KFANGNSIVPLTTPGKRYFICGMPGHCTQGMKLEVNV  121



>ref|XP_006653637.1| PREDICTED: blue copper protein-like [Oryza brachyantha]
Length=135

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = -3

Query  685  KDHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGG-SHGVDEVSKDDYDNCNAGNAL  509
            +D+ VG   GW+   DYT WA  + FTVGD L+F Y    H V EVS  D+ +C+  N L
Sbjct  26   RDYTVGDSSGWTTGVDYTAWARGKAFTVGDRLLFQYNSDRHSVAEVSAADHGSCSPSNPL  85

Query  508  RSFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            RS+ DG   + L+  G  YF+C S GHC +GMKL + V
Sbjct  86   RSYRDGTAAVALTSPGTRYFICGSSGHCASGMKLTVTV  123



>ref|XP_006399230.1| hypothetical protein EUTSA_v10014745mg [Eutrema salsugineum]
 gb|ESQ40683.1| hypothetical protein EUTSA_v10014745mg [Eutrema salsugineum]
Length=193

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW  S D  +W   + F+VGD L+F Y  +H V EV+KD + NCN  + +R+F
Sbjct  30   YFVGDTSGWDISSDLDSWTLGKRFSVGDVLMFQYSSTHSVYEVAKDKFQNCNTTDPIRTF  89

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            T+G TT+ LSK G  +F+C +  HC  GMKL +NV+
Sbjct  90   TNGNTTVALSKPGDRFFVCGNRLHCFAGMKLQVNVE  125



>ref|XP_006295920.1| hypothetical protein CARUB_v10025057mg [Capsella rubella]
 gb|EOA28818.1| hypothetical protein CARUB_v10025057mg [Capsella rubella]
Length=263

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDDYDNCNAGNALR  506
            DH +GG  GW+      +WAA++TF VGD+LVF+Y  + H V EV+K ++D+C A   L 
Sbjct  25   DHTIGGPSGWTVGASLRSWAAAQTFAVGDNLVFSYPAAFHDVVEVTKPEFDSCQAVKPLI  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +F +G + + L+  G  YF+C   GHC  GMKL +NV
Sbjct  85   TFANGNSIVPLTTPGKRYFICGMPGHCSQGMKLEVNV  121



>ref|XP_008444862.1| PREDICTED: blue copper protein-like [Cucumis melo]
Length=213

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GWS   DY +W + +TF VGD+L+FNYGG H VDEVS  DY++C A N++ S 
Sbjct  28   YTVGDTAGWSIGVDYNSWTSGKTFVVGDTLMFNYGGGHTVDEVSGSDYNSCMASNSISSD  87

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            + G T I L   G  YF+C + GHC  GMKLA+ V 
Sbjct  88   SSGATAITLKMPGTHYFICGALGHCSNGMKLAVTVA  123



>ref|XP_002878327.1| hypothetical protein ARALYDRAFT_486501 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54586.1| hypothetical protein ARALYDRAFT_486501 [Arabidopsis lyrata subsp. 
lyrata]
Length=194

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG + GW+   DYT W   +TF VGD+L F Y  SH V  V K  YD C++  A ++F D
Sbjct  26   VGDNAGWTSGIDYTDWVTGKTFRVGDTLEFIYDLSHSVSVVDKAGYDGCDSSGATQNFFD  85

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G T I L+  G M+F+CP+FGHC  GMKLA+ V
Sbjct  86   GDTKIDLTTVGTMHFLCPTFGHCLDGMKLAVPV  118



>ref|XP_011101849.1| PREDICTED: mavicyanin-like [Sesamum indicum]
Length=186

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 58/95 (61%), Gaps = 0/95 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VGG  GW+    Y  WA+ +TF  GDSL+F Y  SH VDEV++ DY +C++ N + S+
Sbjct  23   HTVGGLRGWNTGVKYDDWASEQTFATGDSLLFIYDISHTVDEVTEADYQSCSSANPINSY  82

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
                TT+ L+  G  YF+CP   HC  GMKL + V
Sbjct  83   PSSPTTVPLNATGTRYFICPRSNHCSQGMKLTVTV  117



>ref|XP_010508251.1| PREDICTED: uclacyanin-2-like [Camelina sativa]
Length=198

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            H VGG   W+   DYT WA  +TF VGD+L F YG SH V+EV+K  YD+C  G  + + 
Sbjct  29   HTVGGASQWASGVDYTVWATGKTFRVGDTLKFTYGPSHSVNEVNKAGYDSCG-GTPIDTH  87

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            + G T I L   G  YF+CP+ GHC+ GMKLA+ V
Sbjct  88   SGGDTEIDLETVGIKYFICPTSGHCEGGMKLAVTV  122



>ref|NP_566810.1| plastocyanin-like domain-containing protein [Arabidopsis thaliana]
 gb|AAL62418.1| blue copper protein, putative [Arabidopsis thaliana]
 gb|AAP21370.1| At3g27200 [Arabidopsis thaliana]
 gb|AEE77278.1| plastocyanin-like domain-containing protein [Arabidopsis thaliana]
Length=174

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEV-SKDDYDNCNAGNALRS  503
            H++GG  GW QS D+ +W++ ++F VGD +VF Y   H V E+ S+  Y +C+ G ++ S
Sbjct  26   HVIGGSQGWEQSVDFDSWSSDQSFKVGDQIVFKYSELHSVVELGSETAYKSCDLGTSVNS  85

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
             + G   +KLSK G  YF C + GHC+ GMK+ +NV
Sbjct  86   LSSGNDVVKLSKTGTRYFACGTVGHCEQGMKIKVNV  121



>ref|XP_010469615.1| PREDICTED: blue copper protein [Camelina sativa]
Length=261

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDDYDNCNAGNALR  506
            DH +GG  GW+      TWAA++TF VGD+LVF+Y  + H V EV+K ++D+C +   L 
Sbjct  25   DHTIGGPSGWTVGTSLRTWAAAQTFAVGDNLVFSYPAAFHDVVEVTKPEFDSCQSVKPLI  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +F +G + + L+  G  YF+C   GHC  GMKL +NV
Sbjct  85   TFANGDSIVPLTTPGKRYFICGMPGHCSQGMKLEVNV  121



>ref|XP_008647896.1| PREDICTED: blue copper protein isoform X1 [Zea mays]
 gb|AFW76732.1| blue copper protein [Zea mays]
Length=213

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNY-GGSHGVDEVSKDDYDNCNAGNALRS  503
            + VG   GW+ +GDY TWA+ + F VGDSL F Y GG+H VDEVS  DY  C++ NAL +
Sbjct  28   YTVGDASGWTTTGDYATWASGKKFKVGDSLEFKYAGGAHTVDEVSAADYAACSSSNALST  87

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKL  407
             + G TT+ L  AG  YF+C   GHC +GMKL
Sbjct  88   DSAGATTVTLKTAGKHYFICGVAGHCSSGMKL  119



>ref|XP_010535292.1| PREDICTED: blue copper protein [Tarenaya hassleriana]
Length=181

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -3

Query  655  WSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDGKTTIK  476
            WS   DYT+ A+S+TF VGD LVFNYG  H VDEV + DY +C  GN++ S + G T+I 
Sbjct  31   WSLGTDYTSLASSKTFVVGDILVFNYGAGHTVDEVKESDYKSCTVGNSISSDSSGTTSIA  90

Query  475  LSKAGPMYFMCPSFGHCQTGMKLAINV  395
            L   G  +F+C + GHC  GMKL+++V
Sbjct  91   LKTPGTHFFICAAPGHCSGGMKLSVSV  117



>ref|XP_009402874.1| PREDICTED: mavicyanin-like [Musa acuminata subsp. malaccensis]
Length=212

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = -3

Query  670  GGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDG  491
            G +GGW  S D  TWA+++TF  GDSL F Y  SH V EV+K +YD C A   ++S+T G
Sbjct  30   GSEGGWDLSTDLQTWASAQTFVPGDSLSFAYAPSHDVVEVTKAEYDACTASRPIQSYTGG  89

Query  490  KTTIKLSKAGPMYFMCPSFGHCQTGMKLAIN  398
             T IKLS  G  +F+C   GHC  GMKL ++
Sbjct  90   STVIKLSAPGKRHFICGIAGHCTAGMKLEVD  120



>ref|NP_001150898.1| blue copper protein precursor [Zea mays]
 gb|ACG40850.1| blue copper protein precursor [Zea mays]
Length=182

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRS  503
            D++VG   GW+   DY TWA+ +TF  GD+LVF Y   H V EVS  DY  C+A N+++S
Sbjct  26   DYVVGDSAGWASGVDYATWASGKTFAAGDNLVFQYSAMHTVAEVSSADYSACSASNSIQS  85

Query  502  FTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKL  407
            ++D  T + L+  G  YF+C + GHC  GMKL
Sbjct  86   YSDQNTKVALTAPGTRYFICGAPGHCGNGMKL  117



>emb|CDY12217.1| BnaC04g12470D [Brassica napus]
Length=258

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = -3

Query  682  DHIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGS-HGVDEVSKDDYDNCNAGNALR  506
            DH +GG  GW+   +  TWAA +TF VGD+LVF Y  + H V EV+K ++D+C A   L 
Sbjct  25   DHTIGGPSGWTVGANLGTWAAGQTFAVGDNLVFAYPSAFHDVVEVTKPEFDSCQAVKPLI  84

Query  505  SFTDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            +F +G + + L+  G  YF+C   GHC  GMKL +NV
Sbjct  85   TFANGNSIVPLTTPGKRYFICGMPGHCAQGMKLEVNV  121



>ref|XP_002873311.1| hypothetical protein ARALYDRAFT_487581 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49570.1| hypothetical protein ARALYDRAFT_487581 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = -3

Query  679  HIVGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSF  500
            + VG   GW  S D  TW + + F+ GD L+F Y  +H V EV+KD+Y  CN  +A+R+F
Sbjct  30   YFVGDSSGWDISSDLDTWTSGKRFSPGDVLLFQYSSTHSVYEVAKDNYQKCNTTDAIRTF  89

Query  499  TDGKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINVQ  392
            T+G TT+ LSK G  +F+C S  HC  GM+L ++V+
Sbjct  90   TNGNTTVALSKPGDRFFVCGSRLHCFAGMRLLVHVE  125



>ref|XP_010414849.1| PREDICTED: blue copper protein-like [Camelina sativa]
Length=179

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  655  WSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDGKTTIK  476
            WS   DY++ A  + + VGD++VFNYG  H VDEVS+ DY +C  GNA+ S + G T+I 
Sbjct  31   WSLGKDYSSLATGKPYAVGDTIVFNYGAGHTVDEVSESDYKSCTLGNAISSDSSGTTSIA  90

Query  475  LSKAGPMYFMCPSFGHCQTGMKLAINV  395
            L  +GP YF+C   GHC  GMKL++ V
Sbjct  91   LKTSGPRYFICGIPGHCTGGMKLSVTV  117



>ref|XP_010471244.1| PREDICTED: blue copper protein-like [Camelina sativa]
Length=179

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -3

Query  655  WSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTDGKTTIK  476
            WS   DY++ A  + + VGD++VFNYG  H VDEVS+ DY +C  GNA+ S + G T+I 
Sbjct  31   WSLGKDYSSLATGKPYAVGDTIVFNYGAGHTVDEVSESDYKSCTLGNAISSDSSGTTSIA  90

Query  475  LSKAGPMYFMCPSFGHCQTGMKLAINV  395
            L  +GP YF+C   GHC  GMKL++ V
Sbjct  91   LKTSGPRYFICGIPGHCTGGMKLSVTV  117



>ref|XP_002878326.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54585.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=171

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -3

Query  673  VGGDGGWSQSGDYTTWAASETFTVGDSLVFNYGGSHGVDEVSKDDYDNCNAGNALRSFTD  494
            VG + GW+   DYT W   +TF VGD+L F YG SH V  V K DYD C      +SF+ 
Sbjct  25   VGDNAGWAGGVDYTDWVTGKTFRVGDTLEFIYGLSHSVSVVDKADYDGCETSRPTQSFSG  84

Query  493  GKTTIKLSKAGPMYFMCPSFGHCQTGMKLAINV  395
            G T I L++ G ++ +CPS GHC  GMKLA+ V
Sbjct  85   GDTKINLTRVGAIHILCPSPGHCLGGMKLAVTV  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1426075485344