BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c40217_g1_i1 len=1328 path=[1:0-1327]

Length=1328
                                                                      Score     E

ref|XP_004241716.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    502   6e-174   
ref|XP_009799663.1|  PREDICTED: probable 2-oxoglutarate-dependent...    498   2e-172   
ref|XP_006356186.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    494   1e-170   
ref|XP_009616143.1|  PREDICTED: probable 2-oxoglutarate-dependent...    493   3e-170   
emb|CDO98090.1|  unnamed protein product                                487   6e-168   
ref|XP_011072310.1|  PREDICTED: probable 2-oxoglutarate-dependent...    465   2e-159   
gb|EYU21585.1|  hypothetical protein MIMGU_mgv1a010381mg                458   8e-157   
gb|AFC36356.1|  2-oxoglutarate-dependent dioxygenase                    439   5e-149   
emb|CDP17011.1|  unnamed protein product                                380   6e-126   
ref|XP_010110322.1|  Gibberellin 20 oxidase 1                           372   4e-122   
ref|XP_007217562.1|  hypothetical protein PRUPE_ppa021035mg             369   6e-122   
ref|XP_008228622.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    365   5e-120   
emb|CDP10326.1|  unnamed protein product                                363   2e-119   
ref|XP_011072311.1|  PREDICTED: probable 2-oxoglutarate-dependent...    362   7e-119   
ref|XP_002298127.1|  oxidoreductase family protein                      361   1e-118   Populus trichocarpa [western balsam poplar]
ref|XP_011045371.1|  PREDICTED: probable 2-oxoglutarate-dependent...    360   4e-118   
ref|XP_007024003.1|  2-oxoglutarate-dependent dioxygenase               356   1e-116   
emb|CAN77851.1|  hypothetical protein VITISV_030994                     356   1e-116   Vitis vinifera
ref|XP_009339602.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    355   2e-116   
ref|XP_002284974.1|  PREDICTED: probable 2-oxoglutarate-dependent...    355   3e-116   Vitis vinifera
ref|XP_002284983.1|  PREDICTED: probable inactive 2-oxoglutarate-...    355   3e-116   Vitis vinifera
emb|CAN80139.1|  hypothetical protein VITISV_028513                     355   3e-116   Vitis vinifera
gb|KDP37163.1|  hypothetical protein JCGZ_06219                         354   5e-116   
ref|XP_002280670.1|  PREDICTED: probable 2-oxoglutarate-dependent...    354   5e-116   Vitis vinifera
ref|XP_011072270.1|  PREDICTED: probable 2-oxoglutarate-dependent...    353   1e-115   
ref|XP_008377591.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    353   2e-115   
ref|XP_010033904.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    353   2e-115   
emb|CBI36206.3|  unnamed protein product                                357   4e-115   
emb|CDO98089.1|  unnamed protein product                                352   5e-115   
ref|XP_004302942.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    349   9e-114   
ref|XP_002517548.1|  Gibberellin 20 oxidase, putative                   347   3e-113   Ricinus communis
ref|XP_006427132.1|  hypothetical protein CICLE_v10027083mg             347   3e-113   
ref|XP_006465514.1|  PREDICTED: probable 2-oxoglutarate-dependent...    347   5e-113   
ref|XP_002298131.1|  hypothetical protein POPTR_0001s17670g             343   1e-111   Populus trichocarpa [western balsam poplar]
ref|XP_007214491.1|  hypothetical protein PRUPE_ppa020361mg             343   2e-111   
emb|CDP10327.1|  unnamed protein product                                342   4e-111   
ref|XP_006465516.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    340   3e-110   
ref|XP_011045368.1|  PREDICTED: probable 2-oxoglutarate-dependent...    339   5e-110   
ref|XP_008228619.1|  PREDICTED: probable 2-oxoglutarate-dependent...    339   8e-110   
ref|XP_008226092.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    338   8e-110   
ref|XP_007216862.1|  hypothetical protein PRUPE_ppa021358mg             338   1e-109   
ref|XP_006427128.1|  hypothetical protein CICLE_v10027501mg             338   3e-109   
ref|XP_010034855.1|  PREDICTED: probable 2-oxoglutarate-dependent...    336   1e-108   
ref|NP_175688.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    333   8e-108   Arabidopsis thaliana [mouse-ear cress]
gb|EYU21582.1|  hypothetical protein MIMGU_mgv1a010360mg                333   8e-108   
emb|CDP19783.1|  unnamed protein product                                332   2e-107   
ref|XP_004302943.1|  PREDICTED: gibberellin 20 oxidase 1-like           332   2e-107   
emb|CDO98091.1|  unnamed protein product                                332   4e-107   
gb|KDP37168.1|  hypothetical protein JCGZ_06224                         331   6e-107   
ref|XP_008377592.1|  PREDICTED: probable 2-oxoglutarate-dependent...    331   8e-107   
ref|XP_004302952.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     330   1e-106   
ref|XP_002298129.1|  2-oxoglutarate-dependent dioxygenase-related...    328   1e-105   Populus trichocarpa [western balsam poplar]
ref|XP_009339601.1|  PREDICTED: probable 2-oxoglutarate-dependent...    327   3e-105   
emb|CDY26055.1|  BnaC06g05690D                                          327   3e-105   
ref|XP_002517541.1|  Gibberellin 20 oxidase, putative                   327   3e-105   Ricinus communis
ref|XP_002284968.1|  PREDICTED: probable 2-oxoglutarate-dependent...    327   4e-105   Vitis vinifera
ref|XP_002517690.1|  Gibberellin 20 oxidase, putative                   326   4e-105   Ricinus communis
gb|KFK35768.1|  hypothetical protein AALP_AA4G033700                    326   5e-105   
ref|XP_010545796.1|  PREDICTED: probable 2-oxoglutarate-dependent...    325   1e-104   
ref|XP_006427131.1|  hypothetical protein CICLE_v10027420mg             324   2e-104   
emb|CAN80138.1|  hypothetical protein VITISV_028512                     324   4e-104   Vitis vinifera
ref|XP_007024009.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    323   5e-104   
gb|KFK35767.1|  hypothetical protein AALP_AA4G033600                    323   6e-104   
ref|XP_009147661.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    323   7e-104   
ref|XP_007215723.1|  hypothetical protein PRUPE_ppa008973mg             323   8e-104   
emb|CDY68239.1|  BnaA06g37440D                                          322   1e-103   
ref|XP_009339603.1|  PREDICTED: probable 2-oxoglutarate-dependent...    323   1e-103   
gb|ACU24369.1|  unknown                                                 322   2e-103   Glycine max [soybeans]
emb|CDP20247.1|  unnamed protein product                                321   4e-103   
ref|XP_002517546.1|  Gibberellin 20 oxidase, putative                   322   4e-103   Ricinus communis
ref|XP_009771248.1|  PREDICTED: probable 2-oxoglutarate-dependent...    321   4e-103   
ref|XP_006305421.1|  hypothetical protein CARUB_v10009821mg             321   5e-103   
ref|XP_010061960.1|  PREDICTED: probable inactive 2-oxoglutarate-...    321   6e-103   
ref|XP_010061959.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    321   7e-103   
ref|XP_003535849.1|  PREDICTED: probable 2-oxoglutarate-dependent...    320   1e-102   
ref|XP_006306220.1|  hypothetical protein CARUB_v10011908mg             320   1e-102   
ref|XP_006465423.1|  PREDICTED: probable 2-oxoglutarate-dependent...    320   1e-102   
ref|XP_006427129.1|  hypothetical protein CICLE_v10027545mg             321   1e-102   
ref|XP_010665883.1|  PREDICTED: probable 2-oxoglutarate-dependent...    320   1e-102   
ref|NP_175689.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    320   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228621.1|  PREDICTED: probable 2-oxoglutarate-dependent...    319   2e-102   
ref|XP_010462133.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    319   2e-102   
gb|KHN31409.1|  Gibberellin 20 oxidase 1                                319   3e-102   
ref|XP_006465422.1|  PREDICTED: probable 2-oxoglutarate-dependent...    319   4e-102   
ref|XP_009147660.1|  PREDICTED: probable 2-oxoglutarate-dependent...    319   4e-102   
emb|CDP08458.1|  unnamed protein product                                318   6e-102   
ref|XP_008377588.1|  PREDICTED: probable 2-oxoglutarate-dependent...    318   2e-101   
ref|XP_006465515.1|  PREDICTED: probable 2-oxoglutarate-dependent...    317   2e-101   
ref|XP_010110313.1|  Gibberellin 3-beta-dioxygenase 4                   317   2e-101   
ref|XP_010110312.1|  Gibberellin 3-beta-dioxygenase 4                   316   4e-101   
ref|XP_006392870.1|  hypothetical protein EUTSA_v10011669mg             316   6e-101   
gb|KHG05406.1|  2'-deoxymugineic-acid 2'-dioxygenase                    315   9e-101   
emb|CDY26054.1|  BnaC06g05700D                                          315   1e-100   
ref|XP_009799661.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    315   1e-100   
ref|XP_010463426.1|  PREDICTED: probable 2-oxoglutarate-dependent...    315   1e-100   
ref|XP_010033902.1|  PREDICTED: probable 2-oxoglutarate-dependent...    315   1e-100   
ref|XP_009588351.1|  PREDICTED: probable 2-oxoglutarate-dependent...    315   1e-100   
ref|XP_007145554.1|  hypothetical protein PHAVU_007G248400g             314   2e-100   
ref|XP_007024008.1|  2-oxoglutarate-dependent dioxygenase, putative     314   2e-100   
ref|XP_010545794.1|  PREDICTED: probable 2-oxoglutarate-dependent...    315   3e-100   
ref|XP_006356178.1|  PREDICTED: probable 2-oxoglutarate-dependent...    314   4e-100   
ref|XP_004152262.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         313   6e-100   
ref|XP_004241720.1|  PREDICTED: probable 2-oxoglutarate-dependent...    313   7e-100   
ref|XP_006427127.1|  hypothetical protein CICLE_v10027219mg             313   8e-100   
ref|XP_011045369.1|  PREDICTED: probable 2-oxoglutarate-dependent...    312   1e-99    
ref|XP_010500899.1|  PREDICTED: probable 2-oxoglutarate-dependent...    312   2e-99    
ref|XP_007216816.1|  hypothetical protein PRUPE_ppa023108mg             312   2e-99    
ref|XP_009379331.1|  PREDICTED: probable 2-oxoglutarate-dependent...    312   2e-99    
ref|XP_007024335.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    322   4e-99    
emb|CDP19495.1|  unnamed protein product                                311   4e-99    
ref|XP_010535123.1|  PREDICTED: probable 2-oxoglutarate-dependent...    311   5e-99    
gb|KDO58204.1|  hypothetical protein CISIN_1g038676mg                   310   6e-99    
ref|XP_003528366.1|  PREDICTED: probable 2-oxoglutarate-dependent...    310   9e-99    
ref|XP_010479801.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    310   1e-98    
ref|XP_006392868.1|  hypothetical protein EUTSA_v10011672mg             309   3e-98    
gb|KHN01361.1|  Gibberellin 20 oxidase 1                                308   8e-98    
gb|EYU21589.1|  hypothetical protein MIMGU_mgv1a024911mg                305   9e-98    
ref|XP_004241717.1|  PREDICTED: probable 2-oxoglutarate-dependent...    307   1e-97    
ref|XP_009780364.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    307   2e-97    
ref|XP_010481152.1|  PREDICTED: probable 2-oxoglutarate-dependent...    310   2e-97    
ref|XP_008454372.1|  PREDICTED: probable 2-oxoglutarate-dependent...    306   2e-97    
ref|XP_004136074.1|  PREDICTED: gibberellin 20 oxidase 1-like           306   3e-97    
ref|XP_009616144.1|  PREDICTED: probable 2-oxoglutarate-dependent...    306   4e-97    
emb|CDY26044.1|  BnaC06g05800D                                          306   4e-97    
ref|XP_008228620.1|  PREDICTED: probable 2-oxoglutarate-dependent...    306   4e-97    
ref|XP_009147658.1|  PREDICTED: probable 2-oxoglutarate-dependent...    305   7e-97    
ref|XP_010033901.1|  PREDICTED: probable 2-oxoglutarate-dependent...    304   2e-96    
ref|XP_004151475.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         305   3e-96    
ref|XP_004171510.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    303   3e-96    
ref|XP_002517547.1|  Gibberellin 20 oxidase, putative                   303   3e-96    Ricinus communis
ref|XP_002284985.1|  PREDICTED: probable 2-oxoglutarate-dependent...    303   5e-96    Vitis vinifera
gb|KDP37370.1|  hypothetical protein JCGZ_06824                         303   7e-96    
ref|XP_006427130.1|  hypothetical protein CICLE_v10027182mg             303   1e-95    
ref|XP_003533058.1|  PREDICTED: probable 2-oxoglutarate-dependent...    302   2e-95    
ref|XP_010500907.1|  PREDICTED: probable 2-oxoglutarate-dependent...    302   2e-95    
gb|KDO58207.1|  hypothetical protein CISIN_1g037660mg                   301   2e-95    
ref|XP_006305391.1|  hypothetical protein CARUB_v10009783mg             301   3e-95    
ref|XP_008461058.1|  PREDICTED: probable inactive 2-oxoglutarate-...    300   6e-95    
ref|XP_010462134.1|  PREDICTED: probable 2-oxoglutarate-dependent...    300   6e-95    
ref|XP_010047771.1|  PREDICTED: probable 2-oxoglutarate-dependent...    300   6e-95    
ref|XP_006392865.1|  hypothetical protein EUTSA_v10011667mg             300   1e-94    
ref|XP_010500906.1|  PREDICTED: probable 2-oxoglutarate-dependent...    299   2e-94    
ref|XP_009603180.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    299   3e-94    
ref|NP_175691.1|  putative 2-oxoglutarate-dependent dioxygenase         298   4e-94    Arabidopsis thaliana [mouse-ear cress]
gb|KDO58208.1|  hypothetical protein CISIN_1g044747mg                   298   4e-94    
ref|XP_010479810.1|  PREDICTED: probable 2-oxoglutarate-dependent...    297   8e-94    
emb|CDP08459.1|  unnamed protein product                                296   2e-93    
ref|XP_011072273.1|  PREDICTED: probable 2-oxoglutarate-dependent...    296   3e-93    
ref|XP_009371496.1|  PREDICTED: probable 2-oxoglutarate-dependent...    296   4e-93    
gb|KDP24591.1|  hypothetical protein JCGZ_25507                         295   6e-93    
gb|KDP37164.1|  hypothetical protein JCGZ_06220                         294   1e-92    
emb|CAN66061.1|  hypothetical protein VITISV_007808                     293   5e-92    Vitis vinifera
ref|XP_004148019.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    293   5e-92    
ref|XP_003625060.1|  Gibberellin 20 oxidase                             293   5e-92    
gb|KDP37380.1|  hypothetical protein JCGZ_06834                         292   8e-92    
ref|XP_007135717.1|  hypothetical protein PHAVU_010G152300g             292   1e-91    
ref|XP_008377590.1|  PREDICTED: probable 2-oxoglutarate-dependent...    291   1e-91    
ref|XP_003553391.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    292   1e-91    
gb|AFK47428.1|  unknown                                                 291   1e-91    
gb|KEH28749.1|  2-oxoglutarate-dependent dioxygenase                    291   2e-91    
ref|XP_007145552.1|  hypothetical protein PHAVU_007G248200g             291   2e-91    
ref|XP_010542274.1|  PREDICTED: probable 2-oxoglutarate-dependent...    290   4e-91    
ref|XP_006367751.1|  PREDICTED: probable 2-oxoglutarate-dependent...    290   7e-91    
ref|XP_010110314.1|  Gibberellin 3-beta-dioxygenase 4                   290   8e-91    
ref|XP_009347560.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    290   1e-90    
ref|XP_007135718.1|  hypothetical protein PHAVU_010G152400g             289   2e-90    
ref|XP_004506878.1|  PREDICTED: S-norcoclaurine synthase 1-like         288   2e-90    
ref|XP_008366303.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    288   3e-90    
gb|AFK40822.1|  unknown                                                 288   6e-90    
gb|EYU31921.1|  hypothetical protein MIMGU_mgv1a010132mg                288   6e-90    
ref|XP_004241718.1|  PREDICTED: probable 2-oxoglutarate-dependent...    287   6e-90    
ref|XP_010110321.1|  Gibberellin 20 oxidase 1                           287   8e-90    
emb|CDP14980.1|  unnamed protein product                                287   1e-89    
gb|KEH28750.1|  2-oxoglutarate-dependent dioxygenase                    286   2e-89    
ref|XP_006392867.1|  hypothetical protein EUTSA_v10011672mg             285   2e-89    
ref|XP_008784635.1|  PREDICTED: probable 2-oxoglutarate-dependent...    286   2e-89    
ref|XP_010500908.1|  PREDICTED: probable 2-oxoglutarate-dependent...    285   3e-89    
emb|CDP21179.1|  unnamed protein product                                285   4e-89    
ref|XP_004241719.1|  PREDICTED: probable 2-oxoglutarate-dependent...    285   5e-89    
ref|XP_007162137.1|  hypothetical protein PHAVU_001G127200g             285   1e-88    
ref|XP_004165032.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         285   1e-88    
ref|XP_010462135.1|  PREDICTED: probable 2-oxoglutarate-dependent...    283   1e-88    
ref|XP_003555065.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    283   3e-88    
ref|XP_004506877.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    280   4e-87    
emb|CDP21163.1|  unnamed protein product                                277   1e-86    
ref|XP_003521152.1|  PREDICTED: probable 2-oxoglutarate-dependent...    279   1e-86    
ref|XP_006365982.1|  PREDICTED: probable 2-oxoglutarate-dependent...    278   2e-86    
ref|XP_009375961.1|  PREDICTED: probable inactive 2-oxoglutarate-...    278   4e-86    
ref|XP_009621185.1|  PREDICTED: probable 2-oxoglutarate-dependent...    277   1e-85    
ref|XP_007024016.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    276   1e-85    
ref|XP_006356185.1|  PREDICTED: probable 2-oxoglutarate-dependent...    276   2e-85    
emb|CDP08608.1|  unnamed protein product                                276   2e-85    
ref|XP_010032029.1|  PREDICTED: probable 2-oxoglutarate-dependent...    275   2e-85    
ref|XP_008344774.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    275   5e-85    
ref|XP_010061957.1|  PREDICTED: probable 2-oxoglutarate-dependent...    275   6e-85    
ref|XP_010061958.1|  PREDICTED: probable 2-oxoglutarate-dependent...    273   1e-84    
ref|XP_008386022.1|  PREDICTED: probable inactive 2-oxoglutarate-...    273   2e-84    
ref|XP_007024010.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    273   3e-84    
gb|AFK44600.1|  unknown                                                 273   3e-84    
ref|XP_008384915.1|  PREDICTED: probable inactive 2-oxoglutarate-...    273   3e-84    
ref|XP_006301978.1|  hypothetical protein CARUB_v10022458mg             273   4e-84    
ref|XP_011072272.1|  PREDICTED: probable 2-oxoglutarate-dependent...    270   4e-84    
ref|XP_009375959.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    272   5e-84    
gb|KHN06108.1|  Gibberellin 3-beta-dioxygenase 3                        271   7e-84    
ref|XP_004293154.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    271   1e-83    
ref|XP_002515914.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    271   2e-83    Ricinus communis
emb|CDP10138.1|  unnamed protein product                                271   2e-83    
ref|XP_003547720.1|  PREDICTED: probable inactive 2-oxoglutarate-...    270   2e-83    
ref|XP_008447674.1|  PREDICTED: probable 2-oxoglutarate-dependent...    273   3e-83    
ref|XP_006367749.1|  PREDICTED: probable 2-oxoglutarate-dependent...    270   5e-83    
ref|XP_010061956.1|  PREDICTED: probable 2-oxoglutarate-dependent...    270   5e-83    
ref|XP_003553825.1|  PREDICTED: probable 2-oxoglutarate-dependent...    269   6e-83    
ref|XP_006416895.1|  hypothetical protein EUTSA_v10008198mg             270   6e-83    
gb|AFK38656.1|  unknown                                                 269   8e-83    
gb|KHN27538.1|  Gibberellin 20 oxidase 1                                269   9e-83    
ref|XP_009608401.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    268   1e-82    
ref|XP_009354842.1|  PREDICTED: probable inactive 2-oxoglutarate-...    268   2e-82    
gb|KDO58205.1|  hypothetical protein CISIN_1g045288mg                   265   2e-82    
emb|CDO98087.1|  unnamed protein product                                268   3e-82    
ref|XP_007162138.1|  hypothetical protein PHAVU_001G127300g             267   3e-82    
ref|XP_009364342.1|  PREDICTED: probable inactive 2-oxoglutarate-...    268   4e-82    
ref|XP_003554144.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    267   4e-82    
ref|XP_010110319.1|  Protein SRG1                                       266   9e-82    
ref|XP_008390710.1|  PREDICTED: probable inactive 2-oxoglutarate-...    266   2e-81    
gb|KHN14925.1|  Gibberellin 20 oxidase 1                                265   3e-81    
ref|XP_002890109.1|  predicted protein                                  265   5e-81    
ref|XP_011045370.1|  PREDICTED: probable 2-oxoglutarate-dependent...    264   7e-81    
emb|CDP21546.1|  unnamed protein product                                265   7e-81    
ref|XP_008372275.1|  PREDICTED: probable inactive 2-oxoglutarate-...    264   8e-81    
ref|XP_003554143.1|  PREDICTED: probable 2-oxoglutarate-dependent...    264   9e-81    
ref|XP_010429979.1|  PREDICTED: probable 2-oxoglutarate-dependent...    264   9e-81    
ref|XP_002889297.1|  predicted protein                                  264   9e-81    
gb|KHN14924.1|  Gibberellin 20 oxidase 3                                263   1e-80    
ref|XP_009148950.1|  PREDICTED: probable 2-oxoglutarate-dependent...    263   1e-80    
ref|XP_006339306.1|  PREDICTED: probable 2-oxoglutarate-dependent...    262   3e-80    
gb|KFK42423.1|  hypothetical protein AALP_AA2G254300                    263   3e-80    
ref|XP_006348005.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    262   4e-80    
emb|CDY39662.1|  BnaC05g11910D                                          263   6e-80    
ref|XP_007145557.1|  hypothetical protein PHAVU_007G248700g             261   6e-80    
emb|CDY36571.1|  BnaA06g10240D                                          262   6e-80    
ref|XP_006389780.1|  hypothetical protein EUTSA_v10018872mg             261   1e-79    
ref|XP_010472950.1|  PREDICTED: probable 2-oxoglutarate-dependent...    261   1e-79    
emb|CDP21180.1|  unnamed protein product                                261   1e-79    
ref|XP_009802367.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    260   2e-79    
ref|XP_002515925.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    260   2e-79    Ricinus communis
ref|XP_007145555.1|  hypothetical protein PHAVU_007G248500g             259   3e-79    
ref|XP_010472949.1|  PREDICTED: probable 2-oxoglutarate-dependent...    260   3e-79    
ref|XP_008461057.1|  PREDICTED: probable 2-oxoglutarate-dependent...    259   4e-79    
emb|CDP19784.1|  unnamed protein product                                258   9e-79    
ref|XP_009344329.1|  PREDICTED: probable inactive 2-oxoglutarate-...    258   1e-78    
ref|XP_008382989.1|  PREDICTED: probable inactive 2-oxoglutarate-...    258   1e-78    
gb|AAL14645.1|AF417857_1  AOP1                                          258   2e-78    Arabidopsis lyrata [lyrate rockcress]
ref|XP_004229768.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    258   2e-78    
emb|CDY37587.1|  BnaA02g19830D                                          258   2e-78    
ref|XP_004306704.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    257   3e-78    
ref|XP_002298128.2|  hypothetical protein POPTR_0001s17630g             256   5e-78    Populus trichocarpa [western balsam poplar]
emb|CDP14441.1|  unnamed protein product                                256   6e-78    
ref|NP_178148.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    256   6e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227259.1|  PREDICTED: probable inactive 2-oxoglutarate-...    256   6e-78    
ref|XP_007214111.1|  hypothetical protein PRUPE_ppa017120mg             256   7e-78    
sp|Q945B6.1|AOP1L_ARATH  RecName: Full=Probable 2-oxoglutarate-de...    256   7e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288730.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    256   8e-78    
ref|XP_004136073.1|  PREDICTED: gibberellin 2-beta-dioxygenase 8-...    256   9e-78    
emb|CDO98088.1|  unnamed protein product                                256   1e-77    
ref|XP_011045372.1|  PREDICTED: probable 2-oxoglutarate-dependent...    256   1e-77    
ref|XP_009785369.1|  PREDICTED: probable 2-oxoglutarate-dependent...    256   1e-77    
emb|CDY22099.1|  BnaA09g01280D                                          256   1e-77    
ref|XP_002298124.1|  hypothetical protein POPTR_0001s17580g             255   2e-77    Populus trichocarpa [western balsam poplar]
ref|XP_010041295.1|  PREDICTED: probable 2-oxoglutarate-dependent...    255   2e-77    
gb|EYU21581.1|  hypothetical protein MIMGU_mgv1a010326mg                255   2e-77    
gb|AAL14701.1|  2-oxoglutarate-dependent dioxygenase                    254   3e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002517544.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    254   3e-77    Ricinus communis
ref|XP_009128434.1|  PREDICTED: probable 2-oxoglutarate-dependent...    255   4e-77    
ref|XP_006854891.1|  hypothetical protein AMTR_s00052p00016200          254   4e-77    
ref|XP_007210837.1|  hypothetical protein PRUPE_ppa016751mg             253   7e-77    
ref|XP_004301787.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    254   8e-77    
ref|XP_010532147.1|  PREDICTED: probable 2-oxoglutarate-dependent...    254   8e-77    
gb|KHN45675.1|  Gibberellin 20 oxidase 1                                251   2e-76    
ref|XP_008227260.1|  PREDICTED: probable 2-oxoglutarate-dependent...    253   2e-76    
gb|AAL14683.1|  2-oxoglutarate-dependent dioxygenase                    253   2e-76    
gb|KDP24586.1|  hypothetical protein JCGZ_25502                         254   2e-76    
ref|XP_006348004.1|  PREDICTED: probable 2-oxoglutarate-dependent...    252   2e-76    
emb|CDY21938.1|  BnaC09g00440D                                          253   3e-76    
gb|EYU21580.1|  hypothetical protein MIMGU_mgv1a010552mg                252   3e-76    
ref|NP_192216.1|  oxidoreductase AOP1                                   252   3e-76    
emb|CBI36205.3|  unnamed protein product                                250   5e-76    
ref|XP_008792974.1|  PREDICTED: probable 2-oxoglutarate-dependent...    252   5e-76    
gb|AAL14687.1|  2-oxoglutarate-dependent dioxygenase                    250   6e-76    
ref|XP_006598543.1|  PREDICTED: probable 2-oxoglutarate-dependent...    249   8e-76    
ref|XP_008794218.1|  PREDICTED: probable 2-oxoglutarate-dependent...    251   9e-76    
gb|AAL14699.1|  2-oxoglutarate-dependent dioxygenase                    250   9e-76    
gb|AAL14686.1|  2-oxoglutarate-dependent dioxygenase                    250   2e-75    
emb|CDY38659.1|  BnaC02g23200D                                          250   2e-75    
ref|XP_006304019.1|  hypothetical protein CARUB_v10009745mg             250   3e-75    
gb|KFK30903.1|  hypothetical protein AALP_AA6G041100                    249   3e-75    
ref|XP_008227261.1|  PREDICTED: probable inactive 2-oxoglutarate-...    249   3e-75    
ref|XP_009122188.1|  PREDICTED: probable 2-oxoglutarate-dependent...    249   3e-75    
ref|XP_006346585.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    249   5e-75    
ref|XP_007212875.1|  hypothetical protein PRUPE_ppa021625mg             248   7e-75    
ref|XP_004252327.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    248   9e-75    
ref|XP_002517543.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    248   1e-74    
ref|XP_007162139.1|  hypothetical protein PHAVU_001G127400g             248   1e-74    
ref|XP_008227273.1|  PREDICTED: probable 2-oxoglutarate-dependent...    248   1e-74    
ref|XP_008229693.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    248   2e-74    
ref|XP_010459095.1|  PREDICTED: probable 2-oxoglutarate-dependent...    248   2e-74    
ref|XP_010459094.1|  PREDICTED: probable 2-oxoglutarate-dependent...    248   2e-74    
ref|NP_173007.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    248   2e-74    
ref|XP_009134375.1|  PREDICTED: probable 2-oxoglutarate-dependent...    247   2e-74    
ref|XP_010532145.1|  PREDICTED: probable 2-oxoglutarate-dependent...    247   3e-74    
gb|EYU21579.1|  hypothetical protein MIMGU_mgv1a010719mg                246   3e-74    
sp|Q944Z5.1|AOP1V_ARATH  RecName: Full=Probable 2-oxoglutarate-de...    246   3e-74    
ref|XP_006303647.1|  hypothetical protein CARUB_v10011635mg             247   3e-74    
emb|CDY21937.1|  BnaC09g00430D                                          247   4e-74    
ref|XP_006396533.1|  hypothetical protein EUTSA_v10028799mg             247   4e-74    
ref|XP_009621187.1|  PREDICTED: probable 2-oxoglutarate-dependent...    245   5e-74    
gb|KDP40825.1|  hypothetical protein JCGZ_24824                         246   6e-74    
ref|XP_006289716.1|  hypothetical protein CARUB_v10003282mg             246   7e-74    
ref|XP_009147662.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    243   1e-73    
ref|XP_006406954.1|  hypothetical protein EUTSA_v10021145mg             245   1e-73    
ref|XP_004229769.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    245   2e-73    
ref|XP_007224636.1|  hypothetical protein PRUPE_ppa026475mg             244   2e-73    
ref|XP_010497232.1|  PREDICTED: probable 2-oxoglutarate-dependent...    245   2e-73    
gb|KCW69007.1|  hypothetical protein EUGRSUZ_F02567                     242   2e-73    
ref|XP_010476643.1|  PREDICTED: probable 2-oxoglutarate-dependent...    244   3e-73    
ref|XP_010476645.1|  PREDICTED: probable 2-oxoglutarate-dependent...    244   3e-73    
ref|XP_008348454.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    244   4e-73    
ref|XP_004233541.1|  PREDICTED: probable 2-oxoglutarate-dependent...    244   5e-73    
ref|XP_010026428.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    243   6e-73    
emb|CDY17965.1|  BnaC03g30370D                                          243   9e-73    
ref|XP_009372397.1|  PREDICTED: probable inactive 2-oxoglutarate-...    243   9e-73    
ref|XP_009340682.1|  PREDICTED: probable inactive 2-oxoglutarate-...    243   1e-72    
ref|XP_010467243.1|  PREDICTED: probable 2-oxoglutarate-dependent...    243   2e-72    
gb|KFK30904.1|  hypothetical protein AALP_AA6G041200                    242   2e-72    
ref|XP_009115437.1|  PREDICTED: probable 2-oxoglutarate-dependent...    242   3e-72    
emb|CDY20136.1|  BnaA01g28660D                                          242   3e-72    
gb|KFK30901.1|  hypothetical protein AALP_AA6G040900                    242   3e-72    
gb|AAL14698.1|  2-oxoglutarate-dependent dioxygenase                    240   6e-72    
emb|CDP11139.1|  unnamed protein product                                241   6e-72    
ref|XP_010479807.1|  PREDICTED: probable 2-oxoglutarate-dependent...    241   6e-72    
ref|XP_009371876.1|  PREDICTED: probable inactive 2-oxoglutarate-...    240   7e-72    
emb|CDY17969.1|  BnaC03g30410D                                          241   8e-72    
ref|XP_009785373.1|  PREDICTED: probable 2-oxoglutarate-dependent...    239   9e-72    
ref|XP_004233539.1|  PREDICTED: probable 2-oxoglutarate-dependent...    240   1e-71    
ref|XP_006392866.1|  hypothetical protein EUTSA_v10011658mg             240   1e-71    
ref|XP_009349432.1|  PREDICTED: probable inactive 2-oxoglutarate-...    239   2e-71    
ref|XP_009107019.1|  PREDICTED: probable 2-oxoglutarate-dependent...    240   2e-71    
ref|XP_009393623.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    240   2e-71    
emb|CDY22098.1|  BnaA09g01270D                                          240   2e-71    
ref|XP_010500902.1|  PREDICTED: probable 2-oxoglutarate-dependent...    240   2e-71    
ref|XP_009147659.1|  PREDICTED: probable 2-oxoglutarate-dependent...    240   2e-71    
gb|KDP40827.1|  hypothetical protein JCGZ_24826                         239   2e-71    
ref|XP_009122199.1|  PREDICTED: probable 2-oxoglutarate-dependent...    239   3e-71    
ref|XP_010912205.1|  PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutara...    239   3e-71    
gb|KCW69003.1|  hypothetical protein EUGRSUZ_F02563                     237   4e-71    
ref|XP_010049940.1|  PREDICTED: probable 2-oxoglutarate-dependent...    239   5e-71    
ref|XP_010249917.1|  PREDICTED: probable 2-oxoglutarate-dependent...    238   5e-71    
ref|XP_008373756.1|  PREDICTED: probable inactive 2-oxoglutarate-...    238   7e-71    
ref|XP_004233542.1|  PREDICTED: probable 2-oxoglutarate-dependent...    238   8e-71    
ref|XP_008386393.1|  PREDICTED: probable inactive 2-oxoglutarate-...    238   9e-71    
emb|CDY71515.1|  BnaCnng73240D                                          238   1e-70    
ref|XP_010050515.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    238   1e-70    
gb|AAL14685.1|  2-oxoglutarate-dependent dioxygenase                    236   2e-70    
gb|KFK35765.1|  hypothetical protein AALP_AA4G033400                    243   2e-70    
ref|XP_010500900.1|  PREDICTED: probable 2-oxoglutarate-dependent...    234   3e-70    
emb|CDP11141.1|  unnamed protein product                                237   4e-70    
gb|KHG02338.1|  Flavonol synthase/flavanone 3-hydroxylase -like p...    236   5e-70    
ref|XP_010913592.1|  PREDICTED: probable inactive 2-oxoglutarate-...    236   5e-70    
ref|XP_009340689.1|  PREDICTED: probable inactive 2-oxoglutarate-...    236   5e-70    
ref|XP_008346484.1|  PREDICTED: probable 2-oxoglutarate-dependent...    235   5e-70    
ref|XP_009341226.1|  PREDICTED: probable inactive 2-oxoglutarate-...    235   7e-70    
ref|XP_010050517.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    235   9e-70    
ref|XP_008351637.1|  PREDICTED: probable inactive 2-oxoglutarate-...    234   1e-69    
ref|XP_009339369.1|  PREDICTED: probable 2-oxoglutarate-dependent...    234   2e-69    
ref|XP_010110316.1|  Gibberellin 20 oxidase 1                           237   2e-69    
gb|AAL14696.1|  2-oxoglutarate-dependent dioxygenase                    233   3e-69    
gb|KFK30902.1|  hypothetical protein AALP_AA6G041000                    234   3e-69    
ref|XP_009771249.1|  PREDICTED: probable 2-oxoglutarate-dependent...    232   4e-69    
gb|AAL14700.1|  2-oxoglutarate-dependent dioxygenase                    232   5e-69    
emb|CDP11140.1|  unnamed protein product                                233   5e-69    
gb|KHG02339.1|  2'-deoxymugineic-acid 2'-dioxygenase                    233   6e-69    
ref|XP_009355432.1|  PREDICTED: probable 2-oxoglutarate-dependent...    233   8e-69    
ref|XP_009340685.1|  PREDICTED: probable inactive 2-oxoglutarate-...    232   1e-68    
ref|XP_009372418.1|  PREDICTED: probable inactive 2-oxoglutarate-...    232   1e-68    
ref|XP_010497228.1|  PREDICTED: probable 2-oxoglutarate-dependent...    233   1e-68    
ref|XP_010915540.1|  PREDICTED: probable 2-oxoglutarate-dependent...    233   1e-68    
gb|KGN52785.1|  hypothetical protein Csa_4G001530                       229   1e-68    
ref|XP_008346506.1|  PREDICTED: probable inactive 2-oxoglutarate-...    232   1e-68    
ref|XP_009355431.1|  PREDICTED: probable 2-oxoglutarate-dependent...    232   2e-68    
ref|XP_008238357.1|  PREDICTED: probable inactive 2-oxoglutarate-...    231   2e-68    
ref|XP_009373458.1|  PREDICTED: probable 2-oxoglutarate-dependent...    230   5e-68    
ref|XP_007211257.1|  hypothetical protein PRUPE_ppa021247mg             230   7e-68    
gb|KCW82770.1|  hypothetical protein EUGRSUZ_C04146                     231   7e-68    
ref|XP_008373535.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    229   8e-68    
gb|KCW79743.1|  hypothetical protein EUGRSUZ_C01086                     230   1e-67    
gb|EYU24677.1|  hypothetical protein MIMGU_mgv1a010266mg                230   1e-67    
gb|KHG17593.1|  2'-deoxymugineic-acid 2'-dioxygenase                    229   1e-67    
gb|AAL14684.1|  2-oxoglutarate-dependent dioxygenase                    228   1e-67    
gb|AAL14702.1|  2-oxoglutarate-dependent dioxygenase                    228   1e-67    
gb|AAL14680.1|  2-oxoglutarate-dependent dioxygenase                    228   1e-67    
gb|KHG09549.1|  Flavonol synthase/flavanone 3-hydroxylase               229   3e-67    
ref|XP_011019740.1|  PREDICTED: probable 2-oxoglutarate-dependent...    230   3e-67    
gb|AAL14692.1|  2-oxoglutarate-dependent dioxygenase                    227   3e-67    
gb|KGN45318.1|  hypothetical protein Csa_7G434950                       227   4e-67    
ref|XP_006354215.1|  PREDICTED: probable 2-oxoglutarate-dependent...    228   5e-67    
gb|KHG07058.1|  hypothetical protein F383_33647                         228   9e-67    
ref|XP_006304540.1|  hypothetical protein CARUB_v10011508mg             227   2e-66    
ref|XP_002309592.1|  hypothetical protein POPTR_0006s26410g             226   2e-66    
gb|KDP40826.1|  hypothetical protein JCGZ_24825                         226   2e-66    
gb|KDP32296.1|  hypothetical protein JCGZ_13221                         226   2e-66    
ref|XP_002284931.1|  PREDICTED: probable 2-oxoglutarate-dependent...    226   3e-66    
ref|XP_008356475.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    226   3e-66    
ref|XP_010112800.1|  Gibberellin 2-beta-dioxygenase 2                   228   3e-66    
ref|XP_009371875.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    226   4e-66    
ref|XP_008356477.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    225   5e-66    
gb|AAL14678.1|  2-oxoglutarate-dependent dioxygenase                    224   6e-66    
ref|XP_008373690.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    225   6e-66    
emb|CDY39112.1|  BnaA01g29440D                                          225   6e-66    
gb|KFK38900.1|  hypothetical protein AALP_AA3G175500                    225   7e-66    
emb|CDP12471.1|  unnamed protein product                                222   8e-66    
ref|XP_009116922.1|  PREDICTED: probable 2-oxoglutarate-dependent...    225   1e-65    
ref|XP_009342594.1|  PREDICTED: probable 2-oxoglutarate-dependent...    224   1e-65    
ref|XP_010050518.1|  PREDICTED: probable 2-oxoglutarate-dependent...    224   2e-65    
gb|KCW79744.1|  hypothetical protein EUGRSUZ_C01088                     223   4e-65    
gb|KCW82320.1|  hypothetical protein EUGRSUZ_C03724                     223   4e-65    
ref|XP_007162140.1|  hypothetical protein PHAVU_001G127500g             222   5e-65    
ref|XP_008243039.1|  PREDICTED: probable inactive 2-oxoglutarate-...    223   5e-65    
ref|XP_006406953.1|  hypothetical protein EUTSA_v10021144mg             223   6e-65    
ref|XP_010455020.1|  PREDICTED: probable 2-oxoglutarate-dependent...    222   7e-65    
ref|XP_007224725.1|  hypothetical protein PRUPE_ppa024900mg             222   9e-65    
gb|AAL14695.1|  2-oxoglutarate-dependent dioxygenase                    221   9e-65    
gb|KHG05318.1|  2'-deoxymugineic-acid 2'-dioxygenase                    222   1e-64    
ref|XP_010654922.1|  PREDICTED: probable inactive 2-oxoglutarate-...    219   2e-64    
gb|AAL14688.1|  2-oxoglutarate-dependent dioxygenase                    219   2e-64    
ref|XP_011026516.1|  PREDICTED: probable 2-oxoglutarate-dependent...    221   3e-64    
ref|XP_002515597.1|  Gibberellin 2-beta-dioxygenase, putative           221   3e-64    
gb|AAL14691.1|  2-oxoglutarate-dependent dioxygenase                    219   3e-64    
ref|XP_007013772.1|  2-oxoglutarate-dependent dioxygenase               221   3e-64    
gb|AAL14677.1|  2-oxoglutarate-dependent dioxygenase                    218   7e-64    
ref|XP_010112085.1|  Gibberellin 20 oxidase 1                           220   8e-64    
ref|XP_008219866.1|  PREDICTED: probable 2-oxoglutarate-dependent...    219   1e-63    
ref|XP_006450545.1|  hypothetical protein CICLE_v10010426mg             219   2e-63    
ref|XP_009146228.1|  PREDICTED: probable 2-oxoglutarate-dependent...    219   2e-63    
emb|CDY20137.1|  BnaA01g28650D                                          219   2e-63    
ref|XP_006476205.1|  PREDICTED: probable 2-oxoglutarate-dependent...    219   2e-63    
ref|XP_002324836.1|  hypothetical protein POPTR_0018s01190g             218   2e-63    
gb|KFK38898.1|  hypothetical protein AALP_AA3G175300                    218   3e-63    
gb|AAL14681.1|  2-oxoglutarate-dependent dioxygenase                    216   4e-63    
ref|XP_009115427.1|  PREDICTED: probable 2-oxoglutarate-dependent...    218   5e-63    
emb|CDP19782.1|  unnamed protein product                                214   5e-63    
ref|XP_006853001.1|  hypothetical protein AMTR_s00174p00019750          217   8e-63    
ref|XP_004253465.1|  PREDICTED: probable 2-oxoglutarate-dependent...    217   1e-62    
ref|XP_004228723.2|  PREDICTED: probable 2-oxoglutarate-dependent...    216   1e-62    
gb|KGN58142.1|  hypothetical protein Csa_3G555690                       214   1e-62    
ref|XP_003625061.1|  Gibberellin 20 oxidase                             213   2e-62    
gb|AAL14689.1|  2-oxoglutarate-dependent dioxygenase                    214   2e-62    
ref|XP_010481153.1|  PREDICTED: probable 2-oxoglutarate-dependent...    215   3e-62    
ref|XP_009382147.1|  PREDICTED: probable 2-oxoglutarate-dependent...    218   3e-62    
gb|EYU41035.1|  hypothetical protein MIMGU_mgv1a013300mg                213   3e-62    
ref|XP_010050512.1|  PREDICTED: probable 2-oxoglutarate-dependent...    218   4e-62    
ref|XP_010060704.1|  PREDICTED: probable inactive 2-oxoglutarate-...    215   5e-62    
ref|XP_010026663.1|  PREDICTED: probable 2-oxoglutarate-dependent...    213   5e-62    
gb|KCW67512.1|  hypothetical protein EUGRSUZ_F01241                     214   7e-62    
ref|XP_007203886.1|  hypothetical protein PRUPE_ppa008799mg             214   1e-61    
ref|NP_174124.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    214   1e-61    
ref|XP_004228709.1|  PREDICTED: probable inactive 2-oxoglutarate-...    214   1e-61    
ref|XP_010460572.1|  PREDICTED: probable 2-oxoglutarate-dependent...    214   2e-61    
ref|XP_002517545.1|  Leucoanthocyanidin dioxygenase, putative           214   2e-61    
gb|KDP37167.1|  hypothetical protein JCGZ_06223                         213   2e-61    
ref|XP_002298125.1|  hypothetical protein POPTR_0001s17610g             212   3e-61    
ref|XP_009373457.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    213   3e-61    
ref|XP_009146229.1|  PREDICTED: probable 2-oxoglutarate-dependent...    212   5e-61    
ref|XP_010478155.1|  PREDICTED: probable 2-oxoglutarate-dependent...    213   6e-61    
gb|KGN64234.1|  hypothetical protein Csa_1G044830                       210   6e-61    
emb|CDP19785.1|  unnamed protein product                                210   6e-61    
ref|XP_010499297.1|  PREDICTED: probable 2-oxoglutarate-dependent...    212   7e-61    
ref|XP_008366657.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    212   1e-60    
ref|XP_009395077.1|  PREDICTED: probable 2-oxoglutarate-dependent...    211   1e-60    
ref|XP_009377501.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    211   2e-60    
ref|XP_004287966.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    209   3e-60    
ref|XP_006354213.1|  PREDICTED: probable 2-oxoglutarate-dependent...    210   4e-60    
ref|XP_006655618.1|  PREDICTED: probable 2-oxoglutarate-dependent...    209   7e-60    
ref|XP_009372949.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    210   7e-60    
gb|KDP37165.1|  hypothetical protein JCGZ_06221                         209   7e-60    
gb|KEH28751.1|  2-oxoglutarate-dependent dioxygenase                    207   9e-60    
gb|AAL14694.1|  2-oxoglutarate-dependent dioxygenase                    207   1e-59    
ref|XP_008394038.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    209   1e-59    
emb|CDX97295.1|  BnaA02g20860D                                          207   2e-59    
emb|CDX91263.1|  BnaC02g26740D                                          206   6e-59    
ref|XP_007213118.1|  hypothetical protein PRUPE_ppa023886mg             205   1e-58    
ref|NP_175690.1|  2-oxoglutarate-dependent dioxygenase-related pr...    204   2e-58    
ref|XP_004963576.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    207   3e-58    
ref|XP_004292967.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    205   3e-58    
ref|XP_004291427.1|  PREDICTED: gibberellin 20 oxidase 1-B-like i...    204   7e-58    
emb|CDP22145.1|  unnamed protein product                                199   1e-57    
gb|KHG05299.1|  Gibberellin 2-beta-dioxygenase 8 -like protein          204   1e-57    
gb|KHN47795.1|  hypothetical protein glysoja_029213                     201   1e-57    
emb|CBI20990.3|  unnamed protein product                                201   2e-57    
emb|CDY53799.1|  BnaA06g01840D                                          202   2e-57    
gb|KHG18604.1|  hypothetical protein F383_26382                         202   3e-57    
ref|XP_007161252.1|  hypothetical protein PHAVU_001G054800g             202   4e-57    



>ref|XP_004241716.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
lycopersicum]
Length=317

 Score =   502 bits (1293),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 244/318 (77%), Positives = 273/318 (86%), Gaps = 4/318 (1%)
 Frame = -2

Query  1273  MGSLTPL-KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGSLT   KLPVIDFT E+++PGT+SW  A +E+V ALEEYGCFVALYDKVSS++H+ VF
Sbjct  1     MGSLTVTHKLPVIDFTMENLEPGTNSWSKASKEAVCALEEYGCFVALYDKVSSKIHDDVF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
             + L ELFDLPT  KV+NKS+KPLYGYVGQIP +PLYESMGID+ANTL+GIQ+FT  MWP 
Sbjct  61    QALEELFDLPTQKKVQNKSSKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWPN  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN+DFSEA+L YSK AAELEEMVV+MVFESYGVEKYYESH+KS  YLARVMKYREAQ  E
Sbjct  121   GNNDFSEALLAYSKAAAELEEMVVKMVFESYGVEKYYESHIKSVNYLARVMKYREAQVEE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
              KLGFV+HTDKSFMSTI+Q   +NGLEIK K+G  WF V LSPSSIVVMAGDAIMAWSNN
Sbjct  181   AKLGFVAHTDKSFMSTIHQTNQVNGLEIKGKDG-QWFKVELSPSSIVVMAGDAIMAWSNN  239

Query  556   RIKSPHHRVMM-EGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
             RIKSPHHRVMM E KG RYSIAQFSFME + M++TP ELVD DHPL F  F+HL YL FF
Sbjct  240   RIKSPHHRVMMGEEKGARYSIAQFSFMEDSLMVETPKELVDDDHPLLFNSFNHLDYLKFF  299

Query  382   SKEENRRLPCALKTYCGV  329
             SKEENRRL CALK+YCGV
Sbjct  300   SKEENRRLECALKSYCGV  317



>ref|XP_009799663.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana sylvestris]
Length=315

 Score =   498 bits (1283),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 240/317 (76%), Positives = 273/317 (86%), Gaps = 4/317 (1%)
 Frame = -2

Query  1273  MGSLTPL-KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             M SLT   KLP+IDFTKE+++PGT+SW    +E V ALEEYGCFVALYDK+S ++H  VF
Sbjct  1     MDSLTVFHKLPIIDFTKENLEPGTNSWFKVCKEVVCALEEYGCFVALYDKISLKIHNEVF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
             + L ELF+LPT  K++NKSTKPLYGYVGQIP +PLYESMGID+ANT++GIQ+F+  MWP 
Sbjct  61    QALEELFNLPTQTKIQNKSTKPLYGYVGQIPFIPLYESMGIDNANTIEGIQNFSNFMWPN  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN+ FSEA+L YSK AAE+EEMVVRMVFESYGVEKYYESH+KS  YLARVMKY+EAQ  E
Sbjct  121   GNNCFSEALLAYSKAAAEVEEMVVRMVFESYGVEKYYESHIKSVNYLARVMKYKEAQVQE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
             PKLGFV+HTDKSFMSTI+QN  +NGLEIK K+G  WFGV LSPSSIVVMAGDAIMAWSNN
Sbjct  181   PKLGFVAHTDKSFMSTIHQN-QVNGLEIKGKDG-QWFGVELSPSSIVVMAGDAIMAWSNN  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             RIKSPHHRVMMEGKG RYSIAQFSFME T M++TP ELVD +HPL+FK F+HL YL FFS
Sbjct  239   RIKSPHHRVMMEGKGERYSIAQFSFMEDTVMVETPEELVDEEHPLKFKSFNHLDYLHFFS  298

Query  379   KEENRRLPCALKTYCGV  329
             KEENRRL  ALKTYCGV
Sbjct  299   KEENRRLESALKTYCGV  315



>ref|XP_006356186.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
tuberosum]
Length=317

 Score =   494 bits (1271),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 240/318 (75%), Positives = 271/318 (85%), Gaps = 4/318 (1%)
 Frame = -2

Query  1273  MGSLT-PLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGSLT   KLPVIDFT E+++PGT+SW  A +E+V ALEEYGCFVALYDKVS  +H+ VF
Sbjct  1     MGSLTVSHKLPVIDFTMENLEPGTNSWSKASKEAVCALEEYGCFVALYDKVSLNIHDDVF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
             + L ELFDLPT  KV+NKS+KPLYGYVGQIP +PLYESMGID+ANTL+GIQ+FT  MWP 
Sbjct  61    QALEELFDLPTQKKVQNKSSKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWPN  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             G++DFS+A+L YSK +AELEEMVV+MVFESYGVEKYYESHVKS  YLARVMKYREAQ  E
Sbjct  121   GHNDFSQALLAYSKASAELEEMVVKMVFESYGVEKYYESHVKSVNYLARVMKYREAQVEE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
              KLGFV+HTDKSFMSTI+Q   +NGLEIK K+G  WFGV LSPSSIVVMAGDAIMAWSNN
Sbjct  181   AKLGFVAHTDKSFMSTIHQTNQVNGLEIKGKDG-QWFGVELSPSSIVVMAGDAIMAWSNN  239

Query  556   RIKSPHHRVMM-EGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
             RIKSPHHRVMM E KG RYSIAQFSFME + M++TP ELVD +HPL F  F+HL YL FF
Sbjct  240   RIKSPHHRVMMGEEKGARYSIAQFSFMEDSLMVETPKELVDEEHPLLFNSFNHLDYLKFF  299

Query  382   SKEENRRLPCALKTYCGV  329
             SKEENRRL CALK+YCG 
Sbjct  300   SKEENRRLECALKSYCGA  317



>ref|XP_009616143.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=315

 Score =   493 bits (1269),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 238/317 (75%), Positives = 270/317 (85%), Gaps = 4/317 (1%)
 Frame = -2

Query  1273  MGSLT-PLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             M SLT   KLP+IDFTKE+++PGT+SW    +E+V ALEEYGCFVAL DK+S ++H  VF
Sbjct  1     MDSLTVSHKLPIIDFTKENLEPGTNSWSKVCKEAVCALEEYGCFVALSDKISLKIHNEVF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
               L ++FDLP   K++NKSTKPLYGYVGQIP +PLYESMGID+ANTL+GIQ+FT  MW  
Sbjct  61    GALEKVFDLPIQTKIQNKSTKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWSS  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN+ FS+A+L YSK AAELEEMVVRMVFESYGVEK YESH+KS  YLARVMKY+EAQ  E
Sbjct  121   GNNAFSQALLAYSKAAAELEEMVVRMVFESYGVEKNYESHIKSVNYLARVMKYKEAQLEE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
             PKLGFV+HTDKSFMSTI+QN  +NGLEIK K+G  WFGV LSPSSIVVMAGDAIMAWSNN
Sbjct  181   PKLGFVAHTDKSFMSTIHQN-QVNGLEIKGKDG-QWFGVELSPSSIVVMAGDAIMAWSNN  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             RIKSPHHRVMMEGKG RYSIAQFSFME T M++TP E VD +HPL+FKPF+HL YL FFS
Sbjct  239   RIKSPHHRVMMEGKGERYSIAQFSFMEDTVMVETPKEFVDEEHPLKFKPFNHLDYLHFFS  298

Query  379   KEENRRLPCALKTYCGV  329
             KEENRRL CALKTYCGV
Sbjct  299   KEENRRLECALKTYCGV  315



>emb|CDO98090.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   487 bits (1253),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 231/315 (73%), Positives = 275/315 (87%), Gaps = 4/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSLT  KLP IDF+KED+KPGT +W+  R+E +SALEEYGCFVA Y+K+  ++ + VF 
Sbjct  1     MGSLTLHKLPTIDFSKEDLKPGTTAWIKIRKEVMSALEEYGCFVASYEKIP-QLQDAVFG  59

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP+ +K++NKS+KP++GYVGQIP+VPLYESMGID ANT +G+Q+FT  MWP G
Sbjct  60    ALEELFDLPSQIKMQNKSSKPMHGYVGQIPVVPLYESMGIDDANTSEGMQAFTYAMWPNG  119

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N+ FSE +L Y+KLAAELEE+VVRM+FESYGVEKYY++H++S  YL+RVMKYREA+ENE 
Sbjct  120   NEGFSEKLLAYTKLAAELEEIVVRMIFESYGVEKYYDNHLQSVGYLSRVMKYREAKENET  179

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLGFVSHTDKSFMSTI+QN  +NGLEIKAK+G ++F V LS SS+VVMAGDAIMAWSNNR
Sbjct  180   KLGFVSHTDKSFMSTIHQN-QVNGLEIKAKDG-EYFSVDLSRSSVVVMAGDAIMAWSNNR  237

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             IKSPHH+V+MEGKGPRYSIAQFSFM+ T +QTP ELVD +HPLQFKPFDHL YL FFSKE
Sbjct  238   IKSPHHQVIMEGKGPRYSIAQFSFMDGT-VQTPEELVDDEHPLQFKPFDHLEYLSFFSKE  296

Query  373   ENRRLPCALKTYCGV  329
             ENRRL CALKTYCGV
Sbjct  297   ENRRLECALKTYCGV  311



>ref|XP_011072310.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Sesamum indicum]
Length=314

 Score =   465 bits (1197),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 216/316 (68%), Positives = 269/316 (85%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSLT  KLPVI FT+E+ KPGT++W    R+ +SAL+EYGCFVA YD+++  +H  VF+
Sbjct  1     MGSLTLHKLPVIAFTEENSKPGTETWSKTCRQVISALQEYGCFVAAYDQITQRIHTGVFE  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFD+PT  KV+NKS KPLYGYVGQIP++PLYESMGID+ANTL+GIQSF K+MWP G
Sbjct  61    ALEELFDIPTERKVQNKSAKPLYGYVGQIPLIPLYESMGIDNANTLEGIQSFAKVMWPNG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND FSE +L+Y+KLAAELE++VV+MVFE YGV +YYESH+ SA YL RVM+YR+ +  E 
Sbjct  121   NDGFSEKLLLYTKLAAELEKIVVQMVFEGYGVGQYYESHISSANYLCRVMQYRQPKMQEN  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVH-LSPSSIVVMAGDAIMAWSNN  557
             ++GFVSHTDKSFMSTI+QN  ++GLEIKAK+G +WFGVH LSPSS+VVMAGDAIMAWSNN
Sbjct  181   RMGFVSHTDKSFMSTIHQN-QVDGLEIKAKDG-EWFGVHDLSPSSLVVMAGDAIMAWSNN  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI+SP HRV M+G   RYS+AQFSF+EK+M+QTP EL++ D+P Q+KPFDHL +L+F+SK
Sbjct  239   RIRSPPHRVTMQGNEARYSLAQFSFIEKSMVQTPQELINDDNPQQYKPFDHLKFLEFYSK  298

Query  376   EENRRLPCALKTYCGV  329
             EENRRL  A++TYCGV
Sbjct  299   EENRRLESAIRTYCGV  314



>gb|EYU21585.1| hypothetical protein MIMGU_mgv1a010381mg [Erythranthe guttata]
Length=314

 Score =   458 bits (1179),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 222/317 (70%), Positives = 264/317 (83%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLTPL-KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGSL+   KL VI+F+ +++KPGT+SW     E VSALE+YGCFVA YDK++ E H  VF
Sbjct  1     MGSLSQEHKLDVIEFSDKNLKPGTESWSKTCNEVVSALEKYGCFVASYDKLTQETHTTVF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
             K L ELFDLPT  KV+NKSTKPLYGYVGQIP +PLYESMGID+A+TLQGIQ+F K+MWP 
Sbjct  61    KALEELFDLPTQTKVQNKSTKPLYGYVGQIPFIPLYESMGIDNADTLQGIQNFAKVMWPN  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             G +DFSE ++ Y+KLAAELE++VVRMVFE YGV K+YES + SA YL RVMKYRE + NE
Sbjct  121   GYNDFSEKLVSYTKLAAELEKIVVRMVFERYGVGKHYESLIGSANYLCRVMKYREPKSNE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVH-LSPSSIVVMAGDAIMAWSN  560
               +GFVSHTDKSFMSTI+QN  ++GLEIK K+G DWFGVH LS SS++VMAGDAIMAWSN
Sbjct  181   NNMGFVSHTDKSFMSTIHQN-QVDGLEIKTKDG-DWFGVHQLSSSSVIVMAGDAIMAWSN  238

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             NRIKSPHHRV ME K  RYSIAQFSF+EKT ++ P ELVD DHP+Q+KPF+HL +LDF+S
Sbjct  239   NRIKSPHHRVTMEAKKARYSIAQFSFLEKT-VEIPQELVDEDHPMQYKPFEHLEFLDFYS  297

Query  379   KEENRRLPCALKTYCGV  329
             KEENRRL  A++TYCGV
Sbjct  298   KEENRRLESAIRTYCGV  314



>gb|AFC36356.1| 2-oxoglutarate-dependent dioxygenase [Salvia miltiorrhiza]
Length=316

 Score =   439 bits (1128),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 211/316 (67%), Positives = 256/316 (81%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  KL VI+FT ++  P T+SW    ++ V ALEEYGCFVA+YDK++ E+H++ F 
Sbjct  1     MGSETVHKLGVIEFTDKNTNPETESWSETCKKVVDALEEYGCFVAVYDKLTHEIHKQAFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L +LFDLPT  KV+NKS+KPLYGYVGQIP +PLYESMGID A+T+QGIQ+F+ +MW  G
Sbjct  61    SLQQLFDLPTQTKVQNKSSKPLYGYVGQIPFLPLYESMGIDDAHTIQGIQNFSNVMWHNG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F E ++VY+KLAAE+E + VRMV ESYGV K+Y+S+V+SA YL RVMKYRE +  E 
Sbjct  121   NPAFDENLVVYTKLAAEVERIAVRMVCESYGVGKHYDSYVESANYLCRVMKYREPKIGEN  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGV-HLSPSSIVVMAGDAIMAWSNN  557
             K+ FV+HTDKSFMSTI+QN  ++GL+IKAK+G +WF V HLSPSSI+VMAGDAIMAWSN 
Sbjct  181   KMAFVTHTDKSFMSTIHQN-QVDGLQIKAKDG-EWFTVHHLSPSSIIVMAGDAIMAWSNK  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RIKSPHHRV MEG   RYSIAQFSFMEK M+ TP E VD DHPLQ+KPFDHL +LDFFS+
Sbjct  239   RIKSPHHRVTMEGNEARYSIAQFSFMEKDMVATPDEFVDEDHPLQYKPFDHLKFLDFFSQ  298

Query  376   EENRRLPCALKTYCGV  329
             EENRRL  A+ TYCGV
Sbjct  299   EENRRLESAITTYCGV  314



>emb|CDP17011.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   380 bits (975),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 227/315 (72%), Gaps = 2/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL   KLPVIDFTK+++ PG+ SW++ R+  V ALEEYGCF+ALYDKVS E+HE +F+
Sbjct  1     MGSLAQHKLPVIDFTKKNLDPGSSSWLSTRQAVVGALEEYGCFIALYDKVSLELHEAIFR  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LFDLPT  K+ N   KP  GYVGQ P  PLYES+GID A ++ G+Q FT LMWP G
Sbjct  61    ASEDLFDLPTETKLLNTCHKPAPGYVGQNPRFPLYESLGIDDATSIDGVQKFTTLMWPNG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E+   YSKL AEL++MV+RMV E+YGVEK YE+ + S  YL R++KYRE QENE 
Sbjct  121   NDSFCESASSYSKLVAELDQMVMRMVSETYGVEKSYETLLGSTSYLLRLIKYREPQENET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              LG V HTDKSFMS I Q   + GLEIK K+G  W  +   PSS ++MAG+A MAW+N R
Sbjct  181   NLGIVPHTDKSFMS-ILQQHQVKGLEIKTKDG-RWMEIDPFPSSFIIMAGEAFMAWTNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I++PHHRV+M G   RYS+  F+F+   +IQ P ELVD +HPLQFKPFDH  +  F + E
Sbjct  239   IEAPHHRVIMPGNAERYSVGLFTFIWDLLIQVPEELVDVEHPLQFKPFDHHKFHQFHTTE  298

Query  373   ENRRLPCALKTYCGV  329
             E  R  CA+K+YCGV
Sbjct  299   EGMRSKCAIKSYCGV  313



>ref|XP_010110322.1| Gibberellin 20 oxidase 1 [Morus notabilis]
 gb|EXC25842.1| Gibberellin 20 oxidase 1 [Morus notabilis]
Length=372

 Score =   372 bits (956),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 231/306 (75%), Gaps = 3/306 (1%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             KLPV+DF+KE +KPGT SW  AR++   A EEYGCF+  Y+ +S E+   +F  L ELFD
Sbjct  9     KLPVLDFSKETLKPGTKSWELARKDVQRAFEEYGCFLVTYEAISCELRNAMFGALEELFD  68

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LPT  K++NK  KPL GYVGQ P+VPL+ES+GID+A   +GIQSFT L+WP GND FSE+
Sbjct  69    LPTETKMKNKYEKPLNGYVGQNPVVPLHESLGIDNATAKEGIQSFTNLLWPVGNDRFSES  128

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
                ++KLAAE++++V RM+FESY +EKYYE+++ S  YL R++K+   Q N+P+LGFV+H
Sbjct  129   AHSFAKLAAEIDQIVTRMIFESYSLEKYYEAYIGSITYLLRLLKHNAPQGNDPQLGFVAH  188

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TDKSF + ++QN H+N LE++ KNG DW  V LSPSS VV AGDA+MAWSN+RI SP HR
Sbjct  189   TDKSFTTILHQN-HVNALEVETKNG-DWIKVELSPSSFVVFAGDALMAWSNDRIVSPKHR  246

Query  532   VMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPC  353
             V++ G   RYS+AQFSF +  M++ P ELVD  HPL++KPF+HL +L FF++   +RL C
Sbjct  247   VVVSGNEDRYSLAQFSFGDG-MVEVPEELVDEQHPLKYKPFNHLGFLGFFAENAYKRLEC  305

Query  352   ALKTYC  335
              +K YC
Sbjct  306   PIKAYC  311



>ref|XP_007217562.1| hypothetical protein PRUPE_ppa021035mg [Prunus persica]
 gb|EMJ18761.1| hypothetical protein PRUPE_ppa021035mg [Prunus persica]
Length=313

 Score =   369 bits (948),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 177/315 (56%), Positives = 225/315 (71%), Gaps = 2/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS    KLPV+DF+KE +KPGT+ W++  ++   ALEE+GCFVALYDK+S E       
Sbjct  1     MGSEGQPKLPVLDFSKEALKPGTNPWLSVCKDVRQALEEFGCFVALYDKISPEFRNAFLG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLPT  K+ NK  KPL GYVGQIP +PL+ES+GID+A  L+  Q FTKLMWP G
Sbjct  61    ALQELFDLPTRTKMTNKYEKPLNGYVGQIPKLPLHESLGIDNATNLEETQKFTKLMWPGG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E+   ++K+A EL++MV RM+FESYGVEKYYES+V S  YL R++K R  QENEP
Sbjct  121   NDKFCESAYSFAKVAEELDQMVTRMIFESYGVEKYYESYVGSISYLLRLLKNRSPQENEP  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              LGFV+HTDKSF + +YQN H+N LE++ ++  +W  V   PSS +VMAGDA+MAWSN+R
Sbjct  181   SLGFVAHTDKSFTTILYQNNHVNALEVETRS-HEWIRVEFPPSSFIVMAGDALMAWSNDR  239

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I SP+HRV+M G   RYS+AQFSF +   I  P EL D +HPL++K FDH   L FF  +
Sbjct  240   ILSPNHRVIMSGNETRYSLAQFSFSDGE-IHVPEELADEEHPLRYKSFDHPGLLRFFRND  298

Query  373   ENRRLPCALKTYCGV  329
             +      A+K YCGV
Sbjct  299   DRFNSNSAIKAYCGV  313



>ref|XP_008228622.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Prunus 
mume]
Length=312

 Score =   365 bits (936),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 224/315 (71%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS    KLPV+DF+KE +KPGT+SW+ A ++   ALEE+GCFV LYDK+S E       
Sbjct  1     MGSEGQPKLPVLDFSKEALKPGTNSWLLACKDVRQALEEFGCFVVLYDKISPEFRNAFLV  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLPT  K+ NK  KPL GYVGQIP +PL+ES+GID+A  L   Q FTKLMWP G
Sbjct  61    ALQELFDLPTQTKMTNKYEKPLNGYVGQIPKLPLHESLGIDNATKLVETQKFTKLMWPGG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E+   ++K+A EL++MV RM+FESYGVEKYYES+V S  YL R++K R  QENEP
Sbjct  121   NDKFCESAYSFAKVAEELDQMVTRMIFESYGVEKYYESYVGSISYLLRLLKNRSPQENEP  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              LGFV+HTDKSF + +YQN H+N LE++ ++  +W  V   PSS +VMAGDA+MAWSN+R
Sbjct  181   SLGFVAHTDKSFTTILYQN-HVNALEVETRS-HEWIRVEFPPSSFIVMAGDALMAWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I SP+HRV+M G   RYS+AQFSF +   I  P EL D +HPL++K FDH   L FF  +
Sbjct  239   ILSPNHRVIMSGNETRYSLAQFSFSDGA-IHVPEELADEEHPLRYKSFDHPGLLRFFRSD  297

Query  373   ENRRLPCALKTYCGV  329
             +      A+K YCGV
Sbjct  298   DRFNSNSAIKAYCGV  312



>emb|CDP10326.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   363 bits (932),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 224/315 (71%), Gaps = 2/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M SLT   LPVIDFTK+++ P +  W + R+  V ALE+YGCF+ALYD+V+ E++E +F+
Sbjct  1     MCSLTQNYLPVIDFTKKNLDPSSSFWPSTRQAVVRALEDYGCFIALYDEVTLELNEAIFR  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELFDLPT +KV N S  P +GYVGQ PI+PLYE +GI++A TL G++ FT L+WP G
Sbjct  61    ASEELFDLPTEIKVLNTSNTPSHGYVGQEPIIPLYEGLGIENATTLDGVEKFTNLLWPNG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FSE    YSK+ AEL++MV+RMV E+YG+EK YES + S  YL R++KYR   ENE 
Sbjct  121   NHSFSETAFSYSKIVAELDQMVMRMVSEAYGIEKNYESLLGSMSYLLRLIKYRRPHENEK  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              LG V HTDKSFMS + Q+  + GLEIK K+G +W  +  SP S +VMAGD  MAW+N R
Sbjct  181   NLGIVPHTDKSFMSILQQD-QVKGLEIKTKDG-EWMVIDPSPFSFIVMAGDVCMAWTNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I+ PHHRV+M     RYS+  F+F+   ++Q P ELVD +HPLQFKPFDH  Y+D++  +
Sbjct  239   IEPPHHRVVMTENAERYSLGLFTFIRDLIVQVPEELVDDEHPLQFKPFDHYKYIDYYYTD  298

Query  373   ENRRLPCALKTYCGV  329
             E +R  C ++ YCGV
Sbjct  299   EGKRSKCPIRDYCGV  313



>ref|XP_011072311.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Sesamum indicum]
Length=314

 Score =   362 bits (928),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 233/317 (74%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL   +L VID + E +K G+ SW +A ++   ALE +GCF+ALYDK+S ++H  +F+
Sbjct  1     MGSLNLPELVVIDLSNEGLKAGSSSWSSACKDIRQALENHGCFIALYDKISPQLHRSIFQ  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LFDLPT VKV+N + KP +GYVGQ+PIVPL+E +GID+A TL+G QSFTKLMWP G
Sbjct  61    AADQLFDLPTEVKVQNINEKPYHGYVGQMPIVPLHEGLGIDYATTLEGAQSFTKLMWPDG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E  + ++K  A++E++ VR++FESYGV+KY +SHV++  YL R +KYR  +E E 
Sbjct  121   NDSFCETAMSFAKTVADIEKIAVRLLFESYGVQKYTDSHVEATTYLLRFLKYRAPEEGES  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
                F SHTDKSF + ++QN HI+GLE++A+NG +W  V   PSS VVMAGDA  AWSNNR
Sbjct  181   NNAFPSHTDKSFFTVLHQN-HISGLEVRARNG-EWINVVFPPSSFVVMAGDACQAWSNNR  238

Query  553   IKSPHHRVMME--GKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             + SP+H+V ++  GK  RY++AQFSF+ K M++ P ELVD +HPLQFKPF H+  L+F++
Sbjct  239   VLSPNHKVSLDKNGKETRYTMAQFSFLSK-MVEVPEELVDDEHPLQFKPFAHVDLLNFYA  297

Query  379   KEENRRLPCALKTYCGV  329
              +  RR    LK +CGV
Sbjct  298   TDHGRRSQNILKDFCGV  314



>ref|XP_002298127.1| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE82932.1| oxidoreductase family protein [Populus trichocarpa]
Length=313

 Score =   361 bits (926),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/310 (57%), Positives = 226/310 (73%), Gaps = 3/310 (1%)
 Frame = -2

Query  1258  PLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVEL  1079
             P KLP++DF KED+KPGT SW+ A  +   ALEEYGCFV  Y+++  E+ ++VF  L EL
Sbjct  7     PSKLPILDFAKEDLKPGTSSWLKACSDVRLALEEYGCFVVEYNRLPLELRDKVFGVLKEL  66

Query  1078  FDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFS  899
             FDLPT  K++NK  KPL GYVGQI  +PL+ESMGID+A +L   Q+FT LMWP GND F 
Sbjct  67    FDLPTETKMQNKYEKPLNGYVGQIAKLPLHESMGIDNATSLDATQNFTDLMWPNGNDRFC  126

Query  898   EAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFV  719
             E +L Y+ LAAEL+ MV RMVFESYGVEKY++S+V+S  YL R++K R  + +E  LGFV
Sbjct  127   ECVLKYANLAAELDRMVTRMVFESYGVEKYHDSYVESTTYLLRLLKNRPPKVDEHNLGFV  186

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
             +HTDKSF + ++QN  INGLE+  K+G     V LSPSS VV+AGDA+MAWSN+R+ SP 
Sbjct  187   THTDKSFTTILHQN-EINGLEVDTKDGKK-INVELSPSSFVVIAGDALMAWSNDRVISPS  244

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             HRV+M GK  RYS+A F+F  K ++Q P ELVD +HPL +KP DH+  L F+  EE  + 
Sbjct  245   HRVIMNGKIDRYSLALFAF-NKGILQVPEELVDEEHPLMYKPLDHIGLLHFYRTEEGYKS  303

Query  358   PCALKTYCGV  329
              C +K YCGV
Sbjct  304   KCPIKAYCGV  313



>ref|XP_011045371.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=313

 Score =   360 bits (923),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 224/310 (72%), Gaps = 3/310 (1%)
 Frame = -2

Query  1258  PLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVEL  1079
             P KLP++DF KED+KPGT SW+ A  +   ALEEYGCFV  Y+++  E+ ++VF  L EL
Sbjct  7     PSKLPILDFAKEDLKPGTSSWLKACSDVTLALEEYGCFVVEYNRLPLELRDKVFGVLKEL  66

Query  1078  FDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFS  899
             FDLPT  K++NK  KPL GYVGQI  +PL+ESMGID+A +L   Q+FT LMWP GND F 
Sbjct  67    FDLPTETKMQNKYQKPLNGYVGQIAKLPLHESMGIDNATSLDATQNFTDLMWPNGNDRFC  126

Query  898   EAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFV  719
             E +  Y+ LAAEL+ MV RMVFESYGVEKY++S+V+S  YL R++K R  + +E  LGF+
Sbjct  127   EYVFKYANLAAELDRMVTRMVFESYGVEKYHDSYVESTTYLLRLLKNRPPKVDEHNLGFI  186

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
             +HTDKSF + ++QN  INGLE+  K+G     V LSPSS VV+AGDA+MAWSN+R+ SP 
Sbjct  187   THTDKSFTTILHQN-EINGLEVDTKDGKK-INVELSPSSFVVIAGDALMAWSNDRVISPS  244

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             HRV+M GK  RYS+A F+F  K +IQ P ELVD +HPL +KP DH   L F+  EE  + 
Sbjct  245   HRVIMNGKRDRYSLALFAF-NKGIIQVPEELVDEEHPLMYKPLDHTGLLHFYRTEEGYKS  303

Query  358   PCALKTYCGV  329
              C +K YCGV
Sbjct  304   KCPIKAYCGV  313



>ref|XP_007024003.1| 2-oxoglutarate-dependent dioxygenase [Theobroma cacao]
 gb|EOY26625.1| 2-oxoglutarate-dependent dioxygenase [Theobroma cacao]
Length=313

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 231/316 (73%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS +   +P +DF+ ED+KPGTD+W+ A ++   ALEEYGCF+  Y+K   E+H +VF 
Sbjct  1     MGSESSPNVPFLDFSDEDLKPGTDTWLLACKKVRQALEEYGCFILEYNKFPLELHNQVFA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLPT  K++N+  KPL GYVGQIP +PL+ESMGID+ANTL+G + FT LMWPQG
Sbjct  61    VLEELFDLPTETKMKNRYEKPLNGYVGQIPKLPLHESMGIDNANTLEGTRFFTNLMWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E +  Y+K+AAEL++MV RM+FESYG++KY ++++ +  YL R++K R  +ENEP
Sbjct  121   NDRFCEYIYKYAKVAAELDQMVTRMIFESYGLDKYSDAYIDTTTYLLRLLKNRAPRENEP  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIVVMAGDAIMAWSNN  557
              LGF++HTDKSF + ++QN  +N LE++ ++G  W  V   SPSS VV+AGDA+MAWSN+
Sbjct  181   NLGFITHTDKSFTTILHQN-QVNALEVETRDG-TWIDVDFSSPSSFVVIAGDALMAWSND  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             R+ SP HRV+M G   RYS+  F+F   T IQ P ELVD +HPL++K F+HL  L F+  
Sbjct  239   RVLSPSHRVVMRGNMDRYSLGLFAFNSGT-IQVPEELVDEEHPLKYKAFEHLGLLRFYRT  297

Query  376   EENRRLPCALKTYCGV  329
             ++  +  C +K YCGV
Sbjct  298   DKGYKSKCPIKAYCGV  313



>emb|CAN77851.1| hypothetical protein VITISV_030994 [Vitis vinifera]
Length=317

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/317 (52%), Positives = 226/317 (71%), Gaps = 3/317 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS +  K+PV+DF+KE++ PG+ SW A  ++ + ALEE+GCF+A+YDKV SE+  ++F 
Sbjct  1     MGSHSSAKIPVVDFSKENLNPGSSSWSATCKDVLLALEEFGCFIAVYDKVPSELQNKLFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELF+LPT  K++N   KP +GYVGQ   +PL+ES+GID+A TL+G QSF  LMWP G
Sbjct  61    ALEELFNLPTETKMQNAHNKPYHGYVGQHSXLPLHESIGIDNATTLEGXQSFANLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E    +SK+A EL+ +V +M+FESYGV KYY+SH++   YL RV+K++  +  EP
Sbjct  121   NDHFCEITREFSKIALELDHLVTKMIFESYGVGKYYDSHLEPMSYLLRVLKHKAPKVKEP  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              LGF  HTDKSF++ +YQN  + GLE++ K+G +W  + LSPSS  V+AGDA++AWSN R
Sbjct  181   NLGFARHTDKSFITVLYQN-QVKGLEVETKDG-EWISLELSPSSFAVIAGDALVAWSNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             + SP+H+VMM G   RYS+  F F    MIQ P EL D +HPLQFK FDHL  L FF  E
Sbjct  239   LHSPYHKVMMSGNEERYSLGLFQF-SSGMIQIPEELGDDEHPLQFKSFDHLGLLRFFHTE  297

Query  373   ENRRLPCALKTYCGV*P  323
             E ++    +K+YCG+ P
Sbjct  298   EGQKSKSLIKSYCGIQP  314



>ref|XP_009339602.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2 [Pyrus x 
bretschneideri]
Length=313

 Score =   355 bits (912),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 222/315 (70%), Gaps = 2/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS    KLPV+DF+KE +KPGT+SW+ A  +   ALEE+GCFV LYDK+S E    + +
Sbjct  1     MGSEVEQKLPVLDFSKEALKPGTNSWLLACNDVQQALEEFGCFVVLYDKISDEFRNALLR  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLPT  K+ NK  KPL GYVGQIP +PL+ES+GID+A   +  Q FTKLMWP G
Sbjct  61    SLEELFDLPTETKMTNKYEKPLNGYVGQIPKLPLHESLGIDNATNFEETQKFTKLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F EA   ++K+A EL++MV RM+F+SYGVEKYY+S+V S  YL R+++ R  +ENE 
Sbjct  121   NDKFCEAAYAFAKVAEELDQMVARMIFQSYGVEKYYDSYVGSISYLLRILQNRSPKENEH  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              LGFV+HTDKSF + +YQN  ++ LE++ +N  +W  V   PSS +VMAGDA+MAWSN+R
Sbjct  181   NLGFVAHTDKSFTTVLYQNNQVHALEVETRN-HEWIKVEFPPSSFIVMAGDALMAWSNDR  239

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I SP+HRV+M G   RYS+AQF+F +   I  P EL + + PL++K FDH   L FF  +
Sbjct  240   ILSPNHRVIMSGNETRYSLAQFAFSDGE-IHVPEELGNEERPLRYKSFDHPGLLRFFRSQ  298

Query  373   ENRRLPCALKTYCGV  329
             +      A+K YCGV
Sbjct  299   DGYISNSAIKAYCGV  313



>ref|XP_002284974.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36203.3| unnamed protein product [Vitis vinifera]
Length=311

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 226/315 (72%), Gaps = 4/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS  P +LPV++F+   +KPGT SW+ A ++ + ALEEYGCFVA+YDKVSSE+    F 
Sbjct  1     MGSEAP-RLPVLNFSTGTLKPGTRSWLLACKDVLHALEEYGCFVAVYDKVSSELDNTTFC  59

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLPT  KV+N S KP +GY+GQ P++PL+ESMGI+ A TL+G++SFT +MWP G
Sbjct  60    QLEELFDLPTETKVKNTSDKPYFGYIGQHPLIPLHESMGIEDATTLKGVESFTNIMWPAG  119

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E +L YSKL +ELE+MV +MVFESY  EKYY+SH++S  YL R++KYR  Q+NE 
Sbjct  120   NDHFCETVLSYSKLVSELEQMVKKMVFESYDAEKYYDSHIQSTTYLLRLIKYRGPQKNET  179

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              +G   HTDKSF++ ++QN  + GLEI+ K+G +W     SPSS VVMAGDA++AWSN R
Sbjct  180   CIGTSCHTDKSFITVLHQN-EVCGLEIRTKDG-EWISFKPSPSSYVVMAGDALLAWSNGR  237

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I SP HRV+M G   RYSI  F++  + +I+ P EL D +HPLQFKPF+H   L F+   
Sbjct  238   IHSPEHRVIMNGNKARYSIGLFAY-HRGIIEIPEELADEEHPLQFKPFNHYGLLHFYFTN  296

Query  373   ENRRLPCALKTYCGV  329
             +  +     K YCGV
Sbjct  297   KAGQAESTAKAYCGV  311



>ref|XP_002284983.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Vitis vinifera]
Length=313

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 224/315 (71%), Gaps = 2/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  KLP+IDF++E++KPG+DSW +   +   ALEEYGCF+A Y++V  E+H ++F 
Sbjct  1     MGSETHPKLPIIDFSEENLKPGSDSWFSVCHDVRHALEEYGCFMAYYNQVPLELHNKIFN  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLPT +KV+N S KP +GY+GQIP  PL+ESMGIDHA  L+ IQSF KLMWP G
Sbjct  61    ALGELFDLPTEIKVKNTSDKPSHGYIGQIPAYPLHESMGIDHATNLEEIQSFAKLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N+ F E +  Y+ L AELE++V+RMV +SYG+EKY++SH+ S  YL R +K R  + NE 
Sbjct  121   NEHFCEVVHSYTSLLAELEQVVMRMVLQSYGIEKYFDSHIASTRYLLRCLKNRVPKMNEN  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              + F +H+DKSFM+ + QN H++GLE+  K+G        SPS  +V+AGDA MAWSN R
Sbjct  181   DIAFPTHSDKSFMTILQQN-HVSGLEVDTKDGKSIGFGPPSPSVFIVIAGDAFMAWSNGR  239

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I  P HRV+M     RYS+A F+F +  MI+ P ELVD  HPLQFKPFDH+ ++ FF  E
Sbjct  240   IHPPKHRVIMRANEERYSLALFAF-KNGMIKVPEELVDDKHPLQFKPFDHVGFIRFFHTE  298

Query  373   ENRRLPCALKTYCGV  329
             E R+   A+K YCG+
Sbjct  299   EGRKSNSAIKAYCGI  313



>emb|CAN80139.1| hypothetical protein VITISV_028513 [Vitis vinifera]
Length=311

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 226/315 (72%), Gaps = 4/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS  P +LPV++F+   +KPGT SW+ A ++ + ALEEYGCFVA+YDKVSSE+    F 
Sbjct  1     MGSEAP-RLPVLNFSTGTLKPGTRSWLLACKDVLHALEEYGCFVAVYDKVSSELDNTTFC  59

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLPT  KV+N S KP +GY+GQ P++PL+ESMGI+ A TL+G++SFT +MWP G
Sbjct  60    QLEELFDLPTETKVKNTSDKPYFGYIGQHPLIPLHESMGIEDATTLKGVESFTNIMWPAG  119

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E +L YSKL +ELE+MV +MVFESY  EKYY+SH++S  YL R++KYR  Q+NE 
Sbjct  120   NDHFCETVLSYSKLVSELEQMVKKMVFESYDAEKYYDSHIQSTTYLLRLIKYRGPQKNET  179

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              +G   HTDKSF++ ++QN  + GLEI+ K+G +W     SPSS VVMAGDA++AWSN R
Sbjct  180   CIGTSCHTDKSFITVLHQN-EVCGLEIRTKDG-EWISFKPSPSSYVVMAGDALLAWSNGR  237

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I SP HRV+M G   RYSI  F++  + +I+ P EL D +HPLQFKPF+H   L F+   
Sbjct  238   IHSPEHRVIMNGNKARYSIGLFAY-HRGIIEIPEELADEEHPLQFKPFNHYGLLHFYFTN  296

Query  373   ENRRLPCALKTYCGV  329
             +  +     K YCGV
Sbjct  297   KAGQTESTAKAYCGV  311



>gb|KDP37163.1| hypothetical protein JCGZ_06219 [Jatropha curcas]
Length=312

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/315 (54%), Positives = 225/315 (71%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS+   KLPV+DFT+E++KPG+  WV    E   ALEEYGCF+  Y+K+S E+   VF 
Sbjct  1     MGSVLAPKLPVLDFTQENLKPGSSFWVKTCSEVRQALEEYGCFIVKYNKLSPELRNSVFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L +LFDLPT  K++NK  KPL GYVGQIP +PL+ES+GID+A +L+ + SFTKLMWP G
Sbjct  61    ALKDLFDLPTETKMQNKYVKPLNGYVGQIPKIPLHESLGIDNATSLEALLSFTKLMWPDG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FSE +  Y+KLAAEL+ MV RMVFESYGVEK ++S++ S  YL R++K R  + +EP
Sbjct  121   NLRFSEPIFEYAKLAAELDYMVTRMVFESYGVEKLHDSYIGSTTYLLRLLKNRVPKGDEP  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              LGF++HTDKSF + ++QN  ++GLE+  ++G+    V  SPSS VV+AGDA+MAWSN+R
Sbjct  181   NLGFITHTDKSFTTILHQN-QVDGLEVDTRDGEKIM-VEFSPSSFVVIAGDALMAWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I SP HRVMM GK  RYS   F+F     IQ P ELVD +HPL +KP DH+  L F+  +
Sbjct  239   IMSPSHRVMMNGKVDRYSTGLFAF-NSGKIQVPQELVDEEHPLMYKPLDHIGLLYFYRTD  297

Query  373   ENRRLPCALKTYCGV  329
             E  +  C +K YCG+
Sbjct  298   EGYKSKCPVKAYCGI  312



>ref|XP_002280670.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36208.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/317 (52%), Positives = 227/317 (72%), Gaps = 3/317 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS +  K+PV+DF+KE++ PG+ SW A  ++ + ALEE+GCF+A+YDKV SE+  ++F 
Sbjct  1     MGSHSSAKIPVVDFSKENLNPGSSSWSATCKDVLLALEEFGCFIAVYDKVPSELQNKLFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELF+LPT  K++N   KP +GYVGQ   +PL+ES+GID+A TL+G+QSF  LMWP G
Sbjct  61    ALEELFNLPTETKMQNAHNKPYHGYVGQHSRLPLHESIGIDNATTLEGMQSFANLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E    +SK+A EL+ +V +M+FESYGV KYY+SH++   YL RV+K++  +  EP
Sbjct  121   NDHFCEITREFSKIALELDHLVTKMIFESYGVGKYYDSHLEPMSYLLRVLKHKAPKVKEP  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              LGF  HTDKSF++ +YQN  + GLE++ K+G +W  + LSPSS  V+AGDA++AWSN R
Sbjct  181   NLGFARHTDKSFITVLYQN-QVKGLEVETKDG-EWISLELSPSSFAVIAGDALVAWSNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             + SP+H+VMM G   RYS+  F F    MIQ P EL D +HPLQFK F+HL  L FF  E
Sbjct  239   LHSPYHKVMMSGNEERYSLGLFQF-SSGMIQIPEELGDDEHPLQFKSFNHLGLLRFFHTE  297

Query  373   ENRRLPCALKTYCGV*P  323
             E ++    +K+YCG+ P
Sbjct  298   EGQKSKSLIKSYCGIQP  314



>ref|XP_011072270.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Sesamum indicum]
Length=313

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/315 (52%), Positives = 222/315 (70%), Gaps = 2/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL    LP I F+ ++++PG+ +W++  ++ V ALE+YGCF A Y K S  +H+ +F+
Sbjct  1     MGSLVNPTLPTIHFSGKNLEPGSTAWMSTSKDVVRALEDYGCFAATYSKFSLGMHKAIFR  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELFDLPTNVKV+N S  P +GYVGQ PI+PLYE +GI++A T +G++ FT L+WP G
Sbjct  61    CSEELFDLPTNVKVQNTSDTPSHGYVGQEPIIPLYEGLGIENATTREGVKKFTNLLWPSG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E  L YS+L AEL+++V+RMV ESYG+E  YES + +  YL R++KYR+ ++ E 
Sbjct  121   NDRFCETALEYSRLVAELDQVVMRMVSESYGIESSYESLLGATSYLLRIIKYRKPEKGEN  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              LG V HTDKSFM+ I+Q C +NGLEIK K+G DW  V  SPSS +VMAGDA M W+N R
Sbjct  181   GLGIVPHTDKSFMTIIHQ-CQVNGLEIKTKDG-DWITVDPSPSSFIVMAGDACMGWTNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I+   HRV+++G   RYS+  F+F+    IQ P ELVD  HP QFKPFDH  ++ F+  E
Sbjct  239   IEPSIHRVIIKGSEERYSLGLFTFIRDLKIQVPEELVDDHHPAQFKPFDHYKFIHFYYTE  298

Query  373   ENRRLPCALKTYCGV  329
             E R+  C L+ YCGV
Sbjct  299   EGRKSNCPLRAYCGV  313



>ref|XP_008377591.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2 [Malus domestica]
Length=313

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 219/315 (70%), Gaps = 2/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS    KLPV+DF+KE +KPGT+SW+ A ++   ALEE+GCFV LYDK+S E       
Sbjct  1     MGSEVEQKLPVLDFSKEALKPGTNSWLLACKDVQRALEEFGCFVVLYDKISDEFRNAFVG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLPT  K+ NK  KPL GYVGQIP +PL+ES+GID A   +  + FTKLMWP G
Sbjct  61    SLEELFDLPTETKMTNKYEKPLNGYVGQIPKLPLHESLGIDCATNFEETKKFTKLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E    ++K+A EL++MV RM+FESYGVEKYY+S+V S  YL R+++ R  +ENE 
Sbjct  121   NDKFCERAYAFAKVAEELDQMVARMIFESYGVEKYYDSYVGSISYLLRILQNRSPKENEH  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              LGFV+HTDKSF + +YQN  +N LE++ +N  +W  V   PSS +VMAGDA+MAWSN+R
Sbjct  181   NLGFVAHTDKSFTTVLYQNNQVNALEVETRN-HEWIKVEFPPSSFIVMAGDALMAWSNDR  239

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I SP+HRV+M G   RYS+AQF+F +   I  P EL D + PL++K FDH   L FF  +
Sbjct  240   ILSPNHRVIMSGNETRYSLAQFAFSDGE-IHVPEELGDEERPLRYKSFDHPGLLRFFRSQ  298

Query  373   ENRRLPCALKTYCGV  329
             +      A+K YCGV
Sbjct  299   DRYISNSAIKAYCGV  313



>ref|XP_010033904.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Eucalyptus 
grandis]
 gb|KCW53770.1| hypothetical protein EUGRSUZ_J03023 [Eucalyptus grandis]
Length=318

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 232/316 (73%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKV-SSEVHERVF  1097
             MGS    KLP+++F+ E++KPGT SWVA  +E + ALEE+G FV  YD+V  S+VH+  F
Sbjct  1     MGSEGSPKLPILNFSSENLKPGTTSWVATCKEVIQALEEFGFFVVNYDEVIPSQVHDATF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
             + L ELF LPT  K++N+  KPL GYVGQI  +PL+ES+GID A +L+  Q FT LMWP 
Sbjct  61    RVLHELFALPTETKMKNRYQKPLNGYVGQIAKLPLHESLGIDDATSLEATQKFTDLMWPD  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN+ F + M  ++KLAAEL+++V RM+FESY  EK+Y+S+++S  YL R++K R   ENE
Sbjct  121   GNNRFRDIMNSFAKLAAELDQIVTRMIFESYNSEKHYDSYIESTTYLLRLLKNRAPLENE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
             P LGF++HTDKSF + ++Q+  ++GLE++ ++G +W  V +SPS  VV+AGDA+MAWSN+
Sbjct  181   PNLGFINHTDKSFTTILHQDSEVHGLEVETRDG-EWITVEMSPSKFVVIAGDALMAWSND  239

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI+SP+H+V + GK  RYS+A F+F   T+ Q P ELVD DHPL++KPF+HL  L F+  
Sbjct  240   RIQSPNHKVTINGKEDRYSLALFAFNNGTL-QVPEELVDDDHPLKYKPFEHLGLLRFYRT  298

Query  376   EENRRLPCALKTYCGV  329
             +E  +  C +K YCGV
Sbjct  299   DEGYKSKCPIKAYCGV  314



>emb|CBI36206.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   357 bits (917),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 171/319 (54%), Positives = 226/319 (71%), Gaps = 2/319 (1%)
 Frame = -2

Query  1285  KIYIMGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHE  1106
             K  IMGS T  KLP+IDF++E++KPG+DSW +   +   ALEEYGCF+A Y++V  E+H 
Sbjct  145   KTKIMGSETHPKLPIIDFSEENLKPGSDSWFSVCHDVRHALEEYGCFMAYYNQVPLELHN  204

Query  1105  RVFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLM  926
             ++F  L ELFDLPT +KV+N S KP +GY+GQIP  PL+ESMGIDHA  L+ IQSF KLM
Sbjct  205   KIFNALGELFDLPTEIKVKNTSDKPSHGYIGQIPAYPLHESMGIDHATNLEEIQSFAKLM  264

Query  925   WPQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQ  746
             WP GN+ F E +  Y+ L AELE++V+RMV +SYG+EKY++SH+ S  YL R +K R  +
Sbjct  265   WPAGNEHFCEVVHSYTSLLAELEQVVMRMVLQSYGIEKYFDSHIASTRYLLRCLKNRVPK  324

Query  745   ENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAW  566
              NE  + F +H+DKSFM+ + QN H++GLE+  K+G        SPS  +V+AGDA MAW
Sbjct  325   MNENDIAFPTHSDKSFMTILQQN-HVSGLEVDTKDGKSIGFGPPSPSVFIVIAGDAFMAW  383

Query  565   SNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             SN RI  P HRV+M     RYS+A F+F +  MI+ P ELVD  HPLQFKPFDH+ ++ F
Sbjct  384   SNGRIHPPKHRVIMRANEERYSLALFAF-KNGMIKVPEELVDDKHPLQFKPFDHVGFIRF  442

Query  385   FSKEENRRLPCALKTYCGV  329
             F  EE R+   A+K YCG+
Sbjct  443   FHTEEGRKSNSAIKAYCGI  461


 Score = 83.6 bits (205),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 3/82 (4%)
 Frame = -2

Query  883  YSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSHTDK  704
            YSKL +ELE++V+RMV ESYG+E  +  H+ SA +L R +KYR  + NE  +    HTDK
Sbjct  54   YSKLLSELEQIVMRMVLESYGIENDF--HIGSATFLIRFLKYRVPKMNETSISVPPHTDK  111

Query  703  SFMSTIYQNCHINGLEIKAKNG  638
            SF+S ++QN  +NGLEI+ K+G
Sbjct  112  SFISILHQN-QVNGLEIETKDG  132


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCF-------VALYDKVSSE  1115
             MG  T  K+P++DF+KE++KPGTDSW  A      ALEE   F       V  Y K+ SE
Sbjct  1     MGLETLPKIPIVDFSKENLKPGTDSWFPACNNVRHALEEVWLFHGTYLVTVHCYSKLLSE  60

Query  1114  VHERVFKGLVELFDLPTNVKV  1052
             + + V + ++E + +  +  +
Sbjct  61    LEQIVMRMVLESYGIENDFHI  81



>emb|CDO98089.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   352 bits (902),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 171/317 (54%), Positives = 232/317 (73%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS+TP  L V+DFT +++KPG+  W  A  +   ALE +GCF+ALYDK+S E+ + +F 
Sbjct  1     MGSVTPTNLLVVDFTNKELKPGSSCWSLACNDIRHALENHGCFIALYDKISQELDKAIFH  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LFDLPT +KV+N + KP +GYVGQIP VPL+E +GID+A TL G+QSFT LMWPQG
Sbjct  61    AADDLFDLPTQLKVQNTNEKPYHGYVGQIPFVPLHEGLGIDYATTLDGVQSFTNLMWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FSE+   ++K  A+L+EMV++M+FESYGVEKY +SHV+S+ YL R +KYR  + NE 
Sbjct  121   NKSFSESSFSFAKTVAKLDEMVIKMLFESYGVEKYSDSHVESSTYLLRFLKYRAPEVNET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              + F SHTDKSF++ +YQN HI+GLEI+ ++G +W  V   P S VVMAGDA  AWSN+ 
Sbjct  181   TMAFPSHTDKSFLTILYQN-HISGLEIRTRDG-EWITVDFPPRSFVVMAGDACQAWSNDG  238

Query  553   IKSPHHRVMME--GKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             + SP+H+V M+  GK  R++IA FSF+ K M+Q P ELVD + PLQFKPF H+  L+F++
Sbjct  239   VLSPNHKVTMDANGKETRHTIALFSFLSK-MVQVPEELVDDEKPLQFKPFVHVDLLNFYA  297

Query  379   KEENRRLPCALKTYCGV  329
              ++ RR    LK +CGV
Sbjct  298   TDQGRRSQNILKDFCGV  314



>ref|XP_004302942.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Fragaria vesca 
subsp. vesca]
Length=320

 Score =   349 bits (895),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 226/315 (72%), Gaps = 8/315 (3%)
 Frame = -2

Query  1258  PLKLPVIDFT-KEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVE  1082
             PLKLPV+DF+ KE + PGT+SW++AR+    ALEE+GCFV LYD +S +    +   + E
Sbjct  9     PLKLPVLDFSNKESLNPGTNSWLSARKHVQGALEEFGCFVVLYDGISPDFRNTLLATMQE  68

Query  1081  LFDLPTNVKVENK-STKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDD  905
             LFDLPT  K+ NK   KPL GYVGQIP +PL+ESMGID+A +L+  Q FT+LMWP GND+
Sbjct  69    LFDLPTKTKMTNKYEAKPLNGYVGQIPKLPLHESMGIDNATSLEETQRFTELMWPGGNDN  128

Query  904   FSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLG  725
             F E++  ++K+A EL++MV RM+FESYGVEK Y+S+V S  YL R++K +  QEN+P LG
Sbjct  129   FCESVYSFAKVAEELDKMVTRMIFESYGVEKCYDSYVGSITYLLRLLKNKLPQENQPNLG  188

Query  724   FVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKS  545
             FV HTDKSF + +YQN  ++ LEI+ +N  +WF V   PSS +VMAGDA+MAWSN+RI S
Sbjct  189   FVPHTDKSFTTILYQNNQVHALEIETRN-HEWFKVEFPPSSFIVMAGDALMAWSNDRILS  247

Query  544   PHHRVMMEG---KGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             P+HRV+M        RYS+AQF+F     I+ P ELVD  HPL++KPFDH+  L FF   
Sbjct  248   PNHRVVMSTGHETEARYSMAQFAF-SNGEIRVPDELVDDQHPLRYKPFDHVGLLRFFRTA  306

Query  373   ENRRLPCALKTYCGV  329
             E+     A+K YCGV
Sbjct  307   EDNS-NSAIKAYCGV  320



>ref|XP_002517548.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44712.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=313

 Score =   347 bits (891),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 222/316 (70%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKV-SSEVHERVF  1097
             MGS    KLPV+DFT E++KPGT  W  A  E   ALEEYGCF+  Y+ + S ++ + VF
Sbjct  1     MGSAAQPKLPVLDFTLENLKPGTSCWAKACGEVRQALEEYGCFIVEYNNILSPKLRDGVF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
               L ELFDLPT  K++NK  KPL GYVGQI  +PL+ESMGID+A  L+  Q FT LMWP 
Sbjct  61    NSLKELFDLPTETKMQNKYQKPLNGYVGQIAKLPLHESMGIDNATCLEATQDFTTLMWPD  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND+F E +  Y+KL AE+++MV RM+FESYG EKY++S+V+S  YL R++K R  + +E
Sbjct  121   GNDNFCECVYEYAKLTAEIDQMVTRMIFESYGAEKYHDSYVESTNYLLRLLKNRLPKGDE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
             P LGF++HTDKSF + ++QN HINGLE+  K+G     +  SPSS VV+AGDA+M WSN+
Sbjct  181   PNLGFITHTDKSFTTILHQN-HINGLEVDTKDGQK-INIEFSPSSFVVIAGDALMVWSND  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI SP HRV++ GK  RYS+  F+F    +I+ P EL+D DHPL +KP DH+  L F+  
Sbjct  239   RIISPSHRVIINGKEDRYSMGLFAF-NSGIIRVPEELIDKDHPLMYKPLDHIGLLYFYRT  297

Query  376   EENRRLPCALKTYCGV  329
             +E  +  C +K +CGV
Sbjct  298   DEGYKSKCPVKAFCGV  313



>ref|XP_006427132.1| hypothetical protein CICLE_v10027083mg [Citrus clementina]
 gb|ESR40372.1| hypothetical protein CICLE_v10027083mg [Citrus clementina]
 gb|KDO58209.1| hypothetical protein CISIN_1g043442mg [Citrus sinensis]
Length=309

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 223/311 (72%), Gaps = 5/311 (2%)
 Frame = -2

Query  1255  LKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFV--ALYDKVSSEVHERVFKGLVE  1082
             LKLPV+DF+ +D+KPGT+SW+ A  +   ALEE+GCF+    ++ +SSE    VF  L  
Sbjct  2     LKLPVVDFSNKDLKPGTNSWIKACNDVRQALEEFGCFIIECNHNLISSEFRSEVFGALKN  61

Query  1081  LFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDF  902
             LFDLPT  K++NK  +PL GYVGQIP +PL+ESMGID+A +L+  QSFTK+MWPQGND F
Sbjct  62    LFDLPTETKMKNKYERPLTGYVGQIPKLPLHESMGIDNATSLEAAQSFTKIMWPQGNDSF  121

Query  901   SEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGF  722
              + +  Y+ LAAEL+  V RM+FESY +EKY++S+++S  YL RV+K R     EP LGF
Sbjct  122   CKIVHSYATLAAELDRTVSRMIFESYSLEKYHDSYIESITYLLRVLKNRAPIGGEPNLGF  181

Query  721   VSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSP  542
             V+HTDKSF + ++QN  INGLEI  ++G     V LSPSS VV+AGDA+MAWSN+RI SP
Sbjct  182   VTHTDKSFTTILHQN-QINGLEIDTRDGQK-INVELSPSSFVVVAGDALMAWSNDRIHSP  239

Query  541   HHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRR  362
              HRV+M G   RYS+A FSF    +++ P ELVD +HPL++KPF+H   L +F  +E  +
Sbjct  240   SHRVIMNGAVDRYSLALFSF-SSGIVKVPDELVDDEHPLKYKPFEHFGLLRYFRTDEGYK  298

Query  361   LPCALKTYCGV  329
               C +K YCG+
Sbjct  299   SKCPIKAYCGI  309



>ref|XP_006465514.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1-like, 
partial [Citrus sinensis]
Length=314

 Score =   347 bits (889),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 226/317 (71%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFV--ALYDKVSSEVHERV  1100
             +G+   LKLPV+DF+ +D+KPGT+SW+ A  +   ALEE+GCF+    ++ +SSE    V
Sbjct  1     IGAEAMLKLPVVDFSNKDLKPGTNSWIKACNDVRQALEEFGCFIIECNHNLISSEFRSEV  60

Query  1099  FKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP  920
             F  L  LFDLP+  K++NK  +PL GYVGQIP +PL+ESMGID+A +L+  QSFTK+MWP
Sbjct  61    FGALKNLFDLPSETKMKNKYERPLTGYVGQIPKLPLHESMGIDNATSLEAAQSFTKIMWP  120

Query  919   QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQEN  740
             QGND F + +  Y+ LAAEL+  V RM+FESY +EKY++S+++S  YL RV+K R     
Sbjct  121   QGNDSFCKIVNSYATLAAELDRTVSRMIFESYSLEKYHDSYIESITYLLRVLKNRAPIGG  180

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
             EP LGFV+HTDKSF + ++QN  INGLEI  ++G     V LSPSS VV+AGDA+MAWSN
Sbjct  181   EPNLGFVTHTDKSFTTILHQN-QINGLEIDTRDGQK-INVGLSPSSFVVVAGDALMAWSN  238

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             +RI SP HRV+M G   RYS+A FSF    +++ P ELVD +HPL++KPF+H   L +F 
Sbjct  239   DRIHSPSHRVIMNGAVDRYSLALFSF-SSGIVKVPDELVDDEHPLKYKPFEHFGLLRYFR  297

Query  379   KEENRRLPCALKTYCGV  329
              +E  +  C +K YCG+
Sbjct  298   TDEGYKSKCPIKAYCGI  314



>ref|XP_002298131.1| hypothetical protein POPTR_0001s17670g [Populus trichocarpa]
 gb|EEE82936.1| hypothetical protein POPTR_0001s17670g [Populus trichocarpa]
Length=313

 Score =   343 bits (880),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 227/316 (72%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL+P +LPVIDF+KE+MKPGT SW++  ++ + ALEEYGCFVA+YDKV   +H  +F 
Sbjct  1     MGSLSPPELPVIDFSKENMKPGTSSWLSTCKDVMYALEEYGCFVAVYDKVPLTLHNDLFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVP-LYESMGIDHANTLQGIQSFTKLMWPQ  917
              L +LFDLP   K +N S  P YGYVG  P +P LYE MGID+A TL+G + F   MWP 
Sbjct  61    TLKDLFDLPIETKRKNVSDLPYYGYVGNQPFIPSLYEGMGIDNAITLEGTEDFADTMWPG  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND F + +L YS L +ELE+MVVRMVFESYGV ++++SH +S  YL R+MKYR  ++NE
Sbjct  121   GNDHFCKTVLSYSMLVSELEQMVVRMVFESYGVYQHHDSHKESTTYLFRMMKYRGPEKNE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               +G  +HTDKSF++ ++QN  ++GLE+K+K+G  W G   SPSS +VMAG+A++ WSN+
Sbjct  181   ANVGCDAHTDKSFITVLHQN-QVSGLEVKSKDG-QWMGFKPSPSSFIVMAGEALLGWSND  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI +P HRV+M    PRYS+  FSF+ K +I+ P +L+D  +PL+FKPF++   L +F  
Sbjct  239   RINAPFHRVVMSESEPRYSVGLFSFI-KGIIKVPEKLIDEKNPLRFKPFENFGLLRYFFT  297

Query  376   EENRRLPCALKTYCGV  329
             EE R     +K YCGV
Sbjct  298   EEGRGKESTIKAYCGV  313



>ref|XP_007214491.1| hypothetical protein PRUPE_ppa020361mg [Prunus persica]
 gb|EMJ15690.1| hypothetical protein PRUPE_ppa020361mg [Prunus persica]
Length=315

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 218/317 (69%), Gaps = 4/317 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKED--MKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERV  1100
             MGS    KLPV+DF+KE   +KPGT+SWV+A ++   ALEE+GCF   YDK+  E     
Sbjct  1     MGSDGQPKLPVLDFSKEAEALKPGTNSWVSACKDVRQALEEFGCFFVSYDKLPPEFQNGF  60

Query  1099  FKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP  920
                L ELFDLPT  K+ NKS  P  GY GQIP +PL+E +GI++A  L+  Q FTKLMWP
Sbjct  61    LGTLKELFDLPTQTKMTNKSENPSSGYFGQIPSLPLHEGLGIENATNLEETQKFTKLMWP  120

Query  919   QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQEN  740
              GND+F E+   ++K+A EL++MV RM+FESYG+EKYY+S+V S  YL R++K R  QEN
Sbjct  121   GGNDNFCESAHSFAKVAEELDQMVTRMIFESYGMEKYYDSYVGSVSYLLRLLKNRTPQEN  180

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
             EP LGFV+HTDKSF + +YQN   +GLE++ K+  +W      PSS +VMAGDA+MAWSN
Sbjct  181   EPSLGFVAHTDKSFTTLLYQNNQAHGLEVETKS-HEWIRAEFPPSSFLVMAGDALMAWSN  239

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             +RI SP+HRV+M G   RYS+AQF+F +   I  P EL D  HPL++K FDH   L FF 
Sbjct  240   DRILSPNHRVIMNGNEARYSLAQFAFSDGE-IHVPEELADEQHPLRYKSFDHPGLLVFFR  298

Query  379   KEENRRLPCALKTYCGV  329
               E+     A+K YCGV
Sbjct  299   TNESYVSNSAIKAYCGV  315



>emb|CDP10327.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 230/317 (73%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS  P KL V+DFT E++KPG+ SW +A  +   ALE +GCF+ALY+KVS E+ + +F+
Sbjct  1     MGSPAPRKLLVVDFTNEELKPGSSSWASACNDIQRALENHGCFIALYNKVSPELDKAIFQ  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LFDLPT +KV+N + KP +GY+GQIP VPL+E +GID+A TL G+QSFT LMW +G
Sbjct  61    AADDLFDLPTELKVQNINEKPYHGYIGQIPFVPLHEGLGIDYATTLDGVQSFTNLMWSKG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FSE+   ++K  A+L+EMV++M+FESYGVEKY +SH+ S  YL R +KYR  + NE 
Sbjct  121   NKSFSESSFSFAKTVAKLDEMVIKMLFESYGVEKYSDSHIDSTRYLLRFLKYRAPEMNET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              + F SHTDKSF++ +YQN HI+GLEI+ ++ D+W  V     S VVMAGDA  AWSN+R
Sbjct  181   TMAFPSHTDKSFLTILYQN-HISGLEIRTRD-DEWIKVDFPQKSFVVMAGDACQAWSNDR  238

Query  553   IKSPHHRVMME--GKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             + S +H+V M+  GK  RY+IA FSF+ K M+Q P ELV+ + PLQFKPF H+  L+F++
Sbjct  239   VLSSNHKVTMDANGKETRYTIALFSFLSK-MVQVPEELVNDEKPLQFKPFVHIDLLNFYA  297

Query  379   KEENRRLPCALKTYCGV  329
              ++ R+    LK +CGV
Sbjct  298   TDQGRKSQNILKDFCGV  314



>ref|XP_006465516.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Citrus 
sinensis]
 ref|XP_006495319.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Citrus 
sinensis]
Length=315

 Score =   340 bits (871),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/318 (52%), Positives = 231/318 (73%), Gaps = 6/318 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL+  KLPV++ +KE++KPG  SW+   R+   ALEE+GCFVALYD+VS E+H  +F 
Sbjct  1     MGSLSVPKLPVVNLSKENLKPGASSWLGTSRKVREALEEFGCFVALYDEVSLELHNAIFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVP-LYESMGIDHANTLQGIQSFTKLMWPQ  917
                ELF+LP  +K +N S KP YGY+G  P+VP +YE MG+D+ANT++G Q+FT L+WP+
Sbjct  61    AAEELFNLPIEIKEKNVSEKPYYGYLGNNPLVPAIYEGMGVDYANTIEGTQNFTNLIWPE  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN++F + ++ YS+L +ELE+MV RMVFESYGV++YY+S ++S+ YL R+MKYR  + NE
Sbjct  121   GNENFCKTVVSYSRLVSELEQMVKRMVFESYGVDQYYDSVLESSTYLLRIMKYRCPETNE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVH-LSPSSIVVMAGDAIMAWSN  560
               LG   HTDKSF++ ++QN  +N LEI+ K+G  W G +  +PSS +V+AGDA +AWSN
Sbjct  181   NNLGCDVHTDKSFITVLHQN-EVNVLEIRTKDG-CWIGFNDPTPSSFIVLAGDAFLAWSN  238

Query  559   NRIKSPHHRVMMEG-KGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
              RI SP HRV++ G K  RYS+  F++ +  +IQ P ELVD +HPL+FK F+H   L ++
Sbjct  239   GRIHSPVHRVILNGIKQARYSLGLFTYNDG-IIQIPEELVDDEHPLKFKSFEHFGLLRYY  297

Query  382   SKEENRRLPCALKTYCGV  329
              KEE ++  C  K YC V
Sbjct  298   LKEEGQKAECTAKAYCCV  315



>ref|XP_011045368.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=313

 Score =   339 bits (869),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 166/316 (53%), Positives = 225/316 (71%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M SL+P +LPVIDF+KE++KPGT SW++  ++ + ALEEYGCFVA+YDKV   +H  +F 
Sbjct  1     MDSLSPPELPVIDFSKENLKPGTSSWLSTCKDVMYALEEYGCFVAVYDKVPLTLHNDLFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVP-LYESMGIDHANTLQGIQSFTKLMWPQ  917
              L +LFDLP   K +N S  P YGYVG  P VP LYE MGID+A  L+G + F   MWP 
Sbjct  61    TLKDLFDLPLETKRKNVSDLPYYGYVGNQPFVPSLYEGMGIDNAIALEGTEDFADTMWPG  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND F + +L YS L +ELE+MVVRMVFESYGV ++++SH +S  YL R+MKYR  ++NE
Sbjct  121   GNDHFCKTVLSYSMLVSELEQMVVRMVFESYGVYQHHDSHKESTTYLFRMMKYRGPEKNE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               +G  +HTDKSF++ ++QN  ++GLE+K+K+G  W G   SPSS +VMAGDA++ WSN+
Sbjct  181   ANVGCDAHTDKSFITVLHQN-QVSGLEVKSKDG-QWMGFKPSPSSFIVMAGDALLGWSND  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI +P HRV+M    PRYS+  FSF+ K +I+ P +L+D  +PL+FKPF++   L +F  
Sbjct  239   RINAPFHRVVMSESEPRYSVGLFSFI-KGIIKVPEKLIDEKNPLRFKPFENFGLLRYFIT  297

Query  376   EENRRLPCALKTYCGV  329
             EE R     +K YCGV
Sbjct  298   EEGRGKEFTIKAYCGV  313



>ref|XP_008228619.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=321

 Score =   339 bits (869),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 160/316 (51%), Positives = 218/316 (69%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TP KLPVIDF+ + + PGT  W A R +  +ALEEYGCF AL++KV S + + +F 
Sbjct  1     MGSETPPKLPVIDFSNQSLTPGTTEWNAVRAQVHNALEEYGCFEALFNKVPSHIRKSIFP  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELFDLP   K++N S KP +GYVGQ P+VPLYESMG+D AN  + +QS T  +WP+G
Sbjct  61    SIEELFDLPLQTKLQNVSKKPYHGYVGQYPMVPLYESMGVDGANVYEQVQSLTNTLWPRG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F +A+  +S+  +EL++++ RM+ ES G+EKY E H++S  YL RVMKY+  Q NE 
Sbjct  121   NPSFCKAIQSFSEQVSELDQIIRRMILESLGLEKYLEEHLESTNYLLRVMKYKGPQTNET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  +HTDK+ ++ +YQN  ++GLE++ K+G  W  V  SP S + M GD++ AW+N R
Sbjct  181   KLGLNAHTDKNIVTILYQN-QVDGLEVQNKDG-KWINVKPSPDSFIAMIGDSLYAWTNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSF-MEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP+HRVMM G   RYS   FS   E  +I+ P E+VD +HPL FKPFDH+ +L F+  
Sbjct  239   LHSPYHRVMMSGNEARYSTGLFSIPKEGYIIKAPEEVVDEEHPLLFKPFDHVQFLGFYYS  298

Query  376   EENRRLPCALKTYCGV  329
             E  +R   ALKTYCGV
Sbjct  299   EAGQRAHSALKTYCGV  314



>ref|XP_008226092.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Prunus 
mume]
Length=315

 Score =   338 bits (868),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 216/317 (68%), Gaps = 4/317 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKED--MKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERV  1100
             MGS    KLPV+DF+KE   +KPGT+SW++A ++   ALEE+GCF   YDK+  E     
Sbjct  1     MGSDGQPKLPVLDFSKEAEALKPGTNSWLSACKDVRQALEEFGCFFVSYDKLPPEFQNGF  60

Query  1099  FKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP  920
                L ELFDLPT  K+ NKS  P  GY GQIP +PL+E +GI++A  L+  Q FTKLMW 
Sbjct  61    LGALQELFDLPTQTKMTNKSENPSSGYFGQIPSLPLHEGLGIENATNLEETQKFTKLMWA  120

Query  919   QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQEN  740
              GND+F E+   ++K+A EL +MV RM+FESYG+EKYY+S+V S  YL R++K R  QEN
Sbjct  121   GGNDNFCESTHSFAKVAEELNQMVTRMIFESYGMEKYYDSYVGSVSYLLRLLKNRTPQEN  180

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
             EP LGFV+HTDKSF + +YQN   +GLE++ K+  +W      PSS +VMAGDA+MAWSN
Sbjct  181   EPSLGFVAHTDKSFTTLLYQNNQAHGLEVETKS-HEWIRAEFPPSSFLVMAGDALMAWSN  239

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             +RI SP+HRV+M G   RYS+AQF+F +   I  P EL D  HPL++K FDH   L FF 
Sbjct  240   DRILSPNHRVIMSGNEARYSLAQFAFSDGE-IHVPEELADEQHPLRYKSFDHPGLLVFFR  298

Query  379   KEENRRLPCALKTYCGV  329
               E+     A+K YCGV
Sbjct  299   TNESYISNSAIKAYCGV  315



>ref|XP_007216862.1| hypothetical protein PRUPE_ppa021358mg [Prunus persica]
 gb|EMJ18061.1| hypothetical protein PRUPE_ppa021358mg [Prunus persica]
Length=321

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 216/316 (68%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TPLKLPVIDF+ + + PGT  W   R +  +ALEEYGCF AL++KV   + + +F 
Sbjct  1     MGSETPLKLPVIDFSNQSLTPGTTEWNTVRAQVHNALEEYGCFEALFNKVPPHIRKSIFP  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELFDLP   K++N S KP +GYVGQ P+VPLYESMG+D AN  + +QS T  +WPQG
Sbjct  61    SIEELFDLPLQTKLQNVSKKPFHGYVGQYPMVPLYESMGVDDANVYEQVQSLTNTLWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F + +  +S+  +EL++++ RM+ ES G+EKY E H++S  YL RVMKY+  Q NE 
Sbjct  121   NPSFCKTIQSFSEQVSELDQIIRRMILESLGLEKYLEEHLESTNYLLRVMKYKGPQTNET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  +HTDK+ ++ +YQN  ++GLE++ K+G  W  V  SP S + M GD++ AW+N R
Sbjct  181   KLGLNAHTDKNIVTILYQN-QVDGLEVQNKDG-KWINVKPSPDSFIAMIGDSLYAWTNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSF-MEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP+HRVMM G   RYS   FS   E  +I+ P E+VD +HPL FKPFDH+ +L F+  
Sbjct  239   LHSPYHRVMMSGNEVRYSTGLFSIPKEGYIIKAPEEVVDEEHPLLFKPFDHVQFLGFYYS  298

Query  376   EENRRLPCALKTYCGV  329
             E  +R   ALKTYCGV
Sbjct  299   EAGQRAHSALKTYCGV  314



>ref|XP_006427128.1| hypothetical protein CICLE_v10027501mg [Citrus clementina]
 gb|ESR40368.1| hypothetical protein CICLE_v10027501mg [Citrus clementina]
Length=338

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/311 (52%), Positives = 225/311 (72%), Gaps = 6/311 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             KLPV++ +KE+ KPG  SW+   R+   ALEE+GCFVALYD+VS E+H  +F    ELF+
Sbjct  31    KLPVVNLSKENFKPGASSWLGTSRKVREALEEFGCFVALYDEVSLELHNAIFSAAEELFN  90

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVP-LYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             LP  +K +N S KP YGY+G  P+VP +YE MG+D+ANT++G Q+FT L+WP+GN++F +
Sbjct  91    LPIEIKEKNVSEKPYYGYLGNNPLVPAIYEGMGVDYANTIEGTQNFTNLIWPEGNENFCK  150

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
              ++ YS+L +ELE+MV RMVFESYGV+KYY+S ++S+ YL R+MKYR  + NE  LG   
Sbjct  151   TVVSYSRLVSELEQMVKRMVFESYGVDKYYDSVLESSTYLLRIMKYRCPETNEKNLGCDV  210

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGV-HLSPSSIVVMAGDAIMAWSNNRIKSPH  539
             HTDKSF++ ++QN  +NGLEI+ K+G  W G    +PSS +V+AGDA +AWSN+RI SP 
Sbjct  211   HTDKSFITVLHQN-EVNGLEIRTKDG-CWIGFDDPTPSSFIVLAGDAFLAWSNSRIHSPV  268

Query  538   HRVMMEG-KGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRR  362
             HRV++ G K  RYS+  F+F +  +IQ P ELVD +HPL+FK F+H   L ++  EE ++
Sbjct  269   HRVILNGIKQARYSLGLFTFNDG-IIQIPEELVDDEHPLKFKSFEHFGLLRYYLTEEGQK  327

Query  361   LPCALKTYCGV  329
               C  K YC V
Sbjct  328   AECTAKAYCSV  338



>ref|XP_010034855.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW53769.1| hypothetical protein EUGRSUZ_J03022 [Eucalyptus grandis]
Length=315

 Score =   336 bits (861),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/318 (52%), Positives = 219/318 (69%), Gaps = 6/318 (2%)
 Frame = -2

Query  1273  MGSLTPL--KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERV  1100
             MGS + L  +L VI+F++E++ PGTD W++  +  V ALEEYGCF+A     +S+ H  +
Sbjct  1     MGSQSKLLPELSVIEFSRENLDPGTDLWISTSKRVVFALEEYGCFIATCSDFTSQAHNEI  60

Query  1099  FKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP  920
             F  L ELFDLPT +K  N S KP +GYVGQ P +PLYES+GID A TL+G+QSFT L+WP
Sbjct  61    FHALDELFDLPTEIKSRNTSEKPYFGYVGQHPSIPLYESLGIDDATTLKGVQSFTNLLWP  120

Query  919   QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQEN  740
              GN+ F +  L +SK  +ELE+MV RMVFE YGV+KYY+SHV S+ YL R MKYR  + N
Sbjct  121   AGNERFRDGALAFSKKVSELEQMVKRMVFERYGVKKYYDSHVMSSTYLLRFMKYRAPEMN  180

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
             E   G   HTDKSF++ ++QN  I+GLE+K K+G DW     SPSS +VMAGDA +AWSN
Sbjct  181   ETNRGCDVHTDKSFVTILHQN-QIDGLEVKTKDG-DWIAFEPSPSSFLVMAGDAFLAWSN  238

Query  559   NRIKSPHHRVMM-EGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
              RI SP H+V+M E K PRYS+  F+F    +I+ P EL D ++PL+FK FDH   L +F
Sbjct  239   GRIHSPLHQVVMKEKKSPRYSLGLFTF-HSGIIEIPQELADPENPLKFKAFDHYGLLRYF  297

Query  382   SKEENRRLPCALKTYCGV  329
              ++   +  C  + YCGV
Sbjct  298   CQDGVPQDVCTAQAYCGV  315



>ref|NP_175688.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAG52288.1|AC019018_25 putative oxidoreductase; 32373-31266 [Arabidopsis thaliana]
 gb|AEE32852.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=310

 Score =   333 bits (854),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 220/309 (71%), Gaps = 5/309 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVA-LYDKVSSEVHERVFKGLVELF  1076
             K+P +DF++ED+KPGT  W + R     ALEEYGCF+  L DK   ++ +RVF  LV+LF
Sbjct  4     KIPTLDFSREDLKPGTKYWESTRENIRQALEEYGCFIIDLKDKTPLDLLDRVFGSLVDLF  63

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             DLPT  K++NK  KPL GYVGQIP +PL+ES+GID+A +L+  +SFT LMWPQGN+ FSE
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNEHFSE  123

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
              +  Y++ AAEL++MV RMVF+SY VEKYY+ +++S  YL RV+K R      P LGFV+
Sbjct  124   CLYKYAEFAAELDQMVTRMVFQSYNVEKYYDPYIESTTYLLRVLKNRAPNNENPTLGFVT  183

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIVVMAGDAIMAWSNNRIKSPH  539
             HTDKSF + ++Q+  +NGLE++ + G+    ++L SPS  +V+AGDA+MAWSN+R+ SP 
Sbjct  184   HTDKSFTTILHQD-QVNGLEMETREGER-ININLSSPSLFMVVAGDALMAWSNDRVWSPR  241

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V++ G+  RYS+  F+F   T+ Q P EL+D  HPL +KPFDHL  L F+  +   + 
Sbjct  242   HQVLVSGETDRYSLGMFAFNNGTL-QVPEELIDHQHPLMYKPFDHLGLLRFYRTDTGYKS  300

Query  358   PCALKTYCG  332
              C +K YCG
Sbjct  301   ECPIKAYCG  309



>gb|EYU21582.1| hypothetical protein MIMGU_mgv1a010360mg [Erythranthe guttata]
Length=314

 Score =   333 bits (855),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 217/316 (69%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL    LP+IDF++++++PG+ SW     + V ALE+YGCF+A Y K S E+H  +F 
Sbjct  1     MGSLENPTLPIIDFSEKNLEPGSPSWFTTAEKVVHALEDYGCFIATYSKFSPEMHRSIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LFDLPT+VK+ N S  P +GYVGQ PI+PLYE +GI++A T  G+++FT L+WP G
Sbjct  61    VSEQLFDLPTDVKILNTSGTPSHGYVGQEPIIPLYEGLGIENATTHTGVETFTSLLWPSG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F E  L YS+L AELE+ V+RMV ++YG+E  Y+S V +  YL R +KYR   ++E 
Sbjct  121   NHHFGETALEYSRLVAELEQEVMRMVSKNYGIEDSYQSLVGATSYLLRFIKYRAPGKDET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              LG V HTDKSFMS ++Q   + GL+I+ KNG DW  V  SPS  VVMAGDA MAW+N R
Sbjct  181   GLGIVPHTDKSFMSILHQR-QVKGLQIQTKNG-DWLLVDPSPSYFVVMAGDACMAWTNGR  238

Query  553   IKSPHHRVMM-EGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             I+   HRV++ EG   RYS+  F+F++   IQ P ELVD D+P +FKPFDH  Y+ F+  
Sbjct  239   IEPSKHRVIIDEGSEDRYSLGLFTFIKDVKIQVPEELVDDDNPSRFKPFDHYKYIHFYYT  298

Query  376   EENRRLPCALKTYCGV  329
             EE +R  C +K YCG+
Sbjct  299   EEGKRSKCPIKDYCGI  314



>emb|CDP19783.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/315 (51%), Positives = 216/315 (69%), Gaps = 4/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S + ++LPVI+ T+E ++ G DSW  AR     A EEYGCF+A++DK  SEV + +F 
Sbjct  1     MDSASNIRLPVINLTEEILRSGKDSWTEARNTVTRAFEEYGCFIAVHDKYPSEVSDSIFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L +LF+LP  +KV+N S  PL+GY G  P +PLYES  I+ A  L+ +Q FT  MWP  
Sbjct  61    ELQDLFNLPLEIKVQNTSQTPLFGYYGPNPYLPLYESTSIEDAINLEAVQKFTNQMWPSK  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N+ F E +  Y+  AAEL++MV ++VFESYGVEKY+ESHV S  Y+ R  KYR  ++NE 
Sbjct  121   NNHFCELLHCYANQAAELDKMVSKLVFESYGVEKYHESHVGSVTYIVRFTKYRVPEQNET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              +G + HTDK+F+ TI Q    +GLE++ KNG  W  V   PSS+V+MAGDA   WSN R
Sbjct  181   NVGVLPHTDKNFI-TILQQSDADGLEVQLKNG-SWIPVDFPPSSVVIMAGDAFSVWSNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             + SP HRV M+GKG RYSIAQF++ +K +++TPTELVD +HPL +KPFD+  +L F S +
Sbjct  239   VHSPFHRVTMKGKG-RYSIAQFAYCKK-LVKTPTELVDDEHPLLYKPFDNFGFLRFTSTD  296

Query  373   ENRRLPCALKTYCGV  329
             E R+    LK YCGV
Sbjct  297   EGRKAQNPLKAYCGV  311



>ref|XP_004302943.1| PREDICTED: gibberellin 20 oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 219/317 (69%), Gaps = 6/317 (2%)
 Frame = -2

Query  1273  MGSLT--PLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERV  1100
             MGS T    K+P++D +KE++KPGTD+W+ A +E   ALEEYGCF A+Y+KV  E+H   
Sbjct  1     MGSHTQPAAKVPIVDLSKENVKPGTDAWLLASKEIKYALEEYGCFEAIYNKVPLELHNST  60

Query  1099  FKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP  920
             F  L +LF+LP   K+++ S +P + Y GQ   +PLYES+G+D+   ++G+Q FT +MWP
Sbjct  61    FSVLQDLFNLPLETKMQSTSDRPYHSYFGQYSFLPLYESLGVDNPTKIEGVQRFTSIMWP  120

Query  919   QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQEN  740
             +GND F E+   YSKL AEL+EMV +MVFE+YGVE+ YESH+ S  YL R   YRE Q +
Sbjct  121   EGNDKFCESAHSYSKLVAELDEMVTKMVFENYGVERLYESHMASTTYLLRCFYYREPQLD  180

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
             E  +G   HTDK+F+S ++Q+  INGL+IK+K G  W  V  SPSS +VMAGDA MAWSN
Sbjct  181   ETDMGLHPHTDKTFISILHQD-EINGLQIKSKEG-QWIDVEPSPSSFIVMAGDAFMAWSN  238

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             +R++S  H+V+M+ K  RYSI  F+F    ++Q P ELVD  HPL +KPFDH+ +L F  
Sbjct  239   DRVRSCEHQVIMKEKKTRYSIGLFAF--NGVLQVPAELVDEKHPLLYKPFDHIGFLLFNK  296

Query  379   KEENRRLPCALKTYCGV  329
               E  +  C +K YCGV
Sbjct  297   TPEGMKSKCPIKDYCGV  313



>emb|CDO98091.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   332 bits (850),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/316 (52%), Positives = 214/316 (68%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLT-PLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGS+T  ++LPV+DFT E + P +  W + R E V ALEEYGCF+A YDKVS E+H+ +F
Sbjct  1     MGSVTRQIQLPVLDFTGETLNPSSTRWPSTREEVVRALEEYGCFIANYDKVSLELHQAIF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
                 ELF+LPT  KV N S  P +GY+    I PL E++GI++A T+ G+Q FT ++WP 
Sbjct  61    LASQELFELPTETKVLNTSDSPSHGYIAHRRI-PLLEALGIENATTVDGVQRFTNVLWPN  119

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN+ FSE  L YSKL AEL  +V+RMV E+YGVEK  ES + S  YL R++KYR  +E+E
Sbjct  120   GNNHFSETALSYSKLVAELNHVVMRMVAETYGVEKDCESLLGSIYYLLRLIKYRAPREDE  179

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               +G   H D++FMS ++Q   +NGLEI  KNGD      LSPSS +VMAGD  MAW+N 
Sbjct  180   SNVGLFPHADQTFMSILHQ-AQVNGLEIMTKNGDWMLIDSLSPSSFIVMAGDVCMAWTNG  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI+ P HRV M G   RYS++ F+FM   M+Q P +LVD +HPLQ+KPFD   YL F   
Sbjct  239   RIEPPLHRVTMSGSEERYSLSLFAFMRDVMVQVPEKLVDDEHPLQYKPFDPFKYLLFCVT  298

Query  376   EENRRLPCALKTYCGV  329
             EE ++  C +K+YCGV
Sbjct  299   EEGQKSKCQIKSYCGV  314



>gb|KDP37168.1| hypothetical protein JCGZ_06224 [Jatropha curcas]
Length=314

 Score =   331 bits (849),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 215/316 (68%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TPL+LPVIDF++ ++KPGT+ W + R +   AL+EYGCF A Y++V S++ + V  
Sbjct  1     MGSETPLRLPVIDFSEGNLKPGTEEWDSVRSQVFEALKEYGCFEAFYNRVPSDLKKGVVG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELF+LP   K++N S KP +GYVGQ P  PL+ESMGID A+  + + S T  +WPQG
Sbjct  61    AIEELFELPLETKLKNVSKKPFHGYVGQYPQAPLFESMGIDDADVPENVDSLTNTLWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FS+ ++ YS+L +EL++ V RM+ ES GVEKY + H+ S  YL RVMKY+  Q  E 
Sbjct  121   NPAFSKTVVSYSELVSELDQTVRRMILESLGVEKYLDEHMNSTNYLLRVMKYKGPQTTET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG   HTDK+ ++ +YQN  ++GLE+K K G +W  V LSP S VVM GD++ AW+N R
Sbjct  181   KLGLHPHTDKNIVTILYQN-QVDGLEVKTKEG-EWINVKLSPHSFVVMIGDSLYAWANGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP+HRVMM G   RYS   FS  +   M++ P ELVD  HPL FKPFDH+ +L F+  
Sbjct  239   LYSPYHRVMMSGNEARYSAGLFSIPKAGYMVKAPEELVDEQHPLLFKPFDHVKFLGFYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E  ++   ALK YCGV
Sbjct  299   ESGQKSESALKAYCGV  314



>ref|XP_008377592.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Malus domestica]
Length=312

 Score =   331 bits (848),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 156/315 (50%), Positives = 213/315 (68%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  KLPVID + E++KPGTD+W+ A +E   ALEEYGCF A+Y K+  E+H  +F 
Sbjct  1     MGSETQPKLPVIDLSDENLKPGTDAWLLACKEIKDALEEYGCFEAIYHKIPLELHNSIFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + +LF LP   K +  S +P + Y GQ   +PLYES+G+D+  T++G Q FT +MWPQG
Sbjct  61    AMEDLFGLPLETKKQKTSDRPYHSYFGQYSFLPLYESLGVDNPTTVEGAQGFTSIMWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F E    +SKL AEL +MV RMVF+ YGV++ ++SH++S  YL R  KYR  +ENE 
Sbjct  121   NAHFCETAHSFSKLVAELSQMVTRMVFDMYGVQRLFDSHMESTTYLLRCFKYRTQEENET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              +G   HTDK+F+S + QN  +NGL+I  K+G  W  V+ SPSS +++AGDA MAWSN+R
Sbjct  181   NVGLHPHTDKTFISILNQN-QVNGLQIGTKDG-QWIDVNPSPSSFLILAGDAFMAWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             + S  H+V M+    RYS+  F+F +  +IQ P EL+D  HPL +KPFDH  +LDF    
Sbjct  239   VPSCDHQVTMKENKTRYSLGLFAF-KSGIIQVPEELIDEKHPLLYKPFDHFSFLDFDRTP  297

Query  373   ENRRLPCALKTYCGV  329
             E R+L C++K YCGV
Sbjct  298   EARKLKCSIKAYCGV  312



>ref|XP_004302952.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 214/316 (68%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TP+KLP IDF+  ++KPGT  W + R +   ALEEYGCF AL++KV  +V + +F+
Sbjct  1     MGSETPIKLPTIDFSMPNLKPGTTEWDSVRAQVRFALEEYGCFEALFNKVPLDVQKAIFE  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELFDLP   K+ N S KP +GY+GQ P+VPLYES+GID AN    +QSFT  +WPQ 
Sbjct  61    ATEELFDLPLQTKLRNVSQKPFHGYIGQYPMVPLYESVGIDEANVYGQVQSFTHTLWPQQ  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N +FS+ +  +S+  +EL++++ RMV ES G+EKY E H+ S  YL R+MKY+  Q NE 
Sbjct  121   NPNFSKTVHSFSEKLSELDQIIRRMVLESLGLEKYLEEHIGSTNYLLRLMKYKGPQTNET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  SHTDK+ ++ +YQN  ++GLEI+ K+G  W  V   P S + M GD++ AW+N R
Sbjct  181   KLGINSHTDKNIVTILYQN-QVHGLEIQTKDG-KWINVKPLPESFIAMIGDSLYAWTNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP HRVMM G   RYS   FS  +   +I+ P E+VD +HPL FKPFDH+ +L F+  
Sbjct  239   LHSPPHRVMMTGNEDRYSTGLFSIPKAGYIIKAPEEVVDEEHPLLFKPFDHVEFLGFYYS  298

Query  376   EENRRLPCALKTYCGV  329
             E  +R P ALK YCGV
Sbjct  299   EAGQRAPSALKAYCGV  314



>ref|XP_002298129.1| 2-oxoglutarate-dependent dioxygenase-related family protein [Populus 
trichocarpa]
 gb|EEE82934.1| 2-oxoglutarate-dependent dioxygenase-related family protein [Populus 
trichocarpa]
Length=314

 Score =   328 bits (840),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 213/316 (67%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TPLKLP+IDF+     PG   W   + +   ALEEYGCF AL+DK+ +E  + +F 
Sbjct  1     MGSETPLKLPIIDFSNLGQNPGAAEWDLVKLQVRKALEEYGCFEALFDKIPAESRKAIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELFDLP   K+ N S KP +GYVGQ P VPL+ESMGID AN  + ++S T ++WPQG
Sbjct  61    AVEELFDLPLQTKMRNASKKPYHGYVGQYPQVPLFESMGIDDANIAEEVESMTTILWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FS  +L +S+  +EL+++V RM+ ES G+EKY + H+ S  YL RVMKY+  Q  E 
Sbjct  121   NQSFSNTVLSFSEQVSELDQIVRRMIVESLGLEKYLDEHMNSTNYLLRVMKYKGPQTTET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  +HTDK+ ++ +YQN  ++GLE++ K+G  W  +  +P S +VM GD++ AW+N R
Sbjct  181   KLGLTAHTDKNMVTILYQN-QVDGLELQTKDG-CWIDLKPTPDSFIVMIGDSLHAWANGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP+HRVMM G   RYS+  FS  +   +++ P EL+D +HPL FKPFDH+ +L F+  
Sbjct  239   LHSPYHRVMMRGNEARYSVGLFSVPKAGYIVKAPEELIDEEHPLLFKPFDHVKFLGFYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E  +R   ALKTYCGV
Sbjct  299   EAGQRAQSALKTYCGV  314



>ref|XP_009339601.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=312

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 211/315 (67%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  KLPVID + E++KP TD+W+ A +E   ALEEYGCF A+Y KV  E+H  +F 
Sbjct  1     MGSETQPKLPVIDLSDENLKPDTDAWLLACKEIKDALEEYGCFEAIYHKVPLELHNSIFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + +LF LP   K++  S +P + Y+GQ   +PLYES+ +D+  T+ G Q FT +MWPQG
Sbjct  61    AMEDLFGLPLETKMQKTSDRPYHSYIGQYSFLPLYESLAVDNPTTVDGSQGFTNIMWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E +   SKL AEL +MV RMVF+ YGV++ Y SH++S  Y  R +KYR  +ENE 
Sbjct  121   NDHFCETVHSISKLVAELSQMVTRMVFDVYGVQRLYNSHMESTTYQLRCLKYRTPEENET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              +G   HTDK+F+S + QN  +NGL+I+ K+G  W  V+ SPSS +++AGDA MAWSN+R
Sbjct  181   NMGLQPHTDKTFISIVNQN-QVNGLQIRTKDG-QWIDVNPSPSSFLILAGDAFMAWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             + S  H+++M+    RYS+  FSF +  +IQ P EL+D  HPL +KPFDH  +LDF    
Sbjct  239   VPSCEHQIIMKENKTRYSLGLFSF-KSGIIQVPEELIDEKHPLLYKPFDHFSFLDFGRTP  297

Query  373   ENRRLPCALKTYCGV  329
             E R L   +K YCGV
Sbjct  298   EARNLLRTIKAYCGV  312



>emb|CDY26055.1| BnaC06g05690D [Brassica napus]
Length=310

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/310 (50%), Positives = 221/310 (71%), Gaps = 5/310 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVA-LYDKVSSEVHERVFKGLVELF  1076
             K+P +DF++ED+KPGT  W +  +    ALEEYGCF+  L DK   ++ ++VF  LV+LF
Sbjct  4     KIPTLDFSREDLKPGTKYWKSTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVQLF  63

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             DLPT  K++NK  KPL GYVGQIP +PL+ES+GID+A +L+  +SFT LMWPQGN  FSE
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNKHFSE  123

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
              +  Y++ AA+L++MV RMVFESY VEK+Y+ +++S  YL RV+K      ++P LGFV+
Sbjct  124   CVHKYAEFAAKLDQMVTRMVFESYNVEKHYKPYIESTTYLLRVLKNSAPNNDKPNLGFVT  183

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIVVMAGDAIMAWSNNRIKSPH  539
             HTDKSF + ++QN  +NGLE++ + G+    ++L SPS  +++AGDA+MAWSN+R+ SP 
Sbjct  184   HTDKSFTTILHQN-QVNGLEMETREGEK-ININLSSPSLFMIVAGDALMAWSNDRVWSPR  241

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V++ G+  RYS+  FSF   T+ Q P EL+D  HPL +KPFDH+  L F+  +   + 
Sbjct  242   HQVLVSGETDRYSLGMFSFNNGTL-QVPEELIDHQHPLMYKPFDHIGLLRFYRTDIGYKS  300

Query  358   PCALKTYCGV  329
              C +K YCG+
Sbjct  301   ECPIKAYCGI  310



>ref|XP_002517541.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44705.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=314

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 220/316 (70%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TPLKLP IDF+ E++KPGT  W   + +  +ALEEYGCF A + +V +++ + VF 
Sbjct  1     MGSETPLKLPAIDFSTENLKPGTVEWELVKTQVRNALEEYGCFEAFFSRVHNDLKKGVFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELF+LP   K++N S KP +GYVGQ P  PLYESMGI+  +T++ ++SFT ++WPQG
Sbjct  61    AIEELFELPLQTKLKNVSRKPFHGYVGQYPQAPLYESMGIEDPDTVEKVESFTSVLWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FS+ +  +S+  ++L+++V RM+ ES G+EKY + H+ S  YL RVMKY+  + +E 
Sbjct  121   NLTFSKTVQSFSEQVSKLDKVVRRMIVESLGLEKYMDEHMNSTDYLLRVMKYKGPETSEA  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG   HTDK+ ++ ++QN  ++GLE+K KNG +W  V LSP S VVM GD+++AW+N R
Sbjct  181   KLGLHPHTDKNIVTILFQN-QVDGLEVKTKNG-EWITVKLSPDSFVVMIGDSLLAWANGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP+HRVMM G   RYS   FS  +   +++ P ELVD +HPL FKPFDH+ +L F+  
Sbjct  239   LHSPYHRVMMTGNEARYSCGLFSIPKAGYIVKAPEELVDEEHPLLFKPFDHVEFLGFYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E  +R   ALK YCGV
Sbjct  299   EAGQRAQSALKAYCGV  314



>ref|XP_002284968.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36202.3| unnamed protein product [Vitis vinifera]
Length=314

 Score =   327 bits (837),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/316 (50%), Positives = 211/316 (67%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TPLKLPVIDF+  ++KPGT  W   + +   ALEEYGCF A ++KV  ++ + +F 
Sbjct  1     MGSETPLKLPVIDFSDPELKPGTLQWNLVKAQVQKALEEYGCFEAFFNKVPLDLRKAIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K+ N S KP +GYVGQ P VPLYESMGID A   +  + FTKL+WP+G
Sbjct  61    ALEELFDLPLQTKLRNSSKKPYHGYVGQYPTVPLYESMGIDDALVQEKAEHFTKLLWPEG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N +F + +  +S+  +EL+  + RMV ES G+EKY + H+ S  YL RVMKY+  Q  E 
Sbjct  121   NPNFCKTIQSFSEQLSELDHTIRRMVLESLGMEKYLDEHMDSTNYLLRVMKYKGPQTTET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  +HTDK+ ++ +YQN  ++GL ++ K+G  W  +  SP S ++M GD+ +AW+N R
Sbjct  181   KLGLNAHTDKNIVTILYQN-QVDGLGVQTKDG-QWINIKCSPDSFIIMIGDSFLAWTNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP+HRVMM G   RYS   FS  +   +I+ P ELVD +HPL FKPFDHL +L F+  
Sbjct  239   LHSPYHRVMMTGNESRYSTGLFSIPKAGYVIKAPEELVDEEHPLLFKPFDHLEFLQFYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E  +R   ALKTYCGV
Sbjct  299   EAGQRAESALKTYCGV  314



>ref|XP_002517690.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44854.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=307

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/308 (51%), Positives = 217/308 (70%), Gaps = 8/308 (3%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             KLP +DF++E +KPG+  W+ A  E  +ALEEYGCFV  Y K+S E+ + VF  L ELFD
Sbjct  8     KLPALDFSQETLKPGSSCWLKACGEVRTALEEYGCFVVEYKKLSLELRDEVFAELKELFD  67

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LPT VK++NK  +PL  Y+GQ   +PL+ESMGI+ A+T +  Q+FT LMWP GND FSE 
Sbjct  68    LPTAVKMQNKCQRPLISYIGQNSRIPLHESMGIEDADTPEAAQNFTNLMWPNGNDRFSEC  127

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
             +  Y KL  EL+++V RM+FESYG+ KY++S+V+S CY+ R++K R  +E+E  LG  +H
Sbjct  128   IHAYGKLVVELDKIVTRMIFESYGLGKYHDSYVESTCYVIRLLKTRAPKEDETVLGLGAH  187

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TD SF + ++QN  +NGLEI  K+G     V  SP+S VVMAGDA+MAWSN+RIKSP H+
Sbjct  188   TDTSFTTILHQN-QVNGLEIDTKDGKK-INVDFSPTSFVVMAGDALMAWSNDRIKSPRHQ  245

Query  532   VMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPC  353
             V+M GK  RYS+  F+F    + Q P ELV+ DHPL +KPF+H+ +L F+   +N   P 
Sbjct  246   VIMNGKVDRYSMGLFTFNNGNL-QVPEELVNEDHPLTYKPFNHIEFLHFY---QNNHRP-  300

Query  352   ALKTYCGV  329
              ++ YCG+
Sbjct  301   -IRFYCGI  307



>gb|KFK35768.1| hypothetical protein AALP_AA4G033700 [Arabis alpina]
Length=310

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 215/310 (69%), Gaps = 5/310 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVA-LYDKVSSEVHERVFKGLVELF  1076
             K+P +DF++ED+K GT  W +  +  + ALEEYGCF+  L DK   ++ ++VF  LVELF
Sbjct  4     KIPTLDFSREDLKQGTKYWESTSKNIIQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             +LPT  K++N   KPL GYVGQIP +PL+ES+GID+A +L+   SFT LMWPQGN  FSE
Sbjct  64    NLPTQTKMKNTYDKPLNGYVGQIPALPLHESLGIDNATSLEATSSFTGLMWPQGNKHFSE  123

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
              M  Y++  AEL++MV RMVFESY V+KYY+ ++KS  YL RV+K R       KL FV+
Sbjct  124   CMHKYAEFTAELDQMVTRMVFESYNVKKYYDQYIKSTTYLLRVLKNRAPNNENKKLAFVT  183

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIVVMAGDAIMAWSNNRIKSPH  539
             HTDKSF + ++QN  +NGLE++   G+    ++L SPS  +++AGDA+MAWSN+R+ SP 
Sbjct  184   HTDKSFTTILHQN-QVNGLEMETTEGER-ININLSSPSLFMIVAGDALMAWSNDRVWSPR  241

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V+M G   RYS+  FSF   T+ Q P EL+D  HPL++KPFDH+  L F+  +   + 
Sbjct  242   HQVLMSGDTDRYSLGMFSFNNGTL-QVPEELIDHQHPLKYKPFDHIGLLRFYRTDTGYKS  300

Query  358   PCALKTYCGV  329
              C +K YCG+
Sbjct  301   ECPIKAYCGL  310



>ref|XP_010545796.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Tarenaya hassleriana]
Length=310

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 214/308 (69%), Gaps = 3/308 (1%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVA-LYDKVSSEVHERVFKGLVELFD  1073
             +P +DF++ED+KPGT  W    +    ALE+YGCF+  L++K   ++  RVF  L +LFD
Sbjct  5     IPTLDFSREDLKPGTSYWETTSKNIRQALEQYGCFIVDLHEKAPFDLLARVFDSLKQLFD  64

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LPT  K++NK  KP+ GYVGQIP +PL+ES+GID+A +LQ  +SFT LMWP+GND F + 
Sbjct  65    LPTPTKMKNKYDKPMNGYVGQIPALPLHESLGIDNATSLQSTRSFTDLMWPRGNDRFCDC  124

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
             M  Y++  AE++ MV RM+F SYGV KYYE ++KS  YL R++K R  ++  P L FV+H
Sbjct  125   MHRYAEFVAEMDRMVARMIFGSYGVAKYYEPYMKSTSYLLRLLKNRAPKDENPYLAFVTH  184

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TDKSF + ++Q+  INGLE++ + G+       SPS  +V+AGDA+MAWSN+RI SP HR
Sbjct  185   TDKSFTTILHQD-QINGLEMETRLGERINVDLSSPSLFMVIAGDALMAWSNDRILSPRHR  243

Query  532   VMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPC  353
             V++ G+  RYS+ QF+F   T +Q P ELVD +HPL +KPFDH+  L F+  +   R  C
Sbjct  244   VLVSGETDRYSLGQFAFSNGT-LQVPEELVDNEHPLMYKPFDHIGLLHFYRTDIGYRAEC  302

Query  352   ALKTYCGV  329
              +K YCGV
Sbjct  303   PIKAYCGV  310



>ref|XP_006427131.1| hypothetical protein CICLE_v10027420mg [Citrus clementina]
 gb|ESR40371.1| hypothetical protein CICLE_v10027420mg [Citrus clementina]
Length=314

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 210/316 (66%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  K+PVID +K+D+K GT +W++  ++   A EE+GCF A+Y K+S E    V  
Sbjct  1     MGSQTKSKIPVIDLSKQDLKSGTSTWLSTCKDVRHAFEEFGCFEAIYQKISQEFRSEVLA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELFD+P  +KV+N STKP + Y GQ  I+PLYES+ ID+ +T    QSFT LMWP G
Sbjct  61    STEELFDVPIEIKVKNTSTKPYFEYYGQYTIIPLYESLAIDYPDTRNATQSFTNLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E+ L  S+L  EL++MV RM+FESYGVE YY+S++ S  YL R  KYR  + NE 
Sbjct  121   NDCFCESSLSMSELVVELDKMVTRMLFESYGVEGYYDSYIGSVNYLLRYFKYRAPEPNET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             K+G   HTDK+  S I+Q  HINGL+++AK+G +W  V  SPSS +VMAGDA+MAW N+R
Sbjct  181   KMGLTPHTDKTMTSIIHQINHINGLQVQAKDG-EWIDVEPSPSSFIVMAGDALMAWGNDR  239

Query  553   IKSPHHRVMMEGKG-PRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             I+   H+V+M+     RYS+  FSF    ++  P EL D   PL++KPFDH  +L F   
Sbjct  240   IRPCRHQVIMDNASETRYSLGLFSF-SSGVVDIPKELGDETQPLKYKPFDHFGFLHFNQS  298

Query  376   EENRRLPCALKTYCGV  329
             EE ++   ++K YCG+
Sbjct  299   EEGKKSASSIKAYCGI  314



>emb|CAN80138.1| hypothetical protein VITISV_028512 [Vitis vinifera]
Length=314

 Score =   324 bits (830),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 210/316 (66%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TPLKLP IDF+  ++KPGT  W   + +   ALEEYGCF A ++KV  ++ + +F 
Sbjct  1     MGSETPLKLPXIDFSDPELKPGTLQWNLVKAQVQKALEEYGCFEAFFNKVPLDLRKAIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K+ N S KP +GYVGQ P VPLYESMGID A   +  + FTKL+WP+G
Sbjct  61    ALEELFDLPLQTKLRNSSKKPYHGYVGQYPTVPLYESMGIDDALVQEKAEHFTKLLWPEG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N +F + +  +S+  +EL+  + RMV ES G+EKY + H+ S  YL RVMKY+  Q  E 
Sbjct  121   NPNFCKTIQSFSEQLSELDHTIRRMVLESLGMEKYLDEHMDSTNYLLRVMKYKGPQTTET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  +HTDK+ ++ +YQN  ++GL ++ K+G  W  +  SP S ++M GD+ +AW+N R
Sbjct  181   KLGLNAHTDKNIVTILYQN-QVDGLGVQTKDG-XWINIKCSPDSFIIMIGDSFLAWTNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP+HRVMM G   RYS   FS  +   +I+ P ELVD +HPL FKPFDHL +L F+  
Sbjct  239   LHSPYHRVMMTGNESRYSTGLFSIPKAGYVIKAPEELVDEEHPLLFKPFDHLEFLQFYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E  +R   ALKTYCGV
Sbjct  299   EAGQRAESALKTYCGV  314



>ref|XP_007024009.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
 gb|EOY26631.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
Length=316

 Score =   323 bits (829),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 212/316 (67%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TPLKLPVIDFTK D+KPGT  W   + +   AL+EYGCF AL++++  +V E +F 
Sbjct  1     MGSETPLKLPVIDFTKPDLKPGTTEWDLVKGQVQQALQEYGCFEALFNRIPLDVRETIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K+ N S KP +GYVGQ P  PLYES+GID AN ++ +++ T+ +WP+G
Sbjct  61    ALEELFDLPLETKICNVSKKPYHGYVGQYPQAPLYESLGIDDANIIEKVEAQTRALWPEG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FS  +  +SK  AEL++ + RM+ ESY ++KY + H+ S  YL R+MKY+  +  E 
Sbjct  121   NKSFSNIIQSFSKQLAELDQTIRRMILESYDLDKYMDEHLDSTKYLLRLMKYKGPKTTET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  SHTDK+ ++ +YQN  + GLE++ K+G  WF V  S  S +VM G+++ AW N R
Sbjct  181   KLGLQSHTDKNIVTILYQN-EVEGLEVQTKDG-KWFDVKPSKGSFIVMIGESLHAWLNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + +P+HRVMM G   RYSI  FS  +   MI+ P ELVD  HPL FKPFDH+ +L F+  
Sbjct  239   LHAPYHRVMMSGDMARYSIGLFSIPKGGYMIKAPDELVDEAHPLLFKPFDHVQFLGFYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E  ++   ALK YCGV
Sbjct  299   EAGQKAESALKAYCGV  314



>gb|KFK35767.1| hypothetical protein AALP_AA4G033600 [Arabis alpina]
Length=313

 Score =   323 bits (829),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 215/316 (68%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFT-KEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             M S+   K+P++D T ++D+KP T +W +  +E+  ALEEYGCFVA+YD V+ ++ +  F
Sbjct  1     MESILKSKVPILDLTSQQDLKPNTSTWRSISKEACEALEEYGCFVAVYDGVTKQLDDSAF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
                 ELFDLPT  K +N + KP +GYVGQ+PI+PL+E +GID+    +  Q FT LMWPQ
Sbjct  61    AAAKELFDLPTETKRKNVNEKPYHGYVGQMPIIPLHEGLGIDYITNKEDAQRFTHLMWPQ  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN  F E +  +S   AEL+++VVRM+FE+YGVEK YESHV+S  YL + +KY    E+ 
Sbjct  121   GNHHFCETVQAFSTAVAELDKLVVRMIFENYGVEKNYESHVESKTYLLKFLKYLAPPEST  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
                 F  HTDK+F+S ++QN  +NGLE+K+K+G +W  + L P S VVMAGD  M WSN+
Sbjct  181   SMQAFPQHTDKTFLSILHQN-DVNGLEVKSKDG-EWISLQLPPKSYVVMAGDISMGWSND  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI+S  HRV MEG   RY++  FSF+   M+  P +LVD +HPL +KPFD++  ++F++ 
Sbjct  239   RIRSCEHRVTMEGDKTRYTLGLFSFV-TGMVSVPEDLVDDEHPLMYKPFDNIALINFYAT  297

Query  376   EENRRLPCALKTYCGV  329
             +E R     LK YCG+
Sbjct  298   KEGREANSTLKAYCGI  313



>ref|XP_009147661.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3 isoform 
X1 [Brassica rapa]
Length=310

 Score =   323 bits (828),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 154/310 (50%), Positives = 218/310 (70%), Gaps = 5/310 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVA-LYDKVSSEVHERVFKGLVELF  1076
             K+P +DF++ED+KPGT  W +  +    ALEEYGCF+  L DK   ++ ++VF  LVELF
Sbjct  4     KIPTLDFSREDLKPGTKYWKSTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             DLPT  K+ NK  KPL GYVGQIP +PL+ES+GID+A +L+  +SFT LMWPQGN  FSE
Sbjct  64    DLPTQTKMRNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNKHFSE  123

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
              +  Y++ AA+L++MV RMVFESY VEK+Y+ +++S  YL RV+K      ++  LGFV+
Sbjct  124   CVHKYAEFAAKLDQMVTRMVFESYNVEKHYKPYIESTTYLLRVLKNSAPNNDKSNLGFVT  183

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIVVMAGDAIMAWSNNRIKSPH  539
             HTDKSF + ++QN  +NGLE++ + G+    ++L SPS  +++AGDA+MAWSN+R+ SP 
Sbjct  184   HTDKSFTTILHQN-QVNGLEMETREGER-ININLSSPSLFMIVAGDALMAWSNDRVWSPR  241

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V++ G   RYS+  FSF   T+ Q P EL+D  HPL +KPFDH+  L F+  +   + 
Sbjct  242   HQVLVSGDTDRYSLGMFSFNNGTL-QVPEELIDHQHPLMYKPFDHIGLLRFYRTDIGYKS  300

Query  358   PCALKTYCGV  329
              C +K YCG+
Sbjct  301   VCPIKAYCGI  310



>ref|XP_007215723.1| hypothetical protein PRUPE_ppa008973mg [Prunus persica]
 gb|EMJ16922.1| hypothetical protein PRUPE_ppa008973mg [Prunus persica]
Length=312

 Score =   323 bits (828),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 212/315 (67%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  KLPVID + E++KPGT++WV A +    ALEEYGCF A++ KV  ++H  +F 
Sbjct  1     MGSETQPKLPVIDLSNENLKPGTEAWVLASKHVKYALEEYGCFEAVFHKVPLQLHNSIFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + +LFDLP   K +  S +P + Y GQ   +PLYES+G+D+  T++G + FTK+MWP G
Sbjct  61    VVEDLFDLPIETKRQQTSERPYHSYFGQYSFLPLYESLGVDNPTTVEGAKGFTKIMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E+   +SKL AEL++MV RMVF+ YGVE+ Y+SH+ S  YL R  KYRE +ENE 
Sbjct  121   NDHFCESAQSFSKLVAELDQMVTRMVFDIYGVERLYDSHMASTTYLLRCFKYREQKENET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              +G   H DK+F S ++Q+  ++GL++++K+G  W     SPSS +VMAGDA MAWSN+R
Sbjct  181   NVGLRPHKDKTFTSILHQS-QVHGLQVRSKDG-QWIEAEPSPSSFLVMAGDAFMAWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             ++S  H+V+M+    RYS+  FSF    ++Q P EL D  HPL +KPFDH  +L F    
Sbjct  239   VRSCDHQVIMKENKTRYSVGLFSF-NSGILQVPEELTDDQHPLLYKPFDHFSFLRFDQTP  297

Query  373   ENRRLPCALKTYCGV  329
             E ++  C +K YCGV
Sbjct  298   EAKKSECPIKAYCGV  312



>emb|CDY68239.1| BnaA06g37440D [Brassica napus]
Length=310

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/309 (50%), Positives = 218/309 (71%), Gaps = 5/309 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVA-LYDKVSSEVHERVFKGLVELF  1076
             K+P +DF++ED+KPGT  W +  +    ALEEYGCF+  L DK   ++ ++VF  LVELF
Sbjct  4     KIPTLDFSREDLKPGTKYWKSTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             DLPT  K++NK  KPL GYVGQIP +PL+ES+GID+A +L+  +SFT LMWPQGN  FSE
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNKHFSE  123

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
              +  Y++ AA+L++MV RMVFESY VEK+Y+ +++S  YL RV+K      ++  LGFV+
Sbjct  124   CVHKYAEFAAKLDQMVTRMVFESYNVEKHYKPYIESTTYLLRVLKNSAPNNDKSNLGFVT  183

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIVVMAGDAIMAWSNNRIKSPH  539
             HTDKSF + ++QN  +NGLE++ + G+    ++L SPS  +++AGDA+MAWSN+R+ SP 
Sbjct  184   HTDKSFTTILHQN-QVNGLEMETREGER-ININLSSPSLFMIVAGDALMAWSNDRVWSPR  241

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V++ G   RYS+  FSF   T+ Q P EL+D  HPL +KPFDH+  L F+  +   + 
Sbjct  242   HQVLVSGDTDRYSLGMFSFNNGTL-QVPEELIDHQHPLMYKPFDHIGLLRFYRTDIGYKS  300

Query  358   PCALKTYCG  332
              C +K YCG
Sbjct  301   ECPIKAYCG  309



>ref|XP_009339603.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=322

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 212/317 (67%), Gaps = 4/317 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S TPL +P+IDF+K D+  GT  W   R +  +ALEEYGCF AL+DKV S++ +   +
Sbjct  1     MASETPLGIPIIDFSKPDLNQGTKEWDLVRAQVRNALEEYGCFEALFDKVPSDIRKSTIE  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELFDLP   K++N S KP +GYVGQ P+VPLYESMG D AN  + ++S T  +WPQG
Sbjct  61    SIEELFDLPLQTKLQNVSKKPYHGYVGQYPMVPLYESMGFDDANVYEQVESLTNTLWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F   +  +S+  +EL++++ RM+ ES G+EKY+E HV+S  YL RVMKY+  +  E 
Sbjct  121   NPRFCTTIQSFSEQVSELDQIIRRMILESLGLEKYFEEHVESTNYLLRVMKYKGPETKET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLS-PSSIVVMAGDAIMAWSNN  557
             KLG  +HTDK+ ++ +YQN  ++GLE++ K G  W  V  S P S + M GD++ AW+N 
Sbjct  181   KLGINAHTDKNIVTILYQN-QVDGLEVQTKAG-KWIKVKPSLPHSFIAMIGDSLYAWTNG  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSF-MEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             R+ SP+HRVMM G   RYS   FS   E  +I+ P E+VD +HPL FKPFDH+ +L F+ 
Sbjct  239   RLHSPYHRVMMSGNEARYSTGLFSIPKEGYIIKAPEEVVDEEHPLLFKPFDHVEFLGFYY  298

Query  379   KEENRRLPCALKTYCGV  329
              E  +R   ALKTYCGV
Sbjct  299   TEAGQRAQSALKTYCGV  315



>gb|ACU24369.1| unknown [Glycine max]
Length=307

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/317 (51%), Positives = 216/317 (68%), Gaps = 12/317 (4%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS     LPV+DFT ED+KPGT+SW++       A EE G FVA+YDK S+E+   VF 
Sbjct  1     MGSEGKPMLPVLDFTIEDLKPGTNSWLSTCTSVRQAFEENGYFVAVYDKASTELQNGVFG  60

Query  1093  GLVELFDLPTNVKVENK-STKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
              + ELFDLPT  K  N     PL GYVGQ P +PL+ESMGID   TL+GIQSF + MWP 
Sbjct  61    SMKELFDLPTETKRRNIFEGMPLKGYVGQHPKIPLHESMGIDPGTTLEGIQSFAEKMWPH  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND F + +  Y+K+A  L  MVVRM+FESYG+ ++Y++ + S  YL R++ ++  ++NE
Sbjct  121   GNDQFCKYIFEYAKVAEVLNRMVVRMIFESYGLLEHYDTFIGSTNYLLRLLAHKALEQNE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIVVMAGDAIMAWSN  560
             P+LGFV+HTDKSF + ++QN H+N L ++  NG +W  V   SP+S VVMAGDA+MAWSN
Sbjct  181   PQLGFVAHTDKSFTTILHQN-HVNALMVETTNG-NWIDVDFSSPTSFVVMAGDALMAWSN  238

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             +RIKSP+H VMM G   RYS+  F+F  + +++ P EL+D +HPLQ+KPFDHL  L+F  
Sbjct  239   DRIKSPNHMVMMNGNETRYSLGLFAFY-RGILKVPEELIDEEHPLQYKPFDHLALLNF--  295

Query  379   KEENRRLPCALKTYCGV  329
                       +K YCGV
Sbjct  296   -----TYSANMKAYCGV  307



>emb|CDP20247.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 210/315 (67%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M   + ++LPVI+ T+E ++ G DSW  AR     A EEYGCF+A++DK  SEV + +F 
Sbjct  1     MECASNIRLPVINLTEEILRSGKDSWTEARNIVTRAFEEYGCFIAVHDKYPSEVSDSLFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L +LF+LP  +KV+N S  PL GY    P V LYESM I+ A  L+ ++ F   MWP  
Sbjct  61    ELQDLFNLPLEIKVQNTSQTPLSGYARPRPNVNLYESMCIEDATNLEAVEKFANQMWPSK  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N+ F E    Y+   AEL++MV ++VFESYGVEKY+ESHV S  Y  R ++YR  ++NE 
Sbjct  121   NNHFCELFHCYANQVAELDKMVSKLVFESYGVEKYHESHVGSVTYNVRFIRYRVPEQNEM  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              +G   HTDK+F++ + QN   +GLE++ KNG  W  +   PSS+V+MAGD   AWSN R
Sbjct  181   NVGVAPHTDKNFITILQQN-ETDGLEVQLKNG-SWIPIDFPPSSVVIMAGDVFSAWSNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             + SP HRV M+G+G RYSIAQFS+ +K +++TPTELVD +HPL +KPFD   YL F S  
Sbjct  239   VHSPFHRVTMKGRGTRYSIAQFSYCKK-LVKTPTELVDDEHPLLYKPFDCFGYLRFLSTN  297

Query  373   ENRRLPCALKTYCGV  329
             E+  +P +LK YCGV
Sbjct  298   EDWNIPNSLKVYCGV  312



>ref|XP_002517546.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44710.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=321

 Score =   322 bits (824),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 212/317 (67%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS  P K+PVIDF++E++KPGT SWV+  +  + ALEEYGCF+A+Y+K+  E+    + 
Sbjct  1     MGSRIPPKIPVIDFSQENLKPGTSSWVSTCKNVLRALEEYGCFIAVYEKIPLELQSSFYN  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVP-LYESMGIDHANTLQGIQSFTKLMWPQ  917
              L+ LFDLP + K +N S  P YGYVG  P VP LYE MGI++A T++G   FT +MWP 
Sbjct  61    KLITLFDLPIDTKRKNVSAIPYYGYVGNQPFVPPLYEGMGINNAATMEGTLDFTNIMWPN  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             G+DDF + +  YSK  AELE+MV RMVFE YGV+  Y++  +   YL R+MKYR   E E
Sbjct  121   GDDDFCKTVFSYSKWVAELEQMVTRMVFEGYGVQYSYDTQQERTNYLFRMMKYRAPTEGE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVH-LSPSSIVVMAGDAIMAWSN  560
               LG   HTDK F++ ++QN  ++GLE++ K+G  W      SPSS +VMA DA++AWSN
Sbjct  181   SDLGCDVHTDKGFITVLHQN-EVSGLEVQTKDG-QWVCFEPSSPSSFIVMAADALLAWSN  238

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
              RI +  HRV+M G   RYS+  FS++ K + + P EL+D +HPLQFKPFD+   L +F 
Sbjct  239   GRIHAAFHRVVMRGSKARYSVGLFSYL-KGITEVPEELIDEEHPLQFKPFDNFGLLHYFY  297

Query  379   KEENRRLPCALKTYCGV  329
              EE R     +K YCG+
Sbjct  298   TEEGREKESTVKAYCGL  314



>ref|XP_009771248.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Nicotiana sylvestris]
Length=313

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 211/316 (67%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T +KLP IDF+ ED+KPG+  W   + +   AL  YGCF A +DK+   + + +F+
Sbjct  1     MGSET-IKLPNIDFSNEDLKPGSLVWNQVKNQVHKALVNYGCFEASFDKIPIHLRKSIFE  59

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K+ N STKP +GYVGQ P VPLYESMGID AN     + FT+++WP+G
Sbjct  60    SLKELFDLPLQTKIRNISTKPFHGYVGQYPAVPLYESMGIDDANISDKAERFTRILWPEG  119

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N +F + +  YS+  +EL++ V +M+ ES GVEKY + H+ S  YL RVMKY+  Q N+ 
Sbjct  120   NPNFCKTIQSYSEQLSELDQTVRKMILESLGVEKYMDEHMNSTNYLLRVMKYKGPQSNDT  179

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  +HTDK+ ++ +YQN  +NGLE+  K+G  W  V  +P + +VM GD++ AW+N R
Sbjct  180   KLGLNAHTDKNIVTILYQN-QVNGLEVLTKDG-QWINVEPTPDAFIVMIGDSLYAWANGR  237

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTM-IQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP+HRVMM G   RYS+  FS  +    I+ P EL D +HPL FKPFDH+ +L F+  
Sbjct  238   VHSPYHRVMMTGNEARYSVGLFSIPKAGYKIKAPEELADKEHPLLFKPFDHVEFLAFYYT  297

Query  376   EENRRLPCALKTYCGV  329
             EE +R   ALKTYCGV
Sbjct  298   EEGQRCGSALKTYCGV  313



>ref|XP_006305421.1| hypothetical protein CARUB_v10009821mg [Capsella rubella]
 gb|EOA38319.1| hypothetical protein CARUB_v10009821mg [Capsella rubella]
Length=310

 Score =   321 bits (822),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/310 (50%), Positives = 219/310 (71%), Gaps = 5/310 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVA-LYDKVSSEVHERVFKGLVELF  1076
             K+P +DF++ED+K GT  W    +    ALEEYGCF+  L +K   ++ ++VF  LV+LF
Sbjct  4     KIPTLDFSREDLKQGTQYWETTSKNIRQALEEYGCFIIDLQNKTPLDLLDQVFGSLVDLF  63

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             DLPT  K++NK  KPL GYVGQIP +PL+ES+GID+A +L+  +SFT LMWPQGN+ FSE
Sbjct  64    DLPTQTKMKNKYDKPLSGYVGQIPALPLHESLGIDNATSLKETRSFTGLMWPQGNEHFSE  123

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
              +  Y++ AA+L++MVV+MVFESY VEKYY+ +++S  YL RV+K       +P LGFV+
Sbjct  124   CLHKYAEFAAKLDQMVVQMVFESYNVEKYYDPYIESTTYLLRVLKNCAPNNEKPTLGFVT  183

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIVVMAGDAIMAWSNNRIKSPH  539
             HTDKSF + ++Q+  +NGLE++ + G+    ++L SPS  +V AGDA+ AWSN+R+ SP 
Sbjct  184   HTDKSFTTILHQD-QVNGLELETREGER-VNINLSSPSLFMVFAGDALRAWSNDRVWSPR  241

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V++ GK  RYS+A F+F   T+ Q P EL+D  HPL +KPFDHL  L F+  +   + 
Sbjct  242   HQVLVSGKTDRYSLAMFAFNNGTL-QVPEELIDHQHPLMYKPFDHLGLLSFYRTDTGYKS  300

Query  358   PCALKTYCGV  329
              C +K YCG+
Sbjct  301   ECPIKAYCGI  310



>ref|XP_010061960.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Eucalyptus grandis]
Length=318

 Score =   321 bits (823),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 213/316 (67%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M SL    +PVIDF  +D+K GT +W +  ++    LEE+GCF+ALY  V  E+ +  FK
Sbjct  1     MASLISAVVPVIDFNGKDLKQGTSAWDSTMKQMCHGLEEFGCFIALYAGVPPELDDATFK  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELFDLPT +K +N + KP +GYVGQ+ I+PL+E +GID+A   + +  FTKLMWP G
Sbjct  61    AADELFDLPTEIKSQNVNDKPYHGYVGQVSIIPLHEGLGIDNATDPEEVGKFTKLMWPHG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE-NE  737
             ND F E    YS   AEL+ MVVRM+FE+YGVEK+Y+SHV S  YL R +KYR  +  ++
Sbjct  121   NDHFGEVAYSYSMKVAELDHMVVRMIFENYGVEKHYDSHVASKSYLLRFLKYRAPETIDQ  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
                    HTDK+F+S ++QN  INGLEIK K G +W G  L P++ VVMAGDA+M WSN+
Sbjct  181   GDNAIPRHTDKTFLSILHQN-RINGLEIKTKEG-EWIGFDLPPNAFVVMAGDALMGWSND  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI+S  HRV M+    RY++  FSF+   ++Q P ELVD +HPL++KPFD++  + F++ 
Sbjct  239   RIRSCDHRVAMKASTTRYTLGLFSFL-SGIVQVPQELVDENHPLKYKPFDNVAMIHFYAS  297

Query  376   EENRRLPCALKTYCGV  329
             +E R+    +K YCG+
Sbjct  298   DEGRKHEYTVKAYCGI  313



>ref|XP_010061959.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Eucalyptus 
grandis]
 gb|KCW69006.1| hypothetical protein EUGRSUZ_F02566 [Eucalyptus grandis]
Length=313

 Score =   321 bits (822),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 159/317 (50%), Positives = 213/317 (67%), Gaps = 6/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T + +P ID T E+ KP + SWV    +   ALEE+G FVA YDK+S  + E +  
Sbjct  1     MGSQT-MPIPTIDLTLENSKPQSSSWVTTCNDVRLALEEHGWFVAKYDKLSPHLREVILS  59

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              +VELF LP   K++N S KP +GYVG+I  +PL+E +GID A  L   Q FTKLMWP G
Sbjct  60    DVVELFKLPYETKIQNTSDKPAFGYVGKIAAIPLHEGLGIDRATDLGECQKFTKLMWPSG  119

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E   +Y+K  AELE+ VVRM+FESYGVEK+ ESH+ +  YL R + YR  + +E 
Sbjct  120   NDRFCENAQLYAKTVAELEQTVVRMLFESYGVEKHCESHLGATTYLLRFLNYRRPENDEA  179

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              L FV+HTDKSF+S ++QN H+ GLE++ K+G +W G   SPSS +V+AGDA MAWSNNR
Sbjct  180   NLAFVTHTDKSFISILHQN-HVRGLELRNKDG-EWIGFEPSPSSFLVLAGDACMAWSNNR  237

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             ++  +HRV+M+G   RY++  FSF    +I+TP EL+D +HP+Q+KPFDH+  L F+   
Sbjct  238   VRPGYHRVVMKGNEARYALGLFSF-RGGLIETPEELIDDEHPMQYKPFDHVGLLRFYDTV  296

Query  373   ENRRLP--CALKTYCGV  329
             + R        K YCGV
Sbjct  297   DVRERAKHTMTKAYCGV  313



>ref|XP_003535849.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=307

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/317 (51%), Positives = 215/317 (68%), Gaps = 12/317 (4%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS     LPV+DFT ED+KPGT+SW++       A EE G FVA+YDK S E+   VF 
Sbjct  1     MGSEGKPMLPVLDFTIEDLKPGTNSWLSTCTSVRQAFEENGYFVAVYDKASIELQNGVFG  60

Query  1093  GLVELFDLPTNVKVENK-STKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
              + ELFDLPT  K  N     PL GYVGQ P +PL+ESMGID   TL+GIQSF + MWP 
Sbjct  61    SMKELFDLPTETKRRNIFEGMPLKGYVGQHPKIPLHESMGIDPGTTLEGIQSFAEKMWPH  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND F + +  Y+K+A  L  MVVRM+FESYG+ ++Y++ + S  YL R++ ++  ++NE
Sbjct  121   GNDQFCKYIFEYAKVAEVLNRMVVRMIFESYGLLEHYDTFIGSTNYLLRLLAHKALEQNE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIVVMAGDAIMAWSN  560
             P+LGFV+HTDKSF + ++QN H+N L ++  NG +W  V   SP+S VVMAGDA+MAWSN
Sbjct  181   PQLGFVAHTDKSFTTILHQN-HVNALMVETTNG-NWIDVDFSSPTSFVVMAGDALMAWSN  238

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             +RIKSP+H VMM G   RYS+  F+F  + +++ P EL+D +HPLQ+KPFDHL  L+F  
Sbjct  239   DRIKSPNHMVMMNGNETRYSLGLFAFY-RGILKVPEELIDEEHPLQYKPFDHLALLNF--  295

Query  379   KEENRRLPCALKTYCGV  329
                       +K YCGV
Sbjct  296   -----TYSANMKAYCGV  307



>ref|XP_006306220.1| hypothetical protein CARUB_v10011908mg [Capsella rubella]
 gb|EOA39118.1| hypothetical protein CARUB_v10011908mg [Capsella rubella]
Length=315

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 214/312 (69%), Gaps = 4/312 (1%)
 Frame = -2

Query  1261  TPLKLPVIDFT-KEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLV  1085
             T  K+P++DFT ++D+KP T +W +  RE+  ALEEYGCFVA+YD V+ ++ + VF    
Sbjct  7     TTSKVPILDFTSQQDLKPNTSAWRSISREACEALEEYGCFVAVYDGVTQKLEDNVFAAAK  66

Query  1084  ELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDD  905
             +LF LPT  K++N + KP +GYVGQ+PI+PL+E +GID+    +  Q FT LMWPQGND 
Sbjct  67    DLFHLPTETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAQRFTNLMWPQGNDQ  126

Query  904   FSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLG  725
             F + +  +S   AEL+++VVRM+FE+YGVEK+YESHV S  YL + + Y    E+     
Sbjct  127   FCKTIHSFSNAVAELDKLVVRMIFENYGVEKHYESHVGSKTYLLKFLMYLAPPESISMPA  186

Query  724   FVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKS  545
             F  HTDK+F++ ++QN  +NGLE+K+K+G +W  + L   S VVMAGD  M WSN+RI+S
Sbjct  187   FPQHTDKTFLTILHQN-DVNGLEVKSKDG-EWISLQLPLKSYVVMAGDISMGWSNDRIRS  244

Query  544   PHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENR  365
               HRV MEG   RYSI  FSF+   ++  P ELVD +HPL +KPFD++  ++FF+ +E R
Sbjct  245   CVHRVTMEGDKVRYSIGLFSFL-TGLVSIPEELVDDEHPLMYKPFDNIALINFFATKEGR  303

Query  364   RLPCALKTYCGV  329
                  LK YCGV
Sbjct  304   ETNSTLKAYCGV  315



>ref|XP_006465423.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Citrus sinensis]
Length=315

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 212/317 (67%), Gaps = 4/317 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TP+KLP+IDF+K ++KPGT  W + +     ALE+YGCF AL++KV  E+ + VF 
Sbjct  1     MGSETPIKLPIIDFSKPNLKPGTPEWDSVKSHVRKALEDYGCFEALFNKVPEEILKAVFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K+ N S KP +GYVGQ P VPLYESMGID AN  + ++S T ++WP+G
Sbjct  61    ALEELFDLPLRTKMRNISKKPFHGYVGQYPQVPLYESMGIDDANVKEKVESMTNILWPEG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F + +  +S+  +EL++ + RM+ ES G+EKY + H+ S  YL RVMKY+  +  E 
Sbjct  121   NKSFCKTIQSFSEQVSELDQTIRRMILESLGLEKYMDEHMNSTSYLLRVMKYKGPETTEK  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVH-LSPSSIVVMAGDAIMAWSNN  557
             KLG  +HTDK+ ++ +YQN  + GLE++ KNG +W  V   SP S + M GD++ AW+N 
Sbjct  181   KLGLNAHTDKNIVTILYQN-QVEGLELQTKNG-EWINVKPSSPHSFIAMIGDSLYAWTNG  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTM-IQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             ++ SP+HRVMM G   RYS   FS  +    I+ P ELVD +HPL FK FDH  +L+F+ 
Sbjct  239   QLYSPYHRVMMTGIETRYSTGLFSIPKAGYKIEAPEELVDEEHPLLFKSFDHFEFLEFYY  298

Query  379   KEENRRLPCALKTYCGV  329
              E  +R   ALKTYCGV
Sbjct  299   TEAGQRAESALKTYCGV  315



>ref|XP_006427129.1| hypothetical protein CICLE_v10027545mg, partial [Citrus clementina]
 gb|ESR40369.1| hypothetical protein CICLE_v10027545mg, partial [Citrus clementina]
Length=339

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 216/317 (68%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS    KLP++D ++E++KPG+ SW  A  E   ALEEYGCFVALYDK+  E   +VF 
Sbjct  26    MGSEAAQKLPIVDLSQENLKPGSSSWQTACNEIRLALEEYGCFVALYDKLLPEFRNKVFD  85

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K++N + KP +GY+G+I   PL+E MGI++A      + FT LMWPQG
Sbjct  86    SLEELFDLPQETKMKNVNPKPAHGYMGKISAFPLHEGMGIEYATNRGECEKFTSLMWPQG  145

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F E    Y+ + AEL+++V++M+FESYGVEK YES  +S  YL R +KYR++Q +  
Sbjct  146   NYQFCEVAHTYANIVAELQQLVMKMLFESYGVEKLYESQKESTTYLLRFLKYRKSQTDTT  205

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              L F  HTDKS +S ++ N H+ GLE++ K+G +W     SPSS V++AGD  MAWSN+R
Sbjct  206   NLAFKGHTDKSLVSILHSN-HVKGLELRTKDG-EWIHFEPSPSSFVIIAGDVCMAWSNDR  263

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF--S  380
             IKS +HRV+++G   RY++  FSF+   +IQTP ELVD +HPLQ+KPFDH   L F+  +
Sbjct  264   IKSCYHRVIVDGPEVRYALGLFSFL-SGVIQTPEELVDDEHPLQYKPFDHAGLLQFYLSN  322

Query  379   KEENRRLPCALKTYCGV  329
              ++N+     +K YCG+
Sbjct  323   SDQNKGERNMMKAYCGI  339



>ref|XP_010665883.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Beta vulgaris subsp. vulgaris]
Length=319

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/313 (49%), Positives = 211/313 (67%), Gaps = 3/313 (1%)
 Frame = -2

Query  1267  SLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGL  1088
             +L  L+LP I+   E+  PGT SW +       ALEEYGCF+A+YDK S ++H +    +
Sbjct  5     TLAKLQLPTINLGGENTNPGTSSWTSTCNNIKQALEEYGCFIAVYDKFSLDLHNKAIDVI  64

Query  1087  VELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGND  908
               +F+LPT VK  N S  P +GY      +PL ES+GI+ A     ++SFT L+WP GN 
Sbjct  65    QPMFELPTEVKARNSSNLPYHGYYKPGNPMPLLESLGIEDALMRNAVRSFTNLLWPSGNH  124

Query  907   DFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKL  728
              F E +  Y+K  AELE++V+RMVFESYGVEKY+ SH+ S  YL R+ KYR  Q+NE  L
Sbjct  125   QFCETIDQYAKKVAELEQLVLRMVFESYGVEKYHNSHLNSTSYLLRIAKYRVPQKNEHNL  184

Query  727   GFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIK  548
             G V HTDK+F++ +++N  +NGLE++ K+G +W  +  SP S +VMAG+  +AWSNNRI 
Sbjct  185   GAVGHTDKNFITILHEN-DVNGLEVQTKDG-EWLSIDSSPQSFIVMAGEPFLAWSNNRIH  242

Query  547   SPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEEN  368
             +P HRV+M+G  PRYS A FS  + T I+TP ELVD +HPLQFKPFD++  L F++++ +
Sbjct  243   APLHRVIMKGDKPRYSFALFSTTKDT-IETPKELVDDEHPLQFKPFDYMGLLQFYTEDVS  301

Query  367   RRLPCALKTYCGV  329
             R   C +K YCG+
Sbjct  302   RMAVCTIKDYCGI  314



>ref|NP_175689.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAG52291.1|AC019018_28 putative oxidoreductase; 33116-34434 [Arabidopsis thaliana]
 gb|AAY78650.1| oxidoreductase [Arabidopsis thaliana]
 gb|AEE32853.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=314

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 212/313 (68%), Gaps = 4/313 (1%)
 Frame = -2

Query  1264  LTPLKLPVIDFT-KEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGL  1088
             L   K+P++D T ++++KP T +W +  RE+  ALEEYGCF+A+YD V+ ++ + +F   
Sbjct  5     LKTTKVPILDLTSQQELKPNTSTWRSVSREACEALEEYGCFLAVYDGVTQQLDDSIFAAA  64

Query  1087  VELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGND  908
              ELFDLPT  K +N + KP +GYVGQ+P++PL+E +G+D+    +  Q FT LMWPQGND
Sbjct  65    EELFDLPTETKKKNVNEKPYHGYVGQMPVIPLHEGLGVDYVTNKEIAQRFTHLMWPQGND  124

Query  907   DFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKL  728
              F   +  +S   AEL+ +VVRM+FE+YGVEK+YESHV S  YL + +KY    E+    
Sbjct  125   RFCNTVHTFSNAVAELDRLVVRMIFENYGVEKHYESHVGSKTYLLKFLKYLAPPESISMP  184

Query  727   GFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIK  548
              F  HTDK+F+S ++QN  +NGLE+K+K+G +W  + L P S VVMAGD  M WSN+RI+
Sbjct  185   AFPQHTDKTFLSILHQN-DVNGLEVKSKDG-EWISLQLPPKSYVVMAGDISMGWSNDRIR  242

Query  547   SPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEEN  368
             S  HRV MEG   RY++  FSF+   ++  P ELVD  HPL +KPFD++  ++F++ +E 
Sbjct  243   SCEHRVTMEGDKTRYTLGLFSFLTD-LVSIPEELVDDKHPLMYKPFDNIALINFYTTKEG  301

Query  367   RRLPCALKTYCGV  329
             R     LK YCG+
Sbjct  302   REANSTLKAYCGI  314



>ref|XP_008228621.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=312

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/315 (48%), Positives = 211/315 (67%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  KLPVID + E++KPGT++WV A +    ALEEYGCF A++ KV  ++H  +F 
Sbjct  1     MGSETQPKLPVIDLSNENLKPGTEAWVLASKHVKYALEEYGCFEAVFHKVPLQLHNSIFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + +LFDLP   K +  S +P + Y GQ   +PLYES+G+D+  T++G Q FTK+MWP G
Sbjct  61    VVEDLFDLPIETKRQQTSERPYHSYFGQYSFLPLYESLGVDNPTTVEGAQGFTKIMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E+   +SKL AEL++MV RMVF+ YGVE+ Y+SH+ S  YL R  KYRE +ENE 
Sbjct  121   NDHFCESAQSFSKLVAELDQMVTRMVFDIYGVERLYDSHMASTTYLFRCFKYREQKENET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              +G   H DK+F S ++Q+  ++GL++++K+   W     SPSS +VMAGDA MAWSN+R
Sbjct  181   NVGLRPHKDKTFTSILHQS-QVHGLQVRSKDC-QWIDAEPSPSSFLVMAGDAFMAWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             ++S  H+V+M+    RYS+  FSF    +++ P EL D  HPL +KPFDH  +L F    
Sbjct  239   VRSCDHQVIMKENKTRYSLGLFSF-NSGILEVPEELTDDQHPLLYKPFDHFGFLRFDQTP  297

Query  373   ENRRLPCALKTYCGV  329
             E ++  C +K YCGV
Sbjct  298   EAKKSECPIKAYCGV  312



>ref|XP_010462133.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Camelina 
sativa]
Length=310

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/309 (49%), Positives = 214/309 (69%), Gaps = 3/309 (1%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVA-LYDKVSSEVHERVFKGLVELF  1076
             K+P +DF++ED+KPGT  W + R+    ALEEYGCF+  L DK    + ++VF  LV+LF
Sbjct  4     KIPTLDFSREDLKPGTKYWESTRKNITQALEEYGCFIIDLQDKTPLNLLDQVFGSLVDLF  63

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             DLPT  K++NK  KPL GYVGQIP +PL+ES+GID+A +L+  +SFT LMWPQGN+ FS 
Sbjct  64    DLPTQTKMKNKYNKPLSGYVGQIPTLPLHESLGIDNATSLEATRSFTGLMWPQGNEHFSA  123

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
              +  Y++ AA+L+++V+++VFESY VEKYY  +++S  YL R++K        P LGFV+
Sbjct  124   CLHNYAEFAAKLDQIVIQIVFESYNVEKYYNPYMESTTYLLRMLKNCAPNIKNPTLGFVT  183

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHH  536
             HTDKSF + ++Q+  +NGLE++ + G+       SPS  +V AGDA  AWSN+R+ SP H
Sbjct  184   HTDKSFTTILHQD-QVNGLEMETREGERIIINLSSPSLFMVFAGDAFRAWSNDRVWSPRH  242

Query  535   RVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLP  356
             +V++ G+  RYS+A F+F   T+ Q P EL+D  HPL +KPFDHL  L F+  +   +  
Sbjct  243   QVLVSGETDRYSLAMFAFNSGTL-QVPEELIDHQHPLMYKPFDHLGLLRFYRTDTGYKSE  301

Query  355   CALKTYCGV  329
             C +K YCG+
Sbjct  302   CPIKAYCGI  310



>gb|KHN31409.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=307

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 215/317 (68%), Gaps = 12/317 (4%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS     LPV+DFT ED+KPGT+SW++       A EE G FVA+YDK S E+   VF 
Sbjct  1     MGSEGKPMLPVLDFTIEDLKPGTNSWLSTCTSVRQAFEENGYFVAVYDKASIELQNGVFG  60

Query  1093  GLVELFDLPTNVKVENK-STKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
              + ELFDLPT  K  N     PL GYVGQ P +PL+ESMGID   TL+GIQSF + +WP 
Sbjct  61    SMKELFDLPTETKRRNIFEGMPLKGYVGQHPKIPLHESMGIDPGTTLEGIQSFAEKLWPH  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND F + +  Y+K+A  L  MVVRM+FESYG+ ++Y++ + S  YL R++ ++  ++NE
Sbjct  121   GNDQFCKYIFEYAKVAEVLNRMVVRMIFESYGLLEHYDTFIGSTNYLLRLLAHKALEQNE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIVVMAGDAIMAWSN  560
             P+LGFV+HTDKSF + ++QN H+N L ++  NG +W  V   SP+S VVMAGDA+MAWSN
Sbjct  181   PQLGFVAHTDKSFTTILHQN-HVNALMVETTNG-NWIDVDFSSPTSFVVMAGDALMAWSN  238

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             +RIKSP+H VMM G   RYS+  F+F  + +++ P EL+D +HPLQ+KPFDHL  L+F  
Sbjct  239   DRIKSPNHMVMMNGNETRYSLGLFAFY-RGILKVPEELIDEEHPLQYKPFDHLALLNF--  295

Query  379   KEENRRLPCALKTYCGV  329
                       +K YCGV
Sbjct  296   -----TYSANMKAYCGV  307



>ref|XP_006465422.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Citrus sinensis]
 gb|KDO58206.1| hypothetical protein CISIN_1g046776mg [Citrus sinensis]
Length=314

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 215/317 (68%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS    KLP++D ++E++KPG+ SW  A  E   ALEEYGCFVALYDK   E   +VF 
Sbjct  1     MGSEAAQKLPIVDLSQENLKPGSSSWQTACNEIRLALEEYGCFVALYDKHLPEFRNKVFD  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K++N + KP +GY+G+I   PL+E MGI++A      + FT LMWPQG
Sbjct  61    SLEELFDLPQETKMKNVNPKPAHGYMGKISAFPLHEGMGIEYATNRGECEKFTSLMWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F E    Y+ + AEL+++V++M+FESYG+EK YES  +S  YL R +KYR++Q +  
Sbjct  121   NYQFCEVAHTYANIVAELQQLVMKMLFESYGIEKLYESQKESTTYLLRFLKYRKSQTDTT  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              L F  HTDKS +S ++ N H+ GLE++ K+G +W     SPSS V++AGD  MAWSN+R
Sbjct  181   NLAFKGHTDKSLVSILHSN-HVKGLELRTKDG-EWIHFEPSPSSFVIIAGDVCMAWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF--S  380
             IKS +HRV+++G   RY++  FSF+   +IQTP ELVD +HPLQ+KPFDH   L F+  +
Sbjct  239   IKSCYHRVIVDGPEVRYALGLFSFL-SGVIQTPEELVDDEHPLQYKPFDHAGLLQFYLSN  297

Query  379   KEENRRLPCALKTYCGV  329
              ++N+     +K YCG+
Sbjct  298   SDQNKGERNMMKAYCGI  314



>ref|XP_009147660.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
Length=315

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/307 (49%), Positives = 209/307 (68%), Gaps = 4/307 (1%)
 Frame = -2

Query  1246  PVIDFT-KEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             PV+D T ++D+ P T +W +  RE+  ALEEYGCFVALYD V+ E+ + +F    ELFDL
Sbjct  12    PVLDLTSRQDLNPNTSTWRSISREACEALEEYGCFVALYDGVTQELDDSIFAAAEELFDL  71

Query  1069  PTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEAM  890
             PT+ K +N + KP +GYVGQ+P++PL+E +GID+    +  Q FT LMWPQGN  F E  
Sbjct  72    PTDTKRKNVNEKPYHGYVGQMPVIPLHEGLGIDYVTNKEEAQRFTHLMWPQGNHQFCETA  131

Query  889   LVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSHT  710
               +S   AEL+ +VVRM+F++YGVEK+Y+SHV S  YL + +KY    E+     F  HT
Sbjct  132   HGFSNAVAELDRLVVRMIFDNYGVEKHYDSHVGSKTYLLKFLKYLAPPESISMAAFPQHT  191

Query  709   DKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHRV  530
             DK+F+S ++QN  +NGLE+K+K+G  W  +HL P S VVMAGD  M WSN+RI+S  HRV
Sbjct  192   DKTFLSILHQNG-VNGLEVKSKDG-GWISLHLPPKSYVVMAGDISMGWSNDRIRSCEHRV  249

Query  529   MMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPCA  350
              MEG   RY++  FSF+ K ++  P ELVD +HPL +KPFD++  ++F++ +E R     
Sbjct  250   TMEGDKTRYTLGLFSFI-KGLVSVPEELVDDEHPLMYKPFDNIALINFYATKEGREAKST  308

Query  349   LKTYCGV  329
             LK YC +
Sbjct  309   LKAYCCI  315



>emb|CDP08458.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   318 bits (815),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 208/316 (66%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T   LP IDF+   +KPG   W   + +   ALEEYGCF AL+DK+  E+ + +F 
Sbjct  1     MGSET-TSLPTIDFSNPGLKPGAPEWDLVKDQVRKALEEYGCFEALFDKIPLELQKSLFD  59

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   KV N S KP +GYVGQ P+VPLYESMGID A   + ++SFT L+WP+G
Sbjct  60    ALEELFDLPLQTKVRNSSKKPFHGYVGQYPMVPLYESMGIDDATISEKVESFTDLLWPEG  119

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N +F + +  YS   ++L+++V RM+ ES G EKY + H+ S  YL RVMKY+  Q  EP
Sbjct  120   NSNFCKTVHSYSDQLSDLDKIVRRMILESLGAEKYMDEHMDSTNYLLRVMKYKGPQTTEP  179

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  +HTDK+ ++ + QN  + GLE+  K+G  W  V  SP S +VM GD+++AW+N R
Sbjct  180   KLGLNAHTDKNIVTILSQN-QVQGLELLTKDG-HWIDVKPSPGSFIVMIGDSLLAWTNGR  237

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP+H+VMM G   RYS   FS  +   +I+ P ELVD +HPL FKPFDH+ +L F+  
Sbjct  238   LHSPYHQVMMTGNEARYSAGLFSIPKAGYIIKAPEELVDEEHPLLFKPFDHVEFLSFYYT  297

Query  376   EENRRLPCALKTYCGV  329
             E  +R   ALKTYCGV
Sbjct  298   EAGQRAQSALKTYCGV  313



>ref|XP_008377588.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Malus domestica]
Length=322

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/317 (48%), Positives = 212/317 (67%), Gaps = 4/317 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S TPL LP+IDF+K D+  GT  W   R +  +ALEEYGCF AL++KV S++ +   +
Sbjct  1     MASETPLGLPIIDFSKPDLNQGTKEWDLVRAQVHNALEEYGCFEALFNKVPSDIRKSTIE  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELFDLP   K++N S KP +GYVGQ P+VPLYESMG D AN  + ++S T  +WPQG
Sbjct  61    SMEELFDLPLQTKLQNVSKKPYHGYVGQYPMVPLYESMGFDDANVYEQVESLTNTLWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F  ++  +S+  +EL++++ RM+ ES G+EKY+E HV+S  YL RVMKY+  +  E 
Sbjct  121   NPRFCTSIQSFSEQVSELDQIIRRMILESLGLEKYFEEHVESTNYLLRVMKYKGPETKES  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVH-LSPSSIVVMAGDAIMAWSNN  557
             KLG  +HTDK+ ++ +YQN  ++GLE++ K    W  V   SP S + M GD++ AW+N 
Sbjct  181   KLGINAHTDKNIVTILYQN-QVDGLEVQTK-ACKWIKVKPSSPHSFIAMIGDSLHAWTNG  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             R+ SP+HRVMM G   RYS   FS  +   +I+ P E+VD +HPL FKPFDH+ +L F+ 
Sbjct  239   RLHSPYHRVMMSGNEARYSTGLFSIPKAGYIIKAPEEVVDEEHPLLFKPFDHVEFLGFYY  298

Query  379   KEENRRLPCALKTYCGV  329
              E  +R   ALKTYCGV
Sbjct  299   TEAGQRAQSALKTYCGV  315



>ref|XP_006465515.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Citrus sinensis]
Length=314

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 208/316 (66%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  K+PVID +K+D+K GT +W++  ++   A EE+GCF A+Y K S E+   V  
Sbjct  1     MGSQTKSKIPVIDLSKQDLKSGTSTWLSTCKDIRHAFEEFGCFEAIYQKFSQELRSEVLA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELFD+P  +KV+N STKP + Y GQ  I+PLYES+ ID+ +T    QSFT LMWP G
Sbjct  61    STEELFDVPIEIKVKNTSTKPYFEYYGQYTIIPLYESLAIDYPDTRNATQSFTNLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E+ L  S+L  EL++MV RM+FESYGVE YY+S++ S  YL R  KYR  + NE 
Sbjct  121   NDCFCESSLSMSELVVELDKMVTRMLFESYGVEGYYDSYIGSVNYLLRYFKYRAPEPNET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             K+G   HTDK+  S I+Q  HINGL+++AK+G +W  V  SPSS +VMAGDA+ AW N+R
Sbjct  181   KMGLTPHTDKTMTSIIHQINHINGLQVQAKDG-EWIDVEPSPSSFIVMAGDALKAWGNDR  239

Query  553   IKSPHHRVMMEGKG-PRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             I+   H+V+M+     RYS+  FSF    ++  P EL     PL++KPFDH  +L F   
Sbjct  240   IRPCRHQVIMDNASETRYSLGLFSF-SSGVVDIPKELGVETQPLKYKPFDHFGFLHFNQS  298

Query  376   EENRRLPCALKTYCGV  329
             EE ++   ++K YCG+
Sbjct  299   EEGKKSASSIKAYCGI  314



>ref|XP_010110313.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
 gb|EXC25833.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
Length=312

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/310 (51%), Positives = 215/310 (69%), Gaps = 7/310 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             K+P IDF++ ++ PGT SW +   +   ALEEYGCFVALYDK+S ++   +F  L ELFD
Sbjct  8     KIPTIDFSEGNLNPGTSSWFSVCNDVRRALEEYGCFVALYDKISQQLRTSMFSELKELFD  67

Query  1072  LPTNVKVENKSTKPLYGYVGQIP-IVPLYESMGIDHANTLQGIQSFTKLMWPQ-GNDDFS  899
             LPT +K++N S KP +GY+G  P I PL+ESMGI++A TL+G +SFT ++WP+ GN+ F 
Sbjct  68    LPTEIKMKNVSDKPYFGYIGNHPSIPPLHESMGIENATTLEGGESFTNIIWPKGGNNHFC  127

Query  898   EAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFV  719
             E ++ YS+L +ELE+MV RMVF+SYGVEKYY+SH+ S  +L +++KYR  + NE  +G  
Sbjct  128   ETVVSYSRLVSELEKMVKRMVFQSYGVEKYYDSHLGSTTFLLKLIKYRVPEMNESSIGCA  187

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
              HTDKSF++ ++QN  +NGLEI+ ++G DW     SPSS +V+AGDA +AW+N RI S  
Sbjct  188   PHTDKSFITVLHQN-EVNGLEIETRDG-DWIQFEPSPSSFLVLAGDAFLAWTNGRIHSAA  245

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             HRV+M G  PRYSI  FS+   T I+ P ELVD  HP QFK FDH   L  +      ++
Sbjct  246   HRVVMTGTKPRYSIGLFSYHNGT-IEIPDELVDEQHPQQFKSFDHYGLLHHYHAAP--KI  302

Query  358   PCALKTYCGV  329
                 K YCGV
Sbjct  303   ESTAKDYCGV  312



>ref|XP_010110312.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
 gb|EXC25832.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
Length=315

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 215/318 (68%), Gaps = 6/318 (2%)
 Frame = -2

Query  1273  MGSLTP--LKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERV  1100
             MG+ T   +KLPVIDF+ + +KPGT+ W   R +   ALEE+GCF AL+ K+S +    +
Sbjct  1     MGTETSPSVKLPVIDFSIQPLKPGTE-WDLVRSQVRQALEEFGCFEALFGKISLDTRRAI  59

Query  1099  FKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP  920
             F  L ELFDLP   K+ N S KP +GYVGQ P +PL+ESM ID AN  + ++S   ++WP
Sbjct  60    FDTLQELFDLPLQTKLRNVSKKPFHGYVGQYPQMPLFESMAIDDANIHENVESLANILWP  119

Query  919   QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQEN  740
             QGN +F + +  YS+  +EL++++ RM+ ES GVEKY E H+ SA YL RVMKY+  Q  
Sbjct  120   QGNPNFCKIIQSYSEQLSELDQIIRRMILESLGVEKYLEEHLGSANYLLRVMKYKGPQTK  179

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
             E K+G  +HTDK+ ++ +YQN  + GLE++ K+G +W  V  SP+S +VM GD++ AW+N
Sbjct  180   ETKMGLSAHTDKNIVTILYQN-QVEGLEVQTKDG-EWISVKPSPNSFIVMIGDSLYAWAN  237

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
              R+ SP HRV+M G   RYS   FS  +   +++ P ELVD +HPL FKPFDH+ +L+FF
Sbjct  238   GRLHSPCHRVIMTGSEARYSAGLFSIPKAGYIVKAPEELVDEEHPLLFKPFDHVEFLEFF  297

Query  382   SKEENRRLPCALKTYCGV  329
              +E  +R   ALKTYCGV
Sbjct  298   YREAGQRAESALKTYCGV  315



>ref|XP_006392870.1| hypothetical protein EUTSA_v10011669mg [Eutrema salsugineum]
 gb|ESQ30156.1| hypothetical protein EUTSA_v10011669mg [Eutrema salsugineum]
Length=316

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 215/310 (69%), Gaps = 5/310 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVA-LYDKVSSEVHERVFKGLVELF  1076
             K+P +DF++E +KPGT  W +  +    ALEEYGCF+  L DK   ++ ++VF  LVELF
Sbjct  4     KIPTLDFSREVLKPGTKYWESTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             DLPT  K++NK  KPL GYVGQIP +PL+ES+GID A +L   +SFT LMWPQGN+ FS+
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDDATSLVATRSFTGLMWPQGNERFSD  123

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
             ++  Y++  A+L++MV RMVFESY VEK Y  +++S  YL RV+K R        LGF++
Sbjct  124   SVHKYAEFVAKLDQMVTRMVFESYNVEKDYNPYIESTTYLLRVLKTRAPNSKNSNLGFIT  183

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIVVMAGDAIMAWSNNRIKSPH  539
             HTDKSF + ++QN  +NGL ++ + G+    ++L SPS  +V+AGDA+MAWSN+R+ SP 
Sbjct  184   HTDKSFTTILHQN-QVNGLVMETREGER-ININLSSPSLFMVVAGDALMAWSNDRVWSPR  241

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V++ G+  RYS+  FSF   T+ Q P EL+D  HPL++KPFDH+  L F+  +   + 
Sbjct  242   HQVLVSGETDRYSLGMFSFNNGTL-QVPEELIDHQHPLKYKPFDHIGLLRFYRTDTGYKS  300

Query  358   PCALKTYCGV  329
              C +K YCG+
Sbjct  301   ECPIKAYCGI  310



>gb|KHG05406.1| 2'-deoxymugineic-acid 2'-dioxygenase [Gossypium arboreum]
Length=314

 Score =   315 bits (808),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 209/316 (66%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TPLKLPVIDF+K D+K G++ W   + +   AL+EYGCF AL+DK+   + E +F 
Sbjct  1     MGSQTPLKLPVIDFSKPDLKAGSNEWDLVKGQVQQALQEYGCFEALFDKIPLHLREAIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K+ N S KP +GYVGQ P VPLYESMG+D AN  + +++ T  +WPQG
Sbjct  61    SLQELFDLPLQAKIRNVSNKPYHGYVGQYPQVPLYESMGVDDANITEKVEALTTTLWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FS  +  +S+  +EL+++V RM+ ES+ +EKY + H+ S  YL RVMKY+  +  E 
Sbjct  121   NSSFSNTIQSFSEQLSELDQIVRRMILESFDLEKYMDEHMGSTNYLLRVMKYKGPKTTET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  SHTDK+ ++ +YQN  ++GLE+ +K G +W  V  S  S  VM G+++ AW N R
Sbjct  181   KLGLNSHTDKNIVTILYQN-EVDGLEVLSKQG-EWINVKPSKHSFTVMIGESLYAWLNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + +P+HRVMM G   RYS   FS  +   +I+ P ELVD  HPL FKPFDH+ +L F+  
Sbjct  239   LHAPYHRVMMTGDKARYSAGLFSVPKAGYIIKAPDELVDEAHPLLFKPFDHVDFLRFYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E  ++   ALK +CGV
Sbjct  299   EAGQKAESALKVFCGV  314



>emb|CDY26054.1| BnaC06g05700D [Brassica napus]
Length=315

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/308 (48%), Positives = 209/308 (68%), Gaps = 4/308 (1%)
 Frame = -2

Query  1249  LPVIDFT-KEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             +PV+D T ++D+ P T +W +  RE+  ALEEYGCFVALYD V+ E+ + +F    ELFD
Sbjct  11    VPVLDLTSRQDLNPNTSTWRSISREACEALEEYGCFVALYDGVTQELDDSIFAAAEELFD  70

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LPT+ K +N + KP +GYVGQ+P++PL+E +GID+    +  Q FT LMWP+GN  F E 
Sbjct  71    LPTDTKRKNVNEKPYHGYVGQMPVIPLHEGLGIDYVTNKEEAQRFTHLMWPRGNHQFCET  130

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
                +S   AEL+ +VVRM+FE+YGVEK+Y+SH  S  YL + +KY    E+     F  H
Sbjct  131   AHGFSNSVAELDRLVVRMIFENYGVEKHYDSHEGSKTYLLKFLKYLAPPESISMPAFPQH  190

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TDK+F+S ++QN  +NGLE+K+K+G  W  +HL P S VVMAGD  M WSN+RI+S  HR
Sbjct  191   TDKTFLSILHQNG-VNGLEVKSKDG-GWISLHLPPKSYVVMAGDISMGWSNDRIRSCEHR  248

Query  532   VMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPC  353
             V MEG   RY++  FSF+ K ++  P ELVD +HPL +KPFD++  ++F++ +E R    
Sbjct  249   VTMEGDKTRYTLGLFSFI-KGLVSVPGELVDDEHPLMYKPFDNIALINFYATKEGREAKS  307

Query  352   ALKTYCGV  329
              LK YC +
Sbjct  308   TLKAYCCI  315



>ref|XP_009799661.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
sylvestris]
Length=317

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/319 (48%), Positives = 217/319 (68%), Gaps = 6/319 (2%)
 Frame = -2

Query  1273  MGSLTPL-KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGSLT   +L V+DF  E+++PGT +W    ++   A E +GCF+ALYDK+S ++ + +F
Sbjct  1     MGSLTASPQLLVVDFNNEELRPGTATWEFTCKDIRFAFENHGCFIALYDKISPQLQKSIF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
             +   +LF+LP   K+ N + KP +GYVGQIP +P +E+ GID+A T QGIQSF+ LMWPQ
Sbjct  61    QASQQLFELPLEKKILNTNEKPYHGYVGQIPFLPNHEAFGIDYATTSQGIQSFSNLMWPQ  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND FSE  L +SK+ AEL++ VVRM+FESYG+EK  ES+++S  YL R +KY      E
Sbjct  121   GNDFFSENSLTFSKIVAELDQKVVRMLFESYGIEKNCESYLESTTYLLRYLKYDAPNTKE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               + F  HTDK+F + +YQN HI+GLEI+ ++G  W  +   PSS VVMAG+A   WSN+
Sbjct  181   NSMVFPPHTDKTFTTVLYQN-HISGLEIQTRDG-QWLTLDFPPSSFVVMAGEAFRGWSND  238

Query  556   RIKSPHHRVMME--GKGPRYSIAQFSFM-EKTMIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             R+ +P H+V+M+  G   RY++  F+F+ +  MI+   ELVD +HPLQF+PF H+  + F
Sbjct  239   RVLTPVHKVIMDISGNETRYTVGIFTFLKDNKMIEVAEELVDEEHPLQFQPFVHIDLIKF  298

Query  385   FSKEENRRLPCALKTYCGV  329
             F  E  RR    +K +CGV
Sbjct  299   FDTERGRRSQNLVKDFCGV  317



>ref|XP_010463426.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=320

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/313 (48%), Positives = 212/313 (68%), Gaps = 4/313 (1%)
 Frame = -2

Query  1264  LTPLKLPVIDFTKE-DMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGL  1088
             L   K+P++DFT+E D+KP T +W +  R +  ALEEYGCFVA+YD V+ ++   VF   
Sbjct  9     LNTTKVPILDFTREQDLKPRTSAWRSISRAACEALEEYGCFVAVYDGVTQQLDNSVFAAA  68

Query  1087  VELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGND  908
              +LFDLPT  K++N + KP +GYVGQ+PI+PL+E +GID+    +  + FT LMWPQGND
Sbjct  69    KDLFDLPTETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAKKFTNLMWPQGND  128

Query  907   DFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKL  728
              F + +  +S   AEL+ +VVR++FE+YGVEK+YESHVK+  YL + + Y    E+    
Sbjct  129   QFCKTIHRFSNAVAELDRLVVRIIFENYGVEKHYESHVKAKTYLLKFLMYLAPPESISMP  188

Query  727   GFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIK  548
              F  HTDK+F++ ++QN  +NGLE+K+K+G +W  + L   S VVMAGD  M WSN+RI+
Sbjct  189   AFPQHTDKTFLTILHQN-DVNGLEVKSKDG-EWISLQLPLKSYVVMAGDISMGWSNDRIR  246

Query  547   SPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEEN  368
             S  HRV MEG   RY+I  FSF+  + +  P ELVD +HPL +KPF+++  ++FF+ +E 
Sbjct  247   SCEHRVTMEGDKVRYTIGLFSFVTGS-VSIPEELVDDEHPLMYKPFNNIALINFFATKEG  305

Query  367   RRLPCALKTYCGV  329
             R     LK YCG 
Sbjct  306   REANSTLKAYCGT  318



>ref|XP_010033902.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW53768.1| hypothetical protein EUGRSUZ_J03021 [Eucalyptus grandis]
Length=314

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 208/316 (66%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS+  L LPVIDF+   +KPGT  W A R E   ALE  GCF A + KV  ++ E +  
Sbjct  1     MGSMAELMLPVIDFSSLRLKPGTAEWTAVRDEVKQALETCGCFEARFKKVPVDLQESMLG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELFDLP   K+ N S KP +GYVGQ P+VPLYESMGID A+  + +   T ++WP+G
Sbjct  61    SVQELFDLPLQTKLRNVSRKPYHGYVGQYPMVPLYESMGIDDADVYEKVDGLTTILWPEG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             + +FS+ +  +S+  +EL++M+ RM+ ES GVEKY + H+ S  YL RVM+Y   Q  + 
Sbjct  121   HPNFSKNIQSFSEKLSELDKMIRRMILESLGVEKYLDEHMNSTNYLLRVMRYAGPQTTDT  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  SHTDK+ ++ + QN  ++GLE++ K+G +WF    SP+S +VM GD++ AW N R
Sbjct  181   KLGLNSHTDKNIVTILCQN-EVDGLEVQTKDG-EWFSAQPSPNSFIVMIGDSLYAWVNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SPHHRVMM G   RYS+  FS  +   MI+ P ELVD + PL FKPFDH+ +L F+  
Sbjct  239   LHSPHHRVMMSGNKARYSVGLFSIPKGGYMIKAPDELVDEERPLLFKPFDHVEFLGFYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E  +R   ALKTYCGV
Sbjct  299   EAGQRAESALKTYCGV  314



>ref|XP_009588351.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=313

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 208/316 (66%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T +KLP IDF+  D+KPGT  W   + +   AL  YGCF A +DK+   + + +F+
Sbjct  1     MGSET-IKLPNIDFSNVDLKPGTLVWNQVKSQVHKALVNYGCFEASFDKIPIHLRKSIFE  59

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K+ N STKP +GYVGQ P VPLYESMGID AN     +SFT+++WP+G
Sbjct  60    SLKELFDLPLQTKIRNISTKPFHGYVGQYPAVPLYESMGIDDANIPDKAESFTRILWPEG  119

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F + +  YS+  +EL++ V RM+ ES GVE Y   H+ S  YL RVMKY+  Q +E 
Sbjct  120   NPTFCKTIQSYSEQLSELDQTVRRMILESLGVENYMGEHMNSTNYLLRVMKYKGPQSSET  179

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             K+G  +HTDK+ ++ +YQN  +NGLE+  ++G  W  V  +P++ +VM GD++ AW+N R
Sbjct  180   KVGLNAHTDKNIVTILYQN-QVNGLEVLTEDG-QWINVEPTPNAFIVMIGDSLYAWANGR  237

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTM-IQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP HRVMM G   RYS+  FS  +    I  P ELVD +HPL FKPFDH+ +L F+  
Sbjct  238   VHSPFHRVMMRGNEARYSVGLFSIPKAGYKIMAPEELVDEEHPLLFKPFDHVEFLAFYYT  297

Query  376   EENRRLPCALKTYCGV  329
             EE +R   ALKTYCGV
Sbjct  298   EEGQRCGSALKTYCGV  313



>ref|XP_007145554.1| hypothetical protein PHAVU_007G248400g [Phaseolus vulgaris]
 gb|ESW17548.1| hypothetical protein PHAVU_007G248400g [Phaseolus vulgaris]
Length=309

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 217/311 (70%), Gaps = 14/311 (5%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             +LPV+DF+ E++KPG+DSW+   R    A EE+GCFVA+YDKV  E+   VF  + ELFD
Sbjct  10    RLPVLDFSTEELKPGSDSWLERCRSVRKAFEEHGCFVAVYDKVCDELRNDVFCSMKELFD  69

Query  1072  LPTNVKVENK-STKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             L    K  N     PL GYVGQ P +PL++SMGID   TL+GIQSF   MWP+GND F +
Sbjct  70    LSVETKRRNTYEGAPLKGYVGQHPKIPLHQSMGIDQGTTLEGIQSFAHKMWPKGNDQFCK  129

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
              ++ Y+K+A EL+  V RM+FESYG+ +YYES++ S  YL R++K+   +E EP+LGF++
Sbjct  130   HIIEYAKVAEELDGKVARMIFESYGLSEYYESYIGSTSYLLRLLKHTAPEEVEPQLGFLA  189

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPS-SIVVMAGDAIMAWSNNRIKSPH  539
             HTDKSF + ++QN H+N L ++ +NG  W  V  S + S VVMAGDA+MAWSN+RI+SP+
Sbjct  190   HTDKSFTTILHQN-HVNALMVETRNG-VWIDVDFSSTNSFVVMAGDALMAWSNDRIQSPN  247

Query  538   HRVMME-GKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRR  362
             H+V+M+ G+  RYS+  F+F  K +++ P EL+D +HP+ +KPFDHL  L+F+S      
Sbjct  248   HKVVMKNGEDTRYSLGLFAFY-KGIMKVPEELIDEEHPVHYKPFDHLGLLNFYSAN----  302

Query  361   LPCALKTYCGV  329
                 +K YCGV
Sbjct  303   ----MKAYCGV  309



>ref|XP_007024008.1| 2-oxoglutarate-dependent dioxygenase, putative [Theobroma cacao]
 gb|EOY26630.1| 2-oxoglutarate-dependent dioxygenase, putative [Theobroma cacao]
Length=312

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/315 (49%), Positives = 209/315 (66%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MG  +  KLPVIDF++ ++ PGT +WV+A  +   ALEE GCF A +DKV  ++H+ VF 
Sbjct  1     MGLQSQFKLPVIDFSEGNLNPGTSTWVSACNDVRQALEEQGCFEARFDKVPLQLHDTVFA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELFDLPT +K+ N S KP + Y GQ   +PLYES+ +D+  T  G QSFT LMWP G
Sbjct  61    TAAELFDLPTELKMRNTSNKPYFDYFGQYRSLPLYESLAMDNPTTHSGTQSFTNLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E+   +S+L AEL+  V+RM+FESYGV  YY+ ++KS  YL R  KYR+ + NE 
Sbjct  121   NDRFRESAQSFSELVAELDRTVMRMLFESYGVGNYYDYYIKSTNYLLRFYKYRKPEMNES  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
               G   HTD++ +S I+Q   I+GL++K K+G  W GV  SP+S  VMAGDA+MAWSN+R
Sbjct  181   DTGLPPHTDRTLLSIIHQG-RISGLQVKLKDG-QWVGVQPSPTSFAVMAGDALMAWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I   +H+V M+ K  RYSI  FSF+   +I    ELVD  HPL++K FDH  +L F   +
Sbjct  239   IPPCYHQVTMKEKETRYSIGMFSFISG-IIHILEELVDETHPLKYKSFDHFQFLHFDRSD  297

Query  373   ENRRLPCALKTYCGV  329
             E ++  C++K +CGV
Sbjct  298   EGKKSKCSIKAFCGV  312



>ref|XP_010545794.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Tarenaya hassleriana]
Length=330

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/329 (48%), Positives = 217/329 (66%), Gaps = 25/329 (8%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVA-LYDKVSSEVHERVFKGLVELFD  1073
             +P +DF++ED+KPGT  W    +    ALE+YGCF+  L++K   ++  RVF  L +LFD
Sbjct  5     IPTLDFSREDLKPGTSYWETTSKNIRQALEQYGCFIVDLHEKAPFDLLARVFDSLKQLFD  64

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDF---  902
             LPT  K++NK  KP+ GYVGQIP +PL+ES+GID+A +LQ  +SFT LMWP+GND F   
Sbjct  65    LPTPTKMKNKYDKPMNGYVGQIPALPLHESLGIDNATSLQSTRSFTDLMWPRGNDRFWYV  124

Query  901   -----------------SEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLA  773
                              S+ M  Y++  AE++ MV RM+F SYGV KYYE ++KS  YL 
Sbjct  125   LIIRILRYFPEYNVSFCSDCMHRYAEFVAEMDRMVARMIFGSYGVAKYYEPYMKSTSYLL  184

Query  772   RVMKYREAQENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIV  596
             R++K R  ++  P L FV+HTDKSF + ++Q+  INGLE++ + G+    V L SPS  +
Sbjct  185   RLLKNRAPKDENPYLAFVTHTDKSFTTILHQD-QINGLEMETRLGER-INVDLSSPSLFM  242

Query  595   VMAGDAIMAWSNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFK  416
             V+AGDA+MAWSN+RI SP HRV++ G+  RYS+ QF+F   T+ Q P ELVD +HPL +K
Sbjct  243   VIAGDALMAWSNDRILSPRHRVLVSGETDRYSLGQFAFSNGTL-QVPEELVDNEHPLMYK  301

Query  415   PFDHLHYLDFFSKEENRRLPCALKTYCGV  329
             PFDH+  L F+  +   R  C +K YCGV
Sbjct  302   PFDHIGLLHFYRTDIGYRAECPIKAYCGV  330



>ref|XP_006356178.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=313

 Score =   314 bits (804),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 206/309 (67%), Gaps = 3/309 (1%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             KLP+IDF+ ED+KP T  W   + +   AL EYGCF A +DK+   + + +F+ L ELFD
Sbjct  7     KLPIIDFSHEDLKPDTLVWNQVKSQVHKALVEYGCFEASFDKIPIHLRKSIFESLQELFD  66

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LP   K++N S KP +GYVGQ P VPLYESMGID AN     + FT+++WPQGN  F E 
Sbjct  67    LPLQTKLKNISKKPFHGYVGQYPQVPLYESMGIDDANIPHKTEKFTQILWPQGNPTFCET  126

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
             +  YS+  +EL++ V +M+ ES GVEKY + H+ S  YL RVMKY+  Q +E KLG  +H
Sbjct  127   IQSYSEHLSELDQTVRKMILESLGVEKYMDEHMNSTNYLLRVMKYKGPQSSETKLGLNAH  186

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TDK+ ++ +YQN  ++GLE+  K+G  W  V  +P +  VM GD++ AW+N ++ SP+HR
Sbjct  187   TDKNIVTILYQN-EVSGLEVLTKDG-HWINVDPTPDTFTVMIGDSLYAWANGQLHSPNHR  244

Query  532   VMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLP  356
             VMM G   RYS+  FS  +    I+ P ELVD +H L FKPFDH+ +LDF+  EE +R  
Sbjct  245   VMMRGNEARYSVGLFSIPKAGYTIKAPKELVDEEHSLLFKPFDHVEFLDFYYTEEGQRCA  304

Query  355   CALKTYCGV  329
              ALKTYCGV
Sbjct  305   SALKTYCGV  313



>ref|XP_004152262.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
 ref|XP_004156846.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
Length=314

 Score =   313 bits (802),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 209/317 (66%), Gaps = 6/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S + LKLP+IDF+  +++ G   W  A+ +   ALEE+GCF A +DKV  EV + +F+
Sbjct  1     MDSESSLKLPLIDFS--NLESGGPKWELAKAQVKEALEEFGCFEASFDKVPVEVRKGLFE  58

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELF+LP   K+ N S KP +GYVGQ P+ PL+ESMG+D +   Q +Q FT ++WPQG
Sbjct  59    ALEELFNLPLETKLRNVSQKPFHGYVGQYPMAPLFESMGVDDSTIPQKVQDFTNILWPQG  118

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQEN-E  737
             N  FS+ M  YS+  AEL+EMV RMV ES GVEKY E H++S  YL RVMKY+  + N E
Sbjct  119   NPTFSKVMETYSQQLAELDEMVRRMVLESLGVEKYLEEHLESTNYLLRVMKYKGTESNYE  178

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
              K+G  SHTDK+ ++ +YQN H+ GL++K K+G  W     SP S V M GD+  AW+N 
Sbjct  179   TKIGLHSHTDKNIVTILYQN-HVQGLQVKTKDG-KWINFQPSPDSFVAMIGDSFHAWTNG  236

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             R+ SP+HRVMM G+  RYS   FS  +   +++ P ELVD  HPL F PFDH+ +L F+ 
Sbjct  237   RLHSPYHRVMMSGEEVRYSAGLFSIPKAGYIVKAPEELVDEQHPLLFNPFDHVQFLQFYY  296

Query  379   KEENRRLPCALKTYCGV  329
              E  ++   ALKTYCG 
Sbjct  297   TEAGQKAQSALKTYCGA  313



>ref|XP_004241720.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=313

 Score =   313 bits (802),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 209/316 (66%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS   +KLP IDF+ ED+KP T  W   + +   AL EYGCF A +DK+   + + +F+
Sbjct  1     MGSEN-MKLPKIDFSHEDLKPDTLVWNQVKSQVHKALVEYGCFEASFDKIPIHLRKSIFE  59

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K++N S KP +GYVGQ P VPLYESMGID AN     + FT+++WPQG
Sbjct  60    SLQELFDLPLQTKLKNISKKPFHGYVGQYPQVPLYESMGIDDANIPHKAEKFTQILWPQG  119

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F + +  YS+  +EL++ + RM+ ES GVEKY + H+ S  YL RVMKY+  Q +E 
Sbjct  120   NPTFCKTIQSYSEQLSELDQTIRRMIVESLGVEKYMDEHMNSTSYLLRVMKYKGPQSSET  179

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             K+G  +HTDK+ ++ +YQN  ++GLE+  K+G  W  V  +P +  VM GD++ AW+N R
Sbjct  180   KVGLNAHTDKNIVTILYQN-EVSGLEVLTKDG-KWINVDPTPDTFTVMIGDSLYAWANGR  237

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP+HRVMM G   RYS+  FS  +    I+ P ELVD +H L FKPFDH+ +LDF+  
Sbjct  238   LHSPYHRVMMRGNEARYSVGLFSIPKAGYTIKAPEELVDEEHSLLFKPFDHVEFLDFYYT  297

Query  376   EENRRLPCALKTYCGV  329
             EE +R   ALKTYCGV
Sbjct  298   EEGQRCASALKTYCGV  313



>ref|XP_006427127.1| hypothetical protein CICLE_v10027219mg, partial [Citrus clementina]
 gb|ESR40367.1| hypothetical protein CICLE_v10027219mg, partial [Citrus clementina]
Length=307

 Score =   313 bits (801),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 206/309 (67%), Gaps = 4/309 (1%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             LP+IDF+K ++KPGT  W + +     ALEEYGCF AL++KV  E+ + VF  L ELFDL
Sbjct  1     LPIIDFSKPNLKPGTPEWDSVKSHVRKALEEYGCFEALFNKVPEEILKAVFGALEELFDL  60

Query  1069  PTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEAM  890
             P   K+ N S KP +GYVGQ P VPLYESMGID AN  + ++S T ++WP+GN  F + +
Sbjct  61    PLRTKMRNISKKPFHGYVGQYPQVPLYESMGIDDANVKEKVESMTNILWPEGNKSFCKTI  120

Query  889   LVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSHT  710
               +S+  +EL++ + RM+ ES G+EKY + H+ S  YL RVMKY+  +  E KLG  SHT
Sbjct  121   QSFSEQVSELDQTIRRMILESLGLEKYMDEHMNSTSYLLRVMKYKGPETTEKKLGLNSHT  180

Query  709   DKSFMSTIYQNCHINGLEIKAKNGDDWFGVH-LSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             DK+ ++ +YQN  + GLE++ KNG +W  +   SP S + M GD++ AW+N ++ SP+HR
Sbjct  181   DKNIVTILYQN-QVEGLELQTKNG-EWINIKPSSPHSFIAMIGDSLYAWTNGQLYSPYHR  238

Query  532   VMMEGKGPRYSIAQFSFMEKTM-IQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLP  356
             VMM G   RYS   FS  +    I+ P ELVD +HPL FKPFDH  +L+F+  E  +R  
Sbjct  239   VMMTGIETRYSTGFFSIPKAGYKIEAPEELVDEEHPLLFKPFDHFEFLEFYYTEAGQRAE  298

Query  355   CALKTYCGV  329
              ALKTYCGV
Sbjct  299   SALKTYCGV  307



>ref|XP_011045369.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=314

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 208/316 (66%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T LKLP+IDF+     PG   W   + +   ALEEYGCF AL+DK+ +E  + +F 
Sbjct  1     MGSETALKLPIIDFSNLGQNPGAAEWDLVKLQVRKALEEYGCFEALFDKIPAESRKAIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELFDLP   K+ N S KP +GYVGQ P VPL+ESMGID AN  + ++  T ++WPQG
Sbjct  61    AVEELFDLPLQTKMRNASRKPYHGYVGQYPQVPLFESMGIDDANIAEEVERTTAILWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FS  +L +SK  +EL+++V RM+ ES G+EKY + H+ S  YL RVMKY+  Q  E 
Sbjct  121   NQSFSNTVLSFSKQVSELDQIVRRMIVESLGLEKYLDEHMNSTNYLLRVMKYKVPQTTET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  SHTDK+ ++ + QN  ++GLE++ K+G  W  +  +P S +VM GD++ AW+N R
Sbjct  181   KLGLSSHTDKNMVTILCQN-QVDGLELQTKDG-CWTDLKPNPDSFIVMIGDSLYAWANGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP+HRVMM G   RYS+  F+  +   +++ P EL+D +HPL FKPFDH  +L ++  
Sbjct  239   LHSPYHRVMMRGNEVRYSLGLFAVPKAGYIVKAPEELIDEEHPLLFKPFDHFEFLGYYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E  +    ALKTYCGV
Sbjct  299   EAGQTDQSALKTYCGV  314



>ref|XP_010500899.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=320

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/313 (47%), Positives = 211/313 (67%), Gaps = 4/313 (1%)
 Frame = -2

Query  1264  LTPLKLPVIDFTKE-DMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGL  1088
             L   K+P++DFT+E D+KP T +W +  R++  ALEEYGCFVA+YD ++ ++ + VF   
Sbjct  9     LNTTKVPILDFTREQDLKPRTSAWRSISRDACEALEEYGCFVAVYDGITQQLDDSVFAAA  68

Query  1087  VELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGND  908
              +LFDLPT  K++N + KP +GYVGQ+PI+PL+E +GID+    +  + FT LMWPQGND
Sbjct  69    KDLFDLPTETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAKKFTNLMWPQGND  128

Query  907   DFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKL  728
              F + +  +S   AEL+ +VVRM+FE+Y VEKYYESH +S  YL + + Y    E+    
Sbjct  129   QFCKTIHSFSNAVAELDRLVVRMLFENYDVEKYYESHFESKTYLLKFLMYLAPPESVSMP  188

Query  727   GFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIK  548
              F  HTDK+F++ ++QN  +NGLE+K+K+G +W  + L   S VVMAGD  M WSN+RI+
Sbjct  189   AFPQHTDKTFLTILHQN-DVNGLEVKSKDG-EWISLQLPLQSYVVMAGDISMGWSNDRIR  246

Query  547   SPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEEN  368
             S  HRV M G   RY+I  FSF+  + +  P ELVD +HPL +KPF+++  ++FF+ +E 
Sbjct  247   SCEHRVTMVGDKVRYTIGLFSFLTGS-VSIPEELVDDEHPLMYKPFNNIALINFFATKEG  305

Query  367   RRLPCALKTYCGV  329
             R     LK YCG 
Sbjct  306   REANSTLKAYCGT  318



>ref|XP_007216816.1| hypothetical protein PRUPE_ppa023108mg [Prunus persica]
 gb|EMJ18015.1| hypothetical protein PRUPE_ppa023108mg [Prunus persica]
Length=321

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/321 (46%), Positives = 212/321 (66%), Gaps = 3/321 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TPL+LPVIDF+ + + PGT  W   R +  +ALEEYGCF AL+ KV S + + +F+
Sbjct  1     MGSETPLRLPVIDFSNQSLTPGTREWNTVRAQVHNALEEYGCFEALFTKVPSHIRKSIFQ  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + +L DLP   K++N S KP  GY GQ+P++PLYESMGID AN  + +QS    +WPQG
Sbjct  61    SIEDLLDLPLQTKLKNVSRKPYRGYAGQLPMMPLYESMGIDGANVYEQVQSLANTLWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F + +  +++  +EL++++ RM+ ES G+++Y E H+ S  YL RVMKY+  Q NE 
Sbjct  121   NPSFCKTIQSFTEKVSELDQIIRRMILESLGLKEYLEEHLNSTDYLLRVMKYKAPQTNET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG   HTDK+ ++ +YQN  ++GLE++ K+G  W  V  S  S + + G+++ AW+N R
Sbjct  181   KLGLPPHTDKNIVTILYQN-QVDGLEVQTKDG-KWINVKPSSDSFIALIGESLHAWTNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSF-MEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP HRVMM G   RYS   FS   E  +I+ P E+VD +HPL FKP++H  ++ F + 
Sbjct  239   LHSPIHRVMMNGNEIRYSTGLFSAPKEGYIIKAPNEVVDEEHPLLFKPYEHAQFIAFCNS  298

Query  376   EENRRLPCALKTYCGV*PATL  314
             E  +R P +LKT+CGV   TL
Sbjct  299   EAGQRGPFSLKTFCGVQDLTL  319



>ref|XP_009379331.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=313

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 210/316 (66%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTK-EDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGS    KLPV+D T  E++KPGT++W +  ++   ALE+ GCF A Y  V  ++H  +F
Sbjct  1     MGSEGQAKLPVVDLTNAENLKPGTEAWRSTCKQVQQALEDCGCFEATYHGVPLDLHNAMF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
                  LFDLP   K +  S KP + Y+GQI  +PLYES+G+D+A T +G++ FT +MWP 
Sbjct  61    SMSNGLFDLPVETKCQKTSDKPYHSYIGQISSLPLYESLGVDYATTPEGVEKFTNMMWPA  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             G+D+F E +  +S L AEL ++V +MVF +YGV++ YESH+ S  YL R  +YRE +ENE
Sbjct  121   GSDEFREKVYNFSNLVAELTKLVTKMVFHNYGVQRLYESHMASTIYLLRWSQYREQKENE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               +G   HTDK+F+S ++Q   +NGLE++ K+G  WF    SP+S VVMAGDA MAWSN 
Sbjct  181   TNVGLPPHTDKAFISVLHQK-EVNGLEVQTKDG-QWFVAEPSPTSFVVMAGDAFMAWSNG  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             R+ S  H+V+M+    R SI  FS++  T +Q P EL+D +HPL +KPFDH  YL F   
Sbjct  239   RVPSCFHQVIMKQNKTRLSIGLFSWLNGT-VQVPEELIDDEHPLSYKPFDHFSYLHFSVT  297

Query  376   EENRRLPCALKTYCGV  329
              E ++  CA+KTYCGV
Sbjct  298   PEAKQSKCAIKTYCGV  313



>ref|XP_007024335.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, 
putative [Theobroma cacao]
 gb|EOY26957.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, 
putative [Theobroma cacao]
Length=642

 Score =   322 bits (824),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 163/302 (54%), Positives = 209/302 (69%), Gaps = 4/302 (1%)
 Frame = -2

Query  1276  IMGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             IM + + +KLPVID   ++ +PGTDSW++   E   A EEYGCF+A YDKVS ++ + VF
Sbjct  330   IMATQSAIKLPVIDLFDDESEPGTDSWISKCEEVQRAFEEYGCFLATYDKVSLQLQDEVF  389

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
               + ELF LPT  KV N S KP +GY    P +PL ESMGID+   L+G QSFT LMWP 
Sbjct  390   DSVRELFHLPTEKKVLNTSDKPYFGYFKH-PSIPLSESMGIDNPTILEGTQSFTNLMWPN  448

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN  F E++  Y+KL +EL+ MV  MVFESYGV KYY+SH++S  YL R++KYR  +E+E
Sbjct  449   GNQIFCESIYAYAKLVSELDRMVKTMVFESYGVRKYYDSHIQSTNYLLRLIKYRVPREDE  508

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
                    HTDKSFM+ ++ N HI GL+IKAK+G +W GV  S S  VVMAGDA +AWSN 
Sbjct  509   NDFDGCPHTDKSFMTILHDN-HIAGLQIKAKDG-NWIGVEPSGSMFVVMAGDAFLAWSNG  566

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI+SP HRV+M+ K  RY +A FSF  +T I+TP ELVD  HPL FKPFD++  L  FS 
Sbjct  567   RIQSPTHRVIMKAKKERYCLALFSFSGET-IRTPEELVDEAHPLLFKPFDNMDLLRLFSL  625

Query  376   EE  371
             ++
Sbjct  626   DD  627


 Score =   293 bits (749),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 150/304 (49%), Positives = 201/304 (66%), Gaps = 4/304 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M   + ++LPVID   E+  PGT SWV+  ++   ALEEYGCF+  YDKVS ++ ++VF 
Sbjct  1     MAPQSAVRLPVIDLFDENSVPGTASWVSKCKDVRLALEEYGCFLTPYDKVSLQLQDQVFN  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELF LPT  KV+N S KP +GY    P++PL ESMGID    L+G QSFT LMWP G
Sbjct  61    SVQELFALPTEKKVQNTSDKPYFGYFKH-PLIPLSESMGIDGPTVLEGTQSFTDLMWPNG  119

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F E++  Y+KL ++L+  V  MVFESYGV KY++SH+ S  YL R++KYR  +E E 
Sbjct  120   NKRFCESVHTYAKLVSQLDRRVKYMVFESYGVGKYFDSHIDSTSYLLRLIKYRLPKEEET  179

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
                   HTDKSF++ ++ N  + GLEIK K+G  W GV  S S  +VMAGDA +AWSN R
Sbjct  180   NNCGFPHTDKSFLTILHDN-QVAGLEIKTKDG-RWIGVEPSGSMFIVMAGDAFLAWSNGR  237

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             + S  HRV+  GK  RYS+  FSF  +T I+TP EL+D  HPL FKPF+++  L  +S +
Sbjct  238   VHSALHRVVTNGKKERYSLGFFSFSGET-IRTPEELIDEAHPLLFKPFENIDLLRLYSLD  296

Query  373   ENRR  362
             + R+
Sbjct  297   DVRK  300



>emb|CDP19495.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   311 bits (796),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 207/315 (66%), Gaps = 4/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M   + ++LPVI+ T+E ++ G DSW  AR     A EEYGCF+A++DK  SEV + +F 
Sbjct  1     MECASNIRLPVINLTEEILRSGKDSWTEARNIVTRAFEEYGCFIAVHDKYPSEVRDSIFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L +LF+LP  +KV N S  PL GY    P V LYESM I+ A  L+ ++ F   MWP  
Sbjct  61    ELQDLFNLPLEIKVRNTSQTPLIGYARPRPNVDLYESMSIEDATNLEAVEKFANQMWPSK  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N+ F E    Y+   AEL++MV ++VFESYGVEKY+ESHV S  Y  R+++YR  ++NE 
Sbjct  121   NNHFCELFHWYANQVAELDKMVSKLVFESYGVEKYHESHVGSVTYTVRLIRYRVPEQNEM  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              +G   HTDK+F++ + QN   +GLE++ KNG  W  +   PSS+V+MAGD   AWSN R
Sbjct  181   NVGVPPHTDKNFITILQQN-EADGLEVQLKNG-SWIPIDFPPSSVVIMAGDVFSAWSNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             + SP HRV M GK  R+SIAQF++ +K +++TPTELVD +HPL +KP D+  YL F S +
Sbjct  239   VHSPFHRVTMNGKE-RHSIAQFAYCKK-LVETPTELVDDEHPLLYKPLDNFGYLRFLSTD  296

Query  373   ENRRLPCALKTYCGV  329
             +N   P  LK YCGV
Sbjct  297   DNFNTPNPLKAYCGV  311



>ref|XP_010535123.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Tarenaya hassleriana]
Length=314

 Score =   311 bits (796),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 208/316 (66%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS++  K+PV+DFT +D+ P T  WV+   E+  ALEEYGCFVA+Y      +    F 
Sbjct  1     MGSISTTKIPVLDFTNQDLIPDTPLWVSTSVEACKALEEYGCFVAVYGGAPPHLAGAAFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELF LPT  K +N + KP +GYVGQ+ ++PL+E +GID+      ++ FT+LMWPQG
Sbjct  61    AAEELFCLPTETKRKNVNDKPYHGYVGQMSVIPLHEGLGIDYVTDRDHVRKFTELMWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E +  +S   AEL+ +VVRM+FE+Y V KYYESH+ S  YL + +KY    E  P
Sbjct  121   NDPFCETVYSFSNAIAELDRLVVRMIFENYRVGKYYESHIGSKTYLLKFLKYSPPPEANP  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
                F  HTDK+F+S + QN  +NGLE+K+K+G +W  + L P+S VVMAGD  M WSN+R
Sbjct  181   TPAFPMHTDKTFLSILRQN-DVNGLEVKSKDG-EWIALELPPNSYVVMAGDVSMGWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVD-GDHPLQFKPFDHLHYLDFFSK  377
             I+S  HRV M G   RY++  FSF+  T I  P ELVD  D+PL++KPFD++  ++F++ 
Sbjct  239   IRSCEHRVTMSGNKKRYTLGLFSFVTGT-ISVPEELVDEKDYPLKYKPFDNISLIEFYAT  297

Query  376   EENRRLPCALKTYCGV  329
             +E R+    LK YCGV
Sbjct  298   DEGRKAENTLKAYCGV  313



>gb|KDO58204.1| hypothetical protein CISIN_1g038676mg, partial [Citrus sinensis]
Length=307

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/309 (49%), Positives = 206/309 (67%), Gaps = 4/309 (1%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             LP+IDF+K ++KPGT  W + +     ALE+YGCF AL++KV  E+ + VF  L ELFDL
Sbjct  1     LPIIDFSKPNLKPGTPEWDSVKSHVRKALEDYGCFEALFNKVPEEILKAVFGALEELFDL  60

Query  1069  PTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEAM  890
             P   K+ N S KP +GYVGQ P VPLYESMGID AN  + ++S T ++WP+GN  F + +
Sbjct  61    PLRTKMRNISKKPFHGYVGQYPQVPLYESMGIDDANVKEKVESMTNILWPEGNKSFCKTI  120

Query  889   LVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSHT  710
               +S+  +EL++ + RM+ ES G+EKY + H+ S  YL RVMKY+  +  E KLG  +HT
Sbjct  121   QSFSEQVSELDQTIRRMILESLGLEKYMDEHMNSTSYLLRVMKYKGPETTEKKLGLNAHT  180

Query  709   DKSFMSTIYQNCHINGLEIKAKNGDDWFGVH-LSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             DK+ ++ +YQN  + GLE++ KNG +W  V   SP S + M GD++ AW+N ++ SP+HR
Sbjct  181   DKNIVTILYQN-QVEGLELQTKNG-EWINVKPSSPHSFIAMIGDSLYAWTNGQLYSPYHR  238

Query  532   VMMEGKGPRYSIAQFSFMEKTM-IQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLP  356
             VMM G   RYS   FS  +    I+ P ELVD +HPL FKPFDH  +L+F+  E  +R  
Sbjct  239   VMMTGIETRYSTGFFSIPKAGYKIEAPEELVDEEHPLLFKPFDHFEFLEFYYTEAGQRAE  298

Query  355   CALKTYCGV  329
              ALKTYCGV
Sbjct  299   SALKTYCGV  307



>ref|XP_003528366.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=314

 Score =   310 bits (794),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 209/316 (66%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS   LKLPVIDFT   ++    +W A + +   AL +YGCF A+++KV  E+ + +F 
Sbjct  1     MGSEATLKLPVIDFTNLKLEANNPNWEAIKSQVHKALVDYGCFEAIFEKVPLELRKAIFA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K+ N S KP +GYVGQ P+VPL+ESMGID AN  + ++S T +MWP G
Sbjct  61    ALQELFDLPLQTKILNVSKKPYHGYVGQYPMVPLFESMGIDDANVYENVESMTNIMWPHG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FS+ +  +S+  +EL++++ +M+ ES GVEKY E H+ S  YL RVMKY+  Q ++ 
Sbjct  121   NPSFSKTIQSFSEQLSELDQIIRKMILESLGVEKYLEEHMNSTNYLLRVMKYKGPQTSDT  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             K+G  +H+DK+ ++ +YQN  + GLE+  K+G  W     SP S VVM GD++ AWSN R
Sbjct  181   KVGLTTHSDKNIVTILYQN-EVEGLEVMTKDG-KWISYRPSPDSFVVMIGDSLHAWSNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFME-KTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP HRVMM G   RYS   FS  +   +I+ P ELVD +HPL FKPFDH+ +L ++  
Sbjct  239   LHSPFHRVMMSGNEARYSAGLFSIPKGGNIIKAPEELVDEEHPLLFKPFDHVEFLKYYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E+ +R   AL+TYCGV
Sbjct  299   EKGQRDQFALRTYCGV  314



>ref|XP_010479801.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Camelina 
sativa]
Length=310

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/310 (48%), Positives = 217/310 (70%), Gaps = 5/310 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVA-LYDKVSSEVHERVFKGLVELF  1076
             K+  +DF++ED+KPGT  W +  +    ALE+YGCF+  L +K   ++ ++VF  LV+LF
Sbjct  4     KILTLDFSREDLKPGTKYWESTSKNITQALEKYGCFIIDLQNKTPLDLLDQVFGSLVDLF  63

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             DLPT+ K++NK  KPL GYVGQIP + L+ES+GID+A +L+  +SFT LMWPQGN+ FSE
Sbjct  64    DLPTHTKMKNKYDKPLSGYVGQIPTLHLHESLGIDNATSLEATRSFTGLMWPQGNEHFSE  123

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
              +  Y++ AA+L++MV++MVFESY VEKYY  +++S  YL R++K        P LGFV+
Sbjct  124   CLHKYAEFAAKLDQMVIQMVFESYNVEKYYNPYMESTTYLLRMLKNCAPNNENPTLGFVT  183

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHL-SPSSIVVMAGDAIMAWSNNRIKSPH  539
             HTDKSF + ++Q+  +NGLE++ + G+    ++L SPS  +V AGDA  AWSN+R+ SP 
Sbjct  184   HTDKSFTTILHQD-QVNGLEMETREGER-IKINLSSPSLFMVFAGDAFKAWSNDRVWSPR  241

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V++ G+  RYS+A F+F   T+ Q P EL+D  HPL +KPFDHL  L F+  +   + 
Sbjct  242   HQVLVSGETDRYSLAMFAFNNGTL-QVPEELIDHQHPLLYKPFDHLGLLRFYRTDTGFKS  300

Query  358   PCALKTYCGV  329
              C +K YCG+
Sbjct  301   ECPIKAYCGI  310



>ref|XP_006392868.1| hypothetical protein EUTSA_v10011672mg [Eutrema salsugineum]
 gb|ESQ30154.1| hypothetical protein EUTSA_v10011672mg [Eutrema salsugineum]
Length=315

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/318 (46%), Positives = 213/318 (67%), Gaps = 6/318 (2%)
 Frame = -2

Query  1273  MGSL--TPLKLPVIDFT-KEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS+  +  K+P++D T ++D+KP T +W +  +E+  ALEE+GCFV ++D V+ ++ + 
Sbjct  1     MGSIVKSSSKVPILDLTSQQDLKPNTSTWRSISKEACEALEEFGCFVVVHDGVTQQLDDS  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             +F    ELFDLPT  K +N + KP +GYVGQ+P++PL+E +GID+    +  Q FT LMW
Sbjct  61    IFAAAEELFDLPTETKRKNVNEKPYHGYVGQMPVIPLHEGLGIDYVTNKEYAQRFTHLMW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             PQGN  F   +  +S   AE++++VVRM+FE+YGVEK+Y+SHV S  YL + +KY    E
Sbjct  121   PQGNHQFCATVHAFSNAVAEIDQLVVRMIFENYGVEKHYDSHVGSKTYLLKFLKYLAPPE  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
             +     F  HTDK+F+S ++QN  +NGLE+K+K+G +W  + L   S VVMAGD  M WS
Sbjct  181   SISMPAFPQHTDKTFLSILHQN-DVNGLEVKSKDG-EWISLQLPSKSYVVMAGDISMGWS  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
             N+RI+S  HRV M+G   RYS   FSF+   M+  P ELVD +HPL +KPFD++  ++F+
Sbjct  239   NDRIRSCEHRVTMDGGKTRYSFGLFSFV-TGMVSVPKELVDDEHPLMYKPFDNIALINFY  297

Query  382   SKEENRRLPCALKTYCGV  329
             + +E R     LK YCG 
Sbjct  298   ATKEGREAKSTLKAYCGT  315



>gb|KHN01361.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=314

 Score =   308 bits (788),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 208/316 (66%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS   LKLPVIDFT   ++    +W A + +   AL +YGCF A+++KV  E+ + +F 
Sbjct  1     MGSEATLKLPVIDFTNLKLEANNPNWEAIKSQVHKALVDYGCFEAIFEKVPLELRKAIFA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K+ N S KP +GYVGQ P+VPL+ESMGID AN  + ++S T +MWP G
Sbjct  61    ALQELFDLPLQTKILNVSKKPYHGYVGQYPMVPLFESMGIDDANVYENVESMTNIMWPHG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FS+ +  +S+  +EL++++ +M+ ES GVEKY E H+ S  YL  VMKY+  Q ++ 
Sbjct  121   NPSFSKTIQSFSEQLSELDQIIRKMILESLGVEKYLEEHMNSTNYLLEVMKYKGPQTSDT  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             K+G  +H+DK+ ++ +YQN  + GLE+  K+G  W     SP S VVM GD++ AWSN R
Sbjct  181   KVGLTTHSDKNIVTILYQN-EVEGLEVMTKDG-KWISYRPSPDSFVVMIGDSLHAWSNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFME-KTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP HRVMM G   RYS   FS  +   +I+ P ELVD +HPL FKPFDH+ +L ++  
Sbjct  239   LHSPFHRVMMSGNEARYSAGLFSIPKGGNIIKAPEELVDEEHPLLFKPFDHVEFLKYYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E+ +R   AL+TYCGV
Sbjct  299   EKGQRDQFALRTYCGV  314



>gb|EYU21589.1| hypothetical protein MIMGU_mgv1a024911mg [Erythranthe guttata]
Length=251

 Score =   305 bits (782),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 186/232 (80%), Gaps = 4/232 (2%)
 Frame = -2

Query  1273  MGSLTPL-KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGSL+   KL VI+F+ ++ KPGT+SW     E VSALE+YGCFVA YDK++ E H  VF
Sbjct  1     MGSLSQEHKLDVIEFSDKNSKPGTESWSKTCDEVVSALEKYGCFVASYDKLTQETHTTVF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
             + L ELFDLPT  KV+NKSTKPLYGYVGQIP +PLYESMGID A+TLQGIQ+F K+MWP 
Sbjct  61    QALEELFDLPTQTKVQNKSTKPLYGYVGQIPFIPLYESMGIDDADTLQGIQNFAKVMWPN  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN+DFSE ++ Y+KLAAELE++VV+MVFE YGV K+YES + SA YL RVMKYRE + NE
Sbjct  121   GNNDFSEKLVWYTKLAAELEKIVVQMVFERYGVGKHYESLIGSANYLCRVMKYREPKSNE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVH-LSPSSIVVMAG  584
               +GFVSHTDKSFMSTI+QN  ++GLEIK K+G +WFGVH LS SS++   G
Sbjct  181   NNMGFVSHTDKSFMSTIHQN-QVDGLEIKTKDG-EWFGVHQLSSSSVIDSNG  230



>ref|XP_004241717.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=318

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/320 (48%), Positives = 217/320 (68%), Gaps = 7/320 (2%)
 Frame = -2

Query  1273  MGSLT-PLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGSLT P KL V+DF  E+++PGT +W +  +E   A E +GCF+ALYDK+S ++ + +F
Sbjct  1     MGSLTTPPKLLVVDFNNEELRPGTTTWESTCKEIRHAFENHGCFIALYDKISPQLQKSIF  60

Query  1096  K-GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP  920
             +    +LF+LP   KV N S KP +GYVGQI  +P +E+ GID+A T QGIQ+F+ LMWP
Sbjct  61    QDNSQQLFELPLERKVLNISEKPYHGYVGQISFLPNHEAFGIDYATTSQGIQTFSNLMWP  120

Query  919   QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQEN  740
             QGND F E+ L++SK+ A L+  VVRM+FESYG+ K  ES+V+S  YL R +KY   +  
Sbjct  121   QGNDSFCESSLMFSKIVAALDNKVVRMLFESYGITKNCESYVESTTYLLRYLKYNTPKTK  180

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
             E  + F  HTDK+F + +YQN HI+GLE++ ++   W  +   PSS VVMAG+A+  WSN
Sbjct  181   ETSMVFPPHTDKTFTTILYQN-HISGLEVQTRDL-QWITLEFPPSSFVVMAGEALRGWSN  238

Query  559   NRIKSPHHRVMME--GKGPRYSIAQFSFMEK-TMIQTPTELVDGDHPLQFKPFDHLHYLD  389
             +R+ +P HRV+M+  G   RY+I  F+F++   +I+   EL+D +HPL+FKPF HL  + 
Sbjct  239   DRVLTPIHRVIMDINGSETRYTIGLFTFLKNDKIIEVDEELIDEEHPLKFKPFVHLDLIK  298

Query  388   FFSKEENRRLPCALKTYCGV  329
             FF  E  RR    ++ +CGV
Sbjct  299   FFDTERGRRSQNLVEDFCGV  318



>ref|XP_009780364.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
sylvestris]
Length=315

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/300 (51%), Positives = 210/300 (70%), Gaps = 6/300 (2%)
 Frame = -2

Query  1219  MKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDLPTNVKVENKS  1040
             +KP T +W +A  E   ALEE GCF+A+YD VS E++  +F+ + ELFDLPT  K+ N S
Sbjct  19    LKPNTSNWFSACDEVRRALEECGCFLAVYDSVSPELNSDIFQAVEELFDLPTETKLYNTS  78

Query  1039  TKPLYGYVGQIPIVPLYESMGID--HANTLQGIQSFTKLMWPQGNDDFSEAMLVYSKLAA  866
              KP YGY G+IP  PL ES+GI+   A T +G+Q+FT LMWP GND FSE +  Y+ + A
Sbjct  79    EKPFYGYYGKIPDFPLQESLGINIGDAITAEGVQNFTNLMWPSGNDHFSEIIHDYANIVA  138

Query  865   ELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSHTDKSFMSTI  686
              LE+MV +MVFESYGVEK Y+S  +S  YL R++KYR  + +E  +G   HTDK+F+S +
Sbjct  139   GLEKMVKKMVFESYGVEKCYDSLEESTTYLLRLIKYRTPKLDESNVGSQVHTDKTFLSIL  198

Query  685   YQNCHINGLEIKAKNGDDWFGVHLSPS-SIVVMAGDAIMAWSNNRIKSPHHRVMMEGKGP  509
             +QN  +NGLEIK K+G +W  V ++P+ S +VM G+A  AWSNNR+  P HRV+++   P
Sbjct  199   HQN-QVNGLEIKTKDG-EWMAVDMTPANSFLVMVGEAFSAWSNNRLHCPVHRVIVKENKP  256

Query  508   RYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPCALKTYCGV  329
             RY+IA FS++   MIQTP ELVD  HP++F+PFD+   LDFF+K  N ++   ++ +CGV
Sbjct  257   RYTIAHFSYI-NGMIQTPEELVDEKHPIKFQPFDNFELLDFFAKHINDQMEYTVRAFCGV  315



>ref|XP_010481152.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=404

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/311 (47%), Positives = 208/311 (67%), Gaps = 4/311 (1%)
 Frame = -2

Query  1264  LTPLKLPVIDFT-KEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGL  1088
             L   K+P++DFT ++D+KP T  W +  R++  ALEEYGCFVA+YD V+ ++ + VF   
Sbjct  95    LKTTKVPILDFTSQQDLKPNTSVWRSISRDACEALEEYGCFVAVYDGVTQQLDDSVFAAA  154

Query  1087  VELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGND  908
              +LFDLP   K++N + KP +GYVGQ+PI+PL+E +GID+    +  + FT LMWPQGND
Sbjct  155   KDLFDLPAETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAKKFTNLMWPQGND  214

Query  907   DFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKL  728
              F + +  +S   AEL+ +VVRM+FE YGV+KYYESH +S  YL + + Y    E+    
Sbjct  215   RFCKTIHAFSNAVAELDRLVVRMIFEIYGVKKYYESHFESKTYLLKFLMYLAPPESVSMP  274

Query  727   GFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIK  548
              F  HTDK+F++ ++QN  +NGLE+K+K+G +W  + L   S VVMAGD  M WSN+RI+
Sbjct  275   AFPQHTDKTFLTILHQN-DVNGLEVKSKDG-EWISLQLPLKSYVVMAGDISMGWSNDRIR  332

Query  547   SPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEEN  368
             S  HRV MEG   RY+I  FSF+  + +  P ELVD +HPL +KPF ++  ++FF+ +E 
Sbjct  333   SCEHRVTMEGDKVRYTIGLFSFLTGS-VSIPEELVDDEHPLMYKPFTNIALINFFATKEG  391

Query  367   RRLPCALKTYC  335
             R     LK YC
Sbjct  392   REANSTLKAYC  402


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = -2

Query  1264  LTPLKLPVIDFT-KEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGL  1088
             L   K+P++DFT ++D+KP T  W +  R++  ALEEYGCFVA+YD V+ ++ + VF   
Sbjct  5     LKTTKVPILDFTSQQDLKPNTSVWRSISRDACEALEEYGCFVAVYDGVTQQLDDSVFAAA  64

Query  1087  VELFDLPTNVKVEN  1046
              +LFDLP   K++N
Sbjct  65    KDLFDLPAETKMKN  78



>ref|XP_008454372.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Cucumis melo]
Length=314

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/317 (48%), Positives = 208/317 (66%), Gaps = 6/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M   + LKLP+IDF+  +++ G   W  A+ +   ALEE+GCF A +DKV  EV + +F+
Sbjct  1     MDGESSLKLPLIDFS--NLESGGPKWELAKAQVKEALEEFGCFEASFDKVPIEVRKGLFE  58

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELF+LP   K+ N S KP +GYVGQ P+ PL+ESMG+D +   Q +Q FT ++WPQG
Sbjct  59    ALEELFNLPLETKLRNVSQKPFHGYVGQYPMAPLFESMGVDDSTIPQKVQDFTNILWPQG  118

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREA-QENE  737
             N  FS+ +  YS+  +EL+EMV RMV ES GVEKY E H++S  YL RVMKY+   Q NE
Sbjct  119   NPTFSKVIETYSQQLSELDEMVRRMVLESLGVEKYMEEHLESTNYLLRVMKYKGTDQSNE  178

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
              K+G  SHTDK+ ++ +YQN H+ GL+++ K+G  W     SP S V M GD+  AW+N 
Sbjct  179   TKIGLHSHTDKNIVTILYQN-HVEGLQVQTKDG-KWINFQPSPHSFVAMIGDSFHAWTNG  236

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             R+ SP+HRVMM G+  RYS   FS  +   +++ P ELVD  HPL F PFDH+ +L F+ 
Sbjct  237   RLHSPYHRVMMSGEEVRYSAGLFSIPKAGYIVKAPEELVDEQHPLLFNPFDHVQFLQFYY  296

Query  379   KEENRRLPCALKTYCGV  329
              E  ++   ALKT+CG 
Sbjct  297   TEAGQKAQSALKTFCGA  313



>ref|XP_004136074.1| PREDICTED: gibberellin 20 oxidase 1-like [Cucumis sativus]
Length=317

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 210/320 (66%), Gaps = 8/320 (3%)
 Frame = -2

Query  1273  MGSLTP--LKLPVIDFTKEDMKP-GTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS T   ++LPVI+F+ E +K  G   W    +    A+EEYGCF+A Y+ VS E+ E 
Sbjct  1     MGSETTEEIRLPVINFSDEKVKAEGGVEWRRTSKNVREAMEEYGCFIAKYEGVSKELREE  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             V K + ELF+LP   K  NK  KP  GYVG++  +PL+ES+GID A     +QSF+ LMW
Sbjct  61    VLKAVKELFELPIERKKMNKYEKPFNGYVGELRTLPLHESLGIDDATNFNQVQSFSHLMW  120

Query  922   -PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQ  746
              P+GN  FS  +  ++K+A EL++MV +M+FESYGVEKYY SH  S  YL RV+K +  Q
Sbjct  121   PPEGNHHFSATLHSFAKIAEELDKMVTKMIFESYGVEKYYNSHADSITYLLRVLKSKAPQ  180

Query  745   ENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGV-HLSPSSIVVMAGDAIMA  569
               +P L  V HTDKSF + +YQ+ HINGLE+K KNG  W  V + SPSS +V+AGDAI A
Sbjct  181   SPDPTLCLVDHTDKSFTTMVYQD-HINGLELKTKNG-QWIQVDNSSPSSFLVIAGDAIKA  238

Query  568   WSNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLD  389
             WSN+RI+SP H+V + G   RYS+A F F    +++ P ELVD +HPL++KPFDH+  L 
Sbjct  239   WSNDRIESPTHKVTIRGNEDRYSLAMFGF-SNGIVEVPKELVDQNHPLRYKPFDHIGLLH  297

Query  388   FFSKEENRRLPCALKTYCGV  329
             FF  +E       LK YC +
Sbjct  298   FFRSKEGFNSKSPLKDYCAI  317



>ref|XP_009616144.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=317

 Score =   306 bits (784),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 215/319 (67%), Gaps = 6/319 (2%)
 Frame = -2

Query  1273  MGSLTPL-KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGSLT   +L V++F  E+++PGT +W +  +E   A E +G F+ALYDK+S ++ + +F
Sbjct  1     MGSLTASPQLLVVNFNNEELRPGTATWESTCKEIRFAFENHGSFIALYDKISPQLQKSIF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
             +   +LF+LP   KV N + KP +GYVGQIP +P +E+ GID+A T QGIQSF+ LMWPQ
Sbjct  61    QASQQLFELPLEKKVLNTNEKPYHGYVGQIPFLPHHEAFGIDYATTSQGIQSFSNLMWPQ  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND F E  L++SK+ AEL++ VVRM+FESYG+ K  ES+++S  YL R +KY      E
Sbjct  121   GNDFFGENSLMFSKIVAELDQKVVRMLFESYGIGKNCESYLESTTYLLRYLKYDAPNTKE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               + F  HTDK+F + +YQN  I+GLE++ ++G  W  +   PSS VVMAG+A   WSN+
Sbjct  181   NSMVFPPHTDKTFTTILYQN-RISGLEVQTRDG-QWINMEFPPSSFVVMAGEACRGWSND  238

Query  556   RIKSPHHRVMME--GKGPRYSIAQFSFM-EKTMIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             R+ +P H+V+M+  G   RY++  F+F+ +  MI+   ELVD +HPLQFKPF H+  + F
Sbjct  239   RVLTPVHKVIMDISGNETRYTVGIFTFLKDDKMIEVAEELVDEEHPLQFKPFVHIDLIKF  298

Query  385   FSKEENRRLPCALKTYCGV  329
             F  E  RR    LK +CGV
Sbjct  299   FDTERGRRSQDLLKDFCGV  317



>emb|CDY26044.1| BnaC06g05800D [Brassica napus]
Length=317

 Score =   306 bits (784),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 211/319 (66%), Gaps = 6/319 (2%)
 Frame = -2

Query  1273  MGS---LTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS   L PL LPVIDF+ +++KPG   W   + +   AL++YGCF A +DKV  E+ + 
Sbjct  1     MGSETPLLPLHLPVIDFSNQNLKPGEPQWDLTKADVQKALQDYGCFEASFDKVPIELRKS  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             +FK L ELFDLP   K+ N S KP +GYVGQ P+VPLYESMGID ++ +  +++FT+ +W
Sbjct  61    IFKALEELFDLPLKTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDVVDKVEAFTEKLW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             PQGN+ FS  +  +SK  +EL+  + RM+ ES+G+ KY + H++S  YL RVMKY     
Sbjct  121   PQGNNSFSATIHSFSKKLSELDITIRRMIMESFGLVKYIDEHLQSTNYLLRVMKYTGPDT  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              E KLG  +HTDK+ ++ +YQN H+ GLE++ K+  +W  V  S  S +VM GD++ A  
Sbjct  181   EETKLGLNAHTDKNIVTILYQN-HVEGLEVQTKD-KNWIKVKPSEDSFIVMIGDSLHALL  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             N R+ SP+HRVMM G   RYS+  FS  +   ++ +P ELVD +HP  FKPFDH+ +L F
Sbjct  239   NGRLHSPYHRVMMTGTETRYSLGLFSIPKAGHIVSSPDELVDEEHPRLFKPFDHVEFLKF  298

Query  385   FSKEENRRLPCALKTYCGV  329
             +  E  +R   ALKTYCG+
Sbjct  299   YYTEAGQRSQSALKTYCGM  317



>ref|XP_008228620.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=321

 Score =   306 bits (784),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/321 (46%), Positives = 207/321 (64%), Gaps = 3/321 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS TPL+LPVIDF+ + + PGT  W   R +  +ALEEYGCF AL+ KV S + + +F+
Sbjct  1     MGSETPLRLPVIDFSNQSLTPGTTEWNTVRAQVHNALEEYGCFEALFTKVPSHIRKSIFQ  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + EL DLP   K++  S KP  GY GQ P++PLYESM ID AN  + +QS    +WPQG
Sbjct  61    SIEELLDLPLQTKLKIVSKKPFRGYAGQSPMMPLYESMPIDGANVYEQVQSLANTLWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F + +  +++  +EL++++ RM+ ES G+EKY E H+ S  YL RVMKY+  Q NE 
Sbjct  121   NPSFCKTIQSFTEKVSELDQIIRRMILESLGLEKYLEEHLNSTNYLLRVMKYKVPQTNET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG   HTDK+ ++ +YQN  ++GLE++ K+G  W  V  S  S +V+ G+++ AW+N R
Sbjct  181   KLGIPPHTDKNIVTILYQN-QVDGLEVQTKDG-KWINVKPSSDSFIVLIGESLHAWTNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSF-MEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP HRVMM G   RYS   FS   E  +I+ P E+VD +HPL FKP++H  +  F + 
Sbjct  239   LYSPIHRVMMNGNEARYSTGLFSAPKEGYIIKAPNEVVDEEHPLLFKPYEHAQFTAFCNS  298

Query  376   EENRRLPCALKTYCGV*PATL  314
             E  RR    LKT+CGV   TL
Sbjct  299   EAGRRDLFPLKTFCGVQDLTL  319



>ref|XP_009147658.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
Length=317

 Score =   305 bits (782),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 210/319 (66%), Gaps = 6/319 (2%)
 Frame = -2

Query  1273  MGS---LTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS   L PL LPVIDF+ +++KPG   W   + +   AL++YGCF A +DKV  E+ + 
Sbjct  1     MGSETPLLPLHLPVIDFSNQNLKPGEPQWDLTKADVQKALQDYGCFEASFDKVPIELRKS  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             +FK L ELFDLP   K+ N S KP +GYVGQ P+VPLYESMGID ++ +  +++FT+ +W
Sbjct  61    IFKALEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDVVDKVEAFTEKLW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             PQGN  FS  +  +SK  +EL+  + RM+ ES+G+ KY + H++S  YL RVMKY     
Sbjct  121   PQGNTSFSATIHSFSKKLSELDITIRRMIMESFGLVKYIDEHLQSTNYLFRVMKYTGPDT  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              E KLG  +HTDK+ ++ +YQN H+ GLE++ K+  +W  V  S  S +VM GD++ A  
Sbjct  181   EETKLGLNAHTDKNIVTILYQN-HVEGLEVQTKD-KNWINVKPSEDSFIVMIGDSLHALL  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             N R+ SP+HRVMM G   RYS+  FS  +   ++ +P ELVD +HP  FKPFDH+ +L F
Sbjct  239   NGRLHSPYHRVMMTGTETRYSLGLFSIPKAGHIVSSPDELVDEEHPRLFKPFDHVEFLKF  298

Query  385   FSKEENRRLPCALKTYCGV  329
             +  E  +R   ALKTYCG+
Sbjct  299   YYTEAGQRSQSALKTYCGM  317



>ref|XP_010033901.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW53767.1| hypothetical protein EUGRSUZ_J03020 [Eucalyptus grandis]
Length=314

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/316 (46%), Positives = 209/316 (66%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS+  LKLPVIDF+   ++PGT  W A R E   ALE YGCF A ++KV  E+ + +  
Sbjct  1     MGSMAELKLPVIDFSSPRLEPGTAEWTAVRDEVKQALETYGCFEAWFEKVPVELQKSMLG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELFDLP   K+ N S KP +GYVGQ P+VPLYES+GID A+  + +   T  +WP+G
Sbjct  61    SVQELFDLPLQTKLRNVSRKPYHGYVGQYPMVPLYESIGIDDADIYEKVDGLTTTLWPEG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N +FS+ +  +++  +EL++M  RM+ ES+GVEKY + H+ S  YL R+MKY   Q  +P
Sbjct  121   NMNFSKTIHSFTEKLSELDKMSRRMILESFGVEKYLDEHMNSTNYLFRLMKYAGPQTTDP  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG V HTD++ ++ + QN  ++GL+++ K+G +W     S +S VVM G+++ AW N R
Sbjct  181   KLGLVPHTDQNTVTILCQN-EVDGLQVQTKHG-EWISTRPSTNSFVVMIGESLNAWLNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + +P+H+VMM G   RYS   F+  +   +++ P ELVD +HPL FKPFDH+ +LDF+  
Sbjct  239   LHTPYHQVMMSGNRARYSAGLFTVPKGGYIVKAPNELVDEEHPLLFKPFDHVEFLDFYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E  +R   ALK YCGV
Sbjct  299   ETGQRAKSALKAYCGV  314



>ref|XP_004151475.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
Length=335

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 206/314 (66%), Gaps = 9/314 (3%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             +LPV+ F  +++K GT+ WV+  ++   ALEEYGCFVALYD VS+EV   +F  L ELFD
Sbjct  9     QLPVVKFCSQNLKSGTEEWVSTTKKVREALEEYGCFVALYDTVSAEVSSNMFDSLKELFD  68

Query  1072  -LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP-QGNDDFS  899
              +P   K++N S KP +GY GQ P++P++ESMGI+H      I SFT LMWP +GN  F 
Sbjct  69    EVPLERKLQNVSEKPYHGYFGQNPLMPIHESMGIEHPILPTNINSFTNLMWPSRGNHSFR  128

Query  898   EAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFV  719
             E +  Y+ L +EL++ V  MVFESYGV     SH++S  YL R++KYR  +E E  LG  
Sbjct  129   ENVTAYANLVSELDKRVKSMVFESYGVGNALRSHMESTKYLMRMIKYRVPKEKEMNLGAF  188

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVH----LSPSSIVVMAGDAIMAWSNNRI  551
              HTDKSF++ ++QN  +NGL+IK ++ + W   H     S SS +VMAGDA  AWSN RI
Sbjct  189   PHTDKSFLTILHQN-EVNGLQIKTRD-NKWIQYHPFSSSSTSSFIVMAGDAFFAWSNGRI  246

Query  550   KSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEE  371
              SP HRV+M G   RYS+  FSF    ++Q P ELVD  HP  FKPFDH  YL F+S E 
Sbjct  247   YSPPHRVIMSGNKERYSVGLFSF-NNGIVQIPKELVDDKHPQLFKPFDHQDYLRFYSTER  305

Query  370   NRRLPCALKTYCGV  329
              +  PCA+K YCGV
Sbjct  306   GQNSPCAIKAYCGV  319



>ref|XP_004171510.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 20 oxidase 1-like 
[Cucumis sativus]
Length=317

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 210/320 (66%), Gaps = 8/320 (3%)
 Frame = -2

Query  1273  MGSLTP--LKLPVIDFTKEDMKP-GTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS T   ++LPVI+F+ E +K  G   W    ++   A+EEYGCF+A Y+ VS E+ E 
Sbjct  1     MGSETTEEIRLPVINFSDEKVKAEGGVEWRRTSKKVREAMEEYGCFIAKYEGVSKELREE  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             V K + ELF+LP   K  NK  KP  GYVG++  +PL+ES+GID A     +QSF+ LMW
Sbjct  61    VLKAVKELFELPIERKKMNKYEKPFNGYVGELRTLPLHESLGIDDATNFNQVQSFSHLMW  120

Query  922   -PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQ  746
              P+GN  FS  +  ++K+A EL++MV +M+FESYGVEKYY SH  S  YL RV+K +  Q
Sbjct  121   PPEGNHHFSATLHSFAKIAEELDKMVTKMIFESYGVEKYYNSHADSITYLLRVLKSKAPQ  180

Query  745   ENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGV-HLSPSSIVVMAGDAIMA  569
               +P L  V HTDKSF + +YQ+ HINGLE+K K G  W  V + SPSS +V+AGDAI A
Sbjct  181   SPDPTLCLVDHTDKSFTTMVYQD-HINGLELKTKXG-QWIQVDNSSPSSFLVIAGDAIKA  238

Query  568   WSNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLD  389
             WSN+RI+SP H+V + G   RYS+A F F    +++ P ELVD +HPL++KPFDH+  L 
Sbjct  239   WSNDRIESPTHKVTIRGNEDRYSLAMFGF-SNGIVEVPKELVDQNHPLRYKPFDHIGLLH  297

Query  388   FFSKEENRRLPCALKTYCGV  329
             FF  +E       LK YC +
Sbjct  298   FFRSKEGFNSKSPLKDYCAI  317



>ref|XP_002517547.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44711.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=314

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 219/318 (69%), Gaps = 7/318 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  ++P++D + E + PG+ SW +A  +   ALE+YGCF  +Y+  S E H RV  
Sbjct  1     MGSETVGQIPLVDLSSEHLNPGSSSWRSACNDIRKALEQYGCFEVVYNNPSIEFHNRVLA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L +LF LP  +K++N + KP +GY+G++ I P++E MGI++AN     Q FT LMWP+G
Sbjct  61    LLEKLFQLPQEIKMKNVNPKPAHGYMGKMSIFPIHEGMGIEYANDKDECQKFTNLMWPEG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F + +  Y+K+  EL++++V+M+FESYG+EK+ ESH+KS  YL R++KYR +Q  E 
Sbjct  121   NDHFCDTVHSYAKMVTELQQLLVKMLFESYGIEKHSESHIKSTTYLLRLLKYRRSQA-ET  179

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSP-SSIVVMAGDAIMAWSNN  557
              LGF  HTDKSF+S ++QN H+ GLEI+ K+G +W     S  +S VV+AGD  MAWSN+
Sbjct  180   NLGFKGHTDKSFLSILHQN-HVKGLEIRMKDG-NWVSYEPSSHTSFVVVAGDVGMAWSND  237

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF--  383
             RIKS +HRV ++G+  RY++  FSF+   +++ P EL+D +HPLQ+KPF+H   LDF+  
Sbjct  238   RIKSCYHRVTVDGEEVRYALGLFSFL-TGLVKVPEELIDEEHPLQYKPFEHQGLLDFYQS  296

Query  382   SKEENRRLPCALKTYCGV  329
             +  +N+     +K YCGV
Sbjct  297   NNSQNKGDSNMVKAYCGV  314



>ref|XP_002284985.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36207.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   303 bits (776),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 209/319 (66%), Gaps = 9/319 (3%)
 Frame = -2

Query  1276  IMGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             IMG  T  K+P++DF+KE++KPGTDSW+ A      ALEEYGCF+A+YD+V   VH  +F
Sbjct  4     IMGLETLPKIPMVDFSKENLKPGTDSWLPACNNVRHALEEYGCFMAVYDQVPLGVHNTIF  63

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANT-LQGIQSFTKLMWP  920
               + ELFDLP   K +N S KP  GY  + P  PL++ +GID+  T L+ I+ F K+MWP
Sbjct  64    GAMRELFDLPIETKKQNISEKPYQGYTSESPAAPLHQGLGIDNVTTNLEEIRRFAKIMWP  123

Query  919   QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQEN  740
              GN++F +++  YSKL AEL+ MVVRMV ESYG+E    SH++SA +L R++K R  + N
Sbjct  124   AGNENFCQSVHCYSKLVAELDRMVVRMVLESYGIEN--GSHIESASFLVRLLKSRVPKMN  181

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPS--SIVVMAGDAIMAW  566
             E    F SH DKSF+S ++QN  +NGLEI+ K+G  W   H  PS    +VMAG+ + AW
Sbjct  182   ETNKAFPSHCDKSFISILHQN-KVNGLEIQTKDG-KWIS-HEPPSLQVFLVMAGEVLTAW  238

Query  565   SNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             SN RI    HRV+++G   RY++  FS +   MI+ P ELVD  HPLQFKPFDH   L F
Sbjct  239   SNGRIHPARHRVVVKGNEARYTLGLFSTI-NGMIKVPEELVDDHHPLQFKPFDHTGLLHF  297

Query  385   FSKEENRRLPCALKTYCGV  329
                +E R    ALK YCG+
Sbjct  298   LGTKEGRNPETALKAYCGL  316



>gb|KDP37370.1| hypothetical protein JCGZ_06824 [Jatropha curcas]
Length=315

 Score =   303 bits (775),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 152/318 (48%), Positives = 209/318 (66%), Gaps = 6/318 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKP-GTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGSL+  KLPVIDF+ E+++  GT  WV+  ++ + ALEEYGCFVA+YDKV  ++H  +F
Sbjct  1     MGSLSNSKLPVIDFSSENLEAAGTSGWVSKCKDVLKALEEYGCFVAVYDKVPLQLHADLF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
               L ELFDLP   K +N S  P  G++  +P     ESM I    TL+GIQ FTK MWP 
Sbjct  61    NVLQELFDLPLETKRKNVSDVPFTGFIEHVPHRSFIESMAITRTETLEGIQDFTKTMWPN  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQ--E  743
             GN++F + +  Y+K   EL +MVV+M+F+ YG+EKYYESH++S  Y +R + Y   Q  E
Sbjct  121   GNNNFCKIVHSYTKTVEELHKMVVKMIFDGYGMEKYYESHMESTTYFSRFLNYIVPQENE  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
             NE K G   H DKSF++ ++QN  ++GL+IK KNG +W  VHL+ S  +V+AG+ IM WS
Sbjct  181   NETKQGLHPHMDKSFLTMLHQN-DVSGLQIKPKNG-EWLDVHLASSDFLVLAGEGIMGWS  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
             N+RI    HRV ++ K  R+S+  FSF +K ++Q P E VD DHPL +KPFDH+  L FF
Sbjct  239   NDRIDGCDHRVTIKSKEKRFSVGLFSF-DKGIMQVPKEFVDDDHPLMYKPFDHIGLLHFF  297

Query  382   SKEENRRLPCALKTYCGV  329
                E  +   +LK Y G+
Sbjct  298   GTPEGYKQHHSLKAYTGL  315



>ref|XP_006427130.1| hypothetical protein CICLE_v10027182mg, partial [Citrus clementina]
 gb|ESR40370.1| hypothetical protein CICLE_v10027182mg, partial [Citrus clementina]
Length=323

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 210/316 (66%), Gaps = 3/316 (1%)
 Frame = -2

Query  1276  IMGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             +MGS T  K+ V+D   E++KPGT +W++   E   A+E+ GCF A+Y+K+  E+H  +F
Sbjct  11    LMGSQTQPKILVVDLCNENLKPGTSTWISTCNEIRQAMEDTGCFEAIYNKIPLELHNEIF  70

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
             K   ELFDLP   K++N S KP + Y GQ   +PLYES+ ID    L   QSFT  MWP 
Sbjct  71    KAADELFDLPIETKMQNTSDKPYHEYFGQYTGIPLYESLAIDDPTNLTATQSFTDRMWPN  130

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN  F E++  ++K+  E++++V+RM+ ESYG+EKYY+SH++++ YL R  KYR+ + NE
Sbjct  131   GNPPFCESVHSFAKIIVEVDQLVMRMIMESYGIEKYYDSHIETSNYLLRFFKYRKPEINE  190

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               +G   HTDK+ +S I+QN HINGL+IKAK+G +W  +  SPSS V+MA D ++AWSN 
Sbjct  191   HNVGLYPHTDKNMVSIIHQN-HINGLQIKAKDG-EWIDLEPSPSSFVIMAADGLLAWSNG  248

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI+S  H+V++     RYS+  FSF  + ++  P E VD  HPL+++PFD   +L F   
Sbjct  249   RIRSCEHQVIINAHETRYSMGLFSF-NRGIVHIPEEFVDELHPLRYRPFDIYEFLRFHDS  307

Query  376   EENRRLPCALKTYCGV  329
             +E ++   ++ ++CG+
Sbjct  308   DEGKKTDGSITSFCGI  323



>ref|XP_003533058.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1-like 
[Glycine max]
 gb|KHN47794.1| Gibberellin 20 oxidase 2 [Glycine soja]
Length=319

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 214/316 (68%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  ++P++DFT E++KPGT  W +A     SALE++GCF AL DKV  +++  VF 
Sbjct  1     MGSQTACQVPIVDFTDEELKPGTAKWASACLVIRSALEDHGCFYALCDKVPMDLYNSVFA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELF LP   K++  S KP +GY GQ   +PLYES+GI+   T++G+Q+FTKLMWP G
Sbjct  61    LMEELFYLPLETKLQKMSDKPYHGYYGQFTHLPLYESLGINDPLTMEGVQNFTKLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGV-EKYYESHVKSACYLARVMKYREAQENE  737
              D F E + +Y+KL  EL+ M  RMVF+ YG+ +++ +S ++S  Y+ R  KYR  Q++E
Sbjct  121   YDHFCETLSLYAKLLVELDHMAKRMVFDGYGLDQRHCDSLLESTNYMLRSFKYRLPQKDE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               LG  +HTD SF + ++QN ++NGL++K KNG +W  + LSP  ++++AGDA   WSN+
Sbjct  181   NNLGLHAHTDTSFFTILHQN-NVNGLQVKLKNG-EWVDIDLSPFMLLILAGDAFKVWSND  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI    HRV+++GK  RYS+  FS   K M++TP ELVD DHP ++KPFDH  YL F++ 
Sbjct  239   RIHCCEHRVIIKGKKDRYSMGLFSLGGK-MVETPEELVDEDHPRRYKPFDHYEYLRFYAT  297

Query  376   EENRRLPCALKTYCGV  329
             ++     C +K +CG+
Sbjct  298   KKALESECRIKAFCGI  313



>ref|XP_010500907.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Camelina sativa]
Length=317

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/319 (47%), Positives = 210/319 (66%), Gaps = 6/319 (2%)
 Frame = -2

Query  1273  MGS---LTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS   L PL LPVIDF+ E +KPG   W     +   AL++YGCF A +D++  E+ + 
Sbjct  1     MGSETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKL  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             VF+ L ELFDLP   K+ N S KP +GYVGQ P+VPLYESMGI+  +  + + +FTK +W
Sbjct  61    VFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             PQGN+ FS  +  +SK  ++L+  + RM+ ES+G++KY + H+ S  YL RVMKY+E   
Sbjct  121   PQGNNSFSTRIHTFSKKLSDLDITIRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKEPDT  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              E KLG  +HTDK+ ++ +YQN H+ GLE++ K+ ++W  V  S  S +VM GD++ A  
Sbjct  181   EETKLGLNAHTDKNIVTILYQN-HVEGLEVQTKD-NNWIKVKPSKDSFIVMIGDSLHAML  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             N R+ SP+HRVMM G   RYS+  FS  +   +I +P ELVD +HP  FKPFDH+ +L F
Sbjct  239   NGRLHSPNHRVMMTGTETRYSLGLFSIPKAGHIISSPEELVDEEHPRLFKPFDHVEFLQF  298

Query  385   FSKEENRRLPCALKTYCGV  329
             +  +  +R   ALKTYCG+
Sbjct  299   YYTQAGQRSQSALKTYCGI  317



>gb|KDO58207.1| hypothetical protein CISIN_1g037660mg [Citrus sinensis]
Length=312

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/315 (44%), Positives = 209/315 (66%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  K+ V+D   E++KPGT +W++   E   A+E+ GCF A+Y+K+  E+H  +FK
Sbjct  1     MGSQTQPKILVVDLCNENLKPGTSTWISTCNEIRQAMEDTGCFEAIYNKIPLELHNEIFK  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELFDLP   K++N S KP + Y GQ   +PLYES+ ID    L   QSFT  MWP G
Sbjct  61    AADELFDLPIETKMQNTSDKPYHEYFGQYTGIPLYESLAIDDPTNLTATQSFTDRMWPNG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  F E++  ++K+  E++++V+RM+ ESYG+EKYY+SH++++ YL R  KYR+ + NE 
Sbjct  121   NPPFCESVHSFAKIIVEVDQLVMRMIMESYGIEKYYDSHIETSNYLLRFFKYRKPEINEH  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              +G   HTDK+ +S I+QN HINGL+IKAK+G +W  +  SPSS V+MA D ++AWSN R
Sbjct  181   NVGLYPHTDKNMVSIIHQN-HINGLQIKAKDG-EWIDLEPSPSSFVIMAADGLLAWSNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             I+S  H+V++     RYS+  FSF  + ++  P E VD  HPL+++PFD   +L F   +
Sbjct  239   IRSCEHQVIINAHETRYSMGLFSF-NRGIVHIPEEFVDELHPLRYRPFDIYEFLRFHDSD  297

Query  373   ENRRLPCALKTYCGV  329
             E ++   ++ ++CG+
Sbjct  298   EGKKTDGSITSFCGI  312



>ref|XP_006305391.1| hypothetical protein CARUB_v10009783mg [Capsella rubella]
 gb|EOA38289.1| hypothetical protein CARUB_v10009783mg [Capsella rubella]
Length=317

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 208/319 (65%), Gaps = 6/319 (2%)
 Frame = -2

Query  1273  MGS---LTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS   L PL+LPVIDF+ +++KPG   W   R +   AL++YGCF A +D +  E+ + 
Sbjct  1     MGSETPLLPLRLPVIDFSNKNLKPGEPEWDLTRADVKKALQDYGCFEAAFDGIPVELRKS  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             VF  L ELFDLP   K+ N S KP +GYVGQ P+VPLYESMGI+ A+  + +  FT  +W
Sbjct  61    VFGALEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDADVAEKVDDFTGKLW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             PQGN+ FS  +  +S+  +EL+  + RM+ ES+ ++KY + H+ S  YL RVMKY+E   
Sbjct  121   PQGNNSFSTTIHSFSEKLSELDITIRRMIMESFRLDKYIDEHLHSTNYLMRVMKYKEPDT  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              + KLG  +HTDK+ ++ +YQN H+ GLE++ K+ ++W  V  S  S +VM GD++    
Sbjct  181   EDTKLGLNAHTDKNIVTILYQN-HVEGLEVQTKD-NNWIKVKPSQDSFIVMIGDSLYGML  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             N R+ SP+HRVMM G   RYS+  FS  +   +I +P ELVD +HP  FKPFDH+ +L F
Sbjct  239   NGRLHSPYHRVMMTGTETRYSLGLFSIPKAGHIISSPDELVDEEHPRLFKPFDHVEFLQF  298

Query  385   FSKEENRRLPCALKTYCGV  329
             +  E  +R   ALKTYCG+
Sbjct  299   YYTEAGQRSQSALKTYCGI  317



>ref|XP_008461058.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 isoform X2 [Cucumis melo]
Length=316

 Score =   300 bits (769),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 205/318 (64%), Gaps = 6/318 (2%)
 Frame = -2

Query  1273  MGSLT-PLKLPVIDFTKEDMKP-GTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERV  1100
             MGS T   +LPVI+F+ E +K  G+  W    ++   ALEEYGCF+A Y+ V  E+ E V
Sbjct  1     MGSETMEERLPVINFSDEKVKAEGSVEWRRTSKKVREALEEYGCFIAKYEGVGKELREEV  60

Query  1099  FKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP  920
              K + ELF+LP   K  NK  KP  GYVG++  +PL+ES+GID A    G+QSF+ LMWP
Sbjct  61    LKAVKELFELPIERKKMNKYEKPFNGYVGELRTLPLHESLGIDDATNFNGVQSFSHLMWP  120

Query  919   QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQEN  740
             +GN  FS  +  ++K A EL++MV +M+FESYGVEKYY SH  S  YL R++K +  Q  
Sbjct  121   EGNHHFSATLHSFAKRAEELDKMVTKMIFESYGVEKYYNSHADSITYLLRILKNKAPQSP  180

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGV-HLSPSSIVVMAGDAIMAWS  563
             +P L  V HTDKSF + IYQ+ HINGLE+K KNG  W  V + SPSS VV+AGDA  AWS
Sbjct  181   DPTLCLVDHTDKSFTTMIYQD-HINGLELKTKNG-QWIQVDNSSPSSFVVIAGDAFKAWS  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
             N RI+S  HRV+M G+  RYSI  FSF   T I+ P   VD  +PL++KPF+H  +L + 
Sbjct  239   NERIRSCRHRVIMRGEETRYSIGMFSFKNGT-IEVPQGFVDDANPLRYKPFNHYDFLTYD  297

Query  382   SKEENRRLPCALKTYCGV  329
                 +      +K YCG+
Sbjct  298   KANASHNTISRIKDYCGL  315



>ref|XP_010462134.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=317

 Score =   300 bits (769),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 210/319 (66%), Gaps = 6/319 (2%)
 Frame = -2

Query  1273  MGS---LTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS   L PL LPVIDF+ E +KPG   W     +   AL++YGCF A +D++  E+ + 
Sbjct  1     MGSETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKL  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             VF+ L ELFDLP   K+ N S KP +GYVGQ P+VPLYESMGI+  +  + + +FTK +W
Sbjct  61    VFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             PQGN+ FS  +  +SK  ++L+  + RM+ ES+G++KY + H++S  YL RVMKY+    
Sbjct  121   PQGNNSFSTRIHTFSKKLSDLDITIRRMIMESFGLDKYIDEHLQSTNYLLRVMKYKGPDT  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              E KLG  +HTDK+ ++ +YQN H+ GLE++ K+ ++W  V  S  S +VM GD++ A  
Sbjct  181   EETKLGLNAHTDKNIVTILYQN-HVEGLEVQTKD-NNWIKVKPSKDSFIVMIGDSLHAML  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             N R+ SP+HRVMM G   RYS+  FS  +   +I +P ELVD +HP  FKPFDH+ +L F
Sbjct  239   NGRLHSPNHRVMMTGTETRYSLGLFSIPKAGHIISSPEELVDQEHPRLFKPFDHVEFLQF  298

Query  385   FSKEENRRLPCALKTYCGV  329
             +  +  +R   ALKTYCG+
Sbjct  299   YYTQAGQRSQSALKTYCGI  317



>ref|XP_010047771.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW79750.1| hypothetical protein EUGRSUZ_C01096 [Eucalyptus grandis]
Length=313

 Score =   300 bits (769),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 202/316 (64%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MG+L+P KLP+IDF K DMKPG+  W + +RE V ALEEYGCF A YDK+S E+H+ VF+
Sbjct  1     MGALSPPKLPLIDFCKNDMKPGSADWDSVQREVVKALEEYGCFEARYDKISVELHDEVFR  60

Query  1093  GLVELFDLPTNVK-VENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
              + +LF+LP   K +     KP  GY+  +P + LYE++GI       GIQ    LMWPQ
Sbjct  61    QVEDLFNLPAKTKRLFVDPRKPYDGYITNLPNLSLYEAIGISGMLDSGGIQKLANLMWPQ  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN  F E +  Y+   +ELE ++ RMVF+S GVEKY +SH KS  +  R M+Y+     E
Sbjct  121   GNPKFCETLTSYAMRLSELESLITRMVFQSLGVEKYLDSHTKSLNHSIRAMRYKSPMTQE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
             P++G  SH DK+F++ + QN H+NGLE++ K+G  W  V  S S++VVM G++++ WSN 
Sbjct  181   PQVGASSHCDKNFLTILQQN-HVNGLEVQTKDG-RWSPVAPSASTLVVMVGESLLGWSNG  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             R+  P H+VMM G   RYSI  FS + + +I+ P ELVD  HPL FKPFD +  L F   
Sbjct  239   RLHCPRHQVMMSGNETRYSIGSFSAI-RGVIECPCELVDEQHPLLFKPFDEVGLLRFSLT  297

Query  376   EENRRLPCALKTYCGV  329
             E+       LK YCGV
Sbjct  298   EQGHEAESTLKAYCGV  313



>ref|XP_006392865.1| hypothetical protein EUTSA_v10011667mg [Eutrema salsugineum]
 gb|ESQ30151.1| hypothetical protein EUTSA_v10011667mg [Eutrema salsugineum]
Length=317

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 208/319 (65%), Gaps = 6/319 (2%)
 Frame = -2

Query  1273  MGS---LTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS   L PL LPVI+F+ +++KPG   W   R     AL++YGCF A +D++ SE+ + 
Sbjct  1     MGSETPLLPLNLPVINFSNKNLKPGEPEWDLTRAHVKKALQDYGCFEASFDRIPSELRKS  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             +F  + ELFDLP   K+ N S KP +GYVGQ P+VPLYESMGID ++    + +FT+ +W
Sbjct  61    IFGAMEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDVAAKVDAFTEKLW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             PQGN+  S  +  +SK  +EL+  + RM+ ES+G+ KY + H++S  YL RVMKY+    
Sbjct  121   PQGNNSLSTTIQSFSKKLSELDVTIRRMIMESFGLVKYMDEHLQSTNYLLRVMKYKGPDT  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              E +LG  +HTDK+ ++ +YQN H+ GLE++ K+ ++W  V  S  S +VM GD++ A  
Sbjct  181   EETELGLNAHTDKNIVTILYQN-HVEGLEVQTKD-NNWIKVKPSQDSFIVMIGDSLHALL  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             N R+ SP+HRVMM G   RYS+  FS  +   ++  P ELVD +HP  FKPFDH+ +L F
Sbjct  239   NGRLYSPNHRVMMTGTETRYSLGLFSIPKAGYIVNAPDELVDEEHPRMFKPFDHVEFLQF  298

Query  385   FSKEENRRLPCALKTYCGV  329
             +  E  +R   ALKTYCG+
Sbjct  299   YYTEAGQRSQSALKTYCGM  317



>ref|XP_010500906.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=318

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/320 (47%), Positives = 210/320 (66%), Gaps = 7/320 (2%)
 Frame = -2

Query  1273  MGS---LTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS   L PL LPVIDF+ E +KPG   W     +   AL++YGCF A +D++  E+ + 
Sbjct  1     MGSETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKL  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             VF+ L ELFDLP   K+ N S KP +GYVGQ P+VPLYESMGI+  +  + + +FTK +W
Sbjct  61    VFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLW  120

Query  922   PQGNDDFSEAML-VYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQ  746
             PQGN+ FS   +  +SK  ++L+  + RM+ ES+G++KY + H+ S  YL RVMKY+E  
Sbjct  121   PQGNNSFSSTRIHTFSKKLSDLDITIRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKEPD  180

Query  745   ENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAW  566
               E KLG  +HTDK+ ++ +YQN H+ GLE++ K+ ++W  V  S  S +VM GD++ A 
Sbjct  181   TEETKLGLNAHTDKNIVTILYQN-HVEGLEVQTKD-NNWIKVKPSKDSFIVMIGDSLHAM  238

Query  565   SNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLD  389
              N R+ SP+HRVMM G   RYS+  FS  +   +I +P ELVD +HP  FKPFDH+ +L 
Sbjct  239   LNGRLHSPNHRVMMTGTETRYSLGLFSIPKAGHIISSPEELVDEEHPRLFKPFDHVEFLQ  298

Query  388   FFSKEENRRLPCALKTYCGV  329
             F+  +  +R   ALKTYCG+
Sbjct  299   FYYTQAGQRSQSALKTYCGI  318



>ref|XP_009603180.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
tomentosiformis]
Length=316

 Score =   299 bits (765),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/301 (50%), Positives = 207/301 (69%), Gaps = 7/301 (2%)
 Frame = -2

Query  1219  MKPGTDS-WVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDLPTNVKVENK  1043
             +KP T + W +A  E   ALEEYGCF+A+YD VS E++  +F+ +VELFDLPT  K+ N 
Sbjct  19    LKPNTSTNWFSACDEVRRALEEYGCFLAVYDSVSPELNIDIFQAVVELFDLPTESKLRNT  78

Query  1042  STKPLYGYVGQIPIVPLYESMGID--HANTLQGIQSFTKLMWPQGNDDFSEAMLVYSKLA  869
             S KP YGY G I   PL ES+GI+   A T +G+Q+FT LMWP GND FSE +  Y+ + 
Sbjct  79    SEKPFYGYYGNISDFPLQESLGINIGDAITAEGVQNFTSLMWPTGNDHFSEIIHDYANIV  138

Query  868   AELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSHTDKSFMST  689
             A+LE+MV RMV ESYGVE  Y+   KS  YL R++KYR  + +E  +G   HTDK+F+S 
Sbjct  139   ADLEKMVKRMVIESYGVENCYDFLDKSTTYLLRLIKYRTPKLDESNVGSQVHTDKTFLSI  198

Query  688   IYQNCHINGLEIKAKNGDDWFGVHLSPS-SIVVMAGDAIMAWSNNRIKSPHHRVMMEGKG  512
             ++QN  +NGLE+K K+G +W  + ++P+ S +VM G+A  AWSNNR+  P HRV+++   
Sbjct  199   LHQN-QVNGLEVKTKDG-EWMAIDMTPANSFLVMVGEAFSAWSNNRLHCPVHRVIVKENK  256

Query  511   PRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPCALKTYCG  332
             PRY++A FS++   MIQTP ELVD  HP +F+PFD+   LDFF+K  N ++   ++ +CG
Sbjct  257   PRYTLAHFSYI-NGMIQTPEELVDEKHPKKFQPFDNFELLDFFAKHVNEQMEYTVRAFCG  315

Query  331   V  329
             V
Sbjct  316   V  316



>ref|NP_175691.1| putative 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
 gb|AAG52269.1|AC019018_6 putative oxidoreductase; 38288-39393 [Arabidopsis thaliana]
 gb|AEE32855.1| putative 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=317

 Score =   298 bits (764),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/319 (46%), Positives = 208/319 (65%), Gaps = 6/319 (2%)
 Frame = -2

Query  1273  MGS---LTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS   L PL+LPVIDF+ +++KPG   W   R +   AL++YG F A +D++  E+ + 
Sbjct  1     MGSETPLLPLRLPVIDFSNKNLKPGEPEWDLTRADVQKALQDYGYFEASFDRIPFELRKS  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             VF  L ELFDLP   K+ N S KP +GYVGQ P+VPLYESMGID ++  + + +FT+ +W
Sbjct  61    VFGALEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDIAEKVDAFTEKLW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             PQGN  FS  +  +SK  +EL+  + RM+ ES+G++KY + H+ S  YL RVMKY+    
Sbjct  121   PQGNISFSTTIQSFSKKLSELDITIRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKGPDT  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              E K+G  +HTDK+ ++ +YQN H+ GLE++ K+  +W  V  +  S  VM GD++ A  
Sbjct  181   EETKVGLNAHTDKNIVTILYQN-HVEGLEVQTKD-KNWIKVKPTQDSFTVMIGDSLYALL  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             N R+ SP+HRVMM G   RYS+  FS  +   ++ +P ELVD +HP  FKPFDH+ +L F
Sbjct  239   NGRLHSPYHRVMMTGTETRYSLGLFSIPKAGHIVSSPDELVDEEHPRLFKPFDHVEFLQF  298

Query  385   FSKEENRRLPCALKTYCGV  329
             +  E  +R   ALKTYCG+
Sbjct  299   YYTEAGQRSQSALKTYCGI  317



>gb|KDO58208.1| hypothetical protein CISIN_1g044747mg [Citrus sinensis]
Length=322

 Score =   298 bits (764),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 152/324 (47%), Positives = 207/324 (64%), Gaps = 11/324 (3%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  K+PVID +K+D+K GT +W++  ++   A EE+GCF A+Y K+S E    V  
Sbjct  1     MGSQTKSKIPVIDLSKQDLKSGTSTWLSTCKDVRHAFEEFGCFEAIYQKISQEFRSEVLA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELFD+P  +KV+N STKP + Y GQ  I+PLYES+ ID+ +T    QSFT LMWP  
Sbjct  61    STEELFDVPIEIKVKNTSTKPYFEYYGQYTIIPLYESLAIDYPDTRNATQSFTNLMWPAE  120

Query  913   NDDFS--------EAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKY  758
                F         E+ L  S+L  EL++MV RM+FESYGVE YY+S++ S  YL R  KY
Sbjct  121   MIAFGMICPYSLLESSLSMSELVVELDKMVTRMLFESYGVEGYYDSYIGSVNYLLRYFKY  180

Query  757   REAQENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDA  578
             R  + NE K+G   HTDK+  S I+Q  HINGL+++AK+G +W  V  SPSS +VMAGDA
Sbjct  181   RAPEPNETKMGLTPHTDKTMTSIIHQINHINGLQVQAKDG-EWIDVEPSPSSFIVMAGDA  239

Query  577   IMAWSNNRIKSPHHRVMMEGKG-PRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHL  401
             +MAW N+RI+   H+V+M+     RYS+  FSF    ++  P EL D   PL++KPFDH 
Sbjct  240   LMAWGNDRIRPCRHQVIMDNASETRYSLGLFSF-SSGVVDIPKELGDETQPLKYKPFDHF  298

Query  400   HYLDFFSKEENRRLPCALKTYCGV  329
              +L F   EE ++   ++K YCG+
Sbjct  299   GFLHFNQSEEGKKSASSIKAYCGI  322



>ref|XP_010479810.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=317

 Score =   297 bits (761),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 210/319 (66%), Gaps = 6/319 (2%)
 Frame = -2

Query  1273  MGS---LTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS   L PL LPVIDF+ E +KPG   W   R +   AL++YGCF A + ++ +E+ + 
Sbjct  1     MGSESPLLPLCLPVIDFSNEYLKPGEPEWDLTRADVQKALQDYGCFEASFKRIPTELRKL  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             VF+ L ELFDLP   K+ N S KP +GYVGQ P+VPLYESMGI+  +  + + +FTK +W
Sbjct  61    VFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             PQGN+ FS  +  ++K  ++L+  + RM+ ES+G++KY E H+ S  YL RVMKY+    
Sbjct  121   PQGNNSFSTRIHTFAKKLSDLDITIRRMIMESFGLDKYIEEHLHSTNYLLRVMKYKGPDT  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              E KLG  +HTDK+ ++ +YQN H+ GLE++ K+ ++W  V  S  S +VM GD++ A  
Sbjct  181   KETKLGLNAHTDKNIVTILYQN-HVEGLEVQTKD-NNWIKVKPSKDSFIVMIGDSLHAML  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFME-KTMIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             N R+ SP+HRVMM G   RYS+  FS  + + +I +P ELV  +HP  FKPFDH+ +L F
Sbjct  239   NGRLHSPNHRVMMTGTETRYSLGLFSIPKAEHIISSPEELVGEEHPRLFKPFDHVEFLQF  298

Query  385   FSKEENRRLPCALKTYCGV  329
             +  +  +R   ALKTYCG+
Sbjct  299   YYTQAGQRSQSALKTYCGM  317



>emb|CDP08459.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/311 (47%), Positives = 201/311 (65%), Gaps = 5/311 (2%)
 Frame = -2

Query  1255  LKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELF  1076
             +KLP IDF++  +KPG   W + + +   ALEE+GCF A+YDK+S E+ +  FK L ELF
Sbjct  6     IKLPAIDFSQPGLKPGNPEWDSVKGQVRKALEEFGCFEAMYDKISLELQKSFFKALEELF  65

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             +LP   K  N S K  +GY+GQ PI PLYESMG+D AN L+ ++SFT L+WP+GN +F +
Sbjct  66    NLPLQTKQRNASKKIYHGYIGQYPIFPLYESMGLDDANILEKVESFTDLLWPEGNSNFCK  125

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
              +  YS+  +EL+++V RM+ ES G+EKY + H++   YL R MKY   Q  E K+G  +
Sbjct  126   TVHSYSEQISELDKIVRRMILESLGLEKYMDEHMELTNYLLRAMKYEGPQTTETKVGLPA  185

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHH  536
             HTDK+ +S + Q+  I GL++  K+G  W  V  SP S  VM GDA+ AW+N R+  P H
Sbjct  186   HTDKNILSILCQD-QIRGLQVLTKDG-HWIDVEPSPGSFTVMIGDALFAWTNGRLHCPFH  243

Query  535   RVMMEGKGPRYSIAQFSFMEKT--MIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRR  362
             RVMM G   RYS   FS M K   +I+ P ELVD +HPL FKPFD++ +L F   E  + 
Sbjct  244   RVMMTGNIARYSAGIFS-MPKAGYIIKAPEELVDEEHPLLFKPFDNVEFLSFLRTEAGKG  302

Query  361   LPCALKTYCGV  329
                ALKTY G+
Sbjct  303   AQFALKTYSGI  313



>ref|XP_011072273.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Sesamum indicum]
Length=315

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 206/317 (65%), Gaps = 4/317 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS + +KLPVIDF+       T +W + + +  +ALEEYGCF A++D++   + +    
Sbjct  1     MGSESCMKLPVIDFSNLKQDSRTPTWESTKTQVRAALEEYGCFEAVFDQIPPTLRQSTID  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ-  917
             G+ +LFDLP   K+ N+S KP +GYVGQ PIVPLYES+GI+ A +   + SF+ LMWP+ 
Sbjct  61    GIKQLFDLPLQTKLRNRSNKPYHGYVGQYPIVPLYESLGIEDALSPAKVDSFSNLMWPED  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN  FS+++   S+  +EL+++V RMV ES G+EKY   H++S  YL RV KY   Q  E
Sbjct  121   GNPTFSKSIACLSEQFSELDKVVRRMVVESLGLEKYMNEHMESTDYLVRVQKYDGPQSAE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
              K+G  SHTDK+ ++ ++QN  + GLE+  K+G  W     S +S +VM G++  AW+N 
Sbjct  181   SKIGLTSHTDKNIVTILHQN-EVKGLEVLTKDG-QWIAADPSHNSFIVMIGESFYAWTNG  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             R+  P+HRVMM G   RYSI  FS  +   +I+ P ELVD +HPL FKPFDH+ +LDF+ 
Sbjct  239   RLHPPYHRVMMRGDEARYSIGLFSVPKAGYIIKAPEELVDDEHPLLFKPFDHVEFLDFYY  298

Query  379   KEENRRLPCALKTYCGV  329
              E  +R P ALK YCG 
Sbjct  299   TEAGQRSPAALKAYCGA  315



>ref|XP_009371496.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=317

 Score =   296 bits (757),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 208/318 (65%), Gaps = 3/318 (1%)
 Frame = -2

Query  1276  IMGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             ++    P  +PV+D + E++KPGTD+W+ A ++   ALEEY CF A+Y+K + E+H  +F
Sbjct  1     MISKTQPKVVPVVDLSDENLKPGTDAWLLACKQVQHALEEYSCFEAVYNKATLEIHNSIF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
               + +L DLP   K++  S +P + Y GQ+P+ P YE++GI    +L+G Q FT +MWP 
Sbjct  61    SAIKDLCDLPLETKMQKASNRPFHNYFGQLPLNPRYETLGIQDPASLEGAQRFTNIMWPA  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND F E++  +SK+  EL++MV RMVF++YGV + Y+S+  S  Y  R + Y+    NE
Sbjct  121   GNDRFRESVHSFSKVVVELDQMVKRMVFDAYGVGRLYDSYKASTTYQLRCINYKSQLTNE  180

Query  736   PK-LGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
                LG ++HTDK+F S ++QN  + GL+IK K+G+       SPSS +V+A D  MAWSN
Sbjct  181   TTDLGLIAHTDKNFTSILHQN-DVGGLQIKTKDGEWIEAAPSSPSSFLVLASDLFMAWSN  239

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF-  383
             +RI +  H+V+++ K  RYS+A FS++   ++Q P E VDG HPL++KPF H  YL F+ 
Sbjct  240   DRISACEHQVVLKEKKARYSLALFSYIGDGVVQVPEEFVDGKHPLKYKPFGHFDYLRFYE  299

Query  382   SKEENRRLPCALKTYCGV  329
             + EE R+    +K YCGV
Sbjct  300   TDEEARKSKNPIKAYCGV  317



>gb|KDP24591.1| hypothetical protein JCGZ_25507 [Jatropha curcas]
Length=314

 Score =   295 bits (755),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 205/318 (64%), Gaps = 7/318 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKP-GTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGSL+  KLPVIDF++ +++  GT  WV+  ++ + ALEEYGCFVA+YD V  ++HE +F
Sbjct  1     MGSLSNSKLPVIDFSRANLEAAGTSGWVSKCKDVLKALEEYGCFVAVYDNVPLQLHEDLF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
               L ELFDLP   K +N S  P  GY+  +P  P +ESMGI  A TL+  Q FTK MWP 
Sbjct  61    NVLEELFDLPPETKRKNVSDIPFNGYIEYVPDRPFFESMGITRAETLEDTQDFTKTMWPN  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND+F + +  YSK   EL +MV++M+   YG+EKYYE H++S  Y  R + Y   +ENE
Sbjct  121   GNDNFCQNVHSYSKAVEELYQMVMKMILNGYGIEKYYEPHMESTTYSLRFINYN-PEENE  179

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               +  V H DKSF++ ++QN  INGLEIK KNG  W  V L+PS+ +V+AG+ IM WSN+
Sbjct  180   TNMFMVPHKDKSFLTILHQN-DINGLEIKPKNG-QWINVDLAPSNFIVIAGEGIMGWSND  237

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI +  HRV ME +  R ++  FS++ K +   P E VD DHPL +KPFDH+  L F + 
Sbjct  238   RIDACEHRVRMESREKRRTVGLFSYI-KGITHVPQEFVDDDHPLMYKPFDHIGLLYFLAS  296

Query  376   EE--NRRLPCALKTYCGV  329
              E  +  L   +K Y G+
Sbjct  297   PEGHSTSLSHTMKAYAGL  314



>gb|KDP37164.1| hypothetical protein JCGZ_06220 [Jatropha curcas]
Length=308

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/311 (48%), Positives = 209/311 (67%), Gaps = 8/311 (3%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             K+PVID   E++KPG+ +W++A  +   A EEYGC   LY+ ++ E H +V   L ELF 
Sbjct  3     KIPVIDLCSENLKPGSSAWLSACNDIRKAFEEYGCMEVLYN-INIEFHNQVLSALQELFQ  61

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LP  +K++N + KP +GY+G+I   P++E +GI+ A      Q FT LMWP GND+F E 
Sbjct  62    LPQEIKMKNVNPKPAHGYMGKISTFPIHEGLGIEFATIKDECQKFTNLMWPDGNDNFCET  121

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
             +  Y+KL AEL+E++VRM+ ESYG++K+ ES  KS  YL R++KYR +Q  E  LGF  H
Sbjct  122   VHSYAKLVAELQELLVRMLCESYGIDKHSESRNKSTTYLLRLLKYRRSQA-ETNLGFKGH  180

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSP-SSIVVMAGDAIMAWSNNRIKSPHH  536
             TDKSF+S ++QN H+ GLEI+ K+G +W     S  SS  V+AGDA MAWSN+RIKS +H
Sbjct  181   TDKSFISILHQN-HVKGLEIRTKDG-EWISYEPSSFSSFAVVAGDACMAWSNDRIKSCYH  238

Query  535   RVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF--SKEENRR  362
             RV + G+  RY++  FSF+   +I  P ELVD +HPL +KPF+H   LDF+  +  +N+ 
Sbjct  239   RVTVGGEEVRYALGLFSFL-TGLINPPEELVDEEHPLAYKPFEHQGLLDFYVANNAQNKG  297

Query  361   LPCALKTYCGV  329
                 +KTYCGV
Sbjct  298   ESNMVKTYCGV  308



>emb|CAN66061.1| hypothetical protein VITISV_007808 [Vitis vinifera]
Length=330

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 210/333 (63%), Gaps = 23/333 (7%)
 Frame = -2

Query  1276  IMGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             I G  T  K+P++DF+KE++KPGTDSW+ A      ALEEYGCF+A+YD+V   VH  +F
Sbjct  4     IXGLETLPKIPMVDFSKENLKPGTDSWLPACNNVRHALEEYGCFMAVYDQVPLGVHNTIF  63

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANT-LQGIQSFTKLMWP  920
               + ELFDLP   K +N S KP  GY  + P  PL++ +GID+  T L+ I+ F K+MWP
Sbjct  64    GAMRELFDLPIETKKQNISEKPYQGYTSESPAXPLHQGLGIDNVTTXLEEIRXFAKIMWP  123

Query  919   QGNDDF--------------SEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSAC  782
              GN++F              S+++  YSKL AEL+ MVVRMV ESYG+E    SH++SA 
Sbjct  124   AGNENFCYSFISDIFSSXLISQSVHCYSKLVAELDRMVVRMVLESYGIEN--GSHIZSAS  181

Query  781   YLARVMKYREAQENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPS-  605
             +L R++K R  + NE    F SH+DKSF+S ++QN  +NGLEI+ K+G  W   H  PS 
Sbjct  182   FLVRLLKSRVPKMNETNKAFPSHSDKSFISILHQN-KVNGLEIQTKDG-KWIS-HEPPSL  238

Query  604   -SIVVMAGDAIMAWSNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHP  428
                +VMAG+ + AWSN RI    HRV+++G   RY++  FS +   MI+ P ELVD  HP
Sbjct  239   QVFLVMAGEVLTAWSNGRIHPARHRVVVKGNEARYALGLFSTI-NGMIKVPEELVDDHHP  297

Query  427   LQFKPFDHLHYLDFFSKEENRRLPCALKTYCGV  329
             LQFKPFDH   L F   +E R    ALK YCG+
Sbjct  298   LQFKPFDHTGLLHFLGTKEGRNPETALKAYCGL  330



>ref|XP_004148019.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Cucumis sativus]
 ref|XP_004171217.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Cucumis sativus]
Length=338

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/334 (45%), Positives = 207/334 (62%), Gaps = 23/334 (7%)
 Frame = -2

Query  1264  LTPLKLPVIDFTKEDMKPGTDS------WVAARRESVSALEEYGCFVALYD---------  1130
             L  L++P+I  +  D K           W+   ++   ALEEYGCF+  YD         
Sbjct  6     LAKLEVPIIKLSNVDKKDDDSDPESRKLWLERSKQVRDALEEYGCFLGEYDDDESSCSCN  65

Query  1129  -----KVSSEVHERVFKGLVELFDLPTNVKVENKSTKPLYGYVG-QIPIV-PLYESMGID  971
                  K++S  +E +FKGL ELFDLP   K++N S KP +G++  + P V PL++S+GI+
Sbjct  66    SSSSPKLNSNNYEEIFKGLKELFDLPLETKIKNVSDKPYHGFLDCRTPFVLPLHQSLGIE  125

Query  970   HANTLQGIQSFTKLMWPQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVK  791
             +A++ + +Q F  L+WP GN  F E +  YSK  +E+E++V RMVFESYGV KYY+SH+ 
Sbjct  126   NASSYEAVQFFVNLLWPSGNHHFCEKLFAYSKKISEMEQLVKRMVFESYGVGKYYDSHIA  185

Query  790   SACYLARVMKYREAQENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLS  611
             S  YL R MKYR  +  E  +G  +HTDKSF + ++Q   +NGL+IK KN D W GV  S
Sbjct  186   STTYLLRTMKYRIPKMGEENIGAEAHTDKSFFTILHQFDGVNGLQIKPKNYDQWLGVQFS  245

Query  610   PSSIVVMAGDAIMAWSNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDH  431
             P+S +VMAGDA +AWSN RI S  HRV++EG   RYS   FS+  K +I+ P ELVD  H
Sbjct  246   PNSFLVMAGDACLAWSNGRIHSATHRVIIEGNKERYSTGLFSY-HKGIIEIPQELVDEKH  304

Query  430   PLQFKPFDHLHYLDFFSKEENRRLPCALKTYCGV  329
             PL+F PF+H   L +FS ++  ++P     YCGV
Sbjct  305   PLRFNPFNHYGLLGYFSTDDCDKIPSTANAYCGV  338



>ref|XP_003625060.1| Gibberellin 20 oxidase [Medicago truncatula]
 gb|ABD33293.1| Immunoglobulin/major histocompatibility complex; 2OG-Fe(II) oxygenase 
[Medicago truncatula]
 gb|AES81278.1| 2-oxoglutarate-dependent dioxygenase [Medicago truncatula]
 gb|AFK39209.1| unknown [Medicago truncatula]
Length=321

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/318 (47%), Positives = 209/318 (66%), Gaps = 5/318 (2%)
 Frame = -2

Query  1273  MGSLTPLKL-PVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGS T  ++ PV+D + ++MKPGTD+WV+A     ++LE+YGCFVA YDK+  E+ + V 
Sbjct  1     MGSETVSQIIPVVDLSDQNMKPGTDTWVSACNVVKTSLEDYGCFVAHYDKIGKELCDNVI  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
              G+ E F LP   K +  S +P +GY GQ+  +PLYES+ I    T+ G Q FT+++WPQ
Sbjct  61    FGIEEFFKLPLETKAQKISDRPFHGYSGQLLTLPLYESLDIQDPLTMLGCQIFTQIIWPQ  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQEN  740
             GN+ F E+   YSKL  EL+ +  RMVFESYGV+ K  ES ++S+ YL R +KYR  + +
Sbjct  121   GNNRFCESFNEYSKLLGELDHIAKRMVFESYGVDTKICESLIESSNYLIRCLKYRTREMD  180

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
             E  LG   H+D + +S ++Q  ++NGL+IK KNG +W  V  SPSS VV+AGDA   WSN
Sbjct  181   ENDLGLTPHSDLTIISVVHQLNNLNGLQIKLKNG-EWTEVEASPSSFVVLAGDAFTIWSN  239

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKP-FDHLHYLDFF  383
              RI++  HRV+M     RY+ A FSF  K M + P ELV+ +HPL++KP FDH  YL FF
Sbjct  240   GRIRACEHRVIMNATKTRYAAALFSFASKIM-EIPEELVNEEHPLRYKPTFDHYDYLRFF  298

Query  382   SKEENRRLPCALKTYCGV  329
              KE+ +     ++ YCG+
Sbjct  299   QKEKMKEPISRMEVYCGI  316



>gb|KDP37380.1| hypothetical protein JCGZ_06834 [Jatropha curcas]
Length=316

 Score =   292 bits (748),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 153/319 (48%), Positives = 208/319 (65%), Gaps = 7/319 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMK-PGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGSL+  KLPVIDF+ E+++  GT  WV+  ++ + ALEEYGCFVA+Y+ V  ++H  +F
Sbjct  1     MGSLSNSKLPVIDFSSENLESAGTSGWVSKCKDILKALEEYGCFVAVYNNVPLQLHVDLF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
               L ELFDLP   K +N S  P  GYV   P  P YESMGI H   L+G + FTK MWP+
Sbjct  61    NVLEELFDLPLETKRKNVSDIPFTGYVEIEPTRPFYESMGISHVEMLEGNKDFTKTMWPK  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQ--E  743
             GND+F + +  +SK   +L +M V+M+F+ YG+EK Y+SH++   Y +R++ Y   Q  E
Sbjct  121   GNDNFCKIVHSFSKAVEDLHKMAVKMIFDGYGMEKNYQSHMELTTYFSRLVNYIIPQLNE  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSS-IVVMAGDAIMAW  566
             NE KLG   HTDKSF++ ++QN  +NGLEI+ KNG +W  V LS SS  +VMAG+ IM W
Sbjct  181   NETKLGLYPHTDKSFLTILHQN-DVNGLEIQTKNG-EWVDVDLSSSSNFLVMAGEGIMGW  238

Query  565   SNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             SNNRI +  HRV +  K  R SI  FS++ K +I+ P E VD +HPL +KPFDH+  + F
Sbjct  239   SNNRIDACDHRVTINRKEKRLSIGLFSYV-KGIIKVPEEFVDEEHPLMYKPFDHIGLVHF  297

Query  385   FSKEENRRLPCALKTYCGV  329
             F   E  +    LK Y G+
Sbjct  298   FGTPEGHKQHRTLKAYSGL  316



>ref|XP_007135717.1| hypothetical protein PHAVU_010G152300g [Phaseolus vulgaris]
 gb|ESW07711.1| hypothetical protein PHAVU_010G152300g [Phaseolus vulgaris]
Length=314

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 204/316 (65%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS    KLPVI+FT   ++    +W A + +   AL E+GCF A++D+V  E+ + +  
Sbjct  1     MGSEDTPKLPVINFTDLKLEAKDPNWEAVKSQVHRALVEFGCFEAVFDRVPLELRKAILG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K+ N S K  +GYVGQ P+VPL+ESMGID A   + ++S T  MWP G
Sbjct  61    SLQELFDLPLQTKLLNVSKKLFHGYVGQYPMVPLFESMGIDDAVVYEEVESLTNTMWPNG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N +FS+ +  +S+  AEL++++ +MV ES GVEKY E H+ S  YL RVMKY+  Q ++ 
Sbjct  121   NPNFSKTIQSFSEELAELDQIIRKMVLESLGVEKYLEEHMNSTNYLLRVMKYQGPQTSDT  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  +HTDK+ ++ +YQN  + GLE+  K+G  W     SP S VVM GD+  AW+N R
Sbjct  181   KLGLSAHTDKNIVTILYQN-EVEGLEVLTKDG-TWISYKPSPHSFVVMIGDSFNAWANGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFME-KTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP HRVMM G   RYS   FS  +  ++I+ P ELVD +HPL FKPFDH+ +L ++  
Sbjct  239   LHSPFHRVMMSGNETRYSAGLFSIPKGGSIIKAPEELVDEEHPLLFKPFDHMEFLKYYYT  298

Query  376   EENRRLPCALKTYCGV  329
             E+ +R   AL TYCGV
Sbjct  299   EKGQRDQFALLTYCGV  314



>ref|XP_008377590.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Malus domestica]
Length=291

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/293 (48%), Positives = 191/293 (65%), Gaps = 3/293 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S T  KLPVID + E++KPGTD+W+ A +E   ALEEYGCF A+Y KV  E+H  +F 
Sbjct  1     MASETQPKLPVIDLSDENLKPGTDAWLLACKEIKDALEEYGCFEAIYHKVPLELHNSMFT  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + +LF LP   K +  S + L+ Y+GQ   +PLYES+ + +  T++G Q FT  MWPQG
Sbjct  61    AMEDLFGLPLETKKQKTSDRHLHSYLGQYSFIPLYESLAMANPTTVEGAQGFTSTMWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E    +SKL AEL +MV RMVF+ YGV++ Y+SH++   Y  R  KYR  Q NE 
Sbjct  121   NDHFCETAHSFSKLVAELSQMVTRMVFDMYGVQRLYDSHMELTTYQLRWYKYRTQQANET  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              +G + HTDKSF+S + Q+  +NGL+I  K+   W  V  SPSS +++AGDA MAWSN+R
Sbjct  181   NVGMLPHTDKSFISILNQD-QVNGLQIGTKDS-QWIDVKPSPSSFLILAGDAFMAWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHY  395
             + S  H+V M     RYS+  FSF +  +IQ P EL+D  HPL +KPFDH  +
Sbjct  239   VPSCEHQVTMRENKTRYSLGLFSF-KSGIIQVPEELIDEKHPLLYKPFDHFSF  290



>ref|XP_003553391.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Glycine 
max]
 gb|KHN14923.1| Gibberellin 20 oxidase 3 [Glycine soja]
Length=320

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 202/317 (64%), Gaps = 3/317 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  +L V+DFT E+MKPGTD+W++A     + LE  G F+A YDKV  E+ + V  
Sbjct  1     MGSQTQSQLHVVDFTDENMKPGTDAWLSACSVVRTELENNGFFMARYDKVGKELCDSVVF  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + E F LP   K +  S KP +GY+GQ+  +PLYES+GID   TLQG Q F  +MWP+G
Sbjct  61    AVEEFFGLPVETKAQKTSDKPFHGYLGQVSWLPLYESVGIDDPLTLQGCQKFAHIMWPEG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQENE  737
             N  F E++  Y+KL  EL+ M  RMVFESYGV+ +  +S ++S  YL R MKYR  Q +E
Sbjct  121   NGRFCESINEYAKLLGELDHMAKRMVFESYGVDMQRCDSFIESNDYLLRCMKYRTPQMDE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               LG   H+D +  S ++Q  ++NGLEIK K+G +W  +  SPS  VVMAGDA   WSN 
Sbjct  181   NDLGLQPHSDLTITSIVHQLNNLNGLEIKLKDG-EWKEIDASPSLFVVMAGDAFNVWSNG  239

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKP-FDHLHYLDFFS  380
             RI+   HRV M GK  RYS+  FSF    M++ P ELV+  HPL++KP FDH  YL F+ 
Sbjct  240   RIRPCEHRVTMNGKKSRYSMGLFSFGGNKMMRIPDELVNDQHPLRYKPIFDHYEYLRFYD  299

Query  379   KEENRRLPCALKTYCGV  329
             KE+ +     ++ YCG+
Sbjct  300   KEKIKEPYSRIQAYCGI  316



>gb|AFK47428.1| unknown [Lotus japonicus]
Length=311

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 206/316 (65%), Gaps = 6/316 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  KLPVIDFT  +      +W A + +   AL EYGCF A++DKV  ++ + +F 
Sbjct  1     MGSETTRKLPVIDFTDLN---SLANWEAVKSKVHEALVEYGCFEAIFDKVPLDLRKEIFA  57

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELF+LP   K+ N S KP +GYVGQ P+VPL+ESMGID AN  + +++   ++WP G
Sbjct  58    SLEELFNLPLQTKLLNVSKKPYHGYVGQYPMVPLFESMGIDDANVSEKVEAMANILWPDG  117

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FS+ +  +S+  +EL+ ++ +MV ES GVEKY + H+ S  YL RVMKY+  + ++ 
Sbjct  118   NPSFSKTINSFSEQLSELDHIIRKMVLESLGVEKYLDEHLHSTNYLLRVMKYKGPETSDT  177

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  +H+DK+ ++ +YQN  + GLE+  K+G  W     S    VVM GD++ AWSN R
Sbjct  178   KLGLTTHSDKNIVTILYQN-QVEGLEVLTKDG-KWISYKPSSEGFVVMIGDSLHAWSNGR  235

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFME-KTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP HRVMM G   RYS   FS  + + +I+TP ELVD +HPL FKPFDH+ +L ++  
Sbjct  236   LHSPFHRVMMTGNEARYSTGLFSIPKGEYIIKTPEELVDEEHPLLFKPFDHVEFLKYYYT  295

Query  376   EENRRLPCALKTYCGV  329
             E+ +R   AL+TYCGV
Sbjct  296   EKGQRDQFALRTYCGV  311



>gb|KEH28749.1| 2-oxoglutarate-dependent dioxygenase [Medicago truncatula]
Length=315

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 206/317 (65%), Gaps = 4/317 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MG+    KLP+IDF   +++  + +W   + +   AL EYGCF A++DKV  ++ + +F 
Sbjct  1     MGTEATPKLPIIDFNNLNLEAKSPNWELVKSQVYKALVEYGCFEAVFDKVPLDLRKAIFA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K+ N S KP +GYVGQ P++PL+ESMGID AN L+ + S T  +WP G
Sbjct  61    SLQELFDLPLETKLLNVSKKPYHGYVGQYPMIPLFESMGIDDANILEKVDSMTNNLWPDG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N +FS+ +  +S+   EL++++ +M+ ES GVEKY E H+ S  YL RVMKY+  Q ++ 
Sbjct  121   NQNFSKTIHSFSEELTELDQIIRKMILESLGVEKYLEEHMNSTNYLLRVMKYKGPQTSDT  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPS-SIVVMAGDAIMAWSNN  557
             KLG  +H+DK+ ++ +YQN  + GLE+  K+G  W     S S S V M GD+I AWSN 
Sbjct  181   KLGLSTHSDKNVVTILYQN-QVEGLEVMTKDG-QWISYKPSSSGSFVAMIGDSIHAWSNG  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             R+ SP HRVMM G   RYS   FS  +   +I+ P ELVD +HPL F+P+DH+ +L ++ 
Sbjct  239   RLHSPFHRVMMSGNEARYSTGLFSIPKGGYIIKAPEELVDEEHPLLFRPYDHVEFLKYYY  298

Query  379   KEENRRLPCALKTYCGV  329
              E+ +R   A++TYCGV
Sbjct  299   TEKGQRDQFAMRTYCGV  315



>ref|XP_007145552.1| hypothetical protein PHAVU_007G248200g [Phaseolus vulgaris]
 gb|ESW17546.1| hypothetical protein PHAVU_007G248200g [Phaseolus vulgaris]
Length=315

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/315 (46%), Positives = 205/315 (65%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M SL+   LP++D + E++KPGT+ W++A +   +ALE++GC+V   DK+  E+   V  
Sbjct  1     MVSLSASPLPIVDLSDENLKPGTEPWLSACKVVRTALEDHGCYVVRCDKIGEELRNAVVS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + + F+LP + K +  S K  +GY GQ+  +PLYES+GIDH  T+ G Q F  +MWPQG
Sbjct  61    AMEQAFELPVDTKRQKTSDKIFHGYYGQVSFLPLYESLGIDHPLTMAGCQKFAHIMWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQENE  737
             N  FSE++  Y+K+  E++ + +RMVFESYGVE K +ES ++S  YL R  KYR A++ E
Sbjct  121   NHRFSESVNEYAKVLGEIDGVTMRMVFESYGVEMKKWESFMESTNYLLRSFKYRVAEKGE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               +G  SHTD S  S ++Q  +++GLE+K KNG +W  +H SPS  +V+AGDA+  WSN 
Sbjct  181   NDVGIHSHTDMSVTSILHQLNNLDGLEVKLKNG-EWLKLHASPSFFLVLAGDALQCWSNG  239

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI+S  HRV M  K  RYS+   S+    M++ P ELVD  HPL++KPF H  YL FF K
Sbjct  240   RIRSCEHRVTMNAKKTRYSMGLSSY-NTHMVEIPKELVDQQHPLRYKPFHHYGYLHFFDK  298

Query  376   EENRRLPCALKTYCG  332
             E+ +     LK YCG
Sbjct  299   EKIKDPNSRLKAYCG  313



>ref|XP_010542274.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Tarenaya hassleriana]
Length=314

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 148/317 (47%), Positives = 202/317 (64%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T L+LPVIDF+ +++K G+  W   R +   ALEE+GCF A +DK+   +   +F 
Sbjct  1     MGSET-LQLPVIDFSGKNLKKGSKEWECTRSDVRKALEEFGCFEASFDKIPLHLRREIFG  59

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K+ N S KP +GYVGQ P VPLYESMGID A+    + SFT+ +WP G
Sbjct  60    CLEELFDLPLQTKLRNVSKKPFHGYVGQYPQVPLYESMGIDDADLPDQVLSFTQKLWPHG  119

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FS  +  +++  +EL+  + RM  ES+G+EKY + H++S  YL R MKY+     E 
Sbjct  120   NHHFSNTIQSFAEQLSELDITIRRMTLESFGLEKYIDEHLESTNYLLRAMKYKGPDTEET  179

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  +HTDK+ ++ +YQN H+ GLE++ K+ + W  V  S  S + M GD++ A  N R
Sbjct  180   KLGLNAHTDKNIVTILYQN-HVEGLEVQTKD-NKWIKVKPSKDSFIAMIGDSLYALLNGR  237

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGD-HPLQFKPFDHLHYLDFFS  380
             + SP+HRVMM GK  RYS   FS  +   +I  P ELVDGD +P  FKPFDH+ +L F+ 
Sbjct  238   VHSPYHRVMMTGKEARYSAGLFSIPKAGHIIYAPEELVDGDEYPRLFKPFDHVEFLQFYY  297

Query  379   KEENRRLPCALKTYCGV  329
              E  +R   ALKTYCG+
Sbjct  298   TEAGQRAQSALKTYCGM  314



>ref|XP_006367751.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=314

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 206/317 (65%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS   +KLP I+F+ ED+KP T  W   + +   AL EYGCF A +DK+   + + +F+
Sbjct  1     MGSKN-IKLPKINFSHEDLKPDTLVWNQVKSQVYKALVEYGCFEAFFDKIPINLQKSIFE  59

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQI-PIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
                E+FDLP   K++N ST+P YGYVGQ  P +PL+ESMGI  +N LQ ++ +T+L+WPQ
Sbjct  60    VSQEIFDLPLQTKLKNISTEPFYGYVGQYHPSIPLFESMGIIDSNILQKVEKYTQLLWPQ  119

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN  F + +  YS+  ++L++ + RM+ ES GVEKY + H+ S  Y  R++KY+E Q NE
Sbjct  120   GNPSFCKTIQSYSEQLSKLDQTIRRMIVESLGVEKYMDEHMNSTNYRLRLIKYKEPQSNE  179

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
              K+G  +HTDK+ ++ +YQN  +NGLEI  K+G  W  V  +P +  +M GD++ AW+N 
Sbjct  180   TKIGLHAHTDKNIVTILYQN-QVNGLEILTKDG-QWINVDPTPDNFTIMIGDSLHAWTNG  237

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEK-TMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             R+ +P HRVM+ G   RYSI  FS  +   +I+TP ELVD DHPL F PFD+  +L F  
Sbjct  238   RMHAPFHRVMVRGNEARYSIGLFSIPKAGCIIKTPKELVDEDHPLLFTPFDYHEFLSFGY  297

Query  379   KEENRRLPCALKTYCGV  329
              +E+ +    LK Y GV
Sbjct  298   TQEDMKCDFTLKAYSGV  314



>ref|XP_010110314.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
 gb|EXC25834.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
Length=312

 Score =   290 bits (741),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 199/308 (65%), Gaps = 6/308 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             K+PVIDFTK+++KPGTD WV A +E  +  EEYGCF A+YDK+  ++H  VF     LFD
Sbjct  9     KIPVIDFTKKNLKPGTDEWVLACKEVRNGFEEYGCFEAVYDKIPVDLHNSVFAAAESLFD  68

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LP   K++  S +P + Y GQ  +VPLYES+G+D+  TLQG + FT LMWP GN++F E 
Sbjct  69    LPLETKMQKTSERPYHSYYGQFSVVPLYESLGVDNPTTLQGSRKFTNLMWPAGNENFRET  128

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
                 SKL  EL E+  RMVF+SYGV++ + S++    YL R  KYR  Q NE  +G   H
Sbjct  129   TQSMSKLLVELYELATRMVFDSYGVQRLHGSNMALTSYLLRFFKYRTRQPNETDVGLQCH  188

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
              D++FMS + Q+  I GL++K+K+G  W  V  S SS +++AGD + AWSN+R++   H+
Sbjct  189   KDRTFMSIVNQH-QIEGLQVKSKDG-QWIDVKPSASSFLIIAGDIVGAWSNDRVRPCEHQ  246

Query  532   VMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPC  353
             V+M+    RYSI  F+F+   +I  P +LVD  +PL++KP DH  +L F   +E R+ P 
Sbjct  247   VIMKENKTRYSIGLFAFI-NGVIDVPEDLVDEKYPLKYKPIDHFGWLRF---QEQRKAPY  302

Query  352   ALKTYCGV  329
              +K +  +
Sbjct  303   PIKVFSAI  310



>ref|XP_009347560.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Pyrus 
x bretschneideri]
Length=317

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/318 (43%), Positives = 206/318 (65%), Gaps = 3/318 (1%)
 Frame = -2

Query  1276  IMGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             ++    P  +PV+D + E++KPGTD+W+ A ++   ALEEY CF A+Y+K + E+H  +F
Sbjct  1     MISKTQPKVVPVVDLSDENLKPGTDAWLLACKQVQHALEEYSCFEAVYNKATLEIHNSIF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
               + +L DLP   K++  + +P + Y GQ+P+ P YE++GI    +L+G Q FT +MWP 
Sbjct  61    SAIKDLCDLPLETKMQKANDRPFHNYFGQLPLNPRYETLGIQDPASLEGAQRFTNIMWPA  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND F E++  +SK+  EL++MV RMVF++YGV + Y+S+  S  Y  R + Y+    NE
Sbjct  121   GNDHFRESVHSFSKVVVELDQMVKRMVFDAYGVGRLYDSYKASTTYQLRCINYKSQLTNE  180

Query  736   PK-LGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
                LG + HTDK+F S ++QN  + GL+IK K+G+       SPSS +V+A D  MAWSN
Sbjct  181   TTDLGLIPHTDKNFTSILHQN-DVGGLQIKTKDGEWIEAAPSSPSSFLVLASDLFMAWSN  239

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF-  383
             +RI +  H+V+++ K  RYS+A FS++   ++Q P E VD  HPL++KPF H  YL F+ 
Sbjct  240   DRISACEHQVVLKEKKARYSLALFSYIGDGVVQVPEEFVDEKHPLKYKPFGHFDYLRFYE  299

Query  382   SKEENRRLPCALKTYCGV  329
             + EE R+    +K YCGV
Sbjct  300   TDEEARKSKNPIKAYCGV  317



>ref|XP_007135718.1| hypothetical protein PHAVU_010G152400g [Phaseolus vulgaris]
 gb|ESW07712.1| hypothetical protein PHAVU_010G152400g [Phaseolus vulgaris]
Length=320

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 207/309 (67%), Gaps = 4/309 (1%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             ++PV+DFT +++KPGT  W +A     +ALE++GCF ALYD+V  E++  VF  + E FD
Sbjct  9     EVPVVDFTDKELKPGTRKWGSACEVIRNALEDHGCFYALYDEVPMELYNSVFTLMEEQFD  68

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LP   K++  S KP +GY GQ   VPLYES+GI+H  T++GIQ+FTKLMWP G D F E+
Sbjct  69    LPLETKMQKISDKPYHGYYGQHAHVPLYESLGINHPLTMEGIQNFTKLMWPAGYDHFCES  128

Query  892   MLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
             M +Y+KL  EL+ M  RMVF+ YGVE ++ +S ++S  Y+ R  KYR  Q++E  LG  +
Sbjct  129   MSMYAKLLVELDHMTKRMVFDGYGVEQRHCDSLLESTNYMLRSFKYRLPQKDENDLGLHA  188

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHH  536
             HTD SF + ++QN ++NGL++K KNG DW  +  SP   +++AGDA   WSN+RI    H
Sbjct  189   HTDTSFFTILHQN-NVNGLQVKFKNG-DWIDIDPSPFMFLILAGDAFKVWSNDRIHCCEH  246

Query  535   RVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLP  356
             RV++ GK  RYS+  FS   K M++T  ELVD +HP  +KPFDH  YL F + ++  +  
Sbjct  247   RVIISGKKERYSMGLFSLGGK-MVETQEELVDEEHPRCYKPFDHYEYLSFCATKKALQSH  305

Query  355   CALKTYCGV  329
               +K +CG+
Sbjct  306   SRIKAFCGI  314



>ref|XP_004506878.1| PREDICTED: S-norcoclaurine synthase 1-like [Cicer arietinum]
Length=314

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 203/316 (64%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S T LKLP IDFT  +++  + +W   + +   AL EYGCF A++D++  E+ + +F 
Sbjct  1     MSSKTTLKLPQIDFTSLNLEAKSPNWELVKSQVYEALLEYGCFEAIFDEIPIELRKAIFA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K  N S KP +GYVGQ P++PLYESMGID AN    ++S T   WP G
Sbjct  61    SLEELFDLPLETKQLNVSKKPYHGYVGQYPMIPLYESMGIDDANIFDKVESMTNNFWPDG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FS+ +  +S    +L++++ +M+ ES GVEKY E H+ S+ YL RVMKY+  + ++ 
Sbjct  121   NQSFSKTIHSFSDELTKLDQIIRKMILESLGVEKYLEEHLNSSNYLLRVMKYKGPETSDT  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             KLG  SHTD++ ++ +YQN  + GLE+  K+G  W     S +S VVM GD++ AWSN R
Sbjct  181   KLGLSSHTDRNIVTILYQN-EVEGLEVMTKDG-KWISYKPSLNSFVVMIGDSLHAWSNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP H+VMM G   RYS   FS  +   +I+ P ELVD +HPL FKP+DH+ +L ++  
Sbjct  239   LHSPFHQVMMSGNEARYSTGLFSIPKGGYLIKAPKELVDEEHPLLFKPYDHVEFLKYYYS  298

Query  376   EENRRLPCALKTYCGV  329
             E+ +R    ++T+CGV
Sbjct  299   EKGQRDQFPMRTFCGV  314



>ref|XP_008366303.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Malus 
domestica]
Length=317

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/318 (43%), Positives = 204/318 (64%), Gaps = 3/318 (1%)
 Frame = -2

Query  1276  IMGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             ++    P  +PV+D + E++KPGTD+W+ A ++   ALEEY CF A+Y+K + E+H  +F
Sbjct  1     MVSKTQPKVVPVVDLSDENLKPGTDAWLLACKQVQHALEEYSCFEAVYNKXTLEIHNSIF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
               + EL DLP   K++  S +P + Y GQ+P+ P YE++GI    +L+G Q FT +MWP 
Sbjct  61    SAIKELCDLPLETKMQKASDRPFHHYFGQLPLNPRYETLGIQDPASLEGAQRFTSIMWPA  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND F E++  +SK+  EL++MV RMVF++YGV + Y+S+  S  Y  R + Y+    NE
Sbjct  121   GNDRFXESVHSFSKVVVELDQMVKRMVFDAYGVGRLYDSYKASTTYQLRCINYKSXLTNE  180

Query  736   PK-LGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
                 G + HTDK+F S ++QN  + GL+IK K+G+       SPSS +V+A D  MAWSN
Sbjct  181   TTDXGLIPHTDKNFTSILHQN-DVGGLQIKTKDGEWIEAAPSSPSSFLVLASDLFMAWSN  239

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF-  383
             +RI +  H+V ++ K  RYS+A FS++   ++Q P E VD  HPL++KPF H  YL F+ 
Sbjct  240   DRISACEHQVXLKEKKARYSLALFSYIGDGVVQVPEEFVDDXHPLKYKPFGHFDYLRFYE  299

Query  382   SKEENRRLPCALKTYCGV  329
             + EE R+    +K YCGV
Sbjct  300   TDEEARKXKNPIKAYCGV  317



>gb|AFK40822.1| unknown [Medicago truncatula]
Length=315

 Score =   288 bits (736),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/317 (45%), Positives = 205/317 (65%), Gaps = 4/317 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MG+    KLP+IDF   +++  + +W   + +   AL EYGCF A++DKV  ++ + +F 
Sbjct  1     MGTEATPKLPIIDFNNLNLEAKSPNWELVKSQVYKALVEYGCFEAVFDKVPLDLRKAIFA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELF LP   K+ N S KP +GYVGQ P++PL+ESMGID AN L+ + S T  +WP G
Sbjct  61    SLQELFYLPLETKLLNVSKKPYHGYVGQYPMIPLFESMGIDDANILEKVDSMTNNLWPDG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N +FS+ +  +S+   EL++++ +M+ ES GVEKY E H+ S  YL RVMKY+  Q ++ 
Sbjct  121   NQNFSKTIHSFSEELTELDQIIRKMILESLGVEKYLEEHMNSTNYLLRVMKYKGPQTSDT  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPS-SIVVMAGDAIMAWSNN  557
             KLG  +H+DK+ ++ +YQN  + GLE+  K+G  W     S S S V M GD+I AWSN 
Sbjct  181   KLGLSTHSDKNVVTILYQN-QVEGLEVMTKDG-QWISYKPSSSGSFVAMIGDSIHAWSNG  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             R+ SP HRVMM G   RYS   FS  +   +I+ P ELVD +HPL F+P+DH+ +L ++ 
Sbjct  239   RLHSPFHRVMMSGNEARYSTGLFSIPKGGYIIKAPEELVDEEHPLLFRPYDHVEFLKYYY  298

Query  379   KEENRRLPCALKTYCGV  329
              E+ +R   A++TYCGV
Sbjct  299   TEKGQRDQFAMRTYCGV  315



>gb|EYU31921.1| hypothetical protein MIMGU_mgv1a010132mg [Erythranthe guttata]
Length=321

 Score =   288 bits (736),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 204/322 (63%), Gaps = 9/322 (3%)
 Frame = -2

Query  1276  IMGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             +  S  P K+P+ D + +++ PG+ SW  A +    ALEEYG F+A YD+V  E+ +++F
Sbjct  1     MANSQEPSKVPIFDLSPKNLNPGSSSWPQACKNVKQALEEYGFFIAHYDRVPYELDKQLF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
             + L ELFDLP   K  N S    YGYVGQ+P  PL+ESMGI    T   +Q+FT LMWP 
Sbjct  61    EELQELFDLPLETKTRNTSDLVFYGYVGQLPHAPLHESMGIPDVTTFDAVQNFTNLMWPS  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQ---  746
             GN  F E++L Y+KL +ELE++V +MVFESYG +K+Y+SH++S  YL R +KY   +   
Sbjct  121   GNKTFCESILSYAKLVSELEQIVDKMVFESYGTQKHYKSHIESTTYLLRTIKYSVPKIAD  180

Query  745   -ENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMA  569
              +++  +G   HTDKSF+S ++QN  INGL I+ +NG +W  V + P S VVMAGDA  A
Sbjct  181   DKSKDNIGTNVHTDKSFLSILHQN-QINGLYIQLRNG-EWLAVEVPPGSFVVMAGDAYQA  238

Query  568   WSNNRIKSPHHRVMMEG--KGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHY  395
             WSN RI +  H+V+M+G  + PR+ +A FSF    M   P ELVD +HPL+F PFD+   
Sbjct  239   WSNGRIFAAKHQVVMKGDVRMPRFCLALFSF-NHGMTHVPEELVDPEHPLRFNPFDNFGL  297

Query  394   LDFFSKEENRRLPCALKTYCGV  329
               F+     +      + YCG+
Sbjct  298   ARFYLSGVTQMTESTAQAYCGI  319



>ref|XP_004241718.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=314

 Score =   287 bits (735),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/312 (46%), Positives = 203/312 (65%), Gaps = 6/312 (2%)
 Frame = -2

Query  1255  LKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELF  1076
             + LP IDF+ +++KP T  W   + +   AL EYGCF A +DK    + + +F+   ELF
Sbjct  6     INLPKIDFSHKELKPHTLVWNQVKSQVHKALVEYGCFEASFDKFPISLQKSIFESSQELF  65

Query  1075  DLPTNVKVENKSTKPLYGYVGQI-PIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFS  899
             DLP+  K+++  TKP  GYVG   P +PLYESMGID AN     + FT+++WPQGN  F 
Sbjct  66    DLPSQTKLKSIRTKPFNGYVGFYHPSIPLYESMGIDDANIPHKAEKFTQILWPQGNTTFC  125

Query  898   EAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFV  719
             + +  YS+  +EL++M+ RM+ ES GVE Y + H+ S  YL R+MKY+  Q +E ++G  
Sbjct  126   KTIQSYSEQLSELDQMIRRMILESLGVENYMDEHMNSTNYLLRLMKYKTPQSSENEMGLS  185

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
             SHTDKS ++ +YQN  +NGL++  K+G  W  V  +P + +V+ GD++ AW+N R+ +P 
Sbjct  186   SHTDKSNITILYQN-QVNGLQVLTKDG-QWINVDPTPDTFIVLIGDSLHAWTNGRMHAPF  243

Query  538   HRVMMEGKGPRYSIAQFSFMEKT--MIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENR  365
             HRVMM+G   RYSI  F+ + KT  MI+ P ELVD +HPL +KPF HL ++ F   EE  
Sbjct  244   HRVMMKGNEARYSIGLFT-IPKTGYMIKAPKELVDEEHPLLYKPFTHLEFITFSYTEEGM  302

Query  364   RLPCALKTYCGV  329
             +   ALKTYCGV
Sbjct  303   QCESALKTYCGV  314



>ref|XP_010110321.1| Gibberellin 20 oxidase 1 [Morus notabilis]
 gb|EXC25841.1| Gibberellin 20 oxidase 1 [Morus notabilis]
Length=313

 Score =   287 bits (734),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 207/316 (66%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  K+PVIDFT +++KPG+DSWV+A +     LEEYGCF A+YDKV +E+H  +F 
Sbjct  1     MGSQTDHKIPVIDFTDKNLKPGSDSWVSACKLIRYGLEEYGCFEAVYDKVPTELHTSIFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELFDLP   K +  S +P   YVGQ P VPLYES+G+D+  + +  +SFTK MWP G
Sbjct  61    AAKELFDLPIETKEQKTSDRPGANYVGQDPFVPLYESLGLDNPTSFEAAESFTKFMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E +  +SK AAEL    +R+VF+SYG+ + Y SH++SA Y  R  KY   + NE 
Sbjct  121   NDTFREIVRSFSKPAAELYGTAIRIVFDSYGLGRLYGSHIESAFYRLRFFKYSVPKPNES  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              +G  +HTDK+F++ ++Q+  + GL+I+ K+ D +  V   PSS + +AG+ +MAWSN+R
Sbjct  181   NVGLPNHTDKTFVTILHQH-QVEGLQIRTKD-DQYIDVKAKPSSFLCIAGEGLMAWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHY-LDFFSK  377
             I+   HRV+++    RYS+  ++ +   +I  P E++D ++PL +KP D+L + L FF+ 
Sbjct  239   IRPCEHRVIIKENKGRYSLGFYTLV-NGVIHVPEEMIDEEYPLAYKPIDYLDFLLHFFTN  297

Query  376   EENRRLPCALKTYCGV  329
             +  R   C +K + GV
Sbjct  298   DIVRYAACPIKAFAGV  313



>emb|CDP14980.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 206/318 (65%), Gaps = 13/318 (4%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             KLP IDF+ +++KPG   W + + +   ALEEYGCF A YD++  ++ + +F  + ELFD
Sbjct  7     KLPFIDFSNQELKPGFPLWNSLKIQVREALEEYGCFEASYDRIPIQLRKSIFDAVTELFD  66

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LP  VKV+N + KP +GY+GQ P+ PLYE MGID AN L+  +SF+K MWP+GN +FS+ 
Sbjct  67    LPLQVKVKNSNGKPYHGYIGQSPLFPLYEGMGIDEANVLEHAESFSKDMWPEGNSEFSKT  126

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
             +  Y++  +EL++MV +MV E  GVE+Y + H++S  YL RV+KY+  Q NE KLG  SH
Sbjct  127   IQNYAEQLSELDQMVRKMVLEGLGVEQYIDEHLESTHYLLRVIKYKGPQTNETKLGLPSH  186

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAI---------MAWSN  560
              D + ++ ++QN  + GLE++ K+G  W     SP+S VVM G++           AW+N
Sbjct  187   RDANLVTILHQN-QVQGLELQKKDG-QWIDFKPSPNSFVVMIGESFHASLFNKFCSAWTN  244

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSF-MEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
              R+  P+HRV+M G   RYS+  FSF  +  M++ P ELVD  HPL FKPF+   YL + 
Sbjct  245   GRLHPPNHRVLMTGNEARYSVGLFSFPKDGYMVKAPKELVDETHPLLFKPFNCPDYLAYI  304

Query  382   SKEENRRLPCALKTYCGV  329
              K   +++  +LKTYCG 
Sbjct  305   YK-RGKKVDSSLKTYCGA  321



>gb|KEH28750.1| 2-oxoglutarate-dependent dioxygenase [Medicago truncatula]
Length=314

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/316 (45%), Positives = 198/316 (63%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS    KLP+IDF   + +    +W   + +   AL EYGCF A++DKV  ++ + +F 
Sbjct  1     MGSEHTQKLPLIDFNNLNFEAKNPNWELVKSQVYKALVEYGCFEAIFDKVPLDLRKAIFT  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELFDLP   K+ N S KP  GY+GQ P+VPLYESM I+ AN L+ ++S T ++WP G
Sbjct  61    SIEELFDLPLETKLLNVSNKPYDGYIGQYPVVPLYESMAIEDANILEKVKSMTNILWPDG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N +FSE +  +S+   EL++++ +M+ ES GVEKY E H+ S  Y  R MKY+  Q ++ 
Sbjct  121   NKNFSETIHSFSEELIELDQIIRKMILESLGVEKYLEEHMNSTNYRLRAMKYKGPQTSDT  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             K+G   HTDK+F++ +YQN  + GLE+  K+G  W     S  S VV+ GD+I AWSN R
Sbjct  181   KVGLTPHTDKNFVTILYQN-QVEGLEMMTKDG-QWISYKPSSGSFVVVLGDSIHAWSNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP HRVMM G   RYS   FS  +   +I+ P ELVD +HPL FKPFD   +L ++  
Sbjct  239   LHSPFHRVMMSGNEARYSAGLFSTPKGGYIIKAPEELVDEEHPLLFKPFDQAEFLKYYHS  298

Query  376   EENRRLPCALKTYCGV  329
              E  R   A++TYCGV
Sbjct  299   REGARDRFAIRTYCGV  314



>ref|XP_006392867.1| hypothetical protein EUTSA_v10011672mg [Eutrema salsugineum]
 gb|ESQ30153.1| hypothetical protein EUTSA_v10011672mg [Eutrema salsugineum]
Length=288

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 202/318 (64%), Gaps = 33/318 (10%)
 Frame = -2

Query  1273  MGSL--TPLKLPVIDFT-KEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS+  +  K+P++D T ++D+KP T +W +  +E+  ALEE+GCFV ++D V+ ++ + 
Sbjct  1     MGSIVKSSSKVPILDLTSQQDLKPNTSTWRSISKEACEALEEFGCFVVVHDGVTQQLDDS  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             +F    ELFDLPT  K +N + KP +GYVGQ+P++PL+E +GID+    +  Q FT LMW
Sbjct  61    IFAAAEELFDLPTETKRKNVNEKPYHGYVGQMPVIPLHEGLGIDYVTNKEYAQRFTHLMW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             PQGN  F   +  +S   AE++++VVRM+FE+YGVEK+Y+SH                  
Sbjct  121   PQGNHQFCATVHAFSNAVAEIDQLVVRMIFENYGVEKHYDSH------------------  162

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
                      HTDK+F+S ++QN  +NGLE+K+K+G+ W  + L   S VVMAGD  M WS
Sbjct  163   ---------HTDKTFLSILHQN-DVNGLEVKSKDGE-WISLQLPSKSYVVMAGDISMGWS  211

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
             N+RI+S  HRV M+G   RYS   FSF+   M+  P ELVD +HPL +KPFD++  ++F+
Sbjct  212   NDRIRSCEHRVTMDGGKTRYSFGLFSFV-TGMVSVPKELVDDEHPLMYKPFDNIALINFY  270

Query  382   SKEENRRLPCALKTYCGV  329
             + +E R     LK YCG 
Sbjct  271   ATKEGREAKSTLKAYCGT  288



>ref|XP_008784635.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Phoenix dactylifera]
Length=314

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 197/317 (62%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S   +KLP +D + E ++PG++SW   R +   ALE +GCF A++ KV  E+   +F 
Sbjct  1     MASKALVKLPRLDLSDEGLQPGSESWGLVRAQVRQALETFGCFEAVFPKVPEELRRAIFP  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW-PQ  917
              L ELF LPT  K+ N S KP +GYVGQ P +PL+ESMGI+ A   +  Q FT LMW P 
Sbjct  61    ALDELFSLPTEAKLRNISDKPSHGYVGQYPHLPLFESMGIEDAEIPEEAQKFTALMWPPH  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN  FSE +  +SK   EL++MV RMV ES GVEKY +SH++   Y+ RVMKY+     E
Sbjct  121   GNQSFSETICSFSKHVGELDQMVRRMVLESLGVEKYLDSHMQLTRYVLRVMKYKGPDTAE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               +G  +H+D + ++ +YQN   +GLEI+ K+G  W  V  SP S VVM GD+  AWSN 
Sbjct  181   ATMGLGAHSDSNIVTILYQNQ--DGLEIQTKDG-RWIPVSTSPDSFVVMTGDSFTAWSNG  237

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             R+ +P HRVMM G   RYS   F+  +   +++ P ELVD +HPL +KPFDH+ +L F  
Sbjct  238   RVHAPEHRVMMTGSEVRYSAGLFAMPKAGHLVRAPDELVDEEHPLLYKPFDHMDFLRFHR  297

Query  379   KEENRRLPCALKTYCGV  329
                N+ +  AL  +CG 
Sbjct  298   TRLNQTVKAALNEFCGA  314



>ref|XP_010500908.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X3 [Camelina sativa]
Length=299

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 200/319 (63%), Gaps = 24/319 (8%)
 Frame = -2

Query  1273  MGS---LTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS   L PL LPVIDF+ E +KPG   W     +   AL++YGCF A +D++  E+ + 
Sbjct  1     MGSETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKL  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             VF+ L ELFDLP   K+ N S KP +GYVGQ P+VPLYESMGI+  +  + + +FTK +W
Sbjct  61    VFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             PQGN+ F                   RM+ ES+G++KY + H+ S  YL RVMKY+E   
Sbjct  121   PQGNNSFR------------------RMIMESFGLDKYIDEHLHSTNYLLRVMKYKEPDT  162

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              E KLG  +HTDK+ ++ +YQN H+ GLE++ K+ ++W  V  S  S +VM GD++ A  
Sbjct  163   EETKLGLNAHTDKNIVTILYQN-HVEGLEVQTKD-NNWIKVKPSKDSFIVMIGDSLHAML  220

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             N R+ SP+HRVMM G   RYS+  FS  +   +I +P ELVD +HP  FKPFDH+ +L F
Sbjct  221   NGRLHSPNHRVMMTGTETRYSLGLFSIPKAGHIISSPEELVDEEHPRLFKPFDHVEFLQF  280

Query  385   FSKEENRRLPCALKTYCGV  329
             +  +  +R   ALKTYCG+
Sbjct  281   YYTQAGQRSQSALKTYCGI  299



>emb|CDP21179.1| unnamed protein product [Coffea canephora]
 emb|CDP17333.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 199/317 (63%), Gaps = 5/317 (2%)
 Frame = -2

Query  1276  IMGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             +  S +  KLP++D  K+++KPGT SW A       ALEEYGCF+ + D VS++  + VF
Sbjct  1     MAASQSRCKLPIVDLKKDNLKPGTSSWTATCDSVRHALEEYGCFLVVQDHVSAQFEKEVF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
               + ELFDLPT  K +N S     GYVGQ+P  PL+ESM I +A T+ G+Q+FT LMWP 
Sbjct  61    DVVRELFDLPTETKSQN-SLDMFLGYVGQLPHAPLHESMEIPNATTIDGVQAFTDLMWPS  119

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQ-EN  740
             GN  F E ML Y+KL AE+E+ V +MVF SYG   + ESH++S+ Y+ R +KY   +  N
Sbjct  120   GNKRFCETMLTYAKLVAEVEQTVDKMVFASYGAMDHLESHIESSTYILRPLKYTPPEMHN  179

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
                +G   HTDKSF++ ++QN  +N L+++A+N ++W  V  SP+S +V+AGDA  AWSN
Sbjct  180   NVDVGADVHTDKSFITMLHQN-QVNALKVQARN-EEWIDVDFSPASFLVLAGDAYQAWSN  237

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             +RI  P H+V+M+    RY IA F++    M+  P  L+D  HPL FKPFD+   L FF 
Sbjct  238   DRIHPPRHQVIMKENKERYCIALFAY-NYGMVNVPEILIDEKHPLAFKPFDNFDLLRFFL  296

Query  379   KEENRRLPCALKTYCGV  329
                        K YCG+
Sbjct  297   SRTTDMSSSTAKAYCGI  313



>ref|XP_004241719.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=314

 Score =   285 bits (729),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/311 (46%), Positives = 199/311 (64%), Gaps = 4/311 (1%)
 Frame = -2

Query  1255  LKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELF  1076
             +KLP IDF+ ED+KPGT  W   + +   AL EYGCF A + K+   + + +F+ L E+F
Sbjct  6     IKLPKIDFSHEDLKPGTLVWNQVKSQVHKALVEYGCFEASFYKIPIHLKKSIFESLQEIF  65

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             DLP   K+EN STKP +GYVGQ P +PL+ESMGID AN  +    F +++WPQGN  F +
Sbjct  66    DLPLQTKLENISTKPFHGYVGQFPSLPLFESMGIDDANIPRKADEFAQILWPQGNPSFCK  125

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQEN-EPKLGFV  719
              +  YS+  +EL++ V RMV ES G+EKY + H+ S  ++ ++MKY   Q N E ++G  
Sbjct  126   TIQSYSEQLSELDQTVRRMVLESLGLEKYMDEHMNSTNFVLQLMKYNTPQSNTETEIGVS  185

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
             +HTDKS  + +YQN  INGL++  KNG  W  V  +  +  VM GD++ AW+N R+ +P+
Sbjct  186   AHTDKSIATILYQN-QINGLQVMNKNG-QWINVEPTQDTFTVMIGDSLHAWTNGRMHAPY  243

Query  538   HRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRR  362
             HRVMM G   RYS+  FS  +    I+ P E+VD ++PL +KPFD    L F + EE  R
Sbjct  244   HRVMMRGNKARYSVGLFSVPKGDYTIKAPKEMVDEENPLLYKPFDLHGLLAFTNTEEGMR  303

Query  361   LPCALKTYCGV  329
                ALKTYCG+
Sbjct  304   CESALKTYCGL  314



>ref|XP_007162137.1| hypothetical protein PHAVU_001G127200g [Phaseolus vulgaris]
 gb|ESW34131.1| hypothetical protein PHAVU_001G127200g [Phaseolus vulgaris]
Length=319

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/317 (47%), Positives = 203/317 (64%), Gaps = 4/317 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  +L V+DFT E MKPGTD+W++A     +ALE+ GCF+A Y  +  ++ + V  
Sbjct  1     MGSETQSQLHVVDFTDEAMKPGTDAWLSACILVRTALEDNGCFLARYHGIGKDLCDSVVS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + +LF LP   K +  S KP + Y+GQ+  +PLYES+GID+  TLQG Q FT +M  QG
Sbjct  61    AMGDLFSLPVETKAQKTSDKPFHSYLGQVSWLPLYESLGIDNPLTLQGCQKFTHIMGLQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQENE  737
             N  F E++  Y+KL  EL+ M  RMVFESYGV+ +  E  ++S+ YL R MKYR A+ +E
Sbjct  121   NHRFCESVNEYAKLLGELDHMAKRMVFESYGVDMEGRECMIESSDYLLRCMKYRTAETDE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               LG  SHTD + +S ++Q  ++NGLEIK K+G +W GV  S S  VVMAGDA+  WSN 
Sbjct  181   NDLGLQSHTDLTIVSIVHQLNNLNGLEIKLKDG-EWIGVDASSSLFVVMAGDALNVWSNG  239

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKP-FDHLHYLDFFS  380
             RI+   HRV+M     RYS+  FSF    ++Q P ELV  +HPL++K  FDH  YL +  
Sbjct  240   RIRPCEHRVIMNATKTRYSMGLFSF-SGEILQIPDELVSEEHPLRYKSIFDHYEYLRYHE  298

Query  379   KEENRRLPCALKTYCGV  329
             KE N+     ++ YCG+
Sbjct  299   KENNKDSYSRIEAYCGI  315



>ref|XP_004165032.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
Length=321

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/304 (49%), Positives = 198/304 (65%), Gaps = 9/304 (3%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             +LPV+ F  +++K GT+ WV+  ++   ALEEYGCFVALYD VS+EV   +F  L ELFD
Sbjct  9     QLPVVKFCSQNLKSGTEEWVSTTKKVREALEEYGCFVALYDTVSAEVSSNMFDSLKELFD  68

Query  1072  -LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP-QGNDDFS  899
              +P   K++N S KP +GY GQ P++P++ESMGI+H      I SFT LMWP +GN  F 
Sbjct  69    EVPLERKLQNVSEKPYHGYFGQNPLMPIHESMGIEHPILPTNINSFTNLMWPSRGNHSFR  128

Query  898   EAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFV  719
             E +  Y+ L +EL++ V  MVFESYGV     SH++S  YL R++KYR  +E E  LG  
Sbjct  129   ENVTAYANLVSELDKRVKSMVFESYGVGNALRSHMESTKYLMRMIKYRVPKEKEMNLGAF  188

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVH----LSPSSIVVMAGDAIMAWSNNRI  551
              HTDKSF++ ++QN  +NGL+IK ++ + W   H     S SS +VMAGDA  AWSN RI
Sbjct  189   PHTDKSFLTILHQN-EVNGLQIKTRD-NKWIQYHPFSSSSTSSFIVMAGDAFFAWSNGRI  246

Query  550   KSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEE  371
              SP HRV+M G   RYS+  FSF    ++Q P ELVD  HP  FKPFDH  YL F+S E 
Sbjct  247   YSPPHRVIMSGNKERYSVGLFSF-NNGIVQIPKELVDDKHPQLFKPFDHQDYLRFYSTER  305

Query  370   NRRL  359
              ++ 
Sbjct  306   GQKF  309



>ref|XP_010462135.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Camelina sativa]
Length=299

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 200/319 (63%), Gaps = 24/319 (8%)
 Frame = -2

Query  1273  MGS---LTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             MGS   L PL LPVIDF+ E +KPG   W     +   AL++YGCF A +D++  E+ + 
Sbjct  1     MGSETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRKL  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             VF+ L ELFDLP   K+ N S KP +GYVGQ P+VPLYESMGI+  +  + + +FTK +W
Sbjct  61    VFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             PQGN+ F                   RM+ ES+G++KY + H++S  YL RVMKY+    
Sbjct  121   PQGNNSFR------------------RMIMESFGLDKYIDEHLQSTNYLLRVMKYKGPDT  162

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              E KLG  +HTDK+ ++ +YQN H+ GLE++ K+ ++W  V  S  S +VM GD++ A  
Sbjct  163   EETKLGLNAHTDKNIVTILYQN-HVEGLEVQTKD-NNWIKVKPSKDSFIVMIGDSLHAML  220

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             N R+ SP+HRVMM G   RYS+  FS  +   +I +P ELVD +HP  FKPFDH+ +L F
Sbjct  221   NGRLHSPNHRVMMTGTETRYSLGLFSIPKAGHIISSPEELVDQEHPRLFKPFDHVEFLQF  280

Query  385   FSKEENRRLPCALKTYCGV  329
             +  +  +R   ALKTYCG+
Sbjct  281   YYTQAGQRSQSALKTYCGI  299



>ref|XP_003555065.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Glycine 
max]
 gb|KHN05760.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=312

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 205/316 (65%), Gaps = 5/316 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M  LT  +LP++DFT E++KPGTD+WV+A +   SALE++G F+ALYDKVS E ++ V+ 
Sbjct  1     MEFLTQSQLPIVDFTNENLKPGTDAWVSASQVVRSALEDHGGFLALYDKVSLETYDSVYS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              ++  FDL    K    + KP++ Y GQ+P +PLYES+GI +  + Q  Q +T +MWPQG
Sbjct  61    EMMNFFDLSIKTKRRKTTEKPIFSYSGQLPGIPLYESVGIMNPLSFQDCQKYTHVMWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQENE  737
             ND F E++  Y+K   EL+ +V RMVFE+YG+E K +++ ++S  Y+ R  KYR  Q  E
Sbjct  121   NDHFCESVNSYAKKLVELDHIVKRMVFENYGIETKKFDTLLESTEYVLRAYKYRIPQVGE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               LG   H+D +F++ +  N  + GL +K K+G  WF V  SPS  +VM GDA+M WSN+
Sbjct  181   SNLGVAPHSDTAFITIL--NQKVEGLGVKLKDG-KWFEVGASPSLYLVMGGDALMVWSND  237

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI +  HRV++  K  RYS+   S+  K M +   ELVD +HPL++KPFDH  YL FF  
Sbjct  238   RIPACEHRVLINSKIDRYSMGLLSYAAKIM-EPQEELVDEEHPLRYKPFDHYGYLRFFLT  296

Query  376   EENRRLPCALKTYCGV  329
             EE  +    +K YCG+
Sbjct  297   EEAIKSDSRIKAYCGI  312



>ref|XP_004506877.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Cicer arietinum]
Length=314

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 203/316 (64%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S T  KLP+IDF   +++  + +W + + +   ALEEYGCF A+ DKV  ++ + +F 
Sbjct  1     MSSETIPKLPIIDFNNLNLEAKSPNWESVKSQVYKALEEYGCFEAILDKVPLDLRKTIFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELFDLP   K  N S K  +GY+ Q P++PLYES+GID AN  + ++S T ++WP G
Sbjct  61    SLEELFDLPLQTKQLNVSKKLHHGYLSQYPMLPLYESIGIDDANIFENVESLTNILWPDG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N  FS+ +  +S+   EL++++ +M+ ES GVEKY E H+ S  YL R MKY+  Q ++ 
Sbjct  121   NQSFSKTVHTFSEELLELDQIIRKMILESLGVEKYLEEHMNSTSYLLRFMKYKGPQTSDT  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             K+G  +HTDK+ ++ +YQN  + GLE+  K+G  W     S  S VV+ G+++ AWSN R
Sbjct  181   KVGLKAHTDKNTVTILYQN-QVEGLEVMNKDG-KWISYKPSLDSFVVLVGESLHAWSNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSF-MEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP HRVMM G   RYSIA  S   E+ +I+ P ELVD +HPL FKP+ +  +L +F  
Sbjct  239   LHSPLHRVMMSGNEARYSIALGSIPKEECIIKAPDELVDDEHPLLFKPYVYDEFLKYFFS  298

Query  376   EENRRLPCALKTYCGV  329
             E+ +R   A++TYCGV
Sbjct  299   EKGQRDQFAMRTYCGV  314



>emb|CDP21163.1| unnamed protein product [Coffea canephora]
Length=268

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/272 (50%), Positives = 183/272 (67%), Gaps = 4/272 (1%)
 Frame = -2

Query  1144  VALYDKVSSEVHERVFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHA  965
             +A++DK  SEV + +F  L +LF+LP  +KV+N S  PL+GY    P VPLYES  I+ A
Sbjct  1     MAVHDKYPSEVSDSIFSVLQDLFNLPLEIKVQNTSQTPLFGYYAPNPNVPLYESTSIEDA  60

Query  964   NTLQGIQSFTKLMWPQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSA  785
               L+ +Q FT  MWP  N    E +  Y+   AEL++MV ++VFESYGVEKY+ESHV S 
Sbjct  61    INLEPVQEFTNQMWPSKNSHICELLHCYANQVAELDKMVSKLVFESYGVEKYHESHVGSV  120

Query  784   CYLARVMKYREAQENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPS  605
              Y  R+ KYR  ++NE  LG   HTDK+F++ + QN  ++GLE++ KNG  W  V   PS
Sbjct  121   TYFLRLAKYRAPEQNETNLGVRPHTDKNFITILQQN-EVDGLEVQLKNG-SWIPVDFPPS  178

Query  604   SIVVMAGDAIMAWSNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPL  425
             S+V+MAGDA   WSN R+ SP HRV M+GKG RYSIAQFS+ +K +++ PTELVD +HPL
Sbjct  179   SVVIMAGDAFSVWSNGRVHSPFHRVTMKGKG-RYSIAQFSYCKK-LVEAPTELVDDEHPL  236

Query  424   QFKPFDHLHYLDFFSKEENRRLPCALKTYCGV  329
              +KP D+  +L F SK E R +   LK YCG+
Sbjct  237   LYKPLDNFGFLRFLSKGERREIQNPLKAYCGI  268



>ref|XP_003521152.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1-like 
[Glycine max]
 gb|KHN30391.1| Gibberellin 20 oxidase 2 [Glycine soja]
Length=322

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 202/319 (63%), Gaps = 5/319 (2%)
 Frame = -2

Query  1273  MGSLT-PLKLPVIDFTKEDMK-PGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERV  1100
             MGS T   +L V+DFT E+ K PGTD+W++A     +ALE+ G F+A YDKV  E+ + V
Sbjct  1     MGSQTQSQELHVVDFTDENTKKPGTDAWLSACSVVRTALEDNGFFMARYDKVGKELCDSV  60

Query  1099  FKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP  920
                + ELFDLP   K +  S K  +GY+GQ+  +PLYES+GID   TL G Q F  +MWP
Sbjct  61    VSAVEELFDLPVETKAQKTSEKLFHGYLGQVSWLPLYESVGIDDPLTLLGCQKFGHIMWP  120

Query  919   QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQE  743
             +GN  F E++  YSKL  EL+ M  RMVFESYGV+ +  +S ++S  YL R M YR  Q 
Sbjct  121   EGNHRFCESINEYSKLLGELDHMAKRMVFESYGVDMQRCDSFIESNDYLLRCMMYRTPQT  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              E  LG   H+D +  S ++Q  ++NGLEIK K+G +W G+  SPSS VVMAGDA   WS
Sbjct  181   GEIDLGLQPHSDLTITSIVHQLNNLNGLEIKLKDG-EWKGIDASPSSFVVMAGDAFNVWS  239

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKP-FDHLHYLDF  386
             N RI+   HRV M  K  RYS+  FSF    +++ P ELV+  HPL++KP FDH  YL F
Sbjct  240   NGRIRPCEHRVTMNAKKTRYSMGLFSFGGNKVMRIPEELVNKQHPLRYKPLFDHYEYLRF  299

Query  385   FSKEENRRLPCALKTYCGV  329
             + KE+ +     ++ +CG+
Sbjct  300   YDKEKIKEPYSRIQAHCGI  318



>ref|XP_006365982.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=314

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 200/315 (63%), Gaps = 8/315 (3%)
 Frame = -2

Query  1255  LKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELF  1076
             +KLP IDF  ED+K GT  W   + +   AL EYGCF A +DK+S  + + +F+   ELF
Sbjct  2     IKLPEIDFFHEDLKSGTLVWNQVKSQVHKALVEYGCFEASFDKISIHLKKSIFEVSQELF  61

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             DLP   K++N ST+PL+GY+G  P +PLYES+ I+ AN     + FT+ +WPQG   F +
Sbjct  62    DLPLQTKLKNISTRPLHGYIGPCPQIPLYESLCIEDANIHNKAEKFTQTLWPQGKSSFCK  121

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVS  716
              +  YS+  +EL+++V RM+ ES G+EKY + H+ S  YL R+MKY+  Q +E ++G   
Sbjct  122   TIQSYSEKLSELDQIVNRMILESLGMEKYMDEHMNSTNYLLRLMKYKAPQSSETEMGMNV  181

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHH  536
             HTD S ++ +YQN  +NGL+I  K+G  W     +P + +VM GD + AW+N R+ +P+H
Sbjct  182   HTDTSNLTILYQN-QVNGLQILTKDG-QWINADPTPDTFIVMIGDPLHAWTNGRLHAPYH  239

Query  535   RVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRR-  362
             RV+M GK  RYSI  FS  +   +I+TP ELVD DHPL FKPF H  YLDF  +  N   
Sbjct  240   RVIMRGKEARYSIGFFSRPKAGHIIKTPKELVDEDHPLLFKPFVHAEYLDFCYRAFNNTK  299

Query  361   --LPC--ALKTYCGV  329
               + C   LKTY GV
Sbjct  300   EGMGCESILKTYYGV  314



>ref|XP_009375961.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Pyrus x bretschneideri]
Length=318

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 198/316 (63%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSLT  KLP I+F+ + +KPG+ SW++  ++   ALEEYGCFVA YD+VS+++   +F 
Sbjct  1     MGSLTLPKLPTINFSIDALKPGSSSWLSTSKQVRYALEEYGCFVAQYDQVSAQLLNNIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LF++P   KV+N S +P  GY+G   ++PLYE + ID+  + Q  Q F  LMWP G
Sbjct  61    QAKDLFEVPLENKVKNVSDEPYRGYIGPNHLMPLYEGIAIDNVTSPQETQKFKNLMWPDG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE-NE  737
               +F E    +++L +ELE  V +M+FESYG EK YES   +  +L R +KY + +E + 
Sbjct  121   KSNFCETTDSFAQLLSELERKVEQMLFESYGAEKQYESVASANSHLLRFLKYNKPEEADR  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               L F SHTDK+F + + Q+  + GLE+K K+G DW  +  +PS  + MAGD +  W N+
Sbjct  181   ATLRFASHTDKNFTTIVVQH-DVGGLEVKTKDG-DWINIESAPSQFLFMAGDGLQVWRND  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RIK+ HHRV   G   RYS+  F+F    +IQ P ELVD  HPL + P   L Y+ F S+
Sbjct  239   RIKACHHRVKHCGDKTRYSLGLFTF-NNGIIQVPEELVDERHPLLYNPLVSLEYMRFHSR  297

Query  376   EENRRLPCALKTYCGV  329
              E R L   LKT+CGV
Sbjct  298   GEARNLVSPLKTFCGV  313



>ref|XP_009621185.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=321

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 202/316 (64%), Gaps = 6/316 (2%)
 Frame = -2

Query  1267  SLTPLKLPVIDFTK-EDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKG  1091
             S T  K P+ID  K E  K G++SW+        ALE++G F+ALYDKVSSEV + +F  
Sbjct  2     SQTLCKAPIIDLNKLEKSKRGSNSWLELCNGVRLALEDHGYFIALYDKVSSEVEKEIFDV  61

Query  1090  LVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGN  911
             + ELFDLP   K +N S    Y +VGQ+   PL+ES GI +   +Q +QSFT LMWPQGN
Sbjct  62    MDELFDLPIETKKKNSSDFYFYRWVGQLEAAPLHESFGIVYPTHIQALQSFTTLMWPQGN  121

Query  910   DDFSEAMLVYSKLAAELEEMVVRMVFESYGV-EKYYESHVKSACYLARVMKYRE-AQENE  737
               FSE +  Y K+AAELE++V +MVFESYGV E++YESH+ +  YL R  KY      N 
Sbjct  122   QRFSETVTSYVKVAAELEQLVDKMVFESYGVAERHYESHIAATTYLLRPTKYAAPPPSNI  181

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               +G   HTDKSF + ++QN  INGL++++K+G DW  V++ PS+ V MAGDA  AWSN 
Sbjct  182   NNVGANIHTDKSFSTLLFQN-QINGLQVESKSG-DWIAVNVPPSAFVFMAGDAYEAWSNG  239

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI +P H+V+++ +  RY++A F+F  K +   P ELVD  HPLQ+KPFD+     ++  
Sbjct  240   RIYAPRHQVLLKEEKQRYTLALFTF-NKGITDIPEELVDETHPLQYKPFDNFGLAWYYLS  298

Query  376   EENRRLPCALKTYCGV  329
               N  +    K YCG+
Sbjct  299   GANSMIHSTAKAYCGI  314



>ref|XP_007024016.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY26638.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=319

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 207/324 (64%), Gaps = 8/324 (2%)
 Frame = -2

Query  1291  LSKIYIMGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEV  1112
             ++K   M S TP++LPVID +K+D+KPG+  W   + +   AL+EYGCF AL+DKV  E+
Sbjct  1     MTKSAEMSSETPVRLPVIDSSKQDLKPGSADWELVKVQVRQALQEYGCFEALFDKVL-EL  59

Query  1111  HERVFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGI-QSFT  935
              + +   L ELFDLP   K    S K   GY G  P  PL+ESM ID AN  + + Q  T
Sbjct  60    GKPLIGALEELFDLPLQTKTRYVSEKVFRGYYG--PKAPLHESMVIDEANVAENVEQRLT  117

Query  934   KLMWPQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYR  755
              ++WPQGN  FSE +L +S LA+ LE+ + RM+ ES+G+EKY + H++S  Y+ RVMKY 
Sbjct  118   NILWPQGNSSFSETLLSFSSLASGLEKTIRRMILESFGLEKYMDKHMESTNYILRVMKYE  177

Query  754   EAQENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAI  575
                 +EP +G  +H+D++ ++ ++QN  +NGLEI+ K+G +W  V  SP+S +VM G+++
Sbjct  178   GPHTSEPTIGARAHSDQNMVTLLHQN-EVNGLEIQTKDG-EWINVKPSPASFIVMIGESL  235

Query  574   MAWSNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLH  398
               W N R+ SP+HRVM+ G   RYS   F+  +    ++ P ELVD ++PL FKPFD+  
Sbjct  236   SVWLNGRLPSPYHRVMITGNKARYSSGLFATTKGGYKVKVPEELVDEENPLLFKPFDYEE  295

Query  397   YLDFFSKEENR-RLPCALKTYCGV  329
             +L+F+S E  R  L   LK YC V
Sbjct  296   FLEFYSTEAARGALGSGLKAYCSV  319



>ref|XP_006356185.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=314

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 199/317 (63%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS   +KLP I+F+ ED+KP T  W   + +   AL EYGCF A +DK+   + + +F+
Sbjct  1     MGSKN-IKLPKINFSHEDLKPDTLEWNQVKSQVYKALVEYGCFEAFFDKIPINLQKSIFE  59

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQI-PIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
                E FDLP   K++N STKP  GYVGQ  P +PL ESMGI  +N    ++ +T+L+WPQ
Sbjct  60    VSQEFFDLPLQTKLKNISTKPFSGYVGQYHPSIPLAESMGIIDSNIPHKVEKYTQLLWPQ  119

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN  F + +  Y +  ++L++ + RM+ ES G+EKY + H+ S  Y  R+MKY+E Q +E
Sbjct  120   GNPSFCKTIQSYLEQLSKLDQTIRRMIVESLGIEKYMDEHMNSINYSLRLMKYKEPQSDE  179

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
              K+G  +HTDK+ ++ +YQN  + GLEI  K+G  W  V  +P +  VM GD++ AW+N 
Sbjct  180   TKIGLHAHTDKNIVTILYQN-QVKGLEILTKDG-QWINVDPTPDTFTVMIGDSLHAWTNG  237

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSF-MEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             R+ +  HRVMM G   RYSI  FS   +  +I+ P ELVD DHPL FKPFD   +L F  
Sbjct  238   RMHATFHRVMMRGNKARYSIGLFSKPKDGYIIKAPKELVDEDHPLLFKPFDFHEFLAFGY  297

Query  379   KEENRRLPCALKTYCGV  329
              E++ +   +LK YCGV
Sbjct  298   TEQDMKCDFSLKAYCGV  314



>emb|CDP08608.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 196/310 (63%), Gaps = 9/310 (3%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             +PVI FT E++ PGT SW +  +    ALEE+ CFVA+YDKV  E     F    ELF+L
Sbjct  18    VPVIYFTAENLNPGTGSWFSTCKAVSEALEEFSCFVAVYDKVEPEFISDAFASFKELFNL  77

Query  1069  PTNVKVENK-STKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             P   K+ N    +P +GY+   P  P++E++GI+ + T+  +QSF  ++WP GND F E 
Sbjct  78    PMETKLLNTIPDRPAFGYIRPRPETPVHETVGIEDSTTIGAVQSFANVIWPSGNDHFCET  137

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
             +  Y+K  +E+  +V RM+FESYGV KY +SH++S  YL R   YR   E EP LG + H
Sbjct  138   IHSYTKQVSEVNRLVSRMIFESYGVGKYSDSHIESTSYLLRANAYRVPHEKEPNLGIIPH  197

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TD SF+S + Q+  + GL+++ K+G  W  VHL  SS  VMAGDA++AWSN R+    HR
Sbjct  198   TDTSFVSVVKQDS-VQGLQVQLKDG-TWIPVHLPQSSFAVMAGDAMLAWSNGRVHPCFHR  255

Query  532   VMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPC  353
             V+M+ K  R+SIA FSF  K ++Q P EL D ++PL+FK FDH   L+F  + +N  L C
Sbjct  256   VIMKEKA-RFSIALFSF-HKGVVQVPKELADDNYPLRFKSFDHFGLLNF--RLKNPALSC  311

Query  352   A--LKTYCGV  329
                +K YCG+
Sbjct  312   QERVKAYCGI  321



>ref|XP_010032029.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW51414.1| hypothetical protein EUGRSUZ_J00951 [Eucalyptus grandis]
Length=313

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 205/310 (66%), Gaps = 5/310 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             ++PVI F++E  KPGT SW  A +  V ALE++GCF+  +  V   +H+ VF    +LFD
Sbjct  4     QIPVIVFSEECTKPGTSSWEKACKVIVQALEDHGCFIVDHPNVPLGLHDTVFSVAEDLFD  63

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LP   K++N + KP +GY+ ++P  PL E M ID A  L+  + FT +MWP GND F + 
Sbjct  64    LPHETKIKNTNFKPSHGYIAKVPGTPLLEGMNIDGAEKLEECEKFTSIMWPSGNDHFCKT  123

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
             +  YSK  AE+E++V RMV ESYGVEK ++ +++S  YL R +KY++  + +  +  ++H
Sbjct  124   VHDYSKFIAEIEKVVFRMVCESYGVEKCFDPYIESCTYLLRFLKYKKPADLDANVNPIAH  183

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TDKSF+S ++QN +I GLE++ K+G +WF    S  + +VMAGDA +AWSN RIK+ +HR
Sbjct  184   TDKSFLSYLHQN-NIRGLEVRTKDG-EWFTFEPSALTFMVMAGDACVAWSNGRIKACYHR  241

Query  532   VMM-EGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENR-RL  359
             V + E    RYS+  FS++   MI+TP E +D  HP Q+KPF+H+ +L ++   +NR + 
Sbjct  242   VAVREESQVRYSLGTFSYI-SGMIETPEEFIDKAHPRQYKPFNHIDFLCYYDSSDNRIKA  300

Query  358   PCALKTYCGV  329
                +KTYCGV
Sbjct  301   ESLIKTYCGV  310



>ref|XP_008344774.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Malus 
domestica]
Length=317

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 134/319 (42%), Positives = 201/319 (63%), Gaps = 6/319 (2%)
 Frame = -2

Query  1273  MGSLT-PLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGS T P  +PV+D + E+MKPGTD+W+ A ++   ALEE+GCF A+Y K + E    +F
Sbjct  1     MGSETQPPVVPVVDLSSENMKPGTDAWLLACKKVQHALEEFGCFEAVYKKDTLETQNSIF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
               + +  DLP   K++  S KPL+ Y G+ P+ P   S GI++  T++G Q FT +MWP 
Sbjct  61    SAIKDFCDLPLETKMQKTSDKPLHSYFGRNPLFPHDFSTGIENPETVEGXQKFTSIMWPA  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYR---EAQ  746
             GN  F E++  +S++  EL++MV RMVF+ YGV++ Y+SH  S  Y  R ++Y+     Q
Sbjct  121   GNXRFRESVHSFSRMLVELDQMVTRMVFDIYGVZRLYDSHKASTTYQLRCIEYQIQAIQQ  180

Query  745   ENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAW  566
              ++  +    HTDK F + ++QN  +NGL+IK + G        SPSS +V A D +MAW
Sbjct  181   TDKSDVRLFPHTDKGFTTILHQN-EVNGLQIKTRAGQRIDYAPSSPSSFIVFAADVLMAW  239

Query  565   SNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             SN+R+ +  H+V+M+ +  RYS+A FS+ +  ++Q P ELVD  HPL++KPFD   YL F
Sbjct  240   SNDRVYASEHQVIMKEEKTRYSVALFSY-KNGIVQVPEELVDDKHPLRYKPFDQFDYLRF  298

Query  385   FSKEENRRLPCALKTYCGV  329
             F  EE  ++   +K YCG+
Sbjct  299   FQTEEAXKIKHPIKAYCGI  317



>ref|XP_010061957.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
Length=321

 Score =   275 bits (702),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 207/318 (65%), Gaps = 5/318 (2%)
 Frame = -2

Query  1276  IMGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             + G+    ++PVI  ++E MKPGT SW  A +  V ALE++GCF+  +  V   +H+ VF
Sbjct  1     MAGTKVASQIPVIVLSEECMKPGTSSWEKACKVIVQALEDHGCFIVDHPNVPLGLHDTVF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
                 +LFDLP   K++N + KP +GY+ ++P  PL E   ID A  L+  + FT LMWP 
Sbjct  61    SVTEDLFDLPHETKIKNTNFKPSHGYIPKVPGTPLLEGTNIDGAEKLEECEKFTSLMWPS  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND F + +  Y K  AE+E++V RMV ESYGVEK Y+ +++S  YL R +KY++  + +
Sbjct  121   GNDHFCKTVHDYGKFIAEIEKVVFRMVCESYGVEKCYDPYIESCTYLLRFLKYKKPADLD  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               +  ++HTDKSF+S ++QN +I GLE++ K+G +WF    S S+ +VMAGDA +AWSN 
Sbjct  181   ASVNPIAHTDKSFLSYLHQN-NIRGLEVRTKDG-EWFTFEPSASTFMVMAGDACVAWSNG  238

Query  556   RIKSPHHRVMM-EGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             RIK+ +HRV + E    RYS+  FS++   MI+TP E ++  HP Q+KPF+H+ +L ++ 
Sbjct  239   RIKACYHRVAVREESQVRYSLGTFSYV-SGMIETPEEFINKAHPRQYKPFNHIDFLCYYD  297

Query  379   KEENR-RLPCALKTYCGV  329
               +NR +    +KTYCGV
Sbjct  298   SSDNRIKAESLIKTYCGV  315



>ref|XP_010061958.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
Length=310

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 193/310 (62%), Gaps = 5/310 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             ++PVI F++E M+P T SW  A  E V ALE +GCFVA Y+    E  + +F    ELFD
Sbjct  4     EVPVIVFSQESMEPATKSWTRACDEIVQALEHHGCFVAEYEDFPGEFRDPIFGVAKELFD  63

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LP   KV + S+    GY+ + P  PL E + ID A  L+  + FT LMWP GN  F + 
Sbjct  64    LPQETKVRSPSSAYSNGYIAKCPGTPLLEGLNIDGAEKLEAFEKFTALMWPSGNARFCKT  123

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
                Y+K  A++E++V RMVFE YGV KY  SH +S  YL R++KY++  E+E  +  ++H
Sbjct  124   AHSYAKEIAKVEKVVTRMVFEGYGVGKYCNSHFESTTYLLRILKYKKPGEDEGNINPIAH  183

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TDK+F+S +Y N  + GLE+  K+G +W     SPSS +VMAGDA M WSN RIK+ +HR
Sbjct  184   TDKTFLSILYPN-DVRGLEVMTKDG-EWVVFQPSPSSFMVMAGDACMGWSNGRIKACYHR  241

Query  532   VMMEGKGP-RYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENR-RL  359
               +   G  RY++  FS+   T I+ P EL+D DHP QFK F+HL +L F+ K + R + 
Sbjct  242   TNVREDGSVRYALGVFSYNTGT-IEIPKELIDQDHPQQFKSFNHLDFLRFYDKSQGRTKS  300

Query  358   PCALKTYCGV  329
              C +K YCGV
Sbjct  301   QCLIKAYCGV  310



>ref|XP_008386022.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=318

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 197/316 (62%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSLT  KLP IDF+ + +KPG+ SW++  ++   ALEEYG FVA YD++S+++   +F 
Sbjct  1     MGSLTLPKLPTIDFSVDVLKPGSSSWLSTSKQVRYALEEYGGFVAQYDQISAQLLNDIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LF++P   KV+N S +P  GY+G   ++PLYE + ID+  + +  Q F  LMWP G
Sbjct  61    HAKDLFEVPLENKVKNVSNEPYRGYIGPNHLMPLYEGIAIDNVTSPEETQKFKNLMWPDG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE-NE  737
               +F E    +++L +ELE  V +M+FESYG EK YES   +  +L R +KY + +E + 
Sbjct  121   KSNFCETTDSFAQLLSELEHKVEQMLFESYGAEKQYESVASANSHLLRFLKYNKPEEADS  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               L F SHTDK+F + + Q+  + GLE+K K+G DW  V   PS  V +AGD +  WSN+
Sbjct  181   TTLRFASHTDKNFTTIVVQH-DVGGLEVKTKDG-DWISVESVPSQFVFLAGDGLQVWSND  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RIK+ HHRV   G   RYS+  F+F    +IQ P ELVD  HPL + P D L Y+ F S+
Sbjct  239   RIKACHHRVKHCGDKTRYSLGLFTF-NNGIIQVPQELVDERHPLLYNPLDSLEYIRFHSR  297

Query  376   EENRRLPCALKTYCGV  329
              E R L   + T+CGV
Sbjct  298   GEARNLVSPVNTFCGV  313



>ref|XP_007024010.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY26632.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=319

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/313 (45%), Positives = 193/313 (62%), Gaps = 4/313 (1%)
 Frame = -2

Query  1261  TPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVE  1082
             TPL LP+IDF+ +D+K GT  W + + +   AL+E+GCF AL D+V  E+ E VF  L E
Sbjct  9     TPLGLPIIDFSNKDLKQGTPEWDSVKIQVRKALQEFGCFEALVDEVPPELREAVFGALKE  68

Query  1081  LFDLPTNVKVENKSTKPLYGYVGQIP-IVPLYESMGIDHANTLQGIQSFTKLMWPQGNDD  905
             LFDLP   K+ N S KP +GY+G  P   PLYES GI+  N ++ ++  + ++WP+GN  
Sbjct  69    LFDLPLETKMLNVSEKPYHGYLGVHPERSPLYESFGIEDPN-IENVEGLSNILWPEGNLA  127

Query  904   FSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLG  725
             FS+ +   ++    LE MV RM+ ES  +EKY E H+ S  YL R+MKY+  +  E KLG
Sbjct  128   FSKPIHYLAEQVLGLERMVRRMILESLSLEKYMEEHMDSNYYLLRLMKYKGPETTEAKLG  187

Query  724   FVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKS  545
                HTDK+ M+ +YQN  ++ L+++AK+G +W  V  SP S +VM GD + AW N  + S
Sbjct  188   LYGHTDKNIMTILYQNNDVHALQVRAKDG-EWIHVKPSPRSFIVMIGDPLKAWLNGHMHS  246

Query  544   PHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEEN  368
             P HRVMM+G   R+S   FS  +    I+ P ELVD  HPL FKPF +  +L F   E  
Sbjct  247   PFHRVMMKGNETRFSTGLFSIPKAGYTIKAPEELVDEQHPLLFKPFTYDEFLGFLYTEAG  306

Query  367   RRLPCALKTYCGV  329
             +   CAL  YCGV
Sbjct  307   QTAECALTDYCGV  319



>gb|AFK44600.1| unknown [Lotus japonicus]
Length=336

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 202/322 (63%), Gaps = 10/322 (3%)
 Frame = -2

Query  1276  IMGSLT--PLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             IMGS T   + LP IDF+ E +KPGT  WV+  +   SA+E++G F+ALYDKV   +++ 
Sbjct  19    IMGSQTESQVPLPAIDFSDEHLKPGTHKWVSTCQAVRSAMEDHGGFLALYDKVDPLLYDS  78

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             VF  +  LFDLP+  K +  + KP++ Y  Q P +PLYES+ ID+A +    Q +T +MW
Sbjct  79    VFSAMKRLFDLPSETKGQKTTDKPIFSYAAQCPNIPLYESIAIDNAVSAGDCQKYTTIMW  138

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQ  746
             PQGND FSE++  Y+K  AEL+ +V +MVFESYGV+ + +ES   S  Y+ R  KYR   
Sbjct  139   PQGNDHFSESVNSYAKKVAELDYIVKKMVFESYGVDNQKHESMHASTDYVLRCYKYRTPL  198

Query  745   ENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAW  566
               E  +G + HTD  F++ I  N  +NGLEIK ++G  WF V  SPS   V+AG+A+  W
Sbjct  199   VGETNIGVLPHTDSGFLTII--NQRLNGLEIKLQDG-KWFPVEASPSMFAVLAGEALTVW  255

Query  565   SNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             SN+RI +  HRV M  K  RYS+   S+  K M +   ELVD +HPL++KPFDH  YL F
Sbjct  256   SNDRISACLHRVFMNEKVDRYSLGLLSYAGKLM-EPQEELVDEEHPLRYKPFDHYGYLRF  314

Query  385   FSKEENRRL---PCALKTYCGV  329
             +  EE  +       +KTYCG+
Sbjct  315   YVSEEGVKAFKNGTRIKTYCGI  336



>ref|XP_008384915.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=318

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 196/316 (62%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSLT   LP I+F+ + +KPG+ SW++  ++   ALEEYGCFVA Y++VS+++   +F 
Sbjct  1     MGSLTLPNLPTINFSVDALKPGSSSWLSTSKQVRYALEEYGCFVAEYNQVSAQLLNNIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LF++P   KV+N S +P  GY+G   ++PLYE + ID+  + Q  Q F  LMWP G
Sbjct  61    QAKDLFEVPLENKVKNVSNEPYRGYIGPNHLMPLYEGIAIDNVTSPQETQKFKNLMWPDG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE-NE  737
               +F E    +++L +ELE  V +M+FESYG EK YES   +  +L R +KY + +E + 
Sbjct  121   KSNFCETTDSFAQLLSELEHKVEQMLFESYGSEKQYESVASANSHLLRFLKYNKPEEADR  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               L F SHTDK+F + + Q+  + GLE+K K+G DW  +  +PS  + MAGD +  WSN 
Sbjct  181   ATLRFASHTDKNFTTIVVQH-DVGGLEVKTKDG-DWINIESAPSQFLFMAGDGLQVWSNE  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RIK+  HRV   G   RYS+  F+F     IQ P ELVD  HPL + P D L Y+ F S+
Sbjct  239   RIKACDHRVKHCGDKTRYSLGLFTF-NNGKIQVPEELVDERHPLLYNPLDSLEYIRFHSR  297

Query  376   EENRRLPCALKTYCGV  329
              E R L   +KT+CGV
Sbjct  298   GEARNLVSPVKTFCGV  313



>ref|XP_006301978.1| hypothetical protein CARUB_v10022458mg [Capsella rubella]
 gb|EOA34876.1| hypothetical protein CARUB_v10022458mg [Capsella rubella]
Length=320

 Score =   273 bits (697),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 205/315 (65%), Gaps = 9/315 (3%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             LP++DF+++ + PGT  W+  R     A+EE G FVA +D V+S++ + +F G+ E++DL
Sbjct  9     LPILDFSRDKLMPGTSHWITTRDNVRKAMEEQGWFVAEFDGVTSDLRDSLFTGMKEMYDL  68

Query  1069  PTNVKVENKSTKPLYGYVGQ-IPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             P  +K++N++ K  +GY+   +    ++ES+GID+A  LQ  + F+KL+WPQGND FS++
Sbjct  69    PYEIKIKNENHKVSHGYMSMVVDDYRIHESLGIDYATELQACKDFSKLLWPQGNDPFSQS  128

Query  892   MLVYSKLAAELEEMVVRMVFESYGVE--KYYESHVKSACYLARVMKYREAQENEPKLGFV  719
               VY+   AE+E+ V+RM++ESYG++  K+  SH +S  YL R++ YR  +  E   GFV
Sbjct  129   THVYATALAEIEQKVMRMLYESYGMDEKKHSASHSESTRYLLRMLSYRRQRNGEANTGFV  188

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
             SHTDKSFMS ++QN H+ GL +K    D W G   SP+  VV++G  + AWSN+RIK+ +
Sbjct  189   SHTDKSFMSILHQN-HVGGLHLKTMT-DQWVGFKPSPTRFVVLSGMGLTAWSNDRIKACY  246

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V+M     RYS+  FSF + T I+TP ELVD  HPL++ PFDH   L F+    N   
Sbjct  247   HKVVMSADEVRYSLGFFSFHKGT-IRTPEELVDDQHPLRYNPFDHDGLLRFYESYLNSLK  305

Query  358   PCA---LKTYCGV*P  323
               +   L+ YCGV P
Sbjct  306   KSSEDLLQVYCGVDP  320



>ref|XP_011072272.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Sesamum indicum]
Length=246

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 174/247 (70%), Gaps = 3/247 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL    LP I F+ ++++PG+ +W++  ++ V ALE+YGCF A Y K S  +H+ +F+
Sbjct  1     MGSLVNPTLPTIHFSGKNLEPGSTAWMSTSKDVVRALEDYGCFAATYSKFSLGMHKAIFR  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELFDLPTNVKV+N S  P +GYVGQ PI+PLYE +GI++A T +G++ FT L+WP G
Sbjct  61    CSEELFDLPTNVKVQNTSDTPSHGYVGQEPIIPLYEGLGIENATTREGVKKFTNLLWPSG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             ND F E  L YS+L AEL+++V+RMV ESYG+E  YES + +  YL R++KYR+ ++ E 
Sbjct  121   NDRFCETALEYSRLVAELDQVVMRMVSESYGIESSYESLLGATSYLLRIIKYRKPEKGEN  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIM-AWSNN  557
              LG V HTDKSFM+ I+Q C +NGLEIK K+G DW  V  SPSS +VMAGDA M  W N 
Sbjct  181   GLGIVPHTDKSFMTIIHQ-CQVNGLEIKTKDG-DWITVDPSPSSFIVMAGDAWMDKWKNR  238

Query  556   RIKSPHH  536
                S  H
Sbjct  239   TFNSQGH  245



>ref|XP_009375959.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Pyrus 
x bretschneideri]
Length=318

 Score =   272 bits (696),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 195/316 (62%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSLT  KLP I+F+ + +KPG+ SW++  ++   ALEEYGCFVA YD+VS+++   +F 
Sbjct  1     MGSLTLPKLPTINFSVDALKPGSSSWLSTSKQVRYALEEYGCFVAQYDQVSAQLLNNIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LF++P   KV+N S +P  GY+G   ++PLYE + ID   + Q  Q F  LMWP G
Sbjct  61    QAKDLFEVPLENKVKNVSDEPYRGYIGPNHLMPLYEGIAIDKVTSPQETQKFKNLMWPDG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE-NE  737
               +F E    +++L +ELE  V +M+FESYG EK YES   +  +L R +KY + +E + 
Sbjct  121   KSNFCETTDSFAQLLSELEHKVEQMLFESYGAEKQYESVASANSHLLRFLKYNKPEEADR  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               L F SHTDK+F + + Q+  + GLE+K K G +W  +   PS  + MAGD +  WSN+
Sbjct  181   AALRFASHTDKNFTTIVVQH-DVGGLEVKTKYG-NWINIESVPSQFLFMAGDGLQVWSND  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RIK+  HRV   G   RYS+  F+F     IQ P ELVD  HPL + P D L Y+ F S+
Sbjct  239   RIKACDHRVKHCGDKTRYSLGLFTF-NNGKIQVPEELVDETHPLLYNPLDSLEYIRFHSR  297

Query  376   EENRRLPCALKTYCGV  329
              E R L   +KT+CGV
Sbjct  298   GEARNLVSPVKTFCGV  313



>gb|KHN06108.1| Gibberellin 3-beta-dioxygenase 3 [Glycine soja]
Length=313

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/308 (44%), Positives = 197/308 (64%), Gaps = 6/308 (2%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             LPV+DF  E+MKPGTD+W+ A +      E+YGCF+A + KV  E+   V+  + ELF L
Sbjct  11    LPVVDFINENMKPGTDTWLGACQLVRRGFEDYGCFLARFSKVGPELLNSVYYAMEELFSL  70

Query  1069  PTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEAM  890
             P   K    S KP +GY GQ+P  PL+ES  ID+ ++++  Q F ++MWP GND   E++
Sbjct  71    PLETKRRKTSDKPNHGYTGQVPTSPLFESFAIDNPSSIEDCQKFARIMWPTGNDHLCESV  130

Query  889   LVYSKLAAELEEMVVRMVFESYGVEKY-YESHVKSACYLARVMKYREAQENEPKLGFVSH  713
               Y+K+  EL++ V RMVF+SYG++K   ES ++S  Y  R  KY+    +E  +G  SH
Sbjct  131   NEYTKMLKELDQTVKRMVFDSYGLDKLKCESFLESTNYAFRSYKYKIPATDESSVGVNSH  190

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TD +F++ ++Q   ++GLE+K K+G +WFGV  SP    VMAGDA M WS+ RI++  HR
Sbjct  191   TDSTFITILHQ--RVDGLEVKLKDG-EWFGVDASP-LFCVMAGDAFMVWSSERIRACEHR  246

Query  532   VMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPC  353
             V+++ K  RYS+   S+  K M+QT  +LVD DHP+++KPFDH  Y+ F   EE  +   
Sbjct  247   VILKAKVTRYSLGLLSYSSK-MVQTLEDLVDEDHPIRYKPFDHYAYVGFRFTEEAVKYTS  305

Query  352   ALKTYCGV  329
              +KTY G+
Sbjct  306   RIKTYSGI  313



>ref|XP_004293154.1| PREDICTED: gibberellin 3-beta-dioxygenase 4-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 199/317 (63%), Gaps = 5/317 (2%)
 Frame = -2

Query  1273  MGSLT-PLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVF  1097
             MGS+T P ++P I+F+ +D+KPG+ SW +  ++  +ALEEYGCFVALY +VS E+ + +F
Sbjct  1     MGSMTLPKEIPTINFSLQDLKPGSSSWTSTCKQVRNALEEYGCFVALYPQVSQELMDNIF  60

Query  1096  KGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
                 +LF++P   KV+N S +P  GY+G  P++PLYE + ID+  + Q  Q F  LMWP 
Sbjct  61    GQSRDLFEVPLENKVKNTSEEPYRGYIGPNPLLPLYEGIAIDNVTSPQETQKFRDLMWPN  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQEN  740
             G   F E   +++KL  ELE  V +M+FESYG+  + YE+   S  +L R +KY+  +E 
Sbjct  121   GKTQFCEITDLFAKLLGELENTVEKMIFESYGIPLEQYETLASSNSHLLRFLKYKIPEER  180

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
             +  L F SHTDK+F + I Q+  + GLE++ K+G DW  V  + S  + MA D +  WSN
Sbjct  181   DAALRFPSHTDKNFTTIIVQH-DVGGLEVQTKDG-DWISVESASSQFLFMACDELQVWSN  238

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             +R+K+PHHRV   G   RYS+  F+F    + + P ELVD  HPL +  FD L ++ F++
Sbjct  239   DRVKAPHHRVKHCGDKTRYSLGMFTF-NNGVFEVPKELVDDSHPLLYNQFDSLGFVRFYT  297

Query  379   KEENRRLPCALKTYCGV  329
               E ++    +K YCGV
Sbjct  298   TPEAKKAESPIKAYCGV  314



>ref|XP_002515914.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF46334.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=314

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/316 (43%), Positives = 192/316 (61%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  KLP IDF+  ++KPG   W   + +   A EEYGCF AL+  +S E+ + +  
Sbjct  1     MGSETTFKLPAIDFSSTELKPGNPLWETVKSQVRKAAEEYGCFEALFQDISQELRKAMDG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L E+F LP  +K  N S +P +GY+G    + LYES+G D  +    ++SFT +MWPQG
Sbjct  61    ALEEIFALPLEIKKLNVSDRPFHGYIGSSSPLSLYESIGFDDPDNFHKVESFTNIMWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N +FS  +  +SK   EL++M+ +M+ ES+G+EKY + H+ SA  + RV KY   +  + 
Sbjct  121   NINFSTTVHSFSKTLTELDQMIRKMIVESFGMEKYLDEHMNSAYNIFRVTKYAAPETTDK  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
             K G  +HTDK+  S +YQN  I+GLEI+ K+G +W  V  SP S +V+ G+++ AW+N R
Sbjct  181   KTGLRAHTDKNTTSILYQN-QIDGLEIQTKDG-EWINVEFSPYSFIVIIGESLNAWTNGR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSF-MEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             + SP HRVMM G   RYS   F+   E  +I+   ELVD +HPLQFKPF++L YL     
Sbjct  239   LHSPCHRVMMSGSKTRYSAVLFTVPKEGYVIKAVEELVDDEHPLQFKPFEYLEYLKLRYA  298

Query  376   EENRRLPCALKTYCGV  329
             E  +     LK Y G 
Sbjct  299   EVGKNFESPLKAYFGA  314



>emb|CDP10138.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 191/316 (60%), Gaps = 3/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS +   LP++ FT+E +KPGT SW++  ++   ALE++ CF+A Y+++ SE+   +F 
Sbjct  1     MGSQSQANLPIVYFTRETLKPGTGSWLSTCKKVRDALEKHSCFLAQYERIPSELISAIFL  60

Query  1093  GLVELFDLPTNVKVEN-KSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
              L ELFDLPT  KV+N  +T  L+GY GQ P  P YE MGI+  N  + +  FT LMWP 
Sbjct  61    QLGELFDLPTETKVQNITTTDGLFGYFGQQPTNPTYEGMGIEDVNNPEAVLKFTNLMWPS  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GND F E M  Y    ++LE++V+R +FES+GVEK Y SH +S   + R  K+R  Q +E
Sbjct  121   GNDSFCELMESYKNHVSDLEKLVMRTIFESFGVEKLYSSHDESCNRMLRFNKHRPPQMSE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
                G   HTD +F++ I +N   + LE+K+K    W  V   PSS +VMAGD ++AWSN 
Sbjct  181   NLGGVPEHTDPTFVTIIQRN-QYSSLEVKSKEDGSWIAVDFPPSSFLVMAGDCLVAWSNG  239

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             R+ S  HR+ M     R+S A FS+    M+  P ELVD +HPLQFKPFD + +  F   
Sbjct  240   RVHSTVHRIRMRPGETRFSTALFSY-HSGMVHVPEELVDDEHPLQFKPFDQMGFFRFTFA  298

Query  376   EENRRLPCALKTYCGV  329
                      +K YCG+
Sbjct  299   YYPLSDESKIKAYCGI  314



>ref|XP_003547720.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2-like [Glycine max]
Length=312

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 200/316 (63%), Gaps = 5/316 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S T  +LPV+DFT +++KPGTD+WV+A +    ALE++G F+ALYDKVS E ++ V+ 
Sbjct  1     MESQTQSELPVVDFTNKNLKPGTDAWVSASQVVRGALEDHGGFLALYDKVSLETYDSVYS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              ++  FDL    K    + KP++ Y GQ P +PLYES+GI +  + Q  Q +T +MWPQ 
Sbjct  61    EMMNFFDLSIETKRRKTTEKPIFSYSGQRPGIPLYESVGIMNPLSFQDCQKYTHVMWPQE  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQENE  737
             N  F E++  Y+K   EL+ +V RMVFESYG+E K +E+ ++S  Y+ R  KYR  +E E
Sbjct  121   NHHFCESVNSYAKQLVELDHIVKRMVFESYGLETKKFETLLESTEYVLRGYKYRIPREGE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               LG   H D +F++ +  N  + GL +K K+G  W  V  SPS  +VM GDA+M WSN+
Sbjct  181   SNLGVAPHCDTAFLTIL--NQKVEGLGVKLKDG-KWLEVGASPSLYLVMGGDALMVWSND  237

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI +  HRV+M  K  RYS+   S+  K M +   ELVD ++PL++KPFDH  YL FF  
Sbjct  238   RIPACEHRVLMNSKIDRYSMGLLSYAAKIM-EPQEELVDEEYPLRYKPFDHYGYLRFFLT  296

Query  376   EENRRLPCALKTYCGV  329
             EE  +    +K YCG+
Sbjct  297   EEAIKSDSRIKAYCGI  312



>ref|XP_008447674.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Cucumis melo]
Length=395

 Score =   273 bits (698),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 178/263 (68%), Gaps = 3/263 (1%)
 Frame = -2

Query  1111  HERVFKGLVELFDLPTNVKVENKSTKPLYGYV-GQIPIV-PLYESMGIDHANTLQGIQSF  938
             +E +FKGL ELFD P   K++N S KP +G++  + P V PL++S+GI++A++ + +QSF
Sbjct  134   YEEIFKGLKELFDFPLETKMKNVSDKPYHGFLDSRAPFVLPLHQSLGIENASSYEAVQSF  193

Query  937   TKLMWPQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKY  758
               L+WP GN  F E +  YSK   E+E++V RMVFESYGV KY +SH+ S  YL R MKY
Sbjct  194   VNLLWPSGNHHFCENLFAYSKKITEMEQLVKRMVFESYGVGKYTDSHIASTTYLLRTMKY  253

Query  757   REAQENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDA  578
             R  +  E  +G  +HTDKSF + ++Q   +NGL+IK KN D W GVH SP+  +VMAGDA
Sbjct  254   RIPKMGEENIGAEAHTDKSFFTILHQFDGVNGLQIKPKNYDQWLGVHFSPNYFLVMAGDA  313

Query  577   IMAWSNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLH  398
              +AWSN RI S  HRV++EG   RYS A FS+  K +I+ P ELVD  HPL+FKPF+H  
Sbjct  314   CLAWSNGRIHSATHRVIIEGNKERYSTALFSY-HKGIIEIPQELVDDKHPLRFKPFNHYG  372

Query  397   YLDFFSKEENRRLPCALKTYCGV  329
              L +FS ++  ++P     YCGV
Sbjct  373   LLGYFSTDDCDKMPSTANAYCGV  395



>ref|XP_006367749.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=315

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/312 (43%), Positives = 194/312 (62%), Gaps = 5/312 (2%)
 Frame = -2

Query  1255  LKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELF  1076
             +KLP IDF++ED+K  T  W   + +   AL EYGCF A +DK+   + + +F+ L ++F
Sbjct  6     IKLPKIDFSQEDLKTDTLVWNQVKSQVHKALVEYGCFEASFDKIPIHLRKSIFESLQQIF  65

Query  1075  DLPTNVKVENKSTKPLYGYVGQ--IPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDF  902
             DLP   K+EN STKP +GY+     P  PL+ESM +D AN     + F +++WPQGN  F
Sbjct  66    DLPLQTKLENISTKPFHGYISSKTFPSFPLFESMCVDDANIPGKAEKFAQILWPQGNPSF  125

Query  901   SEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGF  722
              + +  YS+  +EL++ V RMV ES G+EKY + H+ S  ++ R++KY   Q +E ++G 
Sbjct  126   CKTVQSYSEQLSELDQTVRRMVLESLGLEKYMDEHMNSTNFVLRLLKYNTPQSSESEIGI  185

Query  721   VSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSP  542
              +HTD+S  + +YQN  INGL++  K+G  W  V  +  +  VM GD++ AW+N R+ +P
Sbjct  186   SAHTDRSIATILYQN-EINGLQVMTKDG-QWINVEPTQDTFTVMIGDSLHAWTNGRMHAP  243

Query  541   HHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENR  365
             +HRVMM G   RYS A FS  +    I+ P ELVD +HPL +K FD   +L F   EE  
Sbjct  244   YHRVMMRGNKARYSAALFSLPKGGYTIKAPRELVDEEHPLLYKSFDLHEFLAFSYTEEGM  303

Query  364   RLPCALKTYCGV  329
             R   ALKTYCG+
Sbjct  304   RCEFALKTYCGL  315



>ref|XP_010061956.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW69002.1| hypothetical protein EUGRSUZ_F02562 [Eucalyptus grandis]
Length=313

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 199/310 (64%), Gaps = 5/310 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             ++PVI F++E  KPGT SW  A +  V ALE++GCF+  +  V   +H+  F    +L D
Sbjct  4     QIPVITFSEECTKPGTSSWEKACKVIVQALEDHGCFIVEHPNVPLGLHDSAFSVTEDLLD  63

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LP   K++N + KP +GY+ ++P  PL E M ID    L+  + FT LMWP GND F + 
Sbjct  64    LPHETKIKNTNLKPSHGYIAKVPGTPLLEGMNIDGVEKLEECEKFTSLMWPSGNDHFCKT  123

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
             +  Y KL  E+E++V RMV ESYGVEK Y+ ++KS  YL R +KY++  + +  +  V+H
Sbjct  124   VHDYGKLMVEIEKVVFRMVCESYGVEKCYDPYIKSCTYLLRFLKYKKPADLDTSVNPVAH  183

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TDKSF+S ++QN +I GLE++ K+G +WF    S S+ +VMAGDA +AWSN RIK+ +HR
Sbjct  184   TDKSFLSYLHQN-NIRGLEVRTKDG-EWFAFEPSASTFMVMAGDACVAWSNGRIKACYHR  241

Query  532   VMM-EGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENR-RL  359
             V++ E    RY +  FS++   MI+TP E +D  HP Q+KPF+H+ +L ++       + 
Sbjct  242   VLVREQNQVRYCLGTFSYV-PGMIETPKEFIDEAHPQQYKPFNHIDFLRYYDSSNGPIKA  300

Query  358   PCALKTYCGV  329
                +KT+CGV
Sbjct  301   ESLIKTFCGV  310



>ref|XP_003553825.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=313

 Score =   269 bits (688),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/308 (44%), Positives = 197/308 (64%), Gaps = 6/308 (2%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             LPV+DF  E+MKPGTD+W+ A +      E+YGCF+A + KV  E+   V+  + ELF L
Sbjct  11    LPVVDFINENMKPGTDTWLGACQLVRRGFEDYGCFLARFSKVGPELLNSVYYAMEELFSL  70

Query  1069  PTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEAM  890
             P   K    S KP +GY GQ+P  PL+ES  ID+ ++++  Q F ++MWP GND   E++
Sbjct  71    PLETKRRKTSDKPNHGYTGQVPTSPLFESFAIDNPSSIEDCQKFARIMWPTGNDHLCESV  130

Query  889   LVYSKLAAELEEMVVRMVFESYGVEKY-YESHVKSACYLARVMKYREAQENEPKLGFVSH  713
               Y+K+  EL++ V RMVF+SYG++K   ES ++S  Y  R  KY+    +E  +G  SH
Sbjct  131   NEYTKMLKELDQTVKRMVFDSYGLDKLKCESFLESTNYAFRSYKYKIPATDESSVGVNSH  190

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TD +F++ ++Q   ++GLE+K K+G +WFGV  SP    VMAGDA M WS+ RI++  HR
Sbjct  191   TDSTFITILHQ--RVDGLEVKLKDG-EWFGVDASP-LFCVMAGDAFMVWSSERIRACEHR  246

Query  532   VMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPC  353
             V+++ K  RYS+   S+  K M+QT  +LVD +HP+++KPFDH  Y+ F   EE  +   
Sbjct  247   VILKSKVTRYSLGLLSYSSK-MVQTLEDLVDEEHPIRYKPFDHYAYVGFRFTEEAVKYTS  305

Query  352   ALKTYCGV  329
              +KTY G+
Sbjct  306   RIKTYSGI  313



>ref|XP_006416895.1| hypothetical protein EUTSA_v10008198mg [Eutrema salsugineum]
 gb|ESQ35248.1| hypothetical protein EUTSA_v10008198mg [Eutrema salsugineum]
Length=324

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 137/330 (42%), Positives = 206/330 (62%), Gaps = 16/330 (5%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MG     +LP+I+ + +++K  T+ W + R     A+E +G FVA Y++  +++H+ + +
Sbjct  1     MGGNETRELPIINLSDKNLKQDTELWNSTRDSVREAMEHHGWFVAEYNRFPTQLHQSILE  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYV-----GQIPIVPLYESMGIDHANTLQGIQSFTKL  929
                EL DLP  +K++N++ K  +GY+     GQ    P++E +GID  N +Q  + F++L
Sbjct  61    AAKELLDLPPEIKIKNENRKAGHGYITMNSDGQ----PVHEGLGIDQVNDIQQCRRFSRL  116

Query  928   MWPQG---NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKY  758
             MWP     ND F E +  Y+K+ AELE++V+RM+FESY +E+Y + H+K + YL R++KY
Sbjct  117   MWPNNDHDNDRFCETIHAYAKMQAELEQLVIRMLFESYNLERYADKHMKGSRYLLRLLKY  176

Query  757   REAQENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDA  578
             +     EP   F+ HTDKSF+S ++QN HINGL +K+   D W+    SP+   V+AGDA
Sbjct  177   KSLPNGEPNRMFMCHTDKSFISILHQN-HINGLMLKSDKEDVWYPFTPSPTRFAVIAGDA  235

Query  577   IMAWSNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLH  398
             IMAWSN+RIK  +H+V ME    RYS   FSF ++ MI TP E+VD +HPL +KPF H  
Sbjct  236   IMAWSNDRIKGCYHKVEMESVETRYSFGFFSF-QQGMISTPDEMVDKNHPLAYKPFHHDG  294

Query  397   YLDFFSKEEN--RRLPCALKTYCGV*PATL  314
              LDF+   E   +      K YCG+ P +L
Sbjct  295   LLDFYETLEVHLKAHRTMTKAYCGIHPISL  324



>gb|AFK38656.1| unknown [Lotus japonicus]
Length=317

 Score =   269 bits (688),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 144/321 (45%), Positives = 201/321 (63%), Gaps = 10/321 (3%)
 Frame = -2

Query  1273  MGSLT--PLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERV  1100
             MGS T   + LPVIDF+ E +KPGT  WV+  +   SA+E++G F+ALYDKV   +++ V
Sbjct  1     MGSQTESQVPLPVIDFSDEHLKPGTHKWVSTCQAVRSAMEDHGGFLALYDKVDPLLYDSV  60

Query  1099  FKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP  920
             F  +  LFDLP+  K +  + KP++ Y  Q P +PLYES+ ID+A +    Q +T +MWP
Sbjct  61    FSAMKRLFDLPSETKGQKTTDKPIFSYAAQCPNIPLYESIAIDNAVSAGDCQKYTTIMWP  120

Query  919   QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQE  743
             QGND FSE++  Y+K  AEL+ +V +MVFESYGV+ + +ES   S  Y+ R  KYR    
Sbjct  121   QGNDHFSESVNSYAKKVAELDYIVKKMVFESYGVDNQKHESMHASTDYVLRCYKYRTPLV  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              E  +G + HTD  F++ +  N  +NGLEIK ++G  WF V  SPS   V+AG+A+  WS
Sbjct  181   GETNIGVLPHTDSGFLTIL--NQRLNGLEIKLQDG-KWFPVEASPSMFAVLAGEALTVWS  237

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
             N+RI +  HRV M  K  RYS+   S+  K M +   ELVD +HPL++KPFDH  Y  F+
Sbjct  238   NDRISACLHRVFMNEKVDRYSLGLLSYAGKLM-EPQEELVDEEHPLRYKPFDHYGYPRFY  296

Query  382   SKEENRRL---PCALKTYCGV  329
               EE  +       +KTYCG+
Sbjct  297   VSEEGVKAFKNGTRIKTYCGI  317



>gb|KHN27538.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=312

 Score =   269 bits (687),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 199/316 (63%), Gaps = 5/316 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S T  +LPV+DFT +++KPGTD+WV+A +    ALE++G F+ALYDKVS E ++  + 
Sbjct  1     MESQTQSELPVVDFTNKNLKPGTDAWVSASQVVRGALEDHGGFLALYDKVSLETYDSAYS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              ++  FDL    K    + KP++ Y GQ P +PLYES+GI +  + Q  Q +T +MWPQ 
Sbjct  61    EMMNFFDLSIETKRRKTTEKPIFSYSGQRPGIPLYESVGIMNPLSFQDCQKYTHVMWPQE  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQENE  737
             N  F E++  Y+K   EL+ +V RMVFESYG+E K +E+ ++S  Y+ R  KYR  +E E
Sbjct  121   NHHFCESVNSYAKQLVELDHIVKRMVFESYGLETKKFETLLESTEYVLRGYKYRIPREGE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               LG   H D +F++ +  N  + GL +K K+G  W  V  SPS  +VM GDA+M WSN+
Sbjct  181   SNLGVAPHCDTAFLTIL--NQKVEGLGVKLKDG-KWLEVGASPSLYLVMGGDALMVWSND  237

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RI +  HRV+M  K  RYS+   S+  K M +   ELVD ++PL++KPFDH  YL FF  
Sbjct  238   RIPACEHRVLMNSKIDRYSMGLLSYAAKIM-EPQEELVDEEYPLRYKPFDHYGYLRFFLT  296

Query  376   EENRRLPCALKTYCGV  329
             EE  +    +K YCG+
Sbjct  297   EEAIKSDSRIKAYCGI  312



>ref|XP_009608401.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
tomentosiformis]
Length=313

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/323 (45%), Positives = 198/323 (61%), Gaps = 18/323 (6%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S    KLP+I+FT E++  GT  W++  +E   ALEEYGCF A+Y KVS E+ E +F 
Sbjct  1     MASQVEPKLPIIEFTDENLSSGTSCWISTSQEIRRALEEYGCFAAVYKKVSPELREAMFN  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELF LP  VK++N S    +GY G  P +PL E  GI++  TL    +F K MWP  
Sbjct  61    HCKELFQLPLEVKLQNTSDVLGFGYGGNFPNMPLAEYFGIENGGTLNSTNNFAKQMWPNA  120

Query  913   N-DDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             N D F E  L YSKL AEL++ V+RM+ ESY +EKYYE    S  YL R +KYR  + NE
Sbjct  121   NVDKFCEETLSYSKLIAELDDAVIRMMLESYSLEKYYEPVKNSCMYLMRFIKYRSPKMNE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSS---IVVMAGDAIMAW  566
               +G + H DKSFM  I  N  + GLE++ ++G +W  +  +PSS   +V +AG+   AW
Sbjct  181   INIGHLPHRDKSFMGIIDTN-QVGGLEMQTRDG-NW--ITFNPSSYKTVVFIAGEPFTAW  236

Query  565   SNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             SN R+ +P HRV+M+G   +YS+A FSFM  T ++ P EL+D ++P  FK FDH  YL +
Sbjct  237   SNGRVYAPIHRVIMKGSEDKYSLALFSFMRGT-VKIPEELIDEENPQHFKSFDHFEYLKY  295

Query  385   FS----KEENRRLPCALKTYCGV  329
              +    KE+N      +K+YCGV
Sbjct  296   CATDGWKEKN-----PIKSYCGV  313



>ref|XP_009354842.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Pyrus x bretschneideri]
Length=316

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/315 (42%), Positives = 189/315 (60%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL P +LP I+F+ ED+KPG+ SW++  ++   ALEEYG FVA YD++S E+H  +F 
Sbjct  1     MGSLAPPQLPTINFSAEDLKPGSSSWLSTAKQVRCALEEYGSFVAQYDQISPELHNNIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LF++P   KV+N   +P +GY+G  P +PLYES+ ID+  + Q    F  LMWP G
Sbjct  61    QAADLFEVPLENKVKNVGDQPYHGYMGPNPGIPLYESLCIDNVTSPQATHKFKNLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
               +FSE    + +L A+LE  V +M+F+S GV   YES      +L R +KY+  ++   
Sbjct  121   KKNFSETTDSFGQLLADLERTVGQMIFDSLGVGNEYESVACCNSHLLRFIKYKVPEDTNT  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              L F  HTD SF + + Q+  ++GLE+K K G DW  +   PS  + MA D +  WSN+R
Sbjct  181   TLRFPMHTDNSFTTIVVQH-DVSGLEVKTKEG-DWINIESVPSHFLFMAADGLQVWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             IK+  HRV   G   RYS+  F+F    +IQ P ELVD +HPL + P D   Y  F +  
Sbjct  239   IKACQHRVKHRGDKTRYSLGLFTF-NNGVIQVPKELVDDEHPLLYNPCDSRGYTRFHASA  297

Query  373   ENRRLPCALKTYCGV  329
             E+++    +K YCG+
Sbjct  298   ESKKAASRIKAYCGI  312



>gb|KDO58205.1| hypothetical protein CISIN_1g045288mg [Citrus sinensis]
Length=236

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 177/237 (75%), Gaps = 4/237 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL+  KLPV++ +KE++KPG  SW+   R+   ALEE+GCFVALYD+VS E+H  +F 
Sbjct  1     MGSLSVPKLPVVNLSKENLKPGASSWLGTSRKVREALEEFGCFVALYDEVSLELHNAIFS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVP-LYESMGIDHANTLQGIQSFTKLMWPQ  917
                ELF+LP  +K +N S KP YGY+G  P+VP +YE MG+D+ANT++G Q+FT L+WP+
Sbjct  61    AAEELFNLPIEIKEKNVSEKPYYGYLGNNPLVPAIYEGMGVDYANTIEGTQNFTNLIWPE  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN++F + ++ YS+L +ELE+MV RMVFESYGV+KYY+S ++S+ YL R+MKYR  + NE
Sbjct  121   GNENFCKTVVSYSRLVSELEQMVKRMVFESYGVDKYYDSVLESSTYLLRIMKYRCPETNE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGV-HLSPSSIVVMAGDAIMA  569
               LG   HTDKSF++ ++QN  +NGLEI+ K+G  W G    +PSS +V+AGDA + 
Sbjct  181   KNLGCDVHTDKSFITVLHQN-EVNGLEIRTKDG-CWIGFDDPTPSSFIVLAGDAFLV  235



>emb|CDO98087.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 202/319 (63%), Gaps = 8/319 (3%)
 Frame = -2

Query  1276  IMGSLTPLK--LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHER  1103
             +MGS   L+  LP+I F  E++ PG+ SW++       ALE YGCFVA+Y  +S E+H++
Sbjct  1     MMGSDQTLEKALPIIHFNSENLTPGSSSWLSTSEIVRKALESYGCFVAVYKNISPELHDK  60

Query  1102  VFKGLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMW  923
             +     ELFD+P  +KV+N S    +GY G   ++PL E +GI +A TL+  + FT L+W
Sbjct  61    MLNLSKELFDVPVEIKVQNTSDYLGFGYGGNYSVMPLIEYLGITNAATLEATKDFTNLIW  120

Query  922   PQGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
             P GND F E    Y+K   EL+ ++++MV E+YGVEK+YE  V+SA +L R +KYR  + 
Sbjct  121   PDGNDSFCETAFSYAKQLLELKNLMMQMVLENYGVEKHYELLVRSAFHLMRFIKYRTPKT  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
             NE   G   H DK+F+S +  N H+ GL+I+ K+G +W     +PS+ +V+AG+   AWS
Sbjct  181   NEINTGLRPHVDKTFLSVLAGN-HVKGLQIETKDG-EWIDFAPTPSAFLVIAGEGFTAWS  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGD-HPLQFKPFDHLHYLDF  386
             N ++ +P HRV++ G   +Y+I  FSFM  T+ Q P EL D D +PLQFKPF+++ +LD+
Sbjct  239   NGKVYAPLHRVIIGGAEEKYTIGLFSFMHGTL-QIPVELADDDQNPLQFKPFNNVAFLDY  297

Query  385   FSKEENRRLPCALKTYCGV  329
              S +       A+K +CG 
Sbjct  298   CSGD--NITARAIKDFCGT  314



>ref|XP_007162138.1| hypothetical protein PHAVU_001G127300g [Phaseolus vulgaris]
 gb|ESW34132.1| hypothetical protein PHAVU_001G127300g [Phaseolus vulgaris]
Length=314

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/308 (45%), Positives = 191/308 (62%), Gaps = 5/308 (2%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             LP+IDF+ E++K GT +W++       ALE++G F+A Y+KV   V++ VF  + +LFDL
Sbjct  11    LPIIDFSDENLKLGTQTWISTSDAVRGALEDHGGFLAHYNKVEPLVNDSVFSAMEQLFDL  70

Query  1069  PTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEAM  890
             P   K+++ + KP+Y Y GQ   +PLYESM ID+    +    +T  MWPQGND FSE +
Sbjct  71    PLETKMQHTTEKPIYSYAGQRRDIPLYESMAIDNPLNAKSCHKYTTTMWPQGNDQFSEIV  130

Query  889   LVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
               Y K  AEL+ +V RMVF SYG+E +  E  ++S  Y+ R  KYR  +  E  LG   H
Sbjct  131   NSYGKKVAELDYIVKRMVFGSYGLENEKCECLLESTDYVLRCYKYRTPEAGETNLGVHPH  190

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TD  F++ +  N  +NGLEI+ KNG +WF V  SPS   V+AGDA M WSN+RI+   HR
Sbjct  191   TDSGFLTIL--NQRLNGLEIQLKNG-EWFQVDASPSIFAVLAGDAFMVWSNDRIRGCVHR  247

Query  532   VMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPC  353
             V+M  K  RYS+   S+  K M +   +LVD +HPL++KPFD   YL FF  EE  +   
Sbjct  248   VLMNSKVERYSLGLLSYAGKVM-EPEEKLVDEEHPLRYKPFDQYGYLRFFLTEEAVKAAS  306

Query  352   ALKTYCGV  329
              +K YCG+
Sbjct  307   RIKAYCGI  314



>ref|XP_009364342.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Pyrus x bretschneideri]
Length=318

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 196/316 (62%), Gaps = 4/316 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M SLT  KLP+IDF+ + +KPG+ SW++  ++   ALEEYG FVA YD++S ++   +F 
Sbjct  1     MDSLTLPKLPIIDFSVDVLKPGSSSWLSTSKKVRYALEEYGGFVAQYDQISEQLLNDIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LF++P   KV++ S +P  GY+G   ++PLYE + ID+  + +  Q F  LMWP G
Sbjct  61    QAKDLFEVPLENKVKSVSKEPYRGYIGPNHLMPLYEGIAIDNVTSPEETQKFKNLMWPDG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE-NE  737
               +F E    +++L +ELE  V +M+FESYG EK YES   +  +L R +KY + +E + 
Sbjct  121   KSNFCETTDSFAQLLSELEHKVEQMLFESYGAEKQYESVASANSHLLRFLKYNKPEEADR  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               L F SHTDK+F + + Q+  + GLE+K K+G DW  +   PS  V +AGD +  WSN+
Sbjct  181   TTLRFASHTDKNFTTIVVQH-DVGGLEVKTKDG-DWISIESVPSQFVFLAGDGLQVWSND  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSK  377
             RIK+ HHRV   G   RYS+  F+F    +IQ P ELVD  HPL + P D L Y+ F S+
Sbjct  239   RIKACHHRVKHCGDKTRYSLGLFTF-NNGIIQVPQELVDERHPLLYNPLDSLEYIRFHSR  297

Query  376   EENRRLPCALKTYCGV  329
              E R L   + T+CGV
Sbjct  298   GEARNLVSPVNTFCGV  313



>ref|XP_003554144.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Glycine 
max]
Length=314

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 198/310 (64%), Gaps = 5/310 (2%)
 Frame = -2

Query  1255  LKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELF  1076
             L LPV+DF  E++KPGTD+WV+A      ALE++G F+ALY+KV   +++ VF  + +LF
Sbjct  9     LPLPVVDFCDENLKPGTDTWVSACDVVRGALEDHGGFLALYNKVDPLLYDSVFSAMEQLF  68

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             DLP   K+++ + KP+Y Y GQ P +PLYESM I +    +    +T +MWPQGND FSE
Sbjct  69    DLPLETKMQHTTDKPIYSYAGQRPDIPLYESMAIANPLNDKDCHEYTNIMWPQGNDQFSE  128

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQENEPKLGFV  719
             ++  Y+K   EL+ +V RMVFESY ++ K +ES ++S  Y+ R  KYR ++  E  LG  
Sbjct  129   SVNSYAKKVVELDYLVKRMVFESYELDNKKFESLLESTDYILRCYKYRTSKGGETNLGVH  188

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
              HTD  F++ + Q   +NGLEI+ K+G +WF V  SP+   V+AGDA M WSN+RI+   
Sbjct  189   PHTDSGFLTILNQK--LNGLEIQLKDG-EWFKVDASPNMFAVLAGDAFMVWSNDRIRGCV  245

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V M  K  RY +   S+  K M     ELVD +HPL++KPFDH  YL FF  EE  + 
Sbjct  246   HQVFMNSKVDRYCLGLLSYAGKVMEPE-EELVDEEHPLRYKPFDHYGYLRFFLTEEAVKS  304

Query  358   PCALKTYCGV  329
                +K YCG+
Sbjct  305   ASRIKAYCGI  314



>ref|XP_010110319.1| Protein SRG1 [Morus notabilis]
 gb|EXC25839.1| Protein SRG1 [Morus notabilis]
Length=313

 Score =   266 bits (680),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 202/317 (64%), Gaps = 6/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL   K+PVI+F +E +KPG+DSW++A ++     EEYGC   + D+   E+H  +F 
Sbjct  1     MGSLAEQKIPVINFKEEHLKPGSDSWISALKQVRYGFEEYGCLEIVCDQFPFELHNSIFD  60

Query  1093  GLVELFDLPTNVKVENKSTKP-LYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
                ++F+LP   K++  ST+P   GY+  +P +PLYES+ +D A TL+ ++ FT +MWP 
Sbjct  61    AAEDVFNLPKETKMQKTSTRPGKIGYIAGLPELPLYESIALDSATTLEEVEYFTNIMWPA  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREA-QEN  740
             GN+ F +++  +SK    L EMV RMVFE+YGVE  + S  +   Y+ R  KY+   Q N
Sbjct  121   GNNSFRDSVHSFSKRIEVLHEMVTRMVFENYGVEGLFNSFWEKRFYVCRFFKYKAPHQTN  180

Query  739   EPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSN  560
             E ++G  +HTD +F+S ++Q+  + GL+IK K+G  W  V   PSS+ V+AGD +  WSN
Sbjct  181   ESEVGIGAHTDSTFLSILHQH-QVKGLQIKTKDG-QWIDVKPKPSSLFVIAGDVLKVWSN  238

Query  559   NRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             +R++S  H+VM+     RYS   F+F+ K ++Q P EL+D ++PL++KPFDH  Y + + 
Sbjct  239   DRVRSCEHQVMVSEDKIRYSAGLFTFI-KGVMQVPEELIDDEYPLRYKPFDHAEY-NRYL  296

Query  379   KEENRRLPCALKTYCGV  329
               E+R   C +  +CG+
Sbjct  297   LSEDRDKNCPINAFCGI  313



>ref|XP_008390710.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=316

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/315 (41%), Positives = 191/315 (61%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL P +LP I+F+ ED+KPG+ SW++  ++   ALEEYG FVA YD++S E+H  +F 
Sbjct  1     MGSLAPPQLPTINFSAEDLKPGSSSWLSTAKQVRCALEEYGSFVAXYDQISPELHNNIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LF++P   KV+N   +P +GY+G  P +PLYES+ ID+  + Q    F  LMWP G
Sbjct  61    QAADLFEVPLENKVKNVGEQPYHGYMGPNPAIPLYESLCIDNVTSPQATHKFKNLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
               +FSE    + +L A+L+  V +M+F+S+GV   YES      +L R +KY+  ++ + 
Sbjct  121   KKNFSETTDSFGQLLADLDRTVGQMIFDSFGVGNEYESVACCNSHLLRFIKYKVPEDPDI  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              L F  HTD +F + + Q+  ++GLE+K K G DW  +   PS  + MA + +  WSN+R
Sbjct  181   TLRFPMHTDNNFTTIVVQH-DVSGLEVKTKEG-DWINIESVPSHFLFMAAEGLQVWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             IK+  HRV   G   RYS+  F+F    +IQ P ELVD +HPL + P D   Y  F +  
Sbjct  239   IKACQHRVKHRGDKTRYSLGLFTF-NNGVIQVPKELVDDEHPLLYNPCDSRGYTRFHASA  297

Query  373   ENRRLPCALKTYCGV  329
             E+++    +K YCG+
Sbjct  298   ESKKAASRIKAYCGI  312



>gb|KHN14925.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=314

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 197/310 (64%), Gaps = 5/310 (2%)
 Frame = -2

Query  1255  LKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELF  1076
             L LPV+DF  E++KPGTD+WV+A      ALE++G F+ALY+KV   +++ VF  + +LF
Sbjct  9     LPLPVVDFCDENLKPGTDTWVSACDVVRGALEDHGGFLALYNKVDPLLYDSVFSAMEQLF  68

Query  1075  DLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSE  896
             DLP   K+++ + KP+Y Y GQ P +PLYESM I +    +    +T +MWPQGND FSE
Sbjct  69    DLPLETKMQHTTDKPIYSYAGQRPDIPLYESMAIANPLNDKDCHEYTNIMWPQGNDQFSE  128

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQENEPKLGFV  719
             ++  Y+K   EL+ +V RMVFESY ++ K +ES ++S  Y+ R  KYR ++  E  LG  
Sbjct  129   SVNSYAKKVVELDYLVKRMVFESYELDNKKFESLLESTDYILRCYKYRTSKGGETNLGVH  188

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
              HTD  F++ + Q   +NGLEI+ K+G +W  V  SP+   V+AGDA M WSN+RI+   
Sbjct  189   PHTDSGFLTILNQK--LNGLEIQLKDG-EWLKVDASPNMFAVLAGDAFMVWSNDRIRGCV  245

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V M  K  RY +   S+  K M     ELVD +HPL++KPFDH  YL FF  EE  + 
Sbjct  246   HQVFMNSKVDRYCLGLLSYAGKVMEPE-EELVDEEHPLRYKPFDHYGYLRFFLTEEAVKS  304

Query  358   PCALKTYCGV  329
                +K YCG+
Sbjct  305   ASRIKAYCGI  314



>ref|XP_002890109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 200/321 (62%), Gaps = 8/321 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MG     +LP+I+ + +++K  T+ W + R     A+E +G FVA Y+   +E+H  + +
Sbjct  1     MGGNETRELPIINLSDKNLKQNTELWNSTRDSVRKAMEHHGWFVAEYNNFPTELHHSILE  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPI-VPLYESMGIDHANTLQGIQSFTKLMWP-  920
                EL DLP  +K++N+S K  +GY+  I    P++E +GID  N +Q  + FT+LMW  
Sbjct  61    AAKELLDLPPEIKIKNESHKARHGYITMISDGQPVHEGLGIDQVNDVQQCRRFTRLMWSD  120

Query  919   --QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQ  746
                 ND F E +  Y+K+ AELE++V+RM+FESY VEK+ + ++    YL R+MKY+   
Sbjct  121   DHHDNDRFCETVHAYAKMQAELEQLVIRMLFESYNVEKHADKYIGGTRYLLRLMKYKRLP  180

Query  745   ENEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAW  566
               EP   F+SHTDKSF+S ++QN HI GL +K++  D W+    SP+  VV+AGDAIMAW
Sbjct  181   NGEPNRKFISHTDKSFISILHQN-HITGLMLKSEKEDVWYPFTPSPTRFVVIAGDAIMAW  239

Query  565   SNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             SN+RIK+ +H+V ME    RYS+  FSF +K MI TP E+VD DHPL +KPF H   L++
Sbjct  240   SNDRIKACYHKVEMESVEMRYSLGFFSF-QKGMISTPEEMVDKDHPLAYKPFHHDGLLEY  298

Query  385   FSK--EENRRLPCALKTYCGV  329
             +       +      K +CG+
Sbjct  299   YETLGAHLKAHRTMTKAFCGI  319



>ref|XP_011045370.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
 ref|XP_011013043.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=312

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 204/318 (64%), Gaps = 9/318 (3%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  K+ V+  +KE+ +PG+ SW+AA  +   ALEEY  F  +Y + S E +  +  
Sbjct  1     MGSETASKIHVVHLSKENFEPGSSSWLAACSDIRRALEEYSFFEVVYSEPSMEFYREIIS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              L ELF+LP   K  N   K  +GY+G+I   P  E +GI++A      Q+FT LMWP G
Sbjct  61    VLEELFNLPHETKNRNTHPKLGHGYMGKISGFP--EGLGIEYATKKDECQNFTSLMWPDG  118

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
             N+ F + +  ++K+A+EL +MVVRM+FESYG++K YE  + S  YL R++KY  +Q  E 
Sbjct  119   NERFCDVIHSFTKIASELNQMVVRMLFESYGIKKDYEPFINSTNYLLRLLKYGRSQ-GET  177

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVH-LSPSSIVVMAGDAIMAWSNN  557
              +GF +H DK+F++ +YQN  + GLEI+ K G +W      S +S  V+AGD  MAWSN+
Sbjct  178   NVGFKAHMDKTFLTLLYQN-PVKGLEIRTKEG-EWITYEPSSTTSFAVIAGDVCMAWSND  235

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFS-  380
             RIKS +HRV++  +  RY++  F+F++  ++Q P ELVD +HPLQ+KPFDH   LDF+  
Sbjct  236   RIKSSYHRVVVTSEEDRYALGLFTFLDG-VVQPPEELVDDEHPLQYKPFDHQKLLDFYQS  294

Query  379   -KEENRRLPCALKTYCGV  329
               + N+R    +KTYCGV
Sbjct  295   YNDPNKRDCNIMKTYCGV  312



>emb|CDP21546.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   265 bits (676),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/307 (44%), Positives = 187/307 (61%), Gaps = 5/307 (2%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             +PVI FT E++K GT SW++  +    ALE++GCF+A+YDK  SE    VF  L E F+L
Sbjct  19    IPVIYFTTENLKLGTSSWLSTCKAVREALEDFGCFIAVYDKAESECKIDVFASLKEFFNL  78

Query  1069  PTNVKVEN-KSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             P   K+ N    K  +GY G  P  PL E++ I+ + T++ +QSF  L WP GND F E 
Sbjct  79    PMETKLLNVHPDKDAFGYFGPKPNFPLLEAISIEDSTTIEAVQSFANLAWPSGNDHFCET  138

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEPKLGFVSH  713
             +   ++  +E+  MV +M+FESYGV +Y +SH++S  YL R   YR +QE EP LG   H
Sbjct  139   ICACTRQLSEVNRMVSKMIFESYGVGRYSDSHIESTSYLFRANAYRVSQEKEPNLGISPH  198

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TD SF+S + Q+  + GL+I++K+G  W  V   PSS+ +MAGDA++AWSN R++   HR
Sbjct  199   TDTSFVSVLKQD-SVQGLQIQSKDG-TWIPVDFPPSSVAIMAGDAMLAWSNGRVRPCFHR  256

Query  532   VMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPC  353
             VM+  K  R SI  FSF    ++Q P EL D ++P QF  FDH   L F SK        
Sbjct  257   VMVTEKA-RTSIGLFSF-HTGIVQVPKELADDNYPSQFTSFDHWGLLKFRSKNPALSSNE  314

Query  352   ALKTYCG  332
              +K YCG
Sbjct  315   RVKAYCG  321



>ref|XP_008372275.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=316

 Score =   264 bits (674),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/314 (41%), Positives = 190/314 (61%), Gaps = 3/314 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL P +LP I+F+ ED+KPG+ SW++  ++   ALEEYG FVA YD++S E+H  +F 
Sbjct  1     MGSLAPPQLPTINFSAEDLKPGSSSWLSTAKQVRCALEEYGSFVAQYDQISPELHNNIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LF++P   KV+N   +P +GY+G  P +PLYES+ ID+  + Q    F  LMWP G
Sbjct  61    QAADLFEVPLENKVKNVGEQPYHGYMGPNPAIPLYESLCIDNVTSPQATHKFKNLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
               +FSE    + +L A+L+  V +M+F+S+GV   YES      +L R +KY+  ++ + 
Sbjct  121   KKNFSETTDSFGQLLADLDRTVGQMIFDSFGVGNEYESVACCNSHLLRFIKYKVPEDPDI  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              L F  HTD +F + + Q+  ++GLE+K K G DW  +   PS  + MA + +  WSN+R
Sbjct  181   TLRFPMHTDNNFTTIVVQH-DVSGLEVKTKEG-DWINIESVPSHFLFMAAEGLQVWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             IK+  HRV   G   RYS+  F+F    +IQ P ELVD +HPL + P D   Y  F +  
Sbjct  239   IKACQHRVKHRGDKTRYSLGLFTF-NNGVIQVPKELVDDEHPLLYNPCDSRGYTRFHASA  297

Query  373   ENRRLPCALKTYCG  332
             E+++    +K YCG
Sbjct  298   ESKKAASRIKAYCG  311



>ref|XP_003554143.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=310

 Score =   264 bits (674),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 200/317 (63%), Gaps = 9/317 (3%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T LKLP+IDF+ E ++  +D W + + +   AL EYGCF A++DKV  ++ + +F 
Sbjct  1     MGSETELKLPIIDFSIEYLESNSDQWESVKSQVHKALVEYGCFEAVFDKVPLDLRKAIFL  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELFDLP   K    S+KP +GYVG +    LYESMGID  +    ++S  K++WPQG
Sbjct  61    EVEELFDLPLQTKQRVVSSKPYHGYVGPLQ---LYESMGIDDVDVHDKVESLIKILWPQG  117

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
                FS+ +  +++    L++++ +M+ ES G+EKY + H+ S  YLAR+MKY+  Q NE 
Sbjct  118   KPGFSKNLQSFTEQVTRLDQIIRKMILESLGIEKYMDEHMNSTNYLARLMKYQGPQTNEA  177

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLS-PSSIVVMAGDAIMAWSNN  557
             K+G   HTDK+ ++T+ QN  I+GLE++ K+G +W     S P+S VV+ GD + AW+N 
Sbjct  178   KVGIREHTDKNILTTLCQN-QIDGLEVQTKSG-EWIKCKPSTPNSFVVVTGDTLYAWTNG  235

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             R+ +P HRVMM G   R+SI  F+  +   +I+ P ELV  +HPL FKPF    ++ F  
Sbjct  236   RVHTPAHRVMMSGNETRFSIGLFTVPKPGFIIKAPDELVTEEHPLLFKPFVQSEFMKFLR  295

Query  379   KEENRRLPCALKTYCGV  329
               E+ +   ALK YCGV
Sbjct  296   SSESTK--NALKVYCGV  310



>ref|XP_010429979.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=320

 Score =   264 bits (674),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 134/314 (43%), Positives = 203/314 (65%), Gaps = 8/314 (3%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             LP++DF+++ + PGT  W+  R +   A+EE G FVA ++ V+S++ E +  G+ E++DL
Sbjct  10    LPILDFSRDKLVPGTSHWITTRDKVRRAMEEQGWFVADFNGVTSDIREDLLTGMKEMYDL  69

Query  1069  PTNVKVENKSTKPLYGYVGQ-IPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             P  +K++N++ K  +GY+   +    ++ES+GID+A   Q  + F+KL+WPQGND FSE 
Sbjct  70    PYEIKIKNENHKVSHGYMSMVVENYRIHESLGIDYATEHQACKDFSKLLWPQGNDPFSET  129

Query  892   MLVYSKLAAELEEMVVRMVFESYGVE--KYYESHVKSACYLARVMKYREAQENEPKLGFV  719
                Y+   AELE+ V+RM++ESYG++  K+  SH +S  YL R++ YR  +  E   GFV
Sbjct  130   THKYATALAELEQRVMRMLYESYGMDEKKHSASHSESTRYLLRMLSYRRQRNGEANTGFV  189

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
             SHTDKSFMS ++QN H+ GL++K    D W     SP+  VV++G  + AWSN+RIK+ +
Sbjct  190   SHTDKSFMSILHQN-HVGGLQLKTMT-DQWVRFKPSPTRFVVLSGMGLTAWSNDRIKACY  247

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V+M     RYS+  FSF + T I+TP ELVD +HPL++ PF+H   L F+    N + 
Sbjct  248   HKVVMSADEIRYSLGFFSFHKGT-IRTPEELVDDEHPLRYNPFEHDGLLRFYESYLNLKK  306

Query  358   PCA--LKTYCGV*P  323
                  L+ YCGV P
Sbjct  307   SSEDLLQVYCGVNP  320



>ref|XP_002889297.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65556.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=320

 Score =   264 bits (674),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 201/315 (64%), Gaps = 9/315 (3%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             LP++DF+++ +  GT  W+  R     A+EE G FVA ++ VS ++ +++  G+ E++DL
Sbjct  9     LPILDFSRDKLVRGTSHWITTRDNVRRAMEEQGWFVAEFNGVSCDLRDKLLAGMKEMYDL  68

Query  1069  PTNVKVENKSTKPLYGYVGQI-PIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             P  +K++N++ K  +GY+  +     ++ES+GID A  LQ  + F KL+WPQGND F + 
Sbjct  69    PDQIKIKNENHKASHGYMSMVVDDYRIHESLGIDFATELQACKDFCKLLWPQGNDPFCQT  128

Query  892   MLVYSKLAAELEEMVVRMVFESYGVE--KYYESHVKSACYLARVMKYREAQENEPKLGFV  719
               +Y+   AEL++ V+RM+FESYG++  K+  SH +S  YL R++ YR  Q  E   GFV
Sbjct  129   THMYATAMAELDQTVMRMLFESYGMDEKKHSASHSESTRYLLRMLSYRRQQNGEANTGFV  188

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
             SHTDKSFMS ++QN H+ GL++K   G  W G + SP+  VV++G  + AWSN+RIK+ +
Sbjct  189   SHTDKSFMSILHQN-HVGGLQLKTMTG-QWVGFNPSPTRFVVLSGMGLTAWSNDRIKACY  246

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V+M     RYS+  FSF + T I+TP ELVD  HPL++ PF+H   L F+    N   
Sbjct  247   HKVVMSADEIRYSLGFFSFHKGT-IRTPEELVDDQHPLRYSPFEHDGLLRFYESYLNSLK  305

Query  358   PCA---LKTYCGV*P  323
               +   L+ YCGV P
Sbjct  306   KSSEDLLQIYCGVNP  320



>gb|KHN14924.1| Gibberellin 20 oxidase 3 [Glycine soja]
Length=310

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 200/317 (63%), Gaps = 9/317 (3%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T LKLP+IDF+ E ++  +D W + + +   AL EYGCF A++DKV  ++ + +F 
Sbjct  1     MGSETELKLPIIDFSIEYLESNSDQWESVKSQVHKALVEYGCFEAVFDKVPLDLRKAIFL  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + ELFDLP   K    S+KP +GYVG +    LYESMGID  +    ++S  K++WPQG
Sbjct  61    EVEELFDLPLQTKQRVVSSKPYHGYVGPLQ---LYESMGIDDVDVHDKVESLIKILWPQG  117

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
                FS+ +  +++    L++++ +M+ ES G+EKY + H+ S  YLAR++KY+  Q NE 
Sbjct  118   KPGFSKNLQSFTEQVTRLDQIIRKMILESLGIEKYMDEHMNSTNYLARLIKYQGPQTNEA  177

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLS-PSSIVVMAGDAIMAWSNN  557
             K+G   HTDK+ ++T+ QN  I+GLE++ K+G +W     S PSS VV+ GD + AW+N 
Sbjct  178   KVGIGEHTDKNILTTLCQN-QIDGLEVQTKSG-EWIKCKPSTPSSFVVVTGDTLYAWTNG  235

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKT-MIQTPTELVDGDHPLQFKPFDHLHYLDFFS  380
             R+ +P HRVMM G   R+SI  F+  +   +I+ P ELV  +HPL FKPF    ++ F  
Sbjct  236   RVHTPAHRVMMSGNETRFSIGLFTVPKPGFIIKAPDELVTEEHPLLFKPFVQSEFMKFLR  295

Query  379   KEENRRLPCALKTYCGV  329
               E+ +   ALK YCGV
Sbjct  296   SSESTK--NALKVYCGV  310



>ref|XP_009148950.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
 ref|XP_009148951.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
Length=324

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 205/320 (64%), Gaps = 7/320 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MG     +LPVI+ + +++KPGT+ W + R     A+E +G FVA Y+   +E+H+ V +
Sbjct  1     MGGNETQELPVINLSDKNLKPGTELWNSTRNSVREAMEHHGWFVAEYNSFPAELHKSVLE  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPI-VPLYESMGIDHANTLQGIQSFTKLMWP-  920
                EL DLP  VKV N++ K  +GY+  I    P++E +GID AN +Q  + F++LMWP 
Sbjct  61    ASKELLDLPPEVKVTNENHKAGHGYITMISDDQPVHEGLGIDQANDIQQCRQFSRLMWPD  120

Query  919   -QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
                ND F E +  Y+K+ AELE++V+RM+FESY +E+Y E H++ + YL R++KYR    
Sbjct  121   HHDNDRFCEIVNAYAKMQAELEQLVIRMLFESYNLERYTEKHIRGSRYLLRLLKYRRLPN  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              EP   F+SHTDKSF+S ++QN HI GL +K++  D W+    SP+   V+AGDAIMAWS
Sbjct  181   GEPNRKFISHTDKSFISILHQN-HITGLMLKSEKEDVWYPFIPSPTRFAVIAGDAIMAWS  239

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
             N+RIKS +H+V ME    RYS   FSF E+ MI TP E+VD DHPL +KPF+H   L F+
Sbjct  240   NDRIKSCYHKVEMESVEMRYSFGFFSFQEE-MISTPEEMVDKDHPLAYKPFNHDGLLAFY  298

Query  382   SKEEN--RRLPCALKTYCGV  329
                +   +      K YCG+
Sbjct  299   ETVDVHLKAHRTMTKVYCGI  318



>ref|XP_006339306.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=310

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 195/314 (62%), Gaps = 9/314 (3%)
 Frame = -2

Query  1255  LKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELF  1076
             +K+P IDF K ++KPGT  W + + +   AL+EYGCF A YDK+ +E  E +F    E+F
Sbjct  1     MKVPTIDFCKPELKPGTIQWDSTKSQVFQALQEYGCFEATYDKLRNETLEAMFGRSKEIF  60

Query  1075  DLPTNVKVENKSTK-PLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFS  899
             + P   K++N S K P  GY+G++P +PLYES+ ID    L+ +++F  + WP+GN    
Sbjct  61    EFPLETKMKNLSKKLPFNGYIGKLPTLPLYESVCIDDLLQLEIVETFANIFWPEGNP--Y  118

Query  898   EAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE--PKLG  725
             + +  YSK   EL+EMV RMV ES G++ Y +  +    +L R+ KY   Q+ +   KLG
Sbjct  119   KVVKSYSKPLVELDEMVKRMVLESLGLQNYIDEFLDLTSFLLRLTKYNATQDEDMGNKLG  178

Query  724   FVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKS  545
                HTD +F++ I QN  +NGL+I  KNG +W  V +S +S VV++GD+ MAW+N R+ S
Sbjct  179   IGDHTDGNFLTIISQN-QVNGLQILKKNG-EWIDVDISSNSFVVLSGDSFMAWTNGRLHS  236

Query  544   PHHRVMMEGKGPRYSIAQFSFMEK-TMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEEN  368
             P HRV M G+  R+SI  F+  +    I+ P ELVD +HPL FKP+D L Y +FF  E  
Sbjct  237   PLHRVTMAGENDRFSIQLFADPKTDCTIKAPKELVDEEHPLLFKPYDMLGYFEFFGTEAG  296

Query  367   RRL-PCALKTYCGV  329
             R   P  LK YCGV
Sbjct  297   REAGPNVLKAYCGV  310



>gb|KFK42423.1| hypothetical protein AALP_AA2G254300 [Arabis alpina]
Length=320

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 203/315 (64%), Gaps = 9/315 (3%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             LP++DF+++ + PGT  W+A R     A+EE G FVA ++ VSS + + +  G+ E++DL
Sbjct  9     LPILDFSRDKLAPGTSHWIATRDNVRKAMEEQGWFVAEFNGVSSNLRDNLLAGMKEMYDL  68

Query  1069  PTNVKVENKSTKPLYGYVGQ-IPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             P  VK++N++ K  +GY+   +    ++ES+GID+A  LQ  + F+KL+WPQGN+ F E 
Sbjct  69    PYEVKIKNENHKASHGYMSMVVDDYKIHESLGIDYATELQSCKDFSKLLWPQGNNPFCET  128

Query  892   MLVYSKLAAELEEMVVRMVFESYGVE--KYYESHVKSACYLARVMKYREAQENEPKLGFV  719
               +Y+   AEL++ V+RM++ESYG++  K+ E+H +S  YL R++ YR  Q  E   GFV
Sbjct  129   THMYAMALAELDKTVMRMLYESYGIDEKKHSENHSESTRYLLRLLSYRRQQNGEANTGFV  188

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
             SHTDKSFMS ++QN H+ GL++K    D W G + SP+  VV++G  + AWSN+RIK  +
Sbjct  189   SHTDKSFMSILHQN-HVAGLKLKTMT-DQWVGFNPSPTRFVVLSGMGLTAWSNDRIKPCY  246

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V+M     RYS+  FSF + T+  TP ELVD  +PL++ PF+H   L F+    N   
Sbjct  247   HKVVMSEDEIRYSLGFFSFHKGTIF-TPEELVDDQNPLRYNPFEHDGLLRFYETYINSMK  305

Query  358   PCA---LKTYCGV*P  323
               +   L+ YCGV P
Sbjct  306   KSSEDLLQIYCGVKP  320



>ref|XP_006348005.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
tuberosum]
Length=315

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 140/313 (45%), Positives = 196/313 (63%), Gaps = 10/313 (3%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             K+P+I+ TK D    ++SWV    E   ALEE+G F+ALY+  ++++ + +F  + ELFD
Sbjct  5     KIPIINLTKLDKY--SNSWVPLCNEVRHALEEHGYFIALYEDANNKISKEIFDVMEELFD  62

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             LP   K +N S    Y Y GQ+   PL+ES GI H N ++ +QSFT LMWPQGN  F E 
Sbjct  63    LPIETKKKNTSDIYFYRYKGQLVTAPLHESFGIPHPNDIEALQSFTTLMWPQGNQRFCET  122

Query  892   MLVYSKLAAELEEMVVRMVFESYGV-EKYYESHVKSACYLARVMKYREAQEN-EPKLGFV  719
             M  Y K+ AE+E++V +MVFESYG+ E++YESHV +  YL R  KYR A    E  +G V
Sbjct  123   MTSYIKVGAEIEQLVDKMVFESYGLPERHYESHVAATTYLLRPTKYRAAPAGAEDGIGNV  182

Query  718   S---HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIK  548
                 HTDK F + ++QN  IN L+I+ K+G +W  + + PS+ V +AGDA  AWSN RI 
Sbjct  183   GSNIHTDKGFSAVLFQN-QINALQIETKSG-EWIPIDVPPSAFVYVAGDAYEAWSNGRIY  240

Query  547   SPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEEN  368
             SP H+V+M+    RY++A F+F  K +   P ELVD  HPLQ+KPFD+   + ++S   +
Sbjct  241   SPRHKVLMKEDKERYTLALFTF-NKGITDIPEELVDETHPLQYKPFDNFDLVMYYSTGAS  299

Query  367   RRLPCALKTYCGV  329
                    K YCG+
Sbjct  300   SMAHGTAKPYCGI  312



>emb|CDY39662.1| BnaC05g11910D [Brassica napus]
Length=362

 Score =   263 bits (673),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 145/320 (45%), Positives = 201/320 (63%), Gaps = 7/320 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MG      LPVI+ + ++MKPGT+ W + R     A+E +G FVA Y+   +E+H+ V +
Sbjct  1     MGGNETQDLPVINLSDKNMKPGTELWNSTRNSVREAMEHHGWFVAEYNSFPAELHKSVLE  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVG-QIPIVPLYESMGIDHANTLQGIQSFTKLMWP-  920
                EL DLP  VKV+N++ K  +GY+       P++E +GID AN +Q  + F+ LMWP 
Sbjct  61    ASKELLDLPPEVKVKNENHKAGHGYITMSSDDQPVHEGLGIDQANDIQQCRRFSSLMWPD  120

Query  919   -QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
                ND F E +  Y+K+ AELE++V+RM+FESY +E+Y E H++ + YL R++KYR    
Sbjct  121   HHNNDRFCETVNAYAKMQAELEQLVIRMLFESYNLERYTEKHIRGSRYLLRLLKYRRLPN  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              EP   F+SHTDKSF+S ++QN HI GL +K++  D W+    SP+   V+AGDAIMAWS
Sbjct  181   GEPNRKFISHTDKSFISILHQN-HITGLMLKSEKEDVWYPFIPSPTKFAVIAGDAIMAWS  239

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
             N+RIKS +H+V ME    RYS   FSF E  MI TP E+VD DHPL +KPF H   L F+
Sbjct  240   NDRIKSCYHKVEMESVEMRYSFGFFSFQE-NMISTPEEMVDKDHPLAYKPFHHDGLLAFY  298

Query  382   SKEEN--RRLPCALKTYCGV  329
                E   +      K YCG+
Sbjct  299   ETVEVHLKAHRTMTKAYCGI  318



>ref|XP_007145557.1| hypothetical protein PHAVU_007G248700g [Phaseolus vulgaris]
 gb|ESW17551.1| hypothetical protein PHAVU_007G248700g [Phaseolus vulgaris]
Length=312

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 200/317 (63%), Gaps = 7/317 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGS T  +L V+DFT +++K GT++WV+  +   SALE++G F+ALYD +S + ++ ++ 
Sbjct  1     MGSETQSQLQVVDFTNQNLKEGTETWVSTCQVVRSALEDHGAFLALYDNISLQTYDSIYS  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
              + +LFDL T  K    + KP++ Y GQ P +PLYES GI +  + Q  Q +T +MWPQG
Sbjct  61    EMSKLFDLSTETKRRKTTEKPIFSYSGQRPSIPLYESAGIINPLSFQDCQKYTHVMWPQG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE-KYYESHVKSACYLARVMKYREAQENE  737
             N  F +++  Y+K   EL+ +V RM+FESYGVE K  ES ++S  Y+ R  KYR+ +  E
Sbjct  121   NHHFCKSVNSYAKNLVELDHIVKRMMFESYGVERKKLESLLESTEYVLRGYKYRKPEVGE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
               LG   H+D + ++ + Q   + GL +K K G +WF V +SPS  +VM GDA+M WSN 
Sbjct  181   SNLGVPPHSDTALLTILNQK--VEGLGVKLKGG-EWFEVGVSPSLYLVMGGDALMVWSNG  237

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTE-LVDGDHPLQFKPFDHLHYLDFFS  380
             RI +  HRV+++ K  RYS+   S++ K M   P E LVD +HPL++KP DH  YL FF 
Sbjct  238   RIPACEHRVLVKSKKERYSMGLLSYVNKIM--EPEEGLVDEEHPLRYKPLDHYGYLRFFI  295

Query  379   KEENRRLPCALKTYCGV  329
              EE  +    +  YCG+
Sbjct  296   TEEALKSDSRINAYCGI  312



>emb|CDY36571.1| BnaA06g10240D [Brassica napus]
Length=324

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 143/320 (45%), Positives = 205/320 (64%), Gaps = 7/320 (2%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MG     +LPVI+ + +++KPGT+ W + R     A+E +G FVA Y+   +E+H+ V +
Sbjct  1     MGGNETQELPVINLSDKNLKPGTELWNSTRNSVREAMEHHGWFVAEYNSFPAELHKSVLE  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPI-VPLYESMGIDHANTLQGIQSFTKLMWP-  920
                EL DLP  VKV N++ K  +GY+  I    P++E +GID AN +Q  + F++LMWP 
Sbjct  61    ASKELLDLPPEVKVTNENHKAGHGYITMISDDQPVHEGLGIDQANDIQQCRQFSRLMWPD  120

Query  919   -QGNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQE  743
                ND F E +  Y+K+ AELE++V+RM+FESY +E+Y E H++ + YL R++KYR    
Sbjct  121   HHDNDRFCEIVNAYAKMQAELEQLVIRMLFESYNLERYTEKHIRGSRYLLRLLKYRRLPN  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              EP   F+SHTDKSF+S ++QN HI GL +K++  D W+    SP+   V+AGDAIMAWS
Sbjct  181   GEPNRKFISHTDKSFISILHQN-HITGLMLKSEKEDVWYPFIPSPTRFAVIAGDAIMAWS  239

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
             N++IKS +H+V ME    RYS   FSF E+ MI TP E+VD DHPL +KPF+H   L F+
Sbjct  240   NDKIKSCYHKVEMESVEMRYSFGFFSFQEE-MISTPEEMVDKDHPLAYKPFNHDGLLAFY  298

Query  382   SKEEN--RRLPCALKTYCGV  329
                +   +      K YCG+
Sbjct  299   ETVDVHLKAHRTMTKVYCGI  318



>ref|XP_006389780.1| hypothetical protein EUTSA_v10018872mg [Eutrema salsugineum]
 gb|ESQ27066.1| hypothetical protein EUTSA_v10018872mg [Eutrema salsugineum]
Length=323

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/321 (42%), Positives = 203/321 (63%), Gaps = 9/321 (3%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S     +P++DF++  + PGT  W+A R +   A+EE G FVA ++ VSSE+ E +  
Sbjct  1     MDSHEEQSIPILDFSRNKLMPGTSHWIATRYKVRKAMEEQGWFVAEFNGVSSELREDLLA  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQ-IPIVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
             G+ E++DLP  VK++N++ K  +GY+   +    ++ES+GID+A   Q  + F+KL+WPQ
Sbjct  61    GMKEMYDLPYEVKIKNENHKASHGYMSMVVDDYQIHESLGIDYATEHQACKDFSKLLWPQ  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVE--KYYESHVKSACYLARVMKYREAQE  743
             GND F ++  +Y+   A L++ V+RM++ESYG++  K+   H +S+ YL R++ YR  + 
Sbjct  121   GNDPFCQSTHMYATALAGLDQTVMRMLYESYGMDEKKHSAIHSESSRYLLRLLSYRRQRN  180

Query  742   NEPKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWS  563
              E   GFVSHTDKSFMS ++QN H+ GL++K    D W G + SP+  VV++G  + AWS
Sbjct  181   GEANTGFVSHTDKSFMSILHQN-HVGGLQLKTMT-DQWVGFNPSPTRFVVLSGMGLTAWS  238

Query  562   NNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFF  383
             N+RIK  +HRV+M  +  RYS+  FSF  K  I+TP ELVD  HPL++ PF+H   L F+
Sbjct  239   NDRIKPCYHRVVMSAEEIRYSLGFFSF-NKGTIRTPEELVDAQHPLRYNPFEHDGLLRFY  297

Query  382   SKEENRRLPCA---LKTYCGV  329
                 N     +   L  +CGV
Sbjct  298   ESYLNSLKKSSEDLLHIFCGV  318



>ref|XP_010472950.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=321

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 201/315 (64%), Gaps = 9/315 (3%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             LP++DF+++ + PGT  W+  R +   A+EE G FVA ++ V+S++ E +  G+ E++DL
Sbjct  10    LPILDFSRDKLVPGTSHWITTRDKVRRAMEEQGWFVAEFNGVTSDIREDLLTGMKEMYDL  69

Query  1069  PTNVKVENKSTKPLYGYVGQ-IPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             P  +K++N++ K  +GY+   +    ++ES+GID+A   Q  + F+KL+WPQGND FSE 
Sbjct  70    PYEIKIKNENHKVSHGYMTMVVEDYRIHESLGIDYATEHQACKDFSKLLWPQGNDPFSET  129

Query  892   MLVYSKLAAELEEMVVRMVFESYGVE--KYYESHVKSACYLARVMKYREAQENEPKLGFV  719
                Y+   AELE+ V+RM++ESYG++  K+  SH +S  YL R++ YR  +  E   GFV
Sbjct  130   THKYATAVAELEQRVMRMLYESYGMDEKKHSASHSESTRYLLRMLSYRRQRNGEANTGFV  189

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
             SHTDKSFMS ++QN H+ GL +K    D W     SP+  VV++G  + AWSN+RIK  +
Sbjct  190   SHTDKSFMSILHQN-HVGGLHLKTMT-DQWVRFKPSPTRFVVLSGMGLTAWSNDRIKPCY  247

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V+M     RYS+  FSF + T I+TP ELVD +HPL++ PF+H   L F+    N   
Sbjct  248   HKVVMSADEIRYSLGVFSFHKGT-IRTPEELVDEEHPLRYNPFEHDGLLRFYESYLNSLK  306

Query  358   PCA---LKTYCGV*P  323
               +   L+ YCGV P
Sbjct  307   KSSEDLLQVYCGVNP  321



>emb|CDP21180.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/312 (46%), Positives = 198/312 (63%), Gaps = 7/312 (2%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             KLPVI+F KE ++ GT+ W  AR E   ALEE GCF+A+YD VS ++ + VF  L +LFD
Sbjct  8     KLPVINFGKEKLQHGTNGWSFARNEVRHALEECGCFLAVYDAVSFKLRDSVFSALEKLFD  67

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDD-FSE  896
             LP   K +N S + L+GY         +ESMGI+++  ++ ++  +KL+WPQGNDD FS 
Sbjct  68    LPVETKKKNTSDRDLFGYFSIDGDSSNHESMGIENSTDIEEVKKLSKLVWPQGNDDNFSG  127

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKYY-ESHVKSACYLARVMKYREAQENEPKLGFV  719
              +   + L +ELEE+V+RMV+ESYGVEK   +SH+ S  +L R  +Y     +E  +   
Sbjct  128   IIHECANLMSELEEVVIRMVYESYGVEKLKCDSHLDSNMHLLRFNRYISHGVDEKTVSSN  187

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
             +HTDK+F++ + +N   NGLE+K K+G  W  V   PSS VVMAG+A MAWSN+RI+   
Sbjct  188   AHTDKTFITILTEN-RENGLEVKLKDG-QWIPVDFLPSSFVVMAGEAAMAWSNSRIQPCF  245

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             HRV+      R S+  FSF  K +I  P EL+D +HP +FK FD+L  LDFF +E+   L
Sbjct  246   HRVLTNANAKRLSLGLFSF-NKGVIHIPQELIDDEHPQRFKSFDNLALLDFFLEEKRMGL  304

Query  358   PC--ALKTYCGV  329
             P     K YCG+
Sbjct  305   PTDSTTKKYCGL  316



>ref|XP_009802367.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
sylvestris]
Length=313

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/323 (44%), Positives = 198/323 (61%), Gaps = 18/323 (6%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S    KLP+I+FT E++  GT SW++  +E   ALEEYGCF A+Y KVS E+ E +F 
Sbjct  1     MASQVEPKLPIIEFTDENLSSGTTSWISTSQEIRRALEEYGCFAAVYKKVSPELREAMFN  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                ELF LP   K++N S    +GY G  P +PL E  GI++  TL   ++F K MWP G
Sbjct  61    HCKELFQLPLEAKLQNTSDVLGFGYGGNFPNMPLAEYFGIENGGTLGSTKNFAKQMWPNG  120

Query  913   N-DDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             N D F E  + YSKL  EL++ V++M+  SYG+EKYY+    S  YL R +KYR  + +E
Sbjct  121   NVDKFCEETISYSKLIVELDDAVIQMILGSYGLEKYYDPLKNSYMYLMRFIKYRSPKIDE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSS---IVVMAGDAIMAW  566
               +G + H DKSFM  I  N  + GLE++ ++G +W  +  +PSS   +V +AG+   AW
Sbjct  181   INIGHLPHRDKSFMGIIDTN-QVGGLEMQTRDG-NW--MTFNPSSYKTVVFIAGEPFTAW  236

Query  565   SNNRIKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDF  386
             SN R+ +P HRV+M+G   +YS+A FSFM  T ++ P EL+D ++P  FK FDH  YL +
Sbjct  237   SNGRVYAPMHRVIMKGTDDKYSLALFSFMRGT-VKIPEELIDEENPQYFKSFDHFEYLKY  295

Query  385   FS----KEENRRLPCALKTYCGV  329
              +    KE+N      +K YCGV
Sbjct  296   CATDGWKEKN-----PIKAYCGV  313



>ref|XP_002515925.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF46345.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=316

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 186/296 (63%), Gaps = 4/296 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             M S   L LP+IDF+  D++PGT +W   + +   A EEYGCF AL++K+  E+ +    
Sbjct  1     MDSENFLSLPMIDFSNSDLRPGTATWDLVKSQVRKAAEEYGCFQALFNKIPEEIQKATNG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIP-IVPLYESMGIDHANTLQGIQSFTKLMWPQ  917
              L ELF LP   K  N S KP +GY+G     V LYES+GI   +  + +++F  ++WP+
Sbjct  61    ALEELFQLPLETKKCNVSEKPFHGYLGSSSSAVSLYESLGIVEPDIYEKVENFINVLWPE  120

Query  916   GNDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENE  737
             GN   S+ +  +S+   EL++++ RM+ ES GVEKY E H+KS  Y  RV KY+  Q  E
Sbjct  121   GNVKVSKILHSFSEPVLELDQIIRRMIVESLGVEKYLEEHMKSTYYFLRVAKYQTPQTTE  180

Query  736   PKLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNN  557
              K G  +HTDK+ ++  YQN  ++GLEI+ +NG DW  V  SP+S+V++ G+++ AW+N 
Sbjct  181   KKTGLRAHTDKNTLTIFYQN-QVDGLEIQTRNG-DWIPVKFSPNSLVILFGESLKAWTNG  238

Query  556   RIKSPHHRVMMEGKGPRYSIAQFSF-MEKTMIQTPTELVDGDHPLQFKPFDHLHYL  392
             R+ SP HRVMM G  PRYS   FS   E  +I+   ELVD DHPLQ+ PFD+  YL
Sbjct  239   RLYSPFHRVMMAGSEPRYSAVFFSVPKEGYIIKALEELVDEDHPLQYNPFDYSEYL  294



>ref|XP_007145555.1| hypothetical protein PHAVU_007G248500g [Phaseolus vulgaris]
 gb|ESW17549.1| hypothetical protein PHAVU_007G248500g [Phaseolus vulgaris]
Length=309

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/308 (42%), Positives = 197/308 (64%), Gaps = 6/308 (2%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             LPV+DF+ E+MKPGTD+W+AA +      E++GCF+A ++KV+ ++   +F  + +LF L
Sbjct  7     LPVVDFSTENMKPGTDTWLAACQMVRRGFEDHGCFLANFNKVTPKLLNSLFSAMEQLFGL  66

Query  1069  PTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEAM  890
             P   K    S KP +GY GQ+P  PL+ES  I + + +Q  Q F+++MWP GN    E++
Sbjct  67    PVETKRRKTSDKPNHGYTGQVPTSPLFESFAIHNPSNIQDCQKFSRVMWPTGNHQLCESV  126

Query  889   LVYSKLAAELEEMVVRMVFESYGVEKY-YESHVKSACYLARVMKYREAQENEPKLGFVSH  713
               Y+KL  EL++ V RMVF+SYG++K   E  ++S  Y  R  KY+    +E  +G  SH
Sbjct  127   NEYAKLLQELDQSVKRMVFDSYGLDKVKCEMFLESTDYSFRSYKYKIPAVDESNVGVNSH  186

Query  712   TDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPHHR  533
             TD +F++ ++Q   ++GLE++ K+G +WFG+  SP    V+AGDA M WS+ RI++  HR
Sbjct  187   TDSTFITILHQ--RVDGLEVQLKDG-EWFGIDASP-LFCVIAGDAFMVWSSERIRACEHR  242

Query  532   VMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRLPC  353
             V++  K  RYS+   S+  K M+QT  +LVD +HP+++KPFDH  Y+ F   EE  +   
Sbjct  243   VILNSKVTRYSLGLLSYSTK-MVQTLEDLVDEEHPIRYKPFDHYSYVGFRFTEEAVKCTS  301

Query  352   ALKTYCGV  329
              +K YCG+
Sbjct  302   RIKAYCGI  309



>ref|XP_010472949.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=321

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 200/315 (63%), Gaps = 9/315 (3%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             LP++DF+++ + PGT  W+  R +   A+EE G FVA ++ V+S+  E +  G+ E++DL
Sbjct  10    LPILDFSRDKLVPGTSHWITTRDKVRRAMEEQGWFVAEFNGVTSDTREDLLTGMKEMYDL  69

Query  1069  PTNVKVENKSTKPLYGYVGQI-PIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDDFSEA  893
             P  +K++N++ K  +GY+  +     ++ES+GID+A   Q  + F+KL+WPQGND FSE 
Sbjct  70    PYEIKIKNENHKVSHGYMTMVVEDYRIHESLGIDYATEHQACKDFSKLLWPQGNDPFSET  129

Query  892   MLVYSKLAAELEEMVVRMVFESYGVE--KYYESHVKSACYLARVMKYREAQENEPKLGFV  719
                Y+   AELE+ V+RM++ESYG++  K+  SH +S  YL R++ YR  +  E   GFV
Sbjct  130   THKYATAVAELEQRVMRMLYESYGMDEKKHSASHSESTRYLLRMLSYRRQRNGEANTGFV  189

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
             SHTDKSFMS ++QN H+ GL +K    D W     SP+  VV++G  + AWSN+RIK  +
Sbjct  190   SHTDKSFMSILHQN-HVGGLHLKTMT-DQWVRFKPSPTRFVVLSGMGLTAWSNDRIKPCY  247

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             H+V+M     RYS+  FSF + T I+TP ELVD +HPL++ PF+H   L F+    N   
Sbjct  248   HKVVMSADEIRYSLGVFSFHKGT-IRTPEELVDEEHPLRYNPFEHDGLLRFYESYLNSLK  306

Query  358   PCA---LKTYCGV*P  323
               +   L+ YCGV P
Sbjct  307   KSSEDLLQVYCGVNP  321



>ref|XP_008461057.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Cucumis melo]
Length=317

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/310 (45%), Positives = 192/310 (62%), Gaps = 7/310 (2%)
 Frame = -2

Query  1249  LPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFDL  1070
             +P ID +K  ++ GT  W  A +E    LEE+GCF  +YDKVS E+H  + +   ELF L
Sbjct  11    IPTIDLSK--LEVGTKEWGLACKEMRFGLEEFGCFSVVYDKVSLELHNSIVEATKELFHL  68

Query  1069  PTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWP-QGNDDFSEA  893
             P   +++N S KP +GY G    +PLYESM ID+   L+  QSF  LMWP + N+ F   
Sbjct  69    PIETRMKNTSEKPYHGYFGGYSFLPLYESMAIDNPIQLKSTQSFANLMWPTRDNNHFCVT  128

Query  892   MLVYSKLAAELEEMVVRMVFESYGVEKYY-ESHVKSACYLARVMKYREAQENEPKLGFVS  716
             +  +S L A+LE+MV +MV ESYGV K   E  ++S  YL R+ KYR A+++E  +G  S
Sbjct  129   VERFSTLVAKLEKMVTKMVLESYGVSKVVNEPIMESTNYLLRLFKYRVAEKDETDVGLHS  188

Query  715   HTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSP-SSIVVMAGDAIMAWSNNRIKSPH  539
             HTD +F S I+Q+  I+GL+I++ N D W  VH S   S +VMAGDA+MAWSN RI+S  
Sbjct  189   HTDLTFFSIIHQHL-ISGLQIQSLNDDQWLDVHPSSHCSFIVMAGDALMAWSNERIRSCR  247

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKEENRRL  359
             HRV+M G+  RYSI  FSF   T I+ P   VD  +PL++KPF+H  +L +     +   
Sbjct  248   HRVIMRGEETRYSIGMFSFKNGT-IEVPQGFVDDANPLRYKPFNHYDFLTYDKANASHNT  306

Query  358   PCALKTYCGV  329
                +K YCG+
Sbjct  307   ISRIKDYCGL  316



>emb|CDP19784.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   258 bits (660),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 140/313 (45%), Positives = 197/313 (63%), Gaps = 8/313 (3%)
 Frame = -2

Query  1252  KLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFKGLVELFD  1073
             KLPV++F +E+++ GT SW  AR E   ALEEYGCF+A+YD VS ++ + VF  L +LFD
Sbjct  8     KLPVVNFGQENLQHGTKSWSLARNEVRHALEEYGCFLAVYDAVSFKLRDSVFSALEKLFD  67

Query  1072  LPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQGNDD-FSE  896
             LP   K +N S    +GY+       + E+MGI+++  ++ ++ F+KLMWPQGNDD FS 
Sbjct  68    LPVETKKKNTSDTLFFGYICDDRDPSIRENMGIENSTDIEEVKKFSKLMWPQGNDDNFSG  127

Query  895   AMLVYSKLAAELEEMVVRMVFESYGVEKY-YESHVKSACYLARVMKYREAQENEPKLGFV  719
              +   + L +ELE++V+RMVFESYGVEK   +SH+ S  Y+ R   Y+    +E  +   
Sbjct  128   IIHECANLLSELEQVVIRMVFESYGVEKLKCDSHIDSIMYVLRFNNYKAPGVDEKTVIAP  187

Query  718   SHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNRIKSPH  539
              HTDK  +S I     +NGLE+  K+ + W  V   PSS VVMAGDA+MAWSN+RI+   
Sbjct  188   PHTDKCLIS-ILAPSQVNGLEVNLKD-EQWIPVDFLPSSFVVMAGDALMAWSNDRIRPCL  245

Query  538   HRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE--ENR  365
             HRV M     R S+   S+  K ++  P EL+D ++P ++KPFDHL Y +F  KE    +
Sbjct  246   HRVQMNANARRSSVLMSSY-HKGVVHIPQELIDEENPQRYKPFDHLEYHNFLKKELQTGQ  304

Query  364   RLPC-ALKTYCGV  329
              L C A+K YCGV
Sbjct  305   HLQCDAIKRYCGV  317



>ref|XP_009344329.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Pyrus x bretschneideri]
Length=316

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 185/315 (59%), Gaps = 3/315 (1%)
 Frame = -2

Query  1273  MGSLTPLKLPVIDFTKEDMKPGTDSWVAARRESVSALEEYGCFVALYDKVSSEVHERVFK  1094
             MGSL P KLP I+F+ + +KPG+ SW+   ++   ALEEYG FVA YD++S E+   +F 
Sbjct  1     MGSLAPPKLPTINFSAKGLKPGSSSWLPTAKQVRYALEEYGSFVAQYDQISPELQNNIFG  60

Query  1093  GLVELFDLPTNVKVENKSTKPLYGYVGQIPIVPLYESMGIDHANTLQGIQSFTKLMWPQG  914
                +LF++P   KV+N   +P +GY+G  P +PLYES+ ID+  + Q    F  LMWP G
Sbjct  61    QAADLFEVPVENKVKNVGEQPYHGYIGPNPFMPLYESLCIDNVTSPQATHKFKNLMWPAG  120

Query  913   NDDFSEAMLVYSKLAAELEEMVVRMVFESYGVEKYYESHVKSACYLARVMKYREAQENEP  734
               +F E    + +L  +LE  V +M+F+S+GV   YES      +L R +KY   ++ + 
Sbjct  121   KKNFCETTDSFGQLLGDLERTVGQMLFDSFGVGNEYESVANCNSHLLRFIKYEVPEDTDT  180

Query  733   KLGFVSHTDKSFMSTIYQNCHINGLEIKAKNGDDWFGVHLSPSSIVVMAGDAIMAWSNNR  554
              L F  HTD SF + + Q+  ++GLE+K K G DW  +   PS  + MA D +  WSN+R
Sbjct  181   TLRFPMHTDNSFTTIVVQH-DVSGLEVKTKEG-DWINIESVPSQFLFMAADGLQMWSNDR  238

Query  553   IKSPHHRVMMEGKGPRYSIAQFSFMEKTMIQTPTELVDGDHPLQFKPFDHLHYLDFFSKE  374
             IK+  HRV   G   RYS+  F+F    ++Q P ELVD +HPL + P D   Y  F +  
Sbjct  239   IKACQHRVKHCGDKTRYSLGLFTF-NNGVLQVPKELVDDEHPLLYNPCDSRGYTRFHASA  297

Query  373   ENRRLPCALKTYCGV  329
             E+++    +K YCG+
Sbjct  298   ESKKAASRIKAYCGI  312



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3464527886360