BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c40037_g1_i1 len=501 path=[1:0-500]

Length=501
                                                                      Score     E

ref|XP_009770747.1|  PREDICTED: uncharacterized protein LOC104221381  79.0    2e-15   
ref|XP_006379170.1|  hypothetical protein POPTR_0009s09430g           75.9    2e-14   
ref|XP_002527485.1|  conserved hypothetical protein                   76.3    2e-14   Ricinus communis
ref|XP_009618571.1|  PREDICTED: uncharacterized protein LOC104110740  75.5    3e-14   
gb|AGH62002.1|  hypothetical protein                                  74.7    4e-14   
ref|XP_009335404.1|  PREDICTED: uncharacterized protein LOC103928...  75.5    5e-14   
ref|XP_009335403.1|  PREDICTED: uncharacterized protein LOC103928...  75.1    5e-14   
ref|XP_010065390.1|  PREDICTED: uncharacterized protein LOC104452632  74.3    7e-14   
ref|XP_008373038.1|  PREDICTED: uncharacterized protein LOC103436388  74.7    8e-14   
ref|XP_010274404.1|  PREDICTED: uncharacterized protein LOC104609725  73.2    1e-13   
ref|XP_009783503.1|  PREDICTED: uncharacterized protein LOC104232100  73.2    2e-13   
ref|XP_009595433.1|  PREDICTED: uncharacterized protein LOC104091735  73.2    2e-13   
ref|XP_008359338.1|  PREDICTED: uncharacterized protein LOC103423045  73.6    2e-13   
ref|XP_011001680.1|  PREDICTED: uncharacterized protein LOC105108...  72.8    2e-13   
ref|XP_011001673.1|  PREDICTED: uncharacterized protein LOC105108...  72.8    2e-13   
ref|XP_004289812.1|  PREDICTED: uncharacterized protein LOC101294520  72.8    3e-13   
ref|XP_010647939.1|  PREDICTED: uncharacterized protein LOC100242...  71.6    5e-13   
ref|XP_002262812.1|  PREDICTED: uncharacterized protein LOC100242...  71.6    5e-13   Vitis vinifera
emb|CBI22485.3|  unnamed protein product                              71.6    7e-13   
emb|CBI22484.3|  unnamed protein product                              72.4    7e-13   
ref|XP_010647938.1|  PREDICTED: uncharacterized protein LOC104878...  71.2    7e-13   
emb|CAN60715.1|  hypothetical protein VITISV_034286                   71.2    8e-13   Vitis vinifera
ref|XP_010647936.1|  PREDICTED: uncharacterized protein LOC100265...  71.2    8e-13   
ref|XP_006606894.1|  PREDICTED: uncharacterized protein LOC100815216  70.9    8e-13   
ref|XP_002262836.1|  PREDICTED: uncharacterized protein LOC100265...  71.2    8e-13   Vitis vinifera
gb|KHN42332.1|  hypothetical protein glysoja_020044                   71.2    8e-13   
ref|XP_010647937.1|  PREDICTED: uncharacterized protein LOC104878...  71.2    9e-13   
gb|KHG15291.1|  hypothetical protein F383_16775                       71.2    9e-13   
ref|XP_007143094.1|  hypothetical protein PHAVU_007G043000g           70.9    1e-12   
ref|XP_010065936.1|  PREDICTED: uncharacterized protein LOC104453116  70.5    2e-12   
ref|XP_002300257.2|  hypothetical protein POPTR_0001s30410g           70.1    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011030368.1|  PREDICTED: uncharacterized protein LOC105129833  70.1    2e-12   
ref|XP_010315194.1|  PREDICTED: uncharacterized protein LOC104645...  70.1    3e-12   
ref|XP_011092522.1|  PREDICTED: uncharacterized protein LOC105172680  70.1    3e-12   
ref|XP_010315195.1|  PREDICTED: uncharacterized protein LOC104645...  69.3    3e-12   
gb|KDP44466.1|  hypothetical protein JCGZ_16299                       69.3    6e-12   
ref|XP_007042595.1|  Late embryogenesis abundant protein Lea5, pu...  68.9    7e-12   
ref|XP_006842001.1|  hypothetical protein AMTR_s00144p00086170        68.2    8e-12   
ref|XP_002885314.1|  hypothetical protein ARALYDRAFT_479468           67.4    3e-11   
ref|XP_006589625.1|  PREDICTED: uncharacterized protein LOC100805...  66.6    3e-11   
ref|XP_006589626.1|  PREDICTED: uncharacterized protein LOC100805...  66.6    4e-11   
ref|XP_006298849.1|  hypothetical protein CARUB_v10014963mg           66.2    6e-11   
dbj|BAB01976.1|  unnamed protein product                              65.5    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008787146.1|  PREDICTED: uncharacterized protein LOC103705269  66.2    6e-11   
ref|XP_008236422.1|  PREDICTED: uncharacterized protein LOC103335...  66.2    7e-11   
ref|XP_008236421.1|  PREDICTED: uncharacterized protein LOC103335...  66.2    8e-11   
ref|XP_006346326.1|  PREDICTED: uncharacterized protein LOC102592215  65.5    9e-11   
gb|EMT17716.1|  hypothetical protein F775_05872                       65.5    9e-11   
ref|NP_566643.1|  uncharacterized protein                             65.9    9e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EMS62950.1|  hypothetical protein TRIUR3_24784                     65.5    9e-11   
ref|XP_009406010.1|  PREDICTED: uncharacterized protein LOC103989011  65.5    1e-10   
ref|XP_003576052.1|  PREDICTED: uncharacterized protein LOC100822465  65.1    1e-10   
ref|XP_010905269.1|  PREDICTED: uncharacterized protein LOC105032509  65.5    1e-10   
ref|XP_004962919.1|  PREDICTED: uncharacterized protein LOC101764303  65.1    1e-10   
emb|CDX99216.1|  BnaC05g33310D                                        65.1    2e-10   
ref|XP_009145775.1|  PREDICTED: uncharacterized protein LOC103869444  65.1    2e-10   
gb|AFK45466.1|  unknown                                               64.7    2e-10   
ref|XP_006664052.1|  PREDICTED: uncharacterized protein LOC102704756  63.9    3e-10   
gb|KHF98123.1|  Glutamate racemase                                    64.3    3e-10   
ref|NP_001066848.2|  Os12g0507700                                     63.9    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010487900.1|  PREDICTED: uncharacterized protein LOC104765824  64.3    3e-10   
ref|XP_002443245.1|  hypothetical protein SORBIDRAFT_08g016280        63.2    6e-10   Sorghum bicolor [broomcorn]
tpg|DAA55383.1|  TPA: hypothetical protein ZEAMMB73_482656            63.2    6e-10   
ref|XP_006406488.1|  hypothetical protein EUTSA_v10021914mg           63.5    6e-10   
ref|XP_003610628.1|  hypothetical protein MTR_5g005180                63.2    6e-10   
ref|XP_006486948.1|  PREDICTED: uncharacterized protein LOC102616231  63.5    7e-10   
gb|KDO57846.1|  hypothetical protein CISIN_1g047273mg                 62.4    1e-09   
ref|XP_006422859.1|  hypothetical protein CICLE_v10029838mg           63.2    1e-09   
ref|XP_010065933.1|  PREDICTED: uncharacterized protein LOC104453112  61.2    2e-09   
emb|CDY70206.1|  BnaA01g36870D                                        60.5    6e-09   
ref|XP_009111730.1|  PREDICTED: uncharacterized protein LOC103837148  60.5    7e-09   
emb|CDY69041.1|  BnaAnng29180D                                        60.1    7e-09   
emb|CDX95437.1|  BnaC01g33290D                                        60.1    8e-09   
ref|XP_008648554.1|  PREDICTED: uncharacterized protein LOC103629154  60.1    8e-09   
ref|XP_008455025.1|  PREDICTED: uncharacterized protein LOC103495298  60.1    9e-09   
gb|EPS60226.1|  hypothetical protein M569_14579                       59.3    9e-09   
ref|XP_010687502.1|  PREDICTED: uncharacterized protein LOC104901611  59.3    2e-08   
ref|XP_004511304.1|  PREDICTED: uncharacterized protein LOC101493476  58.2    2e-08   
ref|XP_009111718.1|  PREDICTED: uncharacterized protein LOC103837139  58.5    3e-08   
gb|KGN43861.1|  hypothetical protein Csa_7G071500                     58.2    4e-08   
ref|XP_004167083.1|  PREDICTED: uncharacterized protein LOC101226771  58.2    4e-08   
ref|XP_006406491.1|  hypothetical protein EUTSA_v10021904mg           57.8    4e-08   
gb|KDP44468.1|  hypothetical protein JCGZ_16301                       57.8    5e-08   
gb|KCW63642.1|  hypothetical protein EUGRSUZ_G01281                   55.8    2e-07   
ref|XP_004136944.1|  PREDICTED: probable protein phosphatase 2C 6...  58.2    4e-07   
ref|XP_006495321.1|  PREDICTED: uncharacterized protein LOC102615023  50.4    1e-05   
gb|KDP32461.1|  hypothetical protein JCGZ_13386                       49.3    4e-05   
ref|XP_006427710.1|  hypothetical protein CICLE_v10026814mg           49.3    6e-05   
ref|XP_010092098.1|  hypothetical protein L484_001357                 47.4    2e-04   
ref|XP_007023466.1|  F-box/RNI-like superfamily protein               49.3    4e-04   
gb|KDP45560.1|  hypothetical protein JCGZ_18220                       45.8    8e-04   
ref|XP_010416096.1|  PREDICTED: uncharacterized protein LOC104702006  45.8    0.001   



>ref|XP_009770747.1| PREDICTED: uncharacterized protein LOC104221381 [Nicotiana sylvestris]
Length=111

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 58/97 (60%), Gaps = 7/97 (7%)
 Frame = +1

Query  79   MPGAWLAKFPRKSLQFSSAAPAARRCMSKMGPGTNRRSKadvaaameeedeKRLEEVSPS  258
            M  A + + PRKS Q         R MSK+  G   R         E +++++ ++ S  
Sbjct  1    MAAAGITRLPRKSPQIRLQLHEVGRRMSKLA-GVEER------YGSELQEKEKKKKKSSC  53

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIYFP GHERV+DD+P+GAA L QTYWLRS
Sbjct  54   WVPHPRTGIYFPQGHERVIDDIPNGAAPLTQTYWLRS  90



>ref|XP_006379170.1| hypothetical protein POPTR_0009s09430g [Populus trichocarpa]
 gb|ERP56967.1| hypothetical protein POPTR_0009s09430g [Populus trichocarpa]
Length=103

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             WAPHPRTGIY P GHE+VMDDVP  AASLNQTYWLR+
Sbjct  44   DWAPHPRTGIYVPKGHEKVMDDVPEKAASLNQTYWLRN  81



>ref|XP_002527485.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34883.1| conserved hypothetical protein [Ricinus communis]
Length=126

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  235  RLEEVSPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            ++   S  W PHPRTGIY P GHERVMDDVP GAAS NQTYWLR+
Sbjct  60   KMNYNSSCWVPHPRTGIYVPKGHERVMDDVPEGAASFNQTYWLRT  104



>ref|XP_009618571.1| PREDICTED: uncharacterized protein LOC104110740 [Nicotiana tomentosiformis]
Length=104

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S  W PHPRTGIYFP GHERV+DD+P+GAASL QTYWLRS
Sbjct  42   SSCWLPHPRTGIYFPQGHERVIDDIPNGAASLTQTYWLRS  81



>gb|AGH62002.1| hypothetical protein [Arachis hypogaea]
Length=100

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  244  EVSPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            E S  W PHPRTGIYFP GHE VMDDVP GAAS  QTYWLR+
Sbjct  50   EDSTCWVPHPRTGIYFPKGHEWVMDDVPEGAASFTQTYWLRN  91



>ref|XP_009335404.1| PREDICTED: uncharacterized protein LOC103928113 isoform X2 [Pyrus 
x bretschneideri]
Length=133

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            +W PHPRTGIY P GHE+VMDDVP GAASLNQT+WLR+
Sbjct  73   NWVPHPRTGIYVPKGHEKVMDDVPKGAASLNQTFWLRN  110



>ref|XP_009335403.1| PREDICTED: uncharacterized protein LOC103928113 isoform X1 [Pyrus 
x bretschneideri]
Length=137

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            +W PHPRTGIY P GHE+VMDDVP GAASLNQT+WLR+
Sbjct  77   NWVPHPRTGIYVPKGHEKVMDDVPKGAASLNQTFWLRN  114



>ref|XP_010065390.1| PREDICTED: uncharacterized protein LOC104452632 [Eucalyptus grandis]
 gb|KCW62842.1| hypothetical protein EUGRSUZ_G00438 [Eucalyptus grandis]
Length=112

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  241  EEVSPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLR  366
            +E  P W PHPRTGIYFP GHERV+DD+P GAASL+Q +WLR
Sbjct  49   DEHGPLWVPHPRTGIYFPRGHERVVDDIPEGAASLSQAFWLR  90



>ref|XP_008373038.1| PREDICTED: uncharacterized protein LOC103436388 [Malus domestica]
Length=137

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            +W PHPRTGIY P GHE+VMDDVP GAASLNQT+WLR+
Sbjct  77   NWVPHPRTGIYVPKGHEKVMDDVPKGAASLNQTFWLRN  114



>ref|XP_010274404.1| PREDICTED: uncharacterized protein LOC104609725, partial [Nelumbo 
nucifera]
Length=102

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 44/84 (52%), Gaps = 7/84 (8%)
 Frame = +1

Query  118  LQFSSAAPAARRCMSKMGPGTNRRSKadvaaameeedeKRLEEVSPSWAPHPRTGIYFPA  297
              FS  A    RC+     G  R  K        +  +K L      W PHPR GIYFP 
Sbjct  4    FDFSREAKRGERCVCSRA-GKIRTEKPSSDDHHGKNSDKTL------WVPHPRNGIYFPK  56

Query  298  GHERVMDDVPSGAASLNQTYWLRS  369
            GHE VMDDVP+GAA LNQ YWLRS
Sbjct  57   GHEWVMDDVPAGAAVLNQAYWLRS  80



>ref|XP_009783503.1| PREDICTED: uncharacterized protein LOC104232100 [Nicotiana sylvestris]
Length=119

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIYFP G ERVMDD+P+GAASL QTYWLRS
Sbjct  59   WMPHPRTGIYFPVGQERVMDDIPNGAASLPQTYWLRS  95



>ref|XP_009595433.1| PREDICTED: uncharacterized protein LOC104091735 [Nicotiana tomentosiformis]
Length=119

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIYFP G ERVMDD+P+GAASL QTYWLRS
Sbjct  59   WMPHPRTGIYFPVGQERVMDDIPNGAASLPQTYWLRS  95



>ref|XP_008359338.1| PREDICTED: uncharacterized protein LOC103423045 [Malus domestica]
Length=138

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            SW PHP+TGIY P GHE+VMDDVP GAAS NQT+WLR+
Sbjct  78   SWVPHPKTGIYVPKGHEKVMDDVPKGAASFNQTFWLRN  115



>ref|XP_011001680.1| PREDICTED: uncharacterized protein LOC105108875 isoform X2 [Populus 
euphratica]
Length=103

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             WAPHPRTGIY P GHE VMDDVP  AASLNQTYWLR+
Sbjct  44   DWAPHPRTGIYVPKGHEWVMDDVPEKAASLNQTYWLRN  81



>ref|XP_011001673.1| PREDICTED: uncharacterized protein LOC105108875 isoform X1 [Populus 
euphratica]
Length=106

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             WAPHPRTGIY P GHE VMDDVP  AASLNQTYWLR+
Sbjct  47   DWAPHPRTGIYVPKGHEWVMDDVPEKAASLNQTYWLRN  84



>ref|XP_004289812.1| PREDICTED: uncharacterized protein LOC101294520 [Fragaria vesca 
subsp. vesca]
Length=127

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASL-NQTYWLRS  369
            S SW P PRTGIYFP GHERVMDD+P GAASL NQT+WLR+
Sbjct  65   SSSWVPDPRTGIYFPKGHERVMDDIPKGAASLNNQTFWLRN  105



>ref|XP_010647939.1| PREDICTED: uncharacterized protein LOC100242957 isoform X1 [Vitis 
vinifera]
Length=105

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S SW PHPRTGIYFP GH+ V+DDVP GAA   QTYWLR+
Sbjct  55   SSSWVPHPRTGIYFPKGHDHVIDDVPDGAACFGQTYWLRT  94



>ref|XP_002262812.1| PREDICTED: uncharacterized protein LOC100242957 isoform X2 [Vitis 
vinifera]
 emb|CBI22486.3| unnamed protein product [Vitis vinifera]
Length=102

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S SW PHPRTGIYFP GH+ V+DDVP GAA   QTYWLR+
Sbjct  52   SSSWVPHPRTGIYFPKGHDHVIDDVPDGAACFGQTYWLRT  91



>emb|CBI22485.3| unnamed protein product [Vitis vinifera]
Length=107

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S SW PHPRTGIYFP GH+ +MDDVP GAA   QTYWLR+
Sbjct  52   SSSWVPHPRTGIYFPEGHDHMMDDVPDGAACFGQTYWLRT  91



>emb|CBI22484.3| unnamed protein product [Vitis vinifera]
Length=157

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S SW PHPRTGIYFP GH+ +MDDVP GAA   QTYWLR+
Sbjct  52   SSSWVPHPRTGIYFPKGHDHMMDDVPDGAACFGQTYWLRT  91



>ref|XP_010647938.1| PREDICTED: uncharacterized protein LOC104878824 isoform X2 [Vitis 
vinifera]
Length=102

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S SW PHPRTGIYFP GH+ +MDDVP GAA   QTYWLR+
Sbjct  52   SSSWVPHPRTGIYFPKGHDHMMDDVPDGAACFGQTYWLRT  91



>emb|CAN60715.1| hypothetical protein VITISV_034286 [Vitis vinifera]
Length=102

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S SW PHPRTGIYFP GH+ +MDDVP GAA   QTYWLR+
Sbjct  52   SSSWVPHPRTGIYFPEGHDHMMDDVPDGAACFGQTYWLRT  91



>ref|XP_010647936.1| PREDICTED: uncharacterized protein LOC100265247 isoform X1 [Vitis 
vinifera]
Length=105

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S SW PHPRTGIYFP GH+ +MDDVP GAA   QTYWLR+
Sbjct  55   SSSWVPHPRTGIYFPEGHDHMMDDVPDGAACFGQTYWLRT  94



>ref|XP_006606894.1| PREDICTED: uncharacterized protein LOC100815216 [Glycine max]
Length=93

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  244  EVSPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            E S  W PHPRTGIYFP GHE VMDDVP  AA LNQTYW R+
Sbjct  43   EDSAFWIPHPRTGIYFPKGHEWVMDDVPEDAARLNQTYWFRN  84



>ref|XP_002262836.1| PREDICTED: uncharacterized protein LOC100265247 isoform X2 [Vitis 
vinifera]
Length=102

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S SW PHPRTGIYFP GH+ +MDDVP GAA   QTYWLR+
Sbjct  52   SSSWVPHPRTGIYFPEGHDHMMDDVPDGAACFGQTYWLRT  91



>gb|KHN42332.1| hypothetical protein glysoja_020044 [Glycine soja]
Length=101

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  244  EVSPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            E S  W PHPRTGIYFP GHE VMDDVP  AA LNQTYW R+
Sbjct  51   EDSAFWIPHPRTGIYFPKGHEWVMDDVPEDAARLNQTYWFRN  92



>ref|XP_010647937.1| PREDICTED: uncharacterized protein LOC104878824 isoform X1 [Vitis 
vinifera]
Length=105

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S SW PHPRTGIYFP GH+ +MDDVP GAA   QTYWLR+
Sbjct  55   SSSWVPHPRTGIYFPKGHDHMMDDVPDGAACFGQTYWLRT  94



>gb|KHG15291.1| hypothetical protein F383_16775 [Gossypium arboreum]
Length=108

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHP++GIYFP GHE VM DVP GAASLNQTYWLR+
Sbjct  46   WVPHPKSGIYFPEGHEWVMKDVPDGAASLNQTYWLRN  82



>ref|XP_007143094.1| hypothetical protein PHAVU_007G043000g [Phaseolus vulgaris]
 gb|ESW15088.1| hypothetical protein PHAVU_007G043000g [Phaseolus vulgaris]
Length=102

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = +1

Query  235  RLEEVSPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            R+E+ S  W PHPRTGIYFP GHE VMDDVP  AA LNQT+W R+
Sbjct  48   RIED-SSWWVPHPRTGIYFPKGHEWVMDDVPEDAARLNQTFWFRN  91



>ref|XP_010065936.1| PREDICTED: uncharacterized protein LOC104453116 [Eucalyptus grandis]
Length=112

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  241  EEVSPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLR  366
            +E  P W PHPRTGIYFP GHERV+DD+P  AAS +Q +WLR
Sbjct  49   DEHGPLWVPHPRTGIYFPRGHERVVDDIPESAASFSQAFWLR  90



>ref|XP_002300257.2| hypothetical protein POPTR_0001s30410g [Populus trichocarpa]
 gb|EEE85062.2| hypothetical protein POPTR_0001s30410g [Populus trichocarpa]
Length=110

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             W PHPRTGIYFP GHE VMDDVP  AAS +QTYWLR+
Sbjct  49   DWVPHPRTGIYFPKGHEWVMDDVPENAASFSQTYWLRN  86



>ref|XP_011030368.1| PREDICTED: uncharacterized protein LOC105129833 [Populus euphratica]
Length=112

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             W PHPRTGIYFP GHE VMDDVP  AAS +QTYWLR+
Sbjct  51   DWVPHPRTGIYFPKGHEWVMDDVPENAASFSQTYWLRN  88



>ref|XP_010315194.1| PREDICTED: uncharacterized protein LOC104645409 isoform X1 [Solanum 
lycopersicum]
Length=110

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIYFP G ERVM+D+P+GAASL Q YWLR+
Sbjct  55   WVPHPRTGIYFPIGQERVMNDIPNGAASLPQNYWLRN  91



>ref|XP_011092522.1| PREDICTED: uncharacterized protein LOC105172680 [Sesamum indicum]
Length=118

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = +1

Query  148  RRCMSKMGPGTNRRSKadvaaameeedeKRL--EEVSPSWAPHPRTGIYFPAGHERVMDD  321
            RRCMSK     N  +K+          E+    E+    W PHPRTGIYFP G E VM+D
Sbjct  29   RRCMSKTVAAQNHHTKSSNKVTQGPAKEEEWVREDTGSCWMPHPRTGIYFPKGQEWVMED  88

Query  322  VPSGAASLNQTYWLRS  369
            +P+ AAS + T+WLRS
Sbjct  89   IPNDAASFDCTFWLRS  104



>ref|XP_010315195.1| PREDICTED: uncharacterized protein LOC104645409 isoform X2 [Solanum 
lycopersicum]
Length=90

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIYFP G ERVM+D+P+GAASL Q YWLR+
Sbjct  35   WVPHPRTGIYFPIGQERVMNDIPNGAASLPQNYWLRN  71



>gb|KDP44466.1| hypothetical protein JCGZ_16299 [Jatropha curcas]
Length=117

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  244  EVSPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            + +P W PHPRTGIY P G E +MDDVP GAAS NQTYWLR+
Sbjct  61   DSAPYWIPHPRTGIYVPKGQEWMMDDVPEGAASFNQTYWLRN  102



>ref|XP_007042595.1| Late embryogenesis abundant protein Lea5, putative [Theobroma 
cacao]
 gb|EOX98426.1| Late embryogenesis abundant protein Lea5, putative [Theobroma 
cacao]
Length=110

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            SPSW PHP++GIYFP GHE VM+DVP  AASL  T+WLR+
Sbjct  48   SPSWVPHPKSGIYFPKGHEWVMNDVPDDAASLGSTFWLRN  87



>ref|XP_006842001.1| hypothetical protein AMTR_s00144p00086170 [Amborella trichopoda]
 gb|ERN03676.1| hypothetical protein AMTR_s00144p00086170 [Amborella trichopoda]
Length=96

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIY+P GHE+VM+DVP GA++  +TYWLRS
Sbjct  52   WVPHPRTGIYYPKGHEKVMEDVPYGASTFEKTYWLRS  88



>ref|XP_002885314.1| hypothetical protein ARALYDRAFT_479468 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61573.1| hypothetical protein ARALYDRAFT_479468 [Arabidopsis lyrata subsp. 
lyrata]
Length=110

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            SW PHPRTGI+FP G E VM+DVP+GAAS N T+WLR+
Sbjct  57   SWVPHPRTGIFFPPGQESVMEDVPNGAASFNMTFWLRN  94



>ref|XP_006589625.1| PREDICTED: uncharacterized protein LOC100805917 isoform X1 [Glycine 
max]
 gb|KHN06790.1| hypothetical protein glysoja_021336 [Glycine soja]
Length=101

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  244  EVSPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            E S  W PHPRTGIYFP GHE VMDDV   AA L+QTYW R+
Sbjct  51   EDSACWIPHPRTGIYFPKGHEWVMDDVTEDAARLSQTYWFRN  92



>ref|XP_006589626.1| PREDICTED: uncharacterized protein LOC100805917 isoform X2 [Glycine 
max]
Length=98

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  244  EVSPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            E S  W PHPRTGIYFP GHE VMDDV   AA L+QTYW R+
Sbjct  48   EDSACWIPHPRTGIYFPKGHEWVMDDVTEDAARLSQTYWFRN  89



>ref|XP_006298849.1| hypothetical protein CARUB_v10014963mg [Capsella rubella]
 gb|EOA31747.1| hypothetical protein CARUB_v10014963mg [Capsella rubella]
Length=113

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRSvdgvdkpdpdvdYYQTY  420
            SW PHPRTGI+FP G E VM+DVP GAASL+ T+W+R+VDGVDKPDPD+ ++ TY
Sbjct  59   SWKPHPRTGIFFPPGQEAVMEDVPDGAASLDMTFWIRNVDGVDKPDPDLHHHLTY  113



>dbj|BAB01976.1| unnamed protein product [Arabidopsis thaliana]
Length=75

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            SW PHPRTGI+FP G E VM+DVP+GAAS + T+WLR+
Sbjct  22   SWVPHPRTGIFFPPGQESVMEDVPNGAASFDMTFWLRN  59



>ref|XP_008787146.1| PREDICTED: uncharacterized protein LOC103705269 [Phoenix dactylifera]
Length=111

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIY+P GHE VM+DVP GA+   QTYWLRS
Sbjct  53   WVPHPRTGIYYPKGHEWVMEDVPRGASCFGQTYWLRS  89



>ref|XP_008236422.1| PREDICTED: uncharacterized protein LOC103335191 isoform X2 [Prunus 
mume]
Length=118

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            +W PHP TGIY P GHE VMDDVP  AASLN+T+WLR+
Sbjct  58   NWVPHPTTGIYVPKGHEGVMDDVPKEAASLNKTFWLRN  95



>ref|XP_008236421.1| PREDICTED: uncharacterized protein LOC103335191 isoform X1 [Prunus 
mume]
Length=122

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            +W PHP TGIY P GHE VMDDVP  AASLN+T+WLR+
Sbjct  62   NWVPHPTTGIYVPKGHEGVMDDVPKEAASLNKTFWLRN  99



>ref|XP_006346326.1| PREDICTED: uncharacterized protein LOC102592215 [Solanum tuberosum]
Length=105

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLR  366
            W PH RTGIYFP G ERVM+D+P+GAASL Q YWLR
Sbjct  50   WVPHRRTGIYFPTGQERVMNDIPNGAASLPQNYWLR  85



>gb|EMT17716.1| hypothetical protein F775_05872 [Aegilops tauschii]
Length=100

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIY+P G E VM+DVPS AA+  QTYWLRS
Sbjct  41   WVPHPRTGIYYPRGFEWVMEDVPSSAATFQQTYWLRS  77



>ref|NP_566643.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM62557.1| unknown [Arabidopsis thaliana]
 gb|AAO22721.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42418.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76256.1| uncharacterized protein AT3G19550 [Arabidopsis thaliana]
Length=110

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            SW PHPRTGI+FP G E VM+DVP+GAAS + T+WLR+
Sbjct  57   SWVPHPRTGIFFPPGQESVMEDVPNGAASFDMTFWLRN  94



>gb|EMS62950.1| hypothetical protein TRIUR3_24784 [Triticum urartu]
Length=100

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIY+P G E VM+DVPS AA+  QTYWLRS
Sbjct  41   WVPHPRTGIYYPRGFEWVMEDVPSSAATFQQTYWLRS  77



>ref|XP_009406010.1| PREDICTED: uncharacterized protein LOC103989011 [Musa acuminata 
subsp. malaccensis]
Length=99

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIY+P GHE VM+DVP GA+S  +TYWLRS
Sbjct  40   WIPHPRTGIYYPKGHEWVMEDVPEGASSFPRTYWLRS  76



>ref|XP_003576052.1| PREDICTED: uncharacterized protein LOC100822465 [Brachypodium 
distachyon]
Length=99

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIY+P G E VM+DVPS AAS  Q+YWLRS
Sbjct  41   WVPHPRTGIYYPRGFEWVMEDVPSNAASFQQSYWLRS  77



>ref|XP_010905269.1| PREDICTED: uncharacterized protein LOC105032509 [Elaeis guineensis]
Length=113

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHP TGIY+P GHE VM+DVP GA+S  QTYWLRS
Sbjct  53   WVPHPTTGIYYPKGHEWVMEDVPRGASSFGQTYWLRS  89



>ref|XP_004962919.1| PREDICTED: uncharacterized protein LOC101764303 [Setaria italica]
Length=100

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIY+P G E VM+DVPSGAAS  Q+YW R+
Sbjct  41   WVPHPRTGIYYPKGFEWVMEDVPSGAASFRQSYWFRT  77



>emb|CDX99216.1| BnaC05g33310D [Brassica napus]
Length=110

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             W PHPRTGI+FP GHE VMD VP GAAS + T+WLR+
Sbjct  58   EWIPHPRTGIFFPPGHESVMDGVPDGAASFDMTFWLRN  95



>ref|XP_009145775.1| PREDICTED: uncharacterized protein LOC103869444 [Brassica rapa]
 emb|CDY46167.1| BnaA05g20540D [Brassica napus]
Length=110

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             W PHPRTGI+FP GHE VMD VP GAAS + T+WLR+
Sbjct  58   EWIPHPRTGIFFPPGHESVMDGVPDGAASFDMTFWLRN  95



>gb|AFK45466.1| unknown [Lotus japonicus]
Length=118

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIYFP GHE VM+DVP GAA+  QT W R+
Sbjct  57   WIPHPRTGIYFPVGHEWVMEDVPDGAANFGQTCWFRN  93



>ref|XP_006664052.1| PREDICTED: uncharacterized protein LOC102704756 [Oryza brachyantha]
Length=99

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIY+P G E VM+DVPS AAS  Q YWLRS
Sbjct  41   WVPHPRTGIYYPKGFEWVMEDVPSSAASFRQLYWLRS  77



>gb|KHF98123.1| Glutamate racemase [Gossypium arboreum]
Length=107

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S SW PHP++GIYFP GHE VMDDVP  AAS   ++W+RS
Sbjct  47   SSSWVPHPKSGIYFPKGHEWVMDDVPDRAASFGSSFWVRS  86



>ref|NP_001066848.2| Os12g0507700 [Oryza sativa Japonica Group]
 gb|ABA98694.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAY83256.1| hypothetical protein OsI_38466 [Oryza sativa Indica Group]
 gb|EAZ20619.1| hypothetical protein OsJ_36233 [Oryza sativa Japonica Group]
 dbj|BAF29867.2| Os12g0507700 [Oryza sativa Japonica Group]
Length=99

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIY+P G E VM+DVPS AAS  Q YWLRS
Sbjct  41   WVPHPRTGIYYPKGFEWVMEDVPSSAASFRQLYWLRS  77



>ref|XP_010487900.1| PREDICTED: uncharacterized protein LOC104765824 [Camelina sativa]
Length=111

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            SW PHPRTGI+FP G E VM+DVP GAAS + T+W+R+
Sbjct  57   SWVPHPRTGIFFPPGQEAVMEDVPDGAASFDMTFWIRN  94



>ref|XP_002443245.1| hypothetical protein SORBIDRAFT_08g016280 [Sorghum bicolor]
 gb|EES17083.1| hypothetical protein SORBIDRAFT_08g016280 [Sorghum bicolor]
Length=100

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIY+P G E VM+DVPS AAS  Q+YW R+
Sbjct  41   WVPHPRTGIYYPKGFEWVMEDVPSSAASFQQSYWFRT  77



>tpg|DAA55383.1| TPA: hypothetical protein ZEAMMB73_482656 [Zea mays]
Length=100

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIY+P G E VM+DVPS AAS  Q+YW R+
Sbjct  41   WVPHPRTGIYYPKGFEWVMEDVPSSAASFQQSYWFRT  77



>ref|XP_006406488.1| hypothetical protein EUTSA_v10021914mg [Eutrema salsugineum]
 gb|ESQ47941.1| hypothetical protein EUTSA_v10021914mg [Eutrema salsugineum]
Length=113

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGI+FP G E VMD VP GAAS + T+WLRS
Sbjct  62   WVPHPRTGIFFPPGQESVMDGVPDGAASFDMTFWLRS  98



>ref|XP_003610628.1| hypothetical protein MTR_5g005180 [Medicago truncatula]
 gb|AES93586.1| hypothetical protein MTR_5g005180 [Medicago truncatula]
Length=99

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S  W PHPRTGIYFP GHE VM+DVP GAA+ ++T + R+
Sbjct  60   SSCWVPHPRTGIYFPVGHEWVMEDVPDGAATFSETCYFRN  99



>ref|XP_006486948.1| PREDICTED: uncharacterized protein LOC102616231 [Citrus sinensis]
Length=129

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASL-NQTYWLRS  369
            +W PHPR+GIY P GHERVMDDVP  AAS  ++T+WLRS
Sbjct  71   NWVPHPRSGIYVPQGHERVMDDVPINAASFGHRTFWLRS  109



>gb|KDO57846.1| hypothetical protein CISIN_1g047273mg, partial [Citrus sinensis]
Length=102

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASL-NQTYWLRS  369
            +W PHPR+GIY P GHERVMDDVP  AAS  ++T+WLRS
Sbjct  49   NWIPHPRSGIYVPQGHERVMDDVPINAASFGHRTFWLRS  87



>ref|XP_006422859.1| hypothetical protein CICLE_v10029838mg, partial [Citrus clementina]
 gb|ESR36099.1| hypothetical protein CICLE_v10029838mg, partial [Citrus clementina]
Length=155

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASL-NQTYWLRS  369
            +W PHPR+GIY P GHERVMDDVP  AAS  ++T+WLRS
Sbjct  102  NWIPHPRSGIYVPQGHERVMDDVPINAASFGHRTFWLRS  140



>ref|XP_010065933.1| PREDICTED: uncharacterized protein LOC104453112 [Eucalyptus grandis]
Length=99

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +1

Query  241  EEVSPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            +E    W PHPRTGIY   G ERV+D+VP GAAS  Q +W RS
Sbjct  49   DEDRQCWVPHPRTGIYVTRGQERVVDNVPEGAASFCQAFWFRS  91



>emb|CDY70206.1| BnaA01g36870D [Brassica napus]
Length=110

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             W PHPRTGI+FP G E VMD VP  AAS + T+WLR 
Sbjct  58   EWVPHPRTGIFFPPGQESVMDGVPDDAASFDMTFWLRD  95



>ref|XP_009111730.1| PREDICTED: uncharacterized protein LOC103837148 [Brassica rapa]
Length=110

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             W PHPRTGI+FP G E VMD VP  AAS + T+WLR 
Sbjct  58   EWVPHPRTGIFFPPGQESVMDGVPDDAASFDMTFWLRD  95



>emb|CDY69041.1| BnaAnng29180D [Brassica napus]
Length=110

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             W PHPRTGI+FP G E VMD VP GAAS +  +WLR+
Sbjct  58   EWVPHPRTGIFFPPGQELVMDGVPEGAASFDMMFWLRN  95



>emb|CDX95437.1| BnaC01g33290D [Brassica napus]
Length=110

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             W PHPRTGI+FP G E VMD VP GAAS +  +WLR 
Sbjct  58   EWVPHPRTGIFFPPGQESVMDGVPEGAASFDMMFWLRD  95



>ref|XP_008648554.1| PREDICTED: uncharacterized protein LOC103629154 [Zea mays]
 gb|AFW74678.1| hypothetical protein ZEAMMB73_917026 [Zea mays]
Length=101

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 36/52 (69%), Gaps = 6/52 (12%)
 Frame = +1

Query  232  KRLE--EV-SPS---WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            KRLE  EV SP    W PHP TGIY+P G E VM+DVP+ AAS  Q+YW R+
Sbjct  27   KRLEPTEVKSPETSLWVPHPMTGIYYPKGFEWVMEDVPTSAASFQQSYWFRT  78



>ref|XP_008455025.1| PREDICTED: uncharacterized protein LOC103495298 [Cucumis melo]
Length=110

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S +W PHPRTGIYFP GHE VM D+P  AAS ++  W R 
Sbjct  54   SSTWVPHPRTGIYFPQGHEWVMKDIPENAASFSRLCWFRD  93



>gb|EPS60226.1| hypothetical protein M569_14579 [Genlisea aurea]
Length=82

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHP +GIYFP GHE VM+D+P  AAS +  YWLRS
Sbjct  38   WRPHPVSGIYFPEGHEWVMEDIPKDAASFDCVYWLRS  74



>ref|XP_010687502.1| PREDICTED: uncharacterized protein LOC104901611 [Beta vulgaris 
subsp. vulgaris]
Length=142

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 2/43 (5%)
 Frame = +1

Query  247  VSPSWAPHPRTGIYFPAGHERVMDDVPSGAASL--NQTYWLRS  369
            +  +W PHPRTGIYFP GHE VM DV   A+SL  +Q+YWLR+
Sbjct  77   METNWVPHPRTGIYFPEGHEWVMKDVSEDASSLGQSQSYWLRN  119



>ref|XP_004511304.1| PREDICTED: uncharacterized protein LOC101493476 [Cicer arietinum]
Length=84

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            W PHPRTGIYFPAGH+ VM+DVP GAA+  +T   R+
Sbjct  47   WIPHPRTGIYFPAGHDWVMEDVPDGAATFAETCCFRN  83



>ref|XP_009111718.1| PREDICTED: uncharacterized protein LOC103837139 [Brassica rapa]
Length=110

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             W PHPR GI+FP G E VMD VP GAAS +  +WLR+
Sbjct  58   EWVPHPRAGIFFPPGQELVMDGVPEGAASFDMMFWLRN  95



>gb|KGN43861.1| hypothetical protein Csa_7G071500 [Cucumis sativus]
Length=105

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S +W PHPRTGIYFP GHE VM D+P  AAS  +  W R 
Sbjct  49   SSTWVPHPRTGIYFPQGHEWVMKDIPENAASFPRLCWFRD  88



>ref|XP_004167083.1| PREDICTED: uncharacterized protein LOC101226771 [Cucumis sativus]
Length=110

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S +W PHPRTGIYFP GHE VM D+P  AAS  +  W R 
Sbjct  54   SSTWVPHPRTGIYFPQGHEWVMKDIPENAASFPRLCWFRD  93



>ref|XP_006406491.1| hypothetical protein EUTSA_v10021904mg, partial [Eutrema salsugineum]
 gb|ESQ47944.1| hypothetical protein EUTSA_v10021904mg, partial [Eutrema salsugineum]
Length=81

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             W PHP TGI+F  G E VMD VP GAAS + T+WLRS
Sbjct  16   EWVPHPHTGIFFLPGQESVMDGVPDGAASFDMTFWLRS  53



>gb|KDP44468.1| hypothetical protein JCGZ_16301 [Jatropha curcas]
Length=115

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  244  EVSPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            + S  W P PRTGIY P G E +MD+V  GAASLNQT WLR+
Sbjct  59   DNSSCWIPDPRTGIYVPKGQEWMMDNVAEGAASLNQTCWLRN  100



>gb|KCW63642.1| hypothetical protein EUGRSUZ_G01281 [Eucalyptus grandis]
Length=92

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  262  APHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
             PHPRTGI+ P G ERV+D++P GA S  Q +W RS
Sbjct  52   VPHPRTGIFVPRGQERVVDNIPEGAVSFCQAFWYRS  87



>ref|XP_004136944.1| PREDICTED: probable protein phosphatase 2C 63-like [Cucumis sativus]
Length=473

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  250  SPSWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWLRS  369
            S +W PHPRTGIYFP GHE VM D+P  AAS  +  W R 
Sbjct  54   SSTWVPHPRTGIYFPQGHEWVMKDIPENAASFPRLCWFRD  93



>ref|XP_006495321.1| PREDICTED: uncharacterized protein LOC102615023, partial [Citrus 
sinensis]
Length=89

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWL  363
            SW PH RTGIY+P GHE+V++DVP  A    +  W 
Sbjct  49   SWVPHERTGIYYPKGHEKVIEDVPPSAGRDFEVNWF  84



>gb|KDP32461.1| hypothetical protein JCGZ_13386 [Jatropha curcas]
Length=104

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  247  VSPSWAPHPRTGIYFPAGHERVMDDVPSGAA  339
            +S SW P  RTGIY+P G E+VMDD+P GA+
Sbjct  62   MSCSWVPDERTGIYYPKGQEKVMDDIPQGAS  92



>ref|XP_006427710.1| hypothetical protein CICLE_v10026814mg [Citrus clementina]
 gb|ESR40950.1| hypothetical protein CICLE_v10026814mg [Citrus clementina]
Length=107

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWL  363
            W PH RTGIY+P GHE+V++DVP  A    +  W 
Sbjct  68   WVPHERTGIYYPKGHEKVIEDVPPSAGRDFEVNWF  102



>ref|XP_010092098.1| hypothetical protein L484_001357 [Morus notabilis]
 gb|EXC37568.1| hypothetical protein L484_001357 [Morus notabilis]
Length=99

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAA  339
            W PH +TGIY+P GHE+VM+D+P  A 
Sbjct  58   WVPHEKTGIYYPKGHEKVMEDIPPNAG  84



>ref|XP_007023466.1| F-box/RNI-like superfamily protein [Theobroma cacao]
 gb|EOY26088.1| F-box/RNI-like superfamily protein [Theobroma cacao]
Length=489

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +1

Query  259  WAPHPRTGIYFPAGHERVMDDVPSGAASLNQTYWL  363
            W PH RTGIY+P G E+VM DVP+ A    Q  W 
Sbjct  454  WVPHDRTGIYYPKGQEKVMADVPAAAGRDTQINWF  488



>gb|KDP45560.1| hypothetical protein JCGZ_18220 [Jatropha curcas]
Length=104

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  247  VSPSWAPHPRTGIYFPAGHERVMDDVPSGAA  339
            +S SW P  RTGIY P G E+V+DD+P GA+
Sbjct  62   MSCSWVPDERTGIYHPKGQEKVIDDIPQGAS  92



>ref|XP_010416096.1| PREDICTED: uncharacterized protein LOC104702006 [Camelina sativa]
Length=108

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +1

Query  256  SWAPHPRTGIYFPAGHERVMDDVPSGAAS  342
            SW PH  TGIY+P GHE+VM DVP  A S
Sbjct  70   SWVPHEGTGIYYPKGHEKVMQDVPPPAGS  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 532538794086