BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3995_g2_i1 len=350 path=[328:0-349]

Length=350
                                                                      Score     E

ref|XP_002525040.1|  Root phototropism protein, putative                149   1e-39   Ricinus communis
emb|CDP04549.1|  unnamed protein product                                147   4e-39   
ref|XP_007026407.1|  Root phototropism protein, putative isoform 1      146   9e-39   
ref|XP_011095883.1|  PREDICTED: BTB/POZ domain-containing protein...    146   1e-38   
ref|XP_006449993.1|  hypothetical protein CICLE_v10014681mg             145   1e-38   
ref|XP_002323131.2|  hypothetical protein POPTR_0016s00530g             145   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006467218.1|  PREDICTED: BTB/POZ domain-containing protein...    145   2e-38   
ref|XP_011086288.1|  PREDICTED: BTB/POZ domain-containing protein...    145   2e-38   
ref|XP_007211380.1|  hypothetical protein PRUPE_ppa002800mg             145   4e-38   
gb|EYU27638.1|  hypothetical protein MIMGU_mgv1a003699mg                143   1e-37   
ref|XP_008224648.1|  PREDICTED: BTB/POZ domain-containing protein...    144   1e-37   
ref|XP_010646247.1|  PREDICTED: BTB/POZ domain-containing protein...    143   1e-37   
ref|XP_009374833.1|  PREDICTED: BTB/POZ domain-containing protein...    141   2e-37   
ref|XP_006467216.1|  PREDICTED: BTB/POZ domain-containing protein...    142   3e-37   
ref|XP_010096492.1|  BTB/POZ domain-containing protein                  143   4e-37   
ref|XP_009374827.1|  PREDICTED: BTB/POZ domain-containing protein...    142   4e-37   
ref|XP_007026409.1|  Root phototropism protein, putative isoform 3      142   4e-37   
ref|XP_007026408.1|  Root phototropism protein, putative isoform 2      141   5e-37   
ref|XP_011095882.1|  PREDICTED: BTB/POZ domain-containing protein...    141   6e-37   
ref|XP_011040135.1|  PREDICTED: BTB/POZ domain-containing protein...    141   7e-37   
ref|XP_011086289.1|  PREDICTED: BTB/POZ domain-containing protein...    140   1e-36   
ref|XP_009358099.1|  PREDICTED: BTB/POZ domain-containing protein...    140   1e-36   
ref|XP_011086287.1|  PREDICTED: BTB/POZ domain-containing protein...    140   2e-36   
ref|XP_004499337.1|  PREDICTED: BTB/POZ domain-containing protein...    139   4e-36   
ref|XP_011005754.1|  PREDICTED: BTB/POZ domain-containing protein...    139   4e-36   
ref|XP_003637604.1|  BTB/POZ domain-containing protein                  139   5e-36   
gb|KHG09801.1|  hypothetical protein F383_02074                         139   5e-36   
gb|KHN03557.1|  BTB/POZ domain-containing protein                       138   6e-36   
ref|XP_010646238.1|  PREDICTED: BTB/POZ domain-containing protein...    138   7e-36   
ref|XP_003550464.1|  PREDICTED: BTB/POZ domain-containing protein...    137   2e-35   
gb|KDP35543.1|  hypothetical protein JCGZ_08981                         137   2e-35   
ref|XP_007147574.1|  hypothetical protein PHAVU_006G136000g             137   2e-35   
ref|XP_011040125.1|  PREDICTED: BTB/POZ domain-containing protein...    136   4e-35   
ref|XP_002308748.2|  hypothetical protein POPTR_0006s00490g             135   1e-34   Populus trichocarpa [western balsam poplar]
gb|KHN40229.1|  BTB/POZ domain-containing protein                       135   1e-34   
ref|XP_003529682.1|  PREDICTED: BTB/POZ domain-containing protein...    135   1e-34   
ref|XP_011005734.1|  PREDICTED: BTB/POZ domain-containing protein...    134   3e-34   
ref|XP_006600279.1|  PREDICTED: BTB/POZ domain-containing protein...    133   4e-34   
ref|XP_004293414.1|  PREDICTED: BTB/POZ domain-containing protein...    133   6e-34   
ref|XP_010252837.1|  PREDICTED: BTB/POZ domain-containing protein...    132   7e-34   
ref|XP_008797736.1|  PREDICTED: BTB/POZ domain-containing protein...    132   9e-34   
ref|XP_010052491.1|  PREDICTED: BTB/POZ domain-containing protein...    131   2e-33   
ref|XP_003547299.1|  PREDICTED: BTB/POZ domain-containing protein...    131   4e-33   
gb|KHN40773.1|  BTB/POZ domain-containing protein                       130   5e-33   
ref|XP_003534987.1|  PREDICTED: BTB/POZ domain-containing protein...    130   5e-33   
ref|XP_010245016.1|  PREDICTED: BTB/POZ domain-containing protein...    130   6e-33   
ref|XP_010942558.1|  PREDICTED: BTB/POZ domain-containing protein...    130   7e-33   
ref|XP_006584110.1|  PREDICTED: BTB/POZ domain-containing protein...    130   7e-33   
ref|XP_008458941.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    130   7e-33   
ref|XP_004158832.1|  PREDICTED: BTB/POZ domain-containing protein...    130   7e-33   
ref|XP_008440966.1|  PREDICTED: BTB/POZ domain-containing protein...    130   8e-33   
ref|XP_004486375.1|  PREDICTED: BTB/POZ domain-containing protein...    130   8e-33   
ref|XP_004134813.1|  PREDICTED: BTB/POZ domain-containing protein...    130   8e-33   
ref|XP_010929030.1|  PREDICTED: BTB/POZ domain-containing protein...    128   2e-32   
ref|XP_003594335.1|  BTB/POZ domain-containing protein                  129   2e-32   
gb|KHN14408.1|  BTB/POZ domain-containing protein                       129   2e-32   
ref|XP_010052486.1|  PREDICTED: BTB/POZ domain-containing protein...    126   1e-31   
ref|XP_004486374.1|  PREDICTED: BTB/POZ domain-containing protein...    126   2e-31   
ref|XP_009391906.1|  PREDICTED: BTB/POZ domain-containing protein...    125   4e-31   
emb|CDX77798.1|  BnaC07g20520D                                          125   4e-31   
ref|XP_008783002.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    125   5e-31   
ref|XP_009101384.1|  PREDICTED: BTB/POZ domain-containing protein...    124   7e-31   
emb|CDY17704.1|  BnaA06g35230D                                          124   8e-31   
ref|XP_006398482.1|  hypothetical protein EUTSA_v10000839mg             123   2e-30   
dbj|BAJ34459.1|  unnamed protein product                                123   2e-30   
ref|XP_009392311.1|  PREDICTED: BTB/POZ domain-containing protein...    122   3e-30   
ref|NP_001148012.1|  protein binding protein                            122   4e-30   Zea mays [maize]
ref|XP_006281573.1|  hypothetical protein CARUB_v10027680mg             122   4e-30   
ref|XP_004956349.1|  PREDICTED: BTB/POZ domain-containing protein...    122   4e-30   
ref|XP_004159120.1|  PREDICTED: BTB/POZ domain-containing protein...    120   2e-29   
ref|XP_004139595.1|  PREDICTED: BTB/POZ domain-containing protein...    120   2e-29   
ref|NP_199591.1|  phototropic-responsive NPH3 family protein            120   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010495804.1|  PREDICTED: BTB/POZ domain-containing protein...    118   4e-29   
ref|XP_010481373.1|  PREDICTED: BTB/POZ domain-containing protein...    118   9e-29   
ref|XP_010481372.1|  PREDICTED: BTB/POZ domain-containing protein...    118   9e-29   
ref|XP_010530083.1|  PREDICTED: BTB/POZ domain-containing protein...    117   2e-28   
ref|XP_009392307.1|  PREDICTED: BTB/POZ domain-containing protein...    117   5e-28   
ref|XP_006661061.1|  PREDICTED: BTB/POZ domain-containing protein...    114   1e-27   
gb|EMT26192.1|  BTB/POZ domain-containing protein                       114   2e-27   
ref|XP_003577186.1|  PREDICTED: BTB/POZ domain-containing protein...    114   6e-27   
ref|XP_010929031.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-26   
gb|EEC84214.1|  hypothetical protein OsI_30621                          112   4e-26   Oryza sativa Indica Group [Indian rice]
gb|EEE69314.1|  hypothetical protein OsJ_28600                          106   8e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009392315.1|  PREDICTED: BTB/POZ domain-containing protein...    107   1e-24   
dbj|BAD26466.1|  putative non-phototropic hypocotyl 3                   106   3e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010248658.1|  PREDICTED: BTB/POZ domain-containing protein...    104   2e-23   
gb|KDO82222.1|  hypothetical protein CISIN_1g006846mg                   103   2e-23   
gb|KGN51751.1|  hypothetical protein Csa_5G598100                       103   4e-23   
ref|XP_008446157.1|  PREDICTED: BTB/POZ domain-containing protein...    103   5e-23   
ref|XP_004135274.1|  PREDICTED: BTB/POZ domain-containing protein...    103   5e-23   
ref|XP_006852352.1|  hypothetical protein AMTR_s00049p00216130          103   5e-23   
ref|XP_004172442.1|  PREDICTED: BTB/POZ domain-containing protein...    103   5e-23   
ref|XP_007153783.1|  hypothetical protein PHAVU_003G064600g             103   6e-23   
ref|XP_010100409.1|  BTB/POZ domain-containing protein                  103   6e-23   
ref|XP_008221906.1|  PREDICTED: BTB/POZ domain-containing protein...    102   9e-23   
ref|XP_003613103.1|  BTB/POZ domain-containing protein                  102   1e-22   
ref|XP_003552044.1|  PREDICTED: BTB/POZ domain-containing protein...    102   1e-22   
ref|XP_006357600.1|  PREDICTED: BTB/POZ domain-containing protein...    102   1e-22   
ref|XP_006483950.1|  PREDICTED: BTB/POZ domain-containing protein...    102   1e-22   
ref|XP_006438255.1|  hypothetical protein CICLE_v10030958mg             102   1e-22   
gb|KHG05824.1|  hypothetical protein F383_32639                         102   2e-22   
ref|XP_009392314.1|  PREDICTED: BTB/POZ domain-containing protein...    101   2e-22   
gb|KDO82220.1|  hypothetical protein CISIN_1g006846mg                   101   2e-22   
ref|XP_009770852.1|  PREDICTED: BTB/POZ domain-containing protein...    101   3e-22   
ref|XP_009614413.1|  PREDICTED: BTB/POZ domain-containing protein...    100   3e-22   
ref|XP_010251055.1|  PREDICTED: BTB/POZ domain-containing protein...    100   4e-22   
ref|XP_004489774.1|  PREDICTED: BTB/POZ domain-containing protein...    100   6e-22   
ref|XP_002452387.1|  hypothetical protein SORBIDRAFT_04g024760          100   6e-22   Sorghum bicolor [broomcorn]
gb|EPS63042.1|  hypothetical protein M569_11744                         100   6e-22   
ref|XP_006300867.1|  hypothetical protein CARUB_v10019960mg             100   7e-22   
ref|XP_009413442.1|  PREDICTED: BTB/POZ domain-containing protein...  99.8    7e-22   
ref|XP_009379958.1|  PREDICTED: BTB/POZ domain-containing protein...    100   7e-22   
ref|XP_010531578.1|  PREDICTED: BTB/POZ domain-containing protein...    100   7e-22   
ref|XP_010470729.1|  PREDICTED: BTB/POZ domain-containing protein...    100   8e-22   
ref|XP_010511760.1|  PREDICTED: BTB/POZ domain-containing protein...    100   8e-22   
ref|XP_010415392.1|  PREDICTED: BTB/POZ domain-containing protein...  99.8    9e-22   
gb|AES89843.2|  BTB/POZ domain plant protein                          92.4    1e-21   
ref|NP_176957.1|  phototropic-responsive NPH3 family protein          99.8    1e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KHN47740.1|  BTB/POZ domain-containing protein                     93.2    1e-21   
ref|XP_003628937.1|  BTB/POZ domain-containing protein                99.0    1e-21   
gb|AET03413.2|  phototropic-responsive NPH3 family protein            99.4    1e-21   
ref|XP_004239131.1|  PREDICTED: BTB/POZ domain-containing protein...  99.4    1e-21   
ref|XP_004509676.1|  PREDICTED: BTB/POZ domain-containing protein...  99.0    2e-21   
ref|XP_003531985.1|  PREDICTED: BTB/POZ domain-containing protein...  99.0    2e-21   
emb|CBI16786.3|  unnamed protein product                              97.8    2e-21   
ref|XP_010556221.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  99.0    2e-21   
emb|CDY72257.1|  BnaCnng76750D                                        97.8    2e-21   
emb|CDY72267.1|  BnaAnng40470D                                        97.8    2e-21   
gb|KHG04804.1|  hypothetical protein F383_28791                       98.6    3e-21   
ref|XP_009105081.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    3e-21   
ref|XP_004952970.1|  PREDICTED: BTB/POZ domain-containing protein...  98.2    4e-21   
ref|XP_002282444.2|  PREDICTED: BTB/POZ domain-containing protein...  97.8    5e-21   Vitis vinifera
gb|ACN27928.1|  unknown                                               97.4    7e-21   Zea mays [maize]
ref|NP_001147893.1|  LOC100281503                                     97.4    7e-21   Zea mays [maize]
ref|XP_010929904.1|  PREDICTED: BTB/POZ domain-containing protein...  97.4    7e-21   
gb|AFW85546.1|  putative phototropic-responsive NPH3 family protein   96.3    1e-20   
ref|XP_006391205.1|  hypothetical protein EUTSA_v10019709mg           96.3    1e-20   
ref|XP_008658464.1|  PREDICTED: uncharacterized protein LOC100279...  96.3    2e-20   
emb|CAN63893.1|  hypothetical protein VITISV_019664                   95.9    2e-20   Vitis vinifera
ref|XP_004299219.1|  PREDICTED: BTB/POZ domain-containing protein...  95.5    3e-20   
ref|XP_009786908.1|  PREDICTED: BTB/POZ domain-containing protein...  95.5    3e-20   
ref|XP_003607646.1|  hypothetical protein MTR_4g080720                88.6    4e-20   
ref|XP_008678759.1|  PREDICTED: BTB/POZ domain-containing protein...  95.1    4e-20   
ref|XP_006655857.1|  PREDICTED: BTB/POZ domain-containing protein...  94.7    5e-20   
ref|XP_011071147.1|  PREDICTED: BTB/POZ domain-containing protein...  94.7    6e-20   
gb|KHN22636.1|  BTB/POZ domain-containing protein                     94.7    6e-20   
gb|EAY99934.1|  hypothetical protein OsI_21936                        94.4    8e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_008778389.1|  PREDICTED: BTB/POZ domain-containing protein...  94.4    8e-20   
ref|NP_001056994.1|  Os06g0184500                                     94.4    9e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010682456.1|  PREDICTED: BTB/POZ domain-containing protein...  94.4    9e-20   
ref|XP_003575274.1|  PREDICTED: BTB/POZ domain-containing protein...  94.0    1e-19   
gb|EAZ23655.1|  hypothetical protein OsJ_07355                        94.0    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648803.1|  PREDICTED: BTB/POZ domain-containing protein...  94.0    1e-19   
ref|XP_007221979.1|  hypothetical protein PRUPE_ppa002809mg           92.8    2e-19   
ref|XP_002530034.1|  signal transducer, putative                      92.8    3e-19   Ricinus communis
ref|XP_008340094.1|  PREDICTED: BTB/POZ domain-containing protein...  92.8    3e-19   
gb|EAY86511.1|  hypothetical protein OsI_07890                        92.8    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_011045254.1|  PREDICTED: BTB/POZ domain-containing protein...  92.8    3e-19   
ref|XP_006378241.1|  hypothetical protein POPTR_0010s05690g           92.8    3e-19   
ref|XP_011045253.1|  PREDICTED: BTB/POZ domain-containing protein...  92.4    3e-19   
ref|XP_006378242.1|  hypothetical protein POPTR_0010s05690g           92.4    4e-19   
ref|XP_004138701.1|  PREDICTED: BTB/POZ domain-containing protein...  92.0    4e-19   
gb|KCW59744.1|  hypothetical protein EUGRSUZ_H02493                   91.7    5e-19   
ref|XP_009630313.1|  PREDICTED: BTB/POZ domain-containing protein...  92.0    5e-19   
gb|KDP26695.1|  hypothetical protein JCGZ_17853                       92.0    5e-19   
ref|XP_010528100.1|  PREDICTED: BTB/POZ domain-containing protein...  92.0    5e-19   
ref|XP_007158393.1|  hypothetical protein PHAVU_002G149400g           92.0    5e-19   
ref|XP_010023464.1|  PREDICTED: BTB/POZ domain-containing protein...  91.7    6e-19   
ref|XP_007044812.1|  Phototropic-responsive NPH3 family protein       91.7    6e-19   
ref|XP_010530706.1|  PREDICTED: BTB/POZ domain-containing protein...  91.7    7e-19   
gb|KHN00400.1|  BTB/POZ domain-containing protein                     91.7    7e-19   
ref|XP_003519715.1|  PREDICTED: BTB/POZ domain-containing protein...  91.7    7e-19   
emb|CDP13229.1|  unnamed protein product                              91.7    8e-19   
ref|XP_003578395.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  91.7    8e-19   
gb|KHN35451.1|  BTB/POZ domain-containing protein                     91.7    8e-19   
ref|XP_002311763.1|  phototropic-responsive NPH3 family protein       91.3    9e-19   Populus trichocarpa [western balsam poplar]
gb|AFW68229.1|  putative phototropic-responsive NPH3 family protein   88.2    9e-19   
ref|XP_008669263.1|  PREDICTED: BTB/POZ domain-containing protein...  91.3    9e-19   
ref|XP_002446667.1|  hypothetical protein SORBIDRAFT_06g020070        91.3    1e-18   Sorghum bicolor [broomcorn]
gb|EMT26515.1|  BTB/POZ domain-containing protein                     91.3    1e-18   
ref|XP_009629742.1|  PREDICTED: BTB/POZ domain-containing protein...  90.9    1e-18   
ref|XP_009359209.1|  PREDICTED: BTB/POZ domain-containing protein...  90.9    1e-18   
ref|XP_004964658.1|  PREDICTED: BTB/POZ domain-containing protein...  90.9    1e-18   
ref|XP_006346315.1|  PREDICTED: BTB/POZ domain-containing protein...  90.9    1e-18   
gb|EMT08606.1|  Coleoptile phototropism protein 1                     90.9    1e-18   
emb|CDO97269.1|  unnamed protein product                              90.5    2e-18   
dbj|BAK03079.1|  predicted protein                                    90.5    2e-18   
gb|KHN14527.1|  BTB/POZ domain-containing protein                     90.1    2e-18   
ref|XP_010086948.1|  BTB/POZ domain-containing protein NPY2           90.1    2e-18   
ref|XP_011086648.1|  PREDICTED: BTB/POZ domain-containing protein...  90.1    3e-18   
ref|XP_004230705.1|  PREDICTED: BTB/POZ domain-containing protein...  90.1    3e-18   
ref|XP_002437972.1|  hypothetical protein SORBIDRAFT_10g005710        90.1    3e-18   Sorghum bicolor [broomcorn]
dbj|BAJ87350.1|  predicted protein                                    89.7    3e-18   
ref|XP_008389720.1|  PREDICTED: BTB/POZ domain-containing protein...  89.7    4e-18   
ref|XP_009776107.1|  PREDICTED: BTB/POZ domain-containing protein...  89.4    4e-18   
ref|XP_004485981.1|  PREDICTED: BTB/POZ domain-containing protein...  89.4    4e-18   
ref|XP_004975963.1|  PREDICTED: BTB/POZ domain-containing protein...  89.4    5e-18   
ref|NP_001050649.1|  Os03g0609800                                     89.4    5e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_189280.1|  phototropic-responsive NPH3 family protein          89.0    5e-18   Arabidopsis thaliana [mouse-ear cress]
gb|EAY90980.1|  hypothetical protein OsI_12589                        89.0    6e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_008445264.1|  PREDICTED: BTB/POZ domain-containing protein...  89.0    6e-18   
gb|KHG02234.1|  BTB/POZ domain-containing NPY2 -like protein          89.0    7e-18   
emb|CDY13635.1|  BnaA06g32880D                                        88.6    8e-18   
ref|XP_004982439.1|  PREDICTED: BTB/POZ domain-containing protein...  88.6    9e-18   
gb|EYU29635.1|  hypothetical protein MIMGU_mgv1a003178mg              88.2    1e-17   
ref|NP_001278721.1|  putative phototropic-resoponsive NPH3 family...  88.2    1e-17   
ref|NP_001053084.1|  Os04g0477000                                     88.2    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010065907.1|  PREDICTED: BTB/POZ domain-containing protein...  88.2    1e-17   
ref|XP_004288238.1|  PREDICTED: BTB/POZ domain-containing protein...  88.2    1e-17   
ref|XP_009152052.1|  PREDICTED: BTB/POZ domain-containing protein...  87.8    1e-17   
ref|XP_011099362.1|  PREDICTED: BTB/POZ domain-containing protein...  87.8    2e-17   
ref|XP_009772494.1|  PREDICTED: BTB/POZ domain-containing protein...  87.8    2e-17   
ref|XP_006650278.1|  PREDICTED: BTB/POZ domain-containing protein...  87.8    2e-17   
ref|XP_011088062.1|  PREDICTED: BTB/POZ domain-containing protein...  87.8    2e-17   
dbj|BAK04631.1|  predicted protein                                    87.8    2e-17   
ref|XP_009126615.1|  PREDICTED: BTB/POZ domain-containing protein...  87.4    2e-17   
ref|XP_010099608.1|  BTB/POZ domain-containing protein NPY2           87.8    2e-17   
emb|CDX68790.1|  BnaC01g06630D                                        87.4    2e-17   
ref|XP_011073694.1|  PREDICTED: BTB/POZ domain-containing protein...  87.4    2e-17   
ref|XP_006857240.1|  hypothetical protein AMTR_s00065p00211770        87.4    2e-17   
ref|XP_007047500.1|  Phototropic-responsive NPH3 family protein i...  87.4    2e-17   
ref|NP_001146294.1|  uncharacterized protein LOC100279869             87.0    3e-17   Zea mays [maize]
ref|XP_003558549.1|  PREDICTED: BTB/POZ domain-containing protein...  87.0    3e-17   
ref|XP_002443443.1|  hypothetical protein SORBIDRAFT_08g019560        87.0    3e-17   Sorghum bicolor [broomcorn]
ref|XP_009797504.1|  PREDICTED: BTB/POZ domain-containing protein...  86.7    3e-17   
ref|XP_009604823.1|  PREDICTED: BTB/POZ domain-containing protein...  86.3    5e-17   
ref|XP_009390548.1|  PREDICTED: BTB/POZ domain-containing protein...  86.3    5e-17   
ref|XP_009394935.1|  PREDICTED: BTB/POZ domain-containing protein...  86.3    5e-17   
gb|KHG03539.1|  hypothetical protein F383_27138                       86.3    5e-17   
gb|KHN06014.1|  BTB/POZ domain-containing protein NPY2                86.3    6e-17   
ref|XP_002468311.1|  hypothetical protein SORBIDRAFT_01g043540        86.3    6e-17   Sorghum bicolor [broomcorn]
ref|XP_009764318.1|  PREDICTED: BTB/POZ domain-containing protein...  86.3    6e-17   
ref|XP_010502573.1|  PREDICTED: BTB/POZ domain-containing protein...  85.9    6e-17   
ref|XP_002464238.1|  hypothetical protein SORBIDRAFT_01g014760        85.9    7e-17   Sorghum bicolor [broomcorn]
gb|KHG12565.1|  BTB/POZ domain-containing NPY2 -like protein          85.9    8e-17   
ref|XP_009625190.1|  PREDICTED: BTB/POZ domain-containing protein...  85.9    8e-17   
emb|CAH66936.1|  OSIGBa0116M22.3                                      85.5    1e-16   Oryza sativa [red rice]
ref|XP_006579940.1|  PREDICTED: BTB/POZ domain-containing protein...  85.5    1e-16   
gb|EYU37575.1|  hypothetical protein MIMGU_mgv1a002858mg              85.5    1e-16   
tpg|DAA50449.1|  TPA: putative phototropic-responsive NPH3 family...  83.6    1e-16   
ref|XP_003593874.1|  BTB/POZ domain-containing protein                85.1    1e-16   
ref|XP_008777297.1|  PREDICTED: BTB/POZ domain-containing protein...  85.1    1e-16   
ref|XP_004985278.1|  PREDICTED: BTB/POZ domain-containing protein...  85.1    1e-16   
gb|KDO57872.1|  hypothetical protein CISIN_1g007080mg                 85.1    1e-16   
ref|XP_006486926.1|  PREDICTED: BTB/POZ domain-containing protein...  85.1    1e-16   
ref|XP_004963017.1|  PREDICTED: BTB/POZ domain-containing protein...  85.1    1e-16   
ref|XP_004963018.1|  PREDICTED: BTB/POZ domain-containing protein...  85.1    1e-16   
tpg|DAA61508.1|  TPA: putative phototropic-responsive NPH3 family...  84.3    1e-16   
emb|CDX83620.1|  BnaC07g23600D                                        84.7    1e-16   
gb|KDP32062.1|  hypothetical protein JCGZ_12523                       85.1    2e-16   
gb|EMS47904.1|  Coleoptile phototropism protein 1                     84.7    2e-16   
gb|EEC77481.1|  hypothetical protein OsI_16312                        85.1    2e-16   Oryza sativa Indica Group [Indian rice]
gb|EMS51026.1|  Root phototropism protein 3                           84.7    2e-16   
gb|ABF94545.1|  transposon protein, putative, Mutator sub-class, ...  84.0    2e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EMS54071.1|  Coleoptile phototropism protein 1                     84.3    2e-16   
ref|XP_006395551.1|  hypothetical protein EUTSA_v10003883mg           84.7    2e-16   
gb|EMT10822.1|  Root phototropism protein 3                           84.7    2e-16   
emb|CDP02592.1|  unnamed protein product                              84.7    2e-16   
ref|NP_001146461.1|  putative phototropic-responsive NPH3 family ...  84.7    2e-16   Zea mays [maize]
ref|XP_006412550.1|  hypothetical protein EUTSA_v10024768mg           84.7    2e-16   
ref|XP_006652413.1|  PREDICTED: BTB/POZ domain-containing protein...  84.7    2e-16   
ref|XP_003578134.1|  PREDICTED: BTB/POZ domain-containing protein...  84.7    2e-16   
ref|XP_010070650.1|  PREDICTED: BTB/POZ domain-containing protein...  84.7    2e-16   
ref|XP_006664149.1|  PREDICTED: BTB/POZ domain-containing protein...  84.3    2e-16   
ref|XP_010942083.1|  PREDICTED: BTB/POZ domain-containing protein...  84.3    3e-16   
ref|XP_002525260.1|  signal transducer, putative                      84.0    3e-16   Ricinus communis
ref|XP_003564193.1|  PREDICTED: BTB/POZ domain-containing protein...  84.3    3e-16   
gb|AFW62813.1|  putative phototropic-responsive NPH3 family protein   84.3    3e-16   
ref|XP_008652721.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    3e-16   
emb|CDY69095.1|  BnaAnng29310D                                        84.0    3e-16   
ref|XP_004511848.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    3e-16   
ref|XP_007042621.1|  Phototropic-responsive NPH3 family protein i...  84.0    3e-16   
ref|XP_006600918.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    3e-16   
ref|XP_007042620.1|  Phototropic-responsive NPH3 family protein i...  84.0    4e-16   
ref|XP_006290800.1|  hypothetical protein CARUB_v10016907mg           84.0    4e-16   
ref|NP_001049315.2|  Os03g0205700                                     83.6    4e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008792560.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    4e-16   
gb|EEC74723.1|  hypothetical protein OsI_10448                        83.6    4e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_008238083.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    4e-16   
ref|XP_009103410.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    5e-16   
emb|CBI22467.3|  unnamed protein product                              83.2    5e-16   
ref|XP_007204979.1|  hypothetical protein PRUPE_ppa002844mg           83.6    5e-16   
ref|XP_006343206.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    5e-16   
ref|XP_008679715.1|  PREDICTED: transposon protein Mutator sub-cl...  83.6    5e-16   
ref|XP_011092512.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    5e-16   
ref|XP_009776135.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    5e-16   
ref|XP_006422840.1|  hypothetical protein CICLE_v10028033mg           83.6    5e-16   
ref|XP_010687360.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    5e-16   
gb|KHG04716.1|  BTB/POZ domain-containing NPY2 -like protein          83.2    6e-16   
ref|XP_010687359.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    6e-16   
ref|XP_008440372.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    6e-16   
ref|XP_011092513.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    6e-16   
ref|XP_010488917.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    6e-16   
ref|XP_002515424.1|  protein binding protein, putative                83.2    6e-16   
ref|XP_010467261.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    7e-16   
ref|NP_001146578.1|  uncharacterized protein LOC100280174             83.2    7e-16   
ref|XP_010687361.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    7e-16   
gb|KDO78947.1|  hypothetical protein CISIN_1g041399mg                 83.2    7e-16   
ref|XP_006579937.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    7e-16   
ref|XP_010907392.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    7e-16   
ref|XP_002264153.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    7e-16   
ref|XP_006426078.1|  hypothetical protein CICLE_v10027450mg           83.2    8e-16   
ref|XP_004231915.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    8e-16   
ref|XP_009631537.1|  PREDICTED: BTB/POZ domain-containing protein...  82.8    8e-16   
ref|XP_003611607.1|  BTB/POZ domain-containing protein                82.8    8e-16   
ref|XP_006339807.1|  PREDICTED: BTB/POZ domain-containing protein...  82.8    8e-16   
ref|XP_006649594.1|  PREDICTED: BTB/POZ domain-containing protein...  82.8    8e-16   
ref|XP_010525901.1|  PREDICTED: BTB/POZ domain-containing protein...  82.8    9e-16   
ref|XP_006339810.1|  PREDICTED: BTB/POZ domain-containing protein...  82.8    9e-16   
ref|XP_010467259.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    9e-16   
ref|XP_006283419.1|  hypothetical protein CARUB_v10004469mg           81.6    9e-16   
gb|KHN23238.1|  BTB/POZ domain-containing protein NPY2                82.4    1e-15   
ref|XP_006297197.1|  hypothetical protein CARUB_v10013204mg           82.4    1e-15   
ref|XP_003550011.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    1e-15   
ref|XP_006466475.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    1e-15   
ref|XP_004244531.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    1e-15   
gb|EMT18058.1|  Coleoptile phototropism protein 1                     82.8    1e-15   
ref|XP_004156852.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  82.4    1e-15   
ref|XP_004152268.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    1e-15   
ref|XP_007011711.1|  Phototropic-responsive NPH3 family protein i...  82.4    1e-15   
gb|EAZ21022.1|  hypothetical protein OsJ_36671                        82.4    1e-15   
ref|XP_011011590.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    1e-15   
gb|EAY83679.1|  hypothetical protein OsI_38903                        82.0    1e-15   
ref|NP_001067147.1|  Os12g0583500                                     82.0    2e-15   
ref|XP_007011710.1|  Phototropic-responsive NPH3 family protein i...  82.0    2e-15   
ref|XP_010277066.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    2e-15   
ref|XP_009626485.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    2e-15   
ref|XP_003544563.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    2e-15   
ref|XP_008341028.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    2e-15   
ref|XP_006283420.1|  hypothetical protein CARUB_v10004469mg           81.6    2e-15   
ref|XP_011001843.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    2e-15   
ref|XP_007136940.1|  hypothetical protein PHAVU_009G086900g           82.0    2e-15   
gb|ADL36611.1|  BZIP domain class transcription factor                82.0    2e-15   
ref|XP_010437988.1|  PREDICTED: BTB/POZ domain-containing protein...  81.6    2e-15   
emb|CBI33702.3|  unnamed protein product                              81.6    2e-15   
gb|KHG00065.1|  BTB/POZ domain-containing protein NPY1                82.0    2e-15   
ref|XP_002284345.1|  PREDICTED: BTB/POZ domain-containing protein...  81.6    2e-15   
ref|XP_010232705.1|  PREDICTED: BTB/POZ domain-containing protein...  81.6    2e-15   
ref|XP_010272331.1|  PREDICTED: BTB/POZ domain-containing protein...  81.6    2e-15   
ref|NP_001151545.1|  transposon protein Mutator sub-class             81.6    3e-15   
ref|NP_001063200.1|  Os09g0420900                                     81.6    3e-15   
gb|EAZ09128.1|  hypothetical protein OsI_31397                        81.6    3e-15   
ref|XP_010232704.1|  PREDICTED: BTB/POZ domain-containing protein...  81.6    3e-15   
ref|XP_010432811.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    3e-15   
ref|XP_002527501.1|  signal transducer, putative                      81.3    3e-15   
ref|XP_004141870.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    3e-15   
gb|KHG00066.1|  BTB/POZ domain-containing protein NPY1                82.0    3e-15   
ref|XP_006409633.1|  hypothetical protein EUTSA_v10023006mg           81.3    3e-15   
ref|XP_002462390.1|  hypothetical protein SORBIDRAFT_02g024890        81.3    3e-15   
gb|KHN48289.1|  BTB/POZ domain-containing protein                     81.3    3e-15   
gb|KHN37088.1|  BTB/POZ domain-containing protein NPY1                81.3    3e-15   
ref|XP_003550246.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    3e-15   
ref|XP_006594148.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    3e-15   
ref|XP_002300262.2|  hypothetical protein POPTR_0001s30270g           81.3    3e-15   
ref|XP_007201732.1|  hypothetical protein PRUPE_ppa002913mg           81.3    3e-15   
ref|XP_008236444.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    3e-15   
ref|XP_008338429.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    3e-15   
ref|XP_007155836.1|  hypothetical protein PHAVU_003G235700g           81.3    3e-15   
ref|XP_002313906.1|  phototropic-responsive NPH3 family protein       81.3    3e-15   
gb|EMT16012.1|  BTB/POZ domain-containing protein                     81.3    3e-15   
ref|XP_009347119.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    3e-15   
gb|AAM13843.1|  unknown protein                                       80.9    3e-15   
ref|NP_194910.2|  BTB/POZ domain-containing protein NPY1              80.9    3e-15   
ref|XP_008352545.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    3e-15   
ref|XP_010447547.1|  PREDICTED: BTB/POZ domain-containing protein...  80.9    3e-15   
ref|XP_010526711.1|  PREDICTED: BTB/POZ domain-containing protein...  80.9    3e-15   
ref|XP_010101025.1|  BTB/POZ domain-containing protein NPY1           80.9    4e-15   
ref|XP_004248766.1|  PREDICTED: BTB/POZ domain-containing protein...  80.9    4e-15   
emb|CDP07841.1|  unnamed protein product                              80.9    4e-15   
ref|XP_004164379.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  80.9    4e-15   
ref|XP_002306504.2|  hypothetical protein POPTR_0005s19010g           80.9    4e-15   
gb|KHF97345.1|  BTB/POZ domain-containing NPY5 -like protein          80.5    4e-15   
ref|XP_009379321.1|  PREDICTED: BTB/POZ domain-containing protein...  80.9    5e-15   
gb|KHN29631.1|  BTB/POZ domain-containing protein NPY1                80.5    5e-15   
ref|XP_003522372.1|  PREDICTED: BTB/POZ domain-containing protein...  80.5    5e-15   
ref|XP_010670801.1|  PREDICTED: BTB/POZ domain-containing protein...  80.5    5e-15   
ref|XP_009335385.1|  PREDICTED: BTB/POZ domain-containing protein...  80.5    6e-15   
ref|XP_003541674.1|  PREDICTED: BTB/POZ domain-containing protein...  80.5    6e-15   
ref|XP_008803708.1|  PREDICTED: BTB/POZ domain-containing protein...  80.5    6e-15   
ref|XP_010942827.1|  PREDICTED: BTB/POZ domain-containing protein...  80.5    6e-15   
ref|XP_009347295.1|  PREDICTED: BTB/POZ domain-containing protein...  80.1    7e-15   
ref|XP_006411871.1|  hypothetical protein EUTSA_v10024767mg           80.1    7e-15   
gb|KDP44480.1|  hypothetical protein JCGZ_16313                       80.1    7e-15   
ref|XP_011034060.1|  PREDICTED: BTB/POZ domain-containing protein...  80.1    7e-15   
ref|XP_008442684.1|  PREDICTED: BTB/POZ domain-containing protein...  80.1    7e-15   
ref|XP_006353967.1|  PREDICTED: BTB/POZ domain-containing protein...  80.1    7e-15   
emb|CBI21142.3|  unnamed protein product                              80.1    8e-15   
ref|XP_002285522.2|  PREDICTED: BTB/POZ domain-containing protein...  80.1    8e-15   
ref|XP_004234653.1|  PREDICTED: BTB/POZ domain-containing protein...  79.7    9e-15   
ref|XP_008787168.1|  PREDICTED: BTB/POZ domain-containing protein...  79.7    1e-14   
ref|XP_004496882.1|  PREDICTED: BTB/POZ domain-containing protein...  79.7    1e-14   
gb|EAZ31088.1|  hypothetical protein OsJ_15185                        79.7    1e-14   
ref|XP_008366255.1|  PREDICTED: BTB/POZ domain-containing protein...  79.7    1e-14   
ref|XP_011036689.1|  PREDICTED: BTB/POZ domain-containing protein...  79.7    1e-14   
ref|XP_003536987.1|  PREDICTED: BTB/POZ domain-containing protein...  79.3    1e-14   
ref|XP_011030353.1|  PREDICTED: BTB/POZ domain-containing protein...  79.3    1e-14   
dbj|BAK06168.1|  predicted protein                                    79.3    1e-14   
ref|XP_008346361.1|  PREDICTED: BTB/POZ domain-containing protein...  79.3    1e-14   
ref|XP_011081969.1|  PREDICTED: BTB/POZ domain-containing protein...  79.3    1e-14   
ref|XP_010275834.1|  PREDICTED: BTB/POZ domain-containing protein...  79.3    1e-14   
gb|EPS65621.1|  hypothetical protein M569_09155                       79.3    1e-14   
ref|XP_010464031.1|  PREDICTED: BTB/POZ domain-containing protein...  79.3    1e-14   
ref|XP_010547549.1|  PREDICTED: BTB/POZ domain-containing protein...  79.3    1e-14   
ref|NP_001147935.1|  signal transducer                                79.3    2e-14   
ref|XP_010444645.1|  PREDICTED: BTB/POZ domain-containing protein...  79.0    2e-14   
ref|XP_003588859.1|  BTB/POZ domain-containing protein                79.3    2e-14   
ref|XP_010425371.1|  PREDICTED: BTB/POZ domain-containing protein...  79.0    2e-14   
ref|XP_006660633.1|  PREDICTED: BTB/POZ domain-containing protein...  79.0    2e-14   
ref|XP_008794358.1|  PREDICTED: BTB/POZ domain-containing protein...  79.0    2e-14   
ref|XP_009138500.1|  PREDICTED: BTB/POZ domain-containing protein...  79.0    2e-14   
emb|CDY29566.1|  BnaA03g54110D                                        79.0    2e-14   
gb|KFK32774.1|  hypothetical protein AALP_AA6G286900                  78.6    2e-14   
ref|XP_010484495.1|  PREDICTED: BTB/POZ domain-containing protein...  78.6    2e-14   
emb|CDX81314.1|  BnaC09g07250D                                        78.6    2e-14   
ref|XP_007222020.1|  hypothetical protein PRUPE_ppa002969mg           78.6    2e-14   
ref|XP_009781793.1|  PREDICTED: BTB/POZ domain-containing protein...  78.6    2e-14   
ref|XP_010939136.1|  PREDICTED: BTB/POZ domain-containing protein...  78.6    2e-14   
ref|XP_010548457.1|  PREDICTED: BTB/POZ domain-containing protein...  78.6    3e-14   
ref|XP_003592479.1|  BTB/POZ domain-containing protein                78.6    3e-14   
ref|XP_008365065.1|  PREDICTED: BTB/POZ domain-containing protein...  77.8    3e-14   
gb|EYU21991.1|  hypothetical protein MIMGU_mgv1a003050mg              78.6    3e-14   
ref|XP_002324913.2|  hypothetical protein POPTR_0018s02590g           78.6    3e-14   
emb|CDX81462.1|  BnaC09g08730D                                        78.6    3e-14   
ref|XP_008454387.1|  PREDICTED: BTB/POZ domain-containing protein...  78.6    3e-14   
ref|XP_004498809.1|  PREDICTED: BTB/POZ domain-containing protein...  78.6    3e-14   
ref|XP_009388923.1|  PREDICTED: BTB/POZ domain-containing protein...  78.6    3e-14   
emb|CDY37223.1|  BnaA09g08440D                                        78.2    3e-14   
ref|XP_009363621.1|  PREDICTED: BTB/POZ domain-containing protein...  78.2    3e-14   
ref|XP_008379044.1|  PREDICTED: BTB/POZ domain-containing protein...  78.2    3e-14   
ref|XP_010921983.1|  PREDICTED: BTB/POZ domain-containing protein...  78.2    3e-14   
emb|CBI32738.3|  unnamed protein product                              77.8    4e-14   
ref|XP_007144352.1|  hypothetical protein PHAVU_007G148900g           78.2    4e-14   
ref|XP_003536583.1|  PREDICTED: BTB/POZ domain-containing protein...  78.2    4e-14   
ref|XP_010653574.1|  PREDICTED: BTB/POZ domain-containing protein...  78.2    4e-14   
ref|XP_007143108.1|  hypothetical protein PHAVU_007G044300g           78.2    4e-14   
ref|XP_010653573.1|  PREDICTED: BTB/POZ domain-containing protein...  78.2    4e-14   
gb|KDO67444.1|  hypothetical protein CISIN_1g007148mg                 77.4    4e-14   
ref|XP_006362513.1|  PREDICTED: BTB/POZ domain-containing protein...  77.8    4e-14   
ref|XP_010048297.1|  PREDICTED: BTB/POZ domain-containing protein...  77.8    4e-14   
ref|XP_002276233.2|  PREDICTED: BTB/POZ domain-containing protein...  77.8    4e-14   
gb|KHG03398.1|  BTB/POZ domain-containing NPY1 -like protein          77.8    5e-14   
ref|XP_006450279.1|  hypothetical protein CICLE_v10007764mg           77.8    5e-14   
ref|XP_006280223.1|  hypothetical protein CARUB_v10026140mg           77.8    5e-14   
ref|XP_004137826.1|  PREDICTED: BTB/POZ domain-containing protein...  77.8    5e-14   
gb|KHN42319.1|  BTB/POZ domain-containing protein NPY2                77.8    5e-14   
ref|XP_003555987.1|  PREDICTED: BTB/POZ domain-containing protein...  77.8    5e-14   
ref|XP_007161085.1|  hypothetical protein PHAVU_001G041700g           77.8    6e-14   
ref|XP_004289798.1|  PREDICTED: BTB/POZ domain-containing protein...  77.4    6e-14   
ref|XP_009397397.1|  PREDICTED: BTB/POZ domain-containing protein...  77.4    7e-14   
ref|XP_010517747.1|  PREDICTED: BTB/POZ domain-containing protein...  77.0    8e-14   
gb|AAK96885.1|  photoreceptor-interacting protein-like                76.6    1e-13   
ref|NP_201545.1|  MAB4/ENP/NPY1-LIKE 2                                76.6    1e-13   
ref|XP_006295878.1|  hypothetical protein CARUB_v10025008mg           76.3    1e-13   
ref|XP_009123215.1|  PREDICTED: BTB/POZ domain-containing protein...  76.6    1e-13   
ref|NP_179089.1|  BTB/POZ domain-containing protein NPY2              76.6    1e-13   
ref|XP_008776743.1|  PREDICTED: BTB/POZ domain-containing protein...  76.3    1e-13   
ref|XP_004291961.1|  PREDICTED: BTB/POZ domain-containing protein...  76.3    2e-13   
ref|XP_003526168.1|  PREDICTED: BTB/POZ domain-containing protein...  76.3    2e-13   
gb|AAK96859.1|  putative protein                                      75.9    2e-13   
ref|XP_006354400.1|  PREDICTED: BTB/POZ domain-containing protein...  75.9    2e-13   
emb|CBI31449.3|  unnamed protein product                              75.9    2e-13   
ref|XP_002274032.1|  PREDICTED: BTB/POZ domain-containing protein...  75.9    2e-13   
ref|XP_010446647.1|  PREDICTED: BTB/POZ domain-containing protein...  75.9    2e-13   
ref|XP_002314596.2|  hypothetical protein POPTR_0010s05690g           75.9    3e-13   
ref|XP_010432046.1|  PREDICTED: BTB/POZ domain-containing protein...  75.5    3e-13   
ref|XP_006393947.1|  hypothetical protein EUTSA_v10003889mg           75.5    3e-13   
ref|XP_010472303.1|  PREDICTED: BTB/POZ domain-containing protein...  75.1    3e-13   
ref|XP_009396038.1|  PREDICTED: BTB/POZ domain-containing protein...  75.5    3e-13   
ref|XP_009596601.1|  PREDICTED: BTB/POZ domain-containing protein...  75.5    3e-13   
ref|XP_006282580.1|  hypothetical protein CARUB_v10004449mg           75.5    3e-13   
ref|XP_008243946.1|  PREDICTED: BTB/POZ domain-containing protein...  75.5    3e-13   
emb|CDX72639.1|  BnaC07g46610D                                        75.5    3e-13   
ref|XP_006363693.1|  PREDICTED: BTB/POZ domain-containing protein...  75.5    3e-13   
gb|KHG11360.1|  BTB/POZ domain-containing NPY1 -like protein          75.5    3e-13   
ref|XP_010437207.1|  PREDICTED: BTB/POZ domain-containing protein...  75.1    4e-13   
ref|XP_007208631.1|  hypothetical protein PRUPE_ppa018795mg           75.5    4e-13   
ref|XP_010417060.1|  PREDICTED: BTB/POZ domain-containing protein...  74.7    4e-13   
ref|XP_009383097.1|  PREDICTED: BTB/POZ domain-containing protein...  75.1    4e-13   
ref|XP_006646392.1|  PREDICTED: BTB/POZ domain-containing protein...  72.4    4e-13   
ref|XP_010429248.1|  PREDICTED: BTB/POZ domain-containing protein...  74.7    4e-13   
ref|XP_009140445.1|  PREDICTED: BTB/POZ domain-containing protein...  74.7    4e-13   
ref|XP_004970185.1|  PREDICTED: BTB/POZ domain-containing protein...  75.1    4e-13   
ref|NP_001130814.1|  putative phototropic-resoponsive NPH3 family...  75.1    4e-13   
ref|XP_009112216.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  74.7    5e-13   
emb|CDY18660.1|  BnaA09g07350D                                        74.7    5e-13   
emb|CDY12846.1|  BnaC07g15870D                                        74.7    5e-13   
emb|CDY38923.1|  BnaA04g13440D                                        74.3    5e-13   
ref|XP_010679621.1|  PREDICTED: BTB/POZ domain-containing protein...  74.7    6e-13   
gb|KFK29782.1|  hypothetical protein AALP_AA7G178600                  74.3    8e-13   
ref|NP_568030.1|  protein NAKED PINS IN YUC MUTANTS 5                 74.3    8e-13   
dbj|BAF02155.1|  hypothetical protein                                 74.3    8e-13   
ref|XP_010929164.1|  PREDICTED: BTB/POZ domain-containing protein...  74.3    8e-13   
ref|XP_007147947.1|  hypothetical protein PHAVU_006G168000g           73.9    1e-12   
ref|XP_010939734.1|  PREDICTED: root phototropism protein 3           73.9    1e-12   
ref|XP_009411058.1|  PREDICTED: BTB/POZ domain-containing protein...  73.9    1e-12   
ref|XP_009418169.1|  PREDICTED: BTB/POZ domain-containing protein...  73.6    1e-12   
ref|XP_002309676.1|  hypothetical protein POPTR_0006s28010g           73.6    1e-12   
ref|XP_010923665.1|  PREDICTED: BTB/POZ domain-containing protein...  73.6    1e-12   
gb|EMT21458.1|  BTB/POZ domain-containing protein                     73.2    1e-12   
ref|XP_008658463.1|  PREDICTED: uncharacterized protein LOC100279...  73.6    1e-12   



>ref|XP_002525040.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF37367.1| Root phototropism protein, putative [Ricinus communis]
Length=591

 Score =   149 bits (376),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F+TE+ TR+VISD+P DL I IN+I YL+HKFPLLPKCGLLQRLC  +
Sbjct  1    MKFMKLGTRPDTFYTEEATRSVISDIPSDLVIRINNINYLLHKFPLLPKCGLLQRLCPDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            +DS  I +ELHDIPGGEEAFELCAK
Sbjct  61   DDSSTITIELHDIPGGEEAFELCAK  85



>emb|CDP04549.1| unnamed protein product [Coffea canephora]
Length=588

 Score =   147 bits (372),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F+TE+ TRTVIS VP DLT+ IN+I+Y +HK PLLPKCGLLQ+LCS +
Sbjct  1    MKFMKLGTRPDTFYTEEATRTVISGVPTDLTVRINNISYHLHKLPLLPKCGLLQQLCSVS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            E+SGN+ LELHDIPGGE AFELCAK
Sbjct  61   EESGNVTLELHDIPGGENAFELCAK  85



>ref|XP_007026407.1| Root phototropism protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007026410.1| Root phototropism protein, putative isoform 1 [Theobroma cacao]
 gb|EOY29029.1| Root phototropism protein, putative isoform 1 [Theobroma cacao]
 gb|EOY29032.1| Root phototropism protein, putative isoform 1 [Theobroma cacao]
Length=579

 Score =   146 bits (369),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+TE+ TRTVISD+P DLTI IN+I YL+HKFPL+P CGLLQRLCS +
Sbjct  1    MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICYLLHKFPLVPTCGLLQRLCSDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            EDS  + ++LHDIPGGE+AFELCAK
Sbjct  61   EDSDIVIIDLHDIPGGEDAFELCAK  85



>ref|XP_011095883.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X2 [Sesamum indicum]
Length=529

 Score =   146 bits (368),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F+TE+ TRTV+SDVP DLT+ IN +TYL+HK+PLLPK GLLQRLCS +
Sbjct  1    MKFMKLGTRPDTFYTEEATRTVMSDVPSDLTVQINDVTYLLHKYPLLPKSGLLQRLCSES  60

Query  75   EDSGN-IALELHDIPGGEEAFELCAK  1
            +D  N +AL+LHDIPGGEEAFELCAK
Sbjct  61   DDRSNSVALDLHDIPGGEEAFELCAK  86



>ref|XP_006449993.1| hypothetical protein CICLE_v10014681mg [Citrus clementina]
 gb|ESR63233.1| hypothetical protein CICLE_v10014681mg [Citrus clementina]
Length=595

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GT+PD F+TE+ TRTVISD P DL I +N+I YL+HKFPLLPKCGLLQRLCS  
Sbjct  1    MKFMKLGTKPDTFYTEEATRTVISDAPSDLVIQVNNIRYLLHKFPLLPKCGLLQRLCSDP  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            EDS ++ +ELHDIPGGE+AFELCAK
Sbjct  61   EDSDSVTIELHDIPGGEDAFELCAK  85



>ref|XP_002323131.2| hypothetical protein POPTR_0016s00530g [Populus trichocarpa]
 gb|EEF04892.2| hypothetical protein POPTR_0016s00530g [Populus trichocarpa]
Length=593

 Score =   145 bits (367),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 62/85 (73%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD FFTE+ TR+VISD+P DL I IN+I +L+H+F LLPKCGLLQRLCS +
Sbjct  1    MKFMKLGTRPDTFFTENATRSVISDIPSDLVIRINNINFLLHQFSLLPKCGLLQRLCSDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            EDS  + +ELHDIPGGE+AFELCAK
Sbjct  61   EDSNTVTIELHDIPGGEDAFELCAK  85



>ref|XP_006467218.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X3 [Citrus sinensis]
 gb|KDO78663.1| hypothetical protein CISIN_1g007644mg [Citrus sinensis]
 gb|KDO78664.1| hypothetical protein CISIN_1g007644mg [Citrus sinensis]
 gb|KDO78665.1| hypothetical protein CISIN_1g007644mg [Citrus sinensis]
Length=595

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GT+PD F+TE+ TRTVISD P DL I +N+I YL+HKFPLLPKCGLLQRLCS  
Sbjct  1    MKFMKLGTKPDTFYTEEATRTVISDAPSDLVIQVNNIRYLLHKFPLLPKCGLLQRLCSDP  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            EDS ++ +ELHDIPGGE+AFELCAK
Sbjct  61   EDSDSVTIELHDIPGGEDAFELCAK  85



>ref|XP_011086288.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X2 [Sesamum indicum]
Length=671

 Score =   145 bits (367),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  258  EMKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            +MKFMK+G  PD F+TE+ TRTV+SDVP DLTI IN+ITYL+HK+ LLPKCGLLQRL S 
Sbjct  72   DMKFMKLGAGPDTFYTEEATRTVLSDVPSDLTIRINNITYLLHKYSLLPKCGLLQRLSSE  131

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             EDS N+AL+LHDIPGG+EAFELCAK
Sbjct  132  KEDSTNVALDLHDIPGGDEAFELCAK  157



>ref|XP_007211380.1| hypothetical protein PRUPE_ppa002800mg [Prunus persica]
 gb|EMJ12579.1| hypothetical protein PRUPE_ppa002800mg [Prunus persica]
Length=632

 Score =   145 bits (365),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F TE+ TRTVISDVP DL I IN+I+YL+HKFPL+PKCGLLQRLCS +
Sbjct  1    MKFMKIGTKPDTFCTEEATRTVISDVPSDLLIQINNISYLLHKFPLVPKCGLLQRLCSDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS  +++ELHDIPGGE+AFELCAK
Sbjct  61   GDSEKVSIELHDIPGGEDAFELCAK  85



>gb|EYU27638.1| hypothetical protein MIMGU_mgv1a003699mg [Erythranthe guttata]
 gb|EYU27639.1| hypothetical protein MIMGU_mgv1a003699mg [Erythranthe guttata]
Length=569

 Score =   143 bits (361),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 77/87 (89%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F+TE+ TRTVISDVP D+TI IN++TYL+HKFPLLPKCGLLQRL + +
Sbjct  1    MKFMKLGTRPDTFYTEEATRTVISDVPSDVTIRINNVTYLLHKFPLLPKCGLLQRLYTES  60

Query  75   ED--SGNIALELHDIPGGEEAFELCAK  1
            ED  SG++ L+L DIPGG+EAFELCAK
Sbjct  61   EDSISGHVTLDLTDIPGGDEAFELCAK  87



>ref|XP_008224648.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Prunus 
mume]
Length=632

 Score =   144 bits (362),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F TE+ +RTVISDVP DL I IN+I+YL+HKFPL+PKCGLLQRLCS +
Sbjct  1    MKFMKIGTKPDTFCTEEASRTVISDVPSDLLIQINNISYLLHKFPLVPKCGLLQRLCSDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS  +++ELHDIPGGE+AFELCAK
Sbjct  61   GDSEKVSIELHDIPGGEDAFELCAK  85



>ref|XP_010646247.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X2 [Vitis vinifera]
 emb|CBI25736.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   143 bits (361),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F+TE+ TRTV SDVP DL I IN+ITYL+HKFPLLPKCGLLQRL + +
Sbjct  1    MKFMKLGTRPDTFYTEEATRTVSSDVPSDLVIRINNITYLLHKFPLLPKCGLLQRLLTDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS N ++ELHDIPGGE+AFELCAK
Sbjct  61   GDSDNDSVELHDIPGGEDAFELCAK  85



>ref|XP_009374833.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X3 [Pyrus x bretschneideri]
Length=422

 Score =   141 bits (356),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+TE+ TRTVISDVP D  I IN+I YL+HKFPLLPKCGLLQRLCS +
Sbjct  1    MKFMKIGTKPDTFYTEEATRTVISDVPSDFVIQINNIHYLLHKFPLLPKCGLLQRLCSDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             D   ++++LHDIPGGE+AFE+CAK
Sbjct  61   GDLEKVSIKLHDIPGGEDAFEMCAK  85



>ref|XP_006467216.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Citrus sinensis]
 ref|XP_006467217.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X2 [Citrus sinensis]
Length=597

 Score =   142 bits (357),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLCS  82
            MKFMK+GT+PD F+TE+ TRTVISD P DL I +N+I YL+HK  FPLLPKCGLLQRLCS
Sbjct  1    MKFMKLGTKPDTFYTEEATRTVISDAPSDLVIQVNNIRYLLHKLQFPLLPKCGLLQRLCS  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
              EDS ++ +ELHDIPGGE+AFELCAK
Sbjct  61   DPEDSDSVTIELHDIPGGEDAFELCAK  87



>ref|XP_010096492.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB64612.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=794

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGTRPD F+TE+  RT+ISDVP DL+I IN+I+YL+HKF L P+CGLLQRLCS +
Sbjct  1    MKFMKIGTRPDTFYTEEAVRTLISDVPSDLSIQINNISYLLHKFSLFPRCGLLQRLCSDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            +DS N+ +ELHDIPGGE+AFELCAK
Sbjct  61   DDSENVTIELHDIPGGEDAFELCAK  85


 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 56/89 (63%), Gaps = 18/89 (20%)
 Frame = -3

Query  228  PDAFFTEDGTRTVISDVPGDL---------TITI---NSITYLIH-KFPLLPKCGLLQRL  88
            P  ++TED     ISD+  D+         TI I     I   +H +F L P+CGLLQRL
Sbjct  196  PKDWWTED-----ISDLDIDMFRCIMTALRTINILQPQLIGEALHLQFSLFPRCGLLQRL  250

Query  87   CSSAEDSGNIALELHDIPGGEEAFELCAK  1
            CS ++DS N+ +ELHDIPGGE+AFELCAK
Sbjct  251  CSDSDDSENVTIELHDIPGGEDAFELCAK  279



>ref|XP_009374827.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009374828.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009374829.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009374830.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Pyrus x bretschneideri]
Length=621

 Score =   142 bits (357),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+TE+ TRTVISDVP D  I IN+I YL+HKFPLLPKCGLLQRLCS +
Sbjct  1    MKFMKIGTKPDTFYTEEATRTVISDVPSDFVIQINNIHYLLHKFPLLPKCGLLQRLCSDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             D   ++++LHDIPGGE+AFE+CAK
Sbjct  61   GDLEKVSIKLHDIPGGEDAFEMCAK  85



>ref|XP_007026409.1| Root phototropism protein, putative isoform 3 [Theobroma cacao]
 gb|EOY29031.1| Root phototropism protein, putative isoform 3 [Theobroma cacao]
Length=580

 Score =   142 bits (357),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGT-RTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMKIGT+PD F+TE+ T RTVISD+P DLTI IN+I YL+HKFPL+P CGLLQRLCS 
Sbjct  1    MKFMKIGTKPDTFYTEEATSRTVISDIPSDLTIRINNICYLLHKFPLVPTCGLLQRLCSD  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            +EDS  + ++LHDIPGGE+AFELCAK
Sbjct  61   SEDSDIVIIDLHDIPGGEDAFELCAK  86



>ref|XP_007026408.1| Root phototropism protein, putative isoform 2 [Theobroma cacao]
 gb|EOY29030.1| Root phototropism protein, putative isoform 2 [Theobroma cacao]
Length=581

 Score =   141 bits (356),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLCS  82
            MKFMKIGT+PD F+TE+ TRTVISD+P DLTI IN+I YL+HK  FPL+P CGLLQRLCS
Sbjct  1    MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICYLLHKLQFPLVPTCGLLQRLCS  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
             +EDS  + ++LHDIPGGE+AFELCAK
Sbjct  61   DSEDSDIVIIDLHDIPGGEDAFELCAK  87



>ref|XP_011095882.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Sesamum indicum]
Length=531

 Score =   141 bits (355),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 64/88 (73%), Positives = 76/88 (86%), Gaps = 3/88 (3%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLCS  82
            MKFMK+GTRPD F+TE+ TRTV+SDVP DLT+ IN +TYL+HK  +PLLPK GLLQRLCS
Sbjct  1    MKFMKLGTRPDTFYTEEATRTVMSDVPSDLTVQINDVTYLLHKLQYPLLPKSGLLQRLCS  60

Query  81   SAEDSGN-IALELHDIPGGEEAFELCAK  1
             ++D  N +AL+LHDIPGGEEAFELCAK
Sbjct  61   ESDDRSNSVALDLHDIPGGEEAFELCAK  88



>ref|XP_011040135.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X2 [Populus euphratica]
Length=593

 Score =   141 bits (355),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD FFTE+ TR+VISD+  DL I IN+I +L+H+F LLPKCGLLQRLC+ +
Sbjct  1    MKFMKLGTRPDTFFTEEATRSVISDITSDLVIRINNINFLLHQFSLLPKCGLLQRLCTDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            EDS  + +ELHDIPGGE+AFELCAK
Sbjct  61   EDSNTVTIELHDIPGGEDAFELCAK  85



>ref|XP_011086289.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X3 [Sesamum indicum]
Length=601

 Score =   140 bits (354),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLCS  82
            MKFMK+G  PD F+TE+ TRTV+SDVP DLTI IN+ITYL+HK  + LLPKCGLLQRL S
Sbjct  1    MKFMKLGAGPDTFYTEEATRTVLSDVPSDLTIRINNITYLLHKLQYSLLPKCGLLQRLSS  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
              EDS N+AL+LHDIPGG+EAFELCAK
Sbjct  61   EKEDSTNVALDLHDIPGGDEAFELCAK  87



>ref|XP_009358099.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Pyrus 
x bretschneideri]
Length=622

 Score =   140 bits (354),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+ E+ TRTVISD P D  I IN+I YL+H FPLLPKCGLLQRLCS +
Sbjct  1    MKFMKIGTKPDTFYAEEATRTVISDAPSDFVIEINNINYLLHTFPLLPKCGLLQRLCSHS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS  +++ELHDIPGGE+AFE+CAK
Sbjct  61   GDSEKVSIELHDIPGGEDAFEMCAK  85



>ref|XP_011086287.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Sesamum indicum]
Length=673

 Score =   140 bits (354),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 2/88 (2%)
 Frame = -3

Query  258  EMKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLC  85
            +MKFMK+G  PD F+TE+ TRTV+SDVP DLTI IN+ITYL+HK  + LLPKCGLLQRL 
Sbjct  72   DMKFMKLGAGPDTFYTEEATRTVLSDVPSDLTIRINNITYLLHKLQYSLLPKCGLLQRLS  131

Query  84   SSAEDSGNIALELHDIPGGEEAFELCAK  1
            S  EDS N+AL+LHDIPGG+EAFELCAK
Sbjct  132  SEKEDSTNVALDLHDIPGGDEAFELCAK  159



>ref|XP_004499337.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Cicer arietinum]
 ref|XP_004499338.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X2 [Cicer arietinum]
 ref|XP_004499339.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X3 [Cicer arietinum]
Length=605

 Score =   139 bits (350),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTR D F+TE  TRT+ SD+P DL I IN +TYL+HKF LLPKCGLLQRLC  +
Sbjct  1    MKFMKLGTRQDTFYTEQATRTLTSDIPSDLVIQINDVTYLLHKFALLPKCGLLQRLCCDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS ++ LELHDIPGGE+AFELCAK
Sbjct  61   SDSESVTLELHDIPGGEDAFELCAK  85



>ref|XP_011005754.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X2 [Populus euphratica]
Length=561

 Score =   139 bits (349),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F+TE+ TR+V+SD+P DL I I++I YL+H+F LLPKCGLLQRLC+ +
Sbjct  1    MKFMKLGTRPDTFYTEEATRSVVSDIPNDLVIQISNINYLLHQFSLLPKCGLLQRLCADS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            +DS  + ++LHDIPGGE+AFELCAK
Sbjct  61   DDSSAVTIQLHDIPGGEDAFELCAK  85



>ref|XP_003637604.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|KEH32706.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=605

 Score =   139 bits (349),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F+TE  TRT+ S++P DL I IN +TYL+HKF LLPKCGLLQRLC  +
Sbjct  1    MKFMKLGTRPDTFYTEQATRTLTSEIPSDLVIQINDVTYLLHKFALLPKCGLLQRLCYDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS +  +ELHDIPGGE+AFELCAK
Sbjct  61   SDSESFTVELHDIPGGEDAFELCAK  85



>gb|KHG09801.1| hypothetical protein F383_02074 [Gossypium arboreum]
Length=567

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+TE+ TRTVISD+P DLTI I+++ +L+HK PL+PKCGLLQRLCS A
Sbjct  1    MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRIDNVCFLLHKIPLVPKCGLLQRLCSDA  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            +DS  + ++LHD+PGGE+AFELCAK
Sbjct  61   DDSDIVTIDLHDVPGGEDAFELCAK  85



>gb|KHN03557.1| BTB/POZ domain-containing protein [Glycine soja]
Length=583

 Score =   138 bits (348),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GT+ D F+TE  TRT+IS++  DL I IN ITYL+HKFPLLPKCGLLQRLC   
Sbjct  1    MKFMKLGTKADTFYTEQATRTLISEIAADLVIQINDITYLLHKFPLLPKCGLLQRLCYDT  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS +++LELHDIPGGE+AFELCAK
Sbjct  61   SDSESVSLELHDIPGGEDAFELCAK  85



>ref|XP_010646238.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Vitis vinifera]
 ref|XP_010646240.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Vitis vinifera]
 ref|XP_010646241.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Vitis vinifera]
 ref|XP_010646242.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Vitis vinifera]
 ref|XP_010646243.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Vitis vinifera]
 ref|XP_010646244.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Vitis vinifera]
 ref|XP_010646246.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Vitis vinifera]
Length=595

 Score =   138 bits (348),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLCS  82
            MKFMK+GTRPD F+TE+ TRTV SDVP DL I IN+ITYL+HK  FPLLPKCGLLQRL +
Sbjct  1    MKFMKLGTRPDTFYTEEATRTVSSDVPSDLVIRINNITYLLHKLQFPLLPKCGLLQRLLT  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
             + DS N ++ELHDIPGGE+AFELCAK
Sbjct  61   DSGDSDNDSVELHDIPGGEDAFELCAK  87



>ref|XP_003550464.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Glycine max]
Length=583

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GT+ D F+TE  TRT+IS++  DL I IN ITYL+HKFPLLPKCGLLQRLC   
Sbjct  1    MKFMKLGTKADTFYTEQATRTLISEIAADLVIQINDITYLLHKFPLLPKCGLLQRLCYDT  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS +++LELHDIPGGE+AFELCAK
Sbjct  61   SDSESVSLELHDIPGGEDAFELCAK  85



>gb|KDP35543.1| hypothetical protein JCGZ_08981 [Jatropha curcas]
Length=592

 Score =   137 bits (345),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLCS  82
            MKFMK+GTRPD F+TE+ TR VISD+P DL I +N+I+YL+HK  FPL+PKCG LQRLC 
Sbjct  1    MKFMKLGTRPDTFYTEEATRCVISDIPSDLVIRVNNISYLLHKLQFPLVPKCGFLQRLCP  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
              +DS  + +ELHD+PGGEEAFELCAK
Sbjct  61   DPDDSSIVTIELHDLPGGEEAFELCAK  87



>ref|XP_007147574.1| hypothetical protein PHAVU_006G136000g [Phaseolus vulgaris]
 gb|ESW19568.1| hypothetical protein PHAVU_006G136000g [Phaseolus vulgaris]
Length=603

 Score =   137 bits (344),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F+TE  TR+V+SDV  DL I IN  TYL+HK  LLPKCGLLQRLCS +
Sbjct  1    MKFMKLGTRPDTFYTEQATRSVVSDVQADLVIKINETTYLLHKSSLLPKCGLLQRLCSDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS N+ LELHD+PGG +AFELCAK
Sbjct  61   SDSENVPLELHDMPGGADAFELCAK  85



>ref|XP_011040125.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Populus euphratica]
 ref|XP_011040126.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Populus euphratica]
 ref|XP_011040127.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Populus euphratica]
 ref|XP_011040128.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Populus euphratica]
 ref|XP_011040129.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Populus euphratica]
 ref|XP_011040130.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Populus euphratica]
 ref|XP_011040131.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Populus euphratica]
 ref|XP_011040133.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Populus euphratica]
 ref|XP_011040134.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Populus euphratica]
Length=595

 Score =   136 bits (342),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 60/87 (69%), Positives = 73/87 (84%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLCS  82
            MKFMK+GTRPD FFTE+ TR+VISD+  DL I IN+I +L+H+  F LLPKCGLLQRLC+
Sbjct  1    MKFMKLGTRPDTFFTEEATRSVISDITSDLVIRINNINFLLHQLQFSLLPKCGLLQRLCT  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
             +EDS  + +ELHDIPGGE+AFELCAK
Sbjct  61   DSEDSNTVTIELHDIPGGEDAFELCAK  87



>ref|XP_002308748.2| hypothetical protein POPTR_0006s00490g [Populus trichocarpa]
 gb|EEE92271.2| hypothetical protein POPTR_0006s00490g [Populus trichocarpa]
Length=561

 Score =   135 bits (339),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTR D F+TE+ TR+V+SD+P DL I I++I YL+H+F LLPKCGLLQRLC+ +
Sbjct  1    MKFMKLGTRLDTFYTEEATRSVVSDIPNDLVIQISNINYLLHQFSLLPKCGLLQRLCADS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            +DS  + ++LHDIPGGE+AFELCAK
Sbjct  61   DDSSTVTIQLHDIPGGEDAFELCAK  85



>gb|KHN40229.1| BTB/POZ domain-containing protein [Glycine soja]
Length=584

 Score =   135 bits (339),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GT+ D F+TE  TRT+IS++  DL I IN ITYL+HKFPLLPKCGLLQR C   
Sbjct  1    MKFMKLGTKADTFYTEQATRTLISEIVVDLVIQINDITYLLHKFPLLPKCGLLQRFCCDT  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS +++LELHDIPGGE+AFELCAK
Sbjct  61   SDSESVSLELHDIPGGEDAFELCAK  85



>ref|XP_003529682.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Glycine max]
Length=585

 Score =   135 bits (339),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GT+ D F+TE  TRT+IS++  DL I IN ITYL+HKFPLLPKCGLLQR C   
Sbjct  1    MKFMKLGTKADTFYTEQATRTLISEIVVDLVIQINDITYLLHKFPLLPKCGLLQRFCCDT  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS +++LELHDIPGGE+AFELCAK
Sbjct  61   SDSESVSLELHDIPGGEDAFELCAK  85



>ref|XP_011005734.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005735.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005736.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005737.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005738.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005739.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005740.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005742.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005743.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005744.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005745.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005746.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005747.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005748.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005749.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005750.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005751.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005752.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
 ref|XP_011005753.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Populus euphratica]
Length=563

 Score =   134 bits (336),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 57/87 (66%), Positives = 74/87 (85%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLCS  82
            MKFMK+GTRPD F+TE+ TR+V+SD+P DL I I++I YL+H+  F LLPKCGLLQRLC+
Sbjct  1    MKFMKLGTRPDTFYTEEATRSVVSDIPNDLVIQISNINYLLHQLQFSLLPKCGLLQRLCA  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
             ++DS  + ++LHDIPGGE+AFELCAK
Sbjct  61   DSDDSSAVTIQLHDIPGGEDAFELCAK  87



>ref|XP_006600279.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X2 [Glycine max]
 ref|XP_006600280.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X3 [Glycine max]
 ref|XP_006600281.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X4 [Glycine max]
 ref|XP_006600282.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X5 [Glycine max]
Length=585

 Score =   133 bits (335),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLCS  82
            MKFMK+GT+ D F+TE  TRT+IS++  DL I IN ITYL+HK  FPLLPKCGLLQRLC 
Sbjct  1    MKFMKLGTKADTFYTEQATRTLISEIAADLVIQINDITYLLHKLQFPLLPKCGLLQRLCY  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
               DS +++LELHDIPGGE+AFELCAK
Sbjct  61   DTSDSESVSLELHDIPGGEDAFELCAK  87



>ref|XP_004293414.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Fragaria 
vesca subsp. vesca]
Length=628

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+TE  TR+V SDVP DL I IN+++YL+HKFPLLPKCGLLQ+LC  +
Sbjct  1    MKFMKIGTKPDTFYTERATRSVASDVPSDLLIQINNVSYLLHKFPLLPKCGLLQQLCCDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
                 + +ELHDIPGGEEAFELCAK
Sbjct  61   GGPEKVNIELHDIPGGEEAFELCAK  85



>ref|XP_010252837.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Nelumbo nucifera]
Length=565

 Score =   132 bits (333),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 61/86 (71%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F+TE+ TR+V SDVP DL I IN+I YL+HKFPLLPKCGLLQRLCS A
Sbjct  1    MKFMKLGTRPDTFYTEEATRSVSSDVPSDLIIQINNIKYLLHKFPLLPKCGLLQRLCSDA  60

Query  75   EDSGNI-ALELHDIPGGEEAFELCAK  1
             +   I  + LHD PGGE AFELCAK
Sbjct  61   GNHSEIPVVGLHDAPGGEAAFELCAK  86



>ref|XP_008797736.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Phoenix 
dactylifera]
Length=567

 Score =   132 bits (332),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+GT+PD F+TE+  R+V+SDVP D+ I INS  YL+HKFPLL KCGLLQRLCS A
Sbjct  1    MKYMKLGTKPDTFYTEEAVRSVLSDVPTDIIIHINSTKYLLHKFPLLLKCGLLQRLCSDA  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
            ED  +  I + LHD+PGGEEAFELCAK
Sbjct  61   EDDSDQPIPIALHDVPGGEEAFELCAK  87



>ref|XP_010052491.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X2 [Eucalyptus grandis]
 gb|KCW76556.1| hypothetical protein EUGRSUZ_D00944 [Eucalyptus grandis]
Length=598

 Score =   131 bits (330),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 69/85 (81%), Gaps = 2/85 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F+TE+ TRTV SD P DL + IN++ YL+HKF LLPKCGLLQ+LC   
Sbjct  1    MKFMKLGTRPDTFYTEEATRTVTSDTPPDLILRINNVNYLLHKFSLLPKCGLLQQLCPV-  59

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             D G I L+LHDIPGGEEAFE+CAK
Sbjct  60   -DDGEITLDLHDIPGGEEAFEMCAK  83



>ref|XP_003547299.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Glycine max]
 ref|XP_006597619.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X2 [Glycine max]
 ref|XP_006597620.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X3 [Glycine max]
 ref|XP_006597621.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X4 [Glycine max]
 ref|XP_006597622.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X5 [Glycine max]
 ref|XP_006597623.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X6 [Glycine max]
 ref|XP_006597624.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X7 [Glycine max]
Length=603

 Score =   131 bits (329),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F++E  TR+++SD+P DL I I   TYL+HK  LLPKCGLL+RLCS +
Sbjct  1    MKFMKLGTRPDTFYSEQATRSLVSDIPSDLVIKIYDTTYLLHKSSLLPKCGLLRRLCSDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS N+ LELHD+PGG +AFE+CAK
Sbjct  61   SDSENVPLELHDMPGGADAFEICAK  85



>gb|KHN40773.1| BTB/POZ domain-containing protein [Glycine soja]
Length=599

 Score =   130 bits (328),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F++E  TR+++SD+P DL I I   TYL+HK  LLPKCGLLQRLCS +
Sbjct  1    MKFMKLGTRPDTFYSEQATRSLVSDIPADLVIKIYDTTYLLHKSSLLPKCGLLQRLCSDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
              S N+ LELHD+PGG +AFELCAK
Sbjct  61   SGSENVPLELHDMPGGADAFELCAK  85



>ref|XP_003534987.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Glycine max]
 ref|XP_006586789.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X2 [Glycine max]
 ref|XP_006586790.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X3 [Glycine max]
 ref|XP_006586791.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X4 [Glycine max]
 ref|XP_006586792.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X5 [Glycine max]
 ref|XP_006586793.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X6 [Glycine max]
 ref|XP_006586794.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X7 [Glycine max]
 ref|XP_006586795.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X8 [Glycine max]
Length=599

 Score =   130 bits (328),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F++E  TR+++SD+P DL I I   TYL+HK  LLPKCGLLQRLCS +
Sbjct  1    MKFMKLGTRPDTFYSEQATRSLVSDIPADLVIKIYDTTYLLHKSSLLPKCGLLQRLCSDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
              S N+ LELHD+PGG +AFELCAK
Sbjct  61   SGSENVPLELHDMPGGADAFELCAK  85



>ref|XP_010245016.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Nelumbo 
nucifera]
 ref|XP_010245017.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Nelumbo 
nucifera]
 ref|XP_010245020.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Nelumbo 
nucifera]
 ref|XP_010245021.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Nelumbo 
nucifera]
 ref|XP_010245022.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Nelumbo 
nucifera]
 ref|XP_010245023.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Nelumbo 
nucifera]
Length=572

 Score =   130 bits (327),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTR D F+TE+  R+V SDVP DLTI IN+I YL+HKFPLLPKCGLLQ LCS  
Sbjct  1    MKFMKLGTRHDTFYTEEANRSVSSDVPSDLTIQINNIKYLLHKFPLLPKCGLLQGLCSDT  60

Query  75   EDSGNIA-LELHDIPGGEEAFELCAK  1
            ++   I+ +ELH IPGGEEAFELCAK
Sbjct  61   DNPSEISVVELHLIPGGEEAFELCAK  86



>ref|XP_010942558.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Elaeis 
guineensis]
 ref|XP_010942559.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Elaeis 
guineensis]
Length=567

 Score =   130 bits (326),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 57/87 (66%), Positives = 71/87 (82%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+GT+PD F+TE+  R+V+SDVP D+ I +NS  YL+HKFPLL KCGLLQRLCS A
Sbjct  1    MKYMKLGTKPDIFYTEEAVRSVLSDVPTDIIIHVNSTKYLLHKFPLLLKCGLLQRLCSDA  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
            +D  +  I + LHD+PGGEEAFELCAK
Sbjct  61   DDDSDQPIPIALHDVPGGEEAFELCAK  87



>ref|XP_006584110.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X2 [Glycine max]
 ref|XP_006584111.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X3 [Glycine max]
Length=587

 Score =   130 bits (326),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 59/87 (68%), Positives = 70/87 (80%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLCS  82
            MKFMK+GT+ D F+TE  TRT+IS++  DL I IN ITYL+HK  FPLLPKCGLLQR C 
Sbjct  1    MKFMKLGTKADTFYTEQATRTLISEIVVDLVIQINDITYLLHKLQFPLLPKCGLLQRFCC  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
               DS +++LELHDIPGGE+AFELCAK
Sbjct  61   DTSDSESVSLELHDIPGGEDAFELCAK  87



>ref|XP_008458941.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g47800-like [Cucumis melo]
Length=572

 Score =   130 bits (326),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 7/92 (8%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLCS  82
            MKFMK+GTRPD F T++ TRTVIS+ P DL+I IN+ITYLIHK  FP++PKCGLLQRLCS
Sbjct  1    MKFMKLGTRPDTFHTQEATRTVISETPSDLSIKINNITYLIHKLQFPVVPKCGLLQRLCS  60

Query  81   SAEDSGN-----IALELHDIPGGEEAFELCAK  1
            +   S N     I +ELH+IPGGE+ FELCAK
Sbjct  61   NHSSSKNNGDEKIRIELHEIPGGEDGFELCAK  92



>ref|XP_004158832.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Cucumis 
sativus]
Length=607

 Score =   130 bits (327),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD+F+TE  TRTV+SDVPG++ I I++ ++L+HKF LLPKCGLLQ LC   
Sbjct  1    MKFMKLGTRPDSFYTEAATRTVLSDVPGNIVICIDNFSFLLHKFQLLPKCGLLQHLCPDL  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS    +ELHD+PGG EAFELCAK
Sbjct  61   GDSNIATIELHDVPGGAEAFELCAK  85



>ref|XP_008440966.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Cucumis 
melo]
 ref|XP_008440967.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Cucumis 
melo]
 ref|XP_008440968.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Cucumis 
melo]
Length=600

 Score =   130 bits (326),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD+F+TE  TRTV+SDVPG++ I I++ ++L+HKF LLPKCGLLQ LC   
Sbjct  1    MKFMKLGTRPDSFYTEAATRTVLSDVPGNIVICIDNFSFLLHKFQLLPKCGLLQHLCPDL  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS    +ELHD+PGG EAFELCAK
Sbjct  61   GDSNIATIELHDVPGGAEAFELCAK  85



>ref|XP_004486375.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X2 [Cicer arietinum]
Length=592

 Score =   130 bits (326),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTR D F+TE  TR+++SD+P DL + IN  TYL+HK PLL KCGLLQRLCS  
Sbjct  1    MKFMKLGTRSDTFYTEQATRSLVSDIPPDLVMKINDTTYLLHKSPLLRKCGLLQRLCSDT  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS ++ LELHD+PGG +AFELCAK
Sbjct  61   NDSESVPLELHDMPGGPDAFELCAK  85



>ref|XP_004134813.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Cucumis 
sativus]
 gb|KGN49022.1| hypothetical protein Csa_6G510890 [Cucumis sativus]
Length=600

 Score =   130 bits (326),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD+F+TE  TRTV+SDVPG++ I I++ ++L+HKF LLPKCGLLQ LC   
Sbjct  1    MKFMKLGTRPDSFYTEAATRTVLSDVPGNIVICIDNFSFLLHKFQLLPKCGLLQHLCPDL  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS    +ELHD+PGG EAFELCAK
Sbjct  61   GDSNIATIELHDVPGGAEAFELCAK  85



>ref|XP_010929030.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Elaeis guineensis]
Length=559

 Score =   128 bits (322),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/87 (64%), Positives = 72/87 (83%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+GT+PD F+TE+  R+V+SDVP DL I INS  +L+HKFPLL KCGLLQR CSS 
Sbjct  1    MKYMKLGTKPDTFYTEEAVRSVLSDVPADLIIHINSTKFLLHKFPLLLKCGLLQRFCSSI  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
            +++ +  I++ LHD+PGGEEAFELCAK
Sbjct  61   DNNSDQPISIALHDVPGGEEAFELCAK  87



>ref|XP_003594335.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES64586.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=573

 Score =   129 bits (323),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTR D F+TE  TR+++SD+P DL I  N  TYLIHK PL+ KCGLLQRLCS  
Sbjct  1    MKFMKLGTRSDTFYTEQATRSLVSDIPPDLVIKTNDTTYLIHKSPLVSKCGLLQRLCSDT  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS ++ LEL+D+PGG EAFELCAK
Sbjct  61   NDSKSVPLELNDMPGGSEAFELCAK  85



>gb|KHN14408.1| BTB/POZ domain-containing protein [Glycine soja]
Length=614

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F++E  TR+++SD+P DL I I   TYL+HK  LLPKCGLL+RLCS +
Sbjct  1    MKFMKLGTRPDTFYSEQATRSLVSDIPSDLVIKIYDTTYLLHKSSLLPKCGLLRRLCSDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             DS N+ LELHD+PGG +AFE+CAK
Sbjct  61   SDSENVPLELHDMPGGADAFEICAK  85



>ref|XP_010052486.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010052487.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010052489.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010052490.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Eucalyptus grandis]
 gb|KCW76555.1| hypothetical protein EUGRSUZ_D00944 [Eucalyptus grandis]
Length=600

 Score =   126 bits (317),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/87 (68%), Positives = 69/87 (79%), Gaps = 4/87 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK--FPLLPKCGLLQRLCS  82
            MKFMK+GTRPD F+TE+ TRTV SD P DL + IN++ YL+HK  F LLPKCGLLQ+LC 
Sbjct  1    MKFMKLGTRPDTFYTEEATRTVTSDTPPDLILRINNVNYLLHKLQFSLLPKCGLLQQLCP  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
               D G I L+LHDIPGGEEAFE+CAK
Sbjct  61   V--DDGEITLDLHDIPGGEEAFEMCAK  85



>ref|XP_004486374.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Cicer arietinum]
Length=594

 Score =   126 bits (316),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/87 (64%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKF--PLLPKCGLLQRLCS  82
            MKFMK+GTR D F+TE  TR+++SD+P DL + IN  TYL+HK   PLL KCGLLQRLCS
Sbjct  1    MKFMKLGTRSDTFYTEQATRSLVSDIPPDLVMKINDTTYLLHKLQSPLLRKCGLLQRLCS  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
               DS ++ LELHD+PGG +AFELCAK
Sbjct  61   DTNDSESVPLELHDMPGGPDAFELCAK  87



>ref|XP_009391906.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391907.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391908.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391909.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391910.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391911.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391912.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Musa 
acuminata subsp. malaccensis]
Length=546

 Score =   125 bits (313),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 55/87 (63%), Positives = 70/87 (80%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+G +PD F+T + TR+V+SDVP DL I +N+  YL+HKFPLLPKCG +QRLCS  
Sbjct  1    MKYMKLGIKPDTFYTGEATRSVLSDVPTDLIIHVNNTKYLLHKFPLLPKCGFIQRLCSDT  60

Query  75   E-DSGN-IALELHDIPGGEEAFELCAK  1
            + D+G  I + LHD+PGGEEAFELCAK
Sbjct  61   DTDAGQAIPVALHDVPGGEEAFELCAK  87



>emb|CDX77798.1| BnaC07g20520D [Brassica napus]
Length=561

 Score =   125 bits (313),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+T+DG+R +I+D P DL I IN+ +Y +H+  L+PKCGLL+RLC+ +
Sbjct  1    MKFMKIGTKPDTFYTQDGSRILITDSPNDLVIRINNTSYHLHRSSLVPKCGLLRRLCTDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            E+S ++ +EL+DIPGG +AFELCAK
Sbjct  61   EESDSVTIELNDIPGGADAFELCAK  85



>ref|XP_008783002.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g47800 [Phoenix dactylifera]
Length=556

 Score =   125 bits (313),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 55/87 (63%), Positives = 70/87 (80%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+GT+PD F+TE+  R+V+SDVP DL I  NS  +L+HKFPLL KCGLLQR CS+ 
Sbjct  1    MKYMKLGTKPDTFYTEEAVRSVLSDVPADLIIRTNSTKFLLHKFPLLLKCGLLQRFCSNI  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
            + + +  I++ LHDIPGGEEAFELCAK
Sbjct  61   DSNSDQPISIALHDIPGGEEAFELCAK  87



>ref|XP_009101384.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Brassica 
rapa]
Length=561

 Score =   124 bits (311),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+T+DG+R +++D P DL I IN+ +Y +H+  L+PKCGLL+RLC+ +
Sbjct  1    MKFMKIGTKPDTFYTQDGSRILVTDSPNDLVIRINNTSYHLHRSSLVPKCGLLRRLCTDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            E+S ++ +EL+DIPGG +AFELCAK
Sbjct  61   EESDSVTIELNDIPGGADAFELCAK  85



>emb|CDY17704.1| BnaA06g35230D [Brassica napus]
Length=561

 Score =   124 bits (311),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+T+DG+R +++D P DL I IN+ +Y +H+  L+PKCGLL+RLC+ +
Sbjct  1    MKFMKIGTKPDTFYTQDGSRILVTDSPNDLVIRINNTSYHLHRSSLVPKCGLLRRLCTDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            E+S ++ +EL+DIPGG +AFELCAK
Sbjct  61   EESDSVTIELNDIPGGADAFELCAK  85



>ref|XP_006398482.1| hypothetical protein EUTSA_v10000839mg [Eutrema salsugineum]
 gb|ESQ39935.1| hypothetical protein EUTSA_v10000839mg [Eutrema salsugineum]
Length=562

 Score =   123 bits (308),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+T+D +R +I+D P DL I I+S TY +H+  L+PKCGLL+RLC+ +
Sbjct  1    MKFMKIGTKPDTFYTQDSSRILITDTPNDLVIRIDSTTYHLHRSSLVPKCGLLRRLCTDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            E+S ++ +EL+DIPGG +AFELCAK
Sbjct  61   EESDSVTIELNDIPGGADAFELCAK  85



>dbj|BAJ34459.1| unnamed protein product [Thellungiella halophila]
Length=562

 Score =   123 bits (308),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+T+D +R +I+D P DL I I+S TY +H+  L+PKCGLL+RLC+ +
Sbjct  1    MKFMKIGTKPDTFYTQDSSRILITDTPNDLVIRIDSTTYHLHRSSLVPKCGLLRRLCTDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            E+S ++ +EL+DIPGG +AFELCAK
Sbjct  61   EESDSVTIELNDIPGGADAFELCAK  85



>ref|XP_009392311.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009392312.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=561

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 70/87 (80%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+GT+PD F+TE+  R+V+SDVP DL I + +  YL+HKFPLL KCGL+QRLCS+A
Sbjct  1    MKYMKLGTKPDTFYTEEAVRSVLSDVPTDLIIHVKNTKYLLHKFPLLLKCGLIQRLCSNA  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
            ++     I + LHDIPGGEEAFELCAK
Sbjct  61   DNETGQPIPIALHDIPGGEEAFELCAK  87



>ref|NP_001148012.1| protein binding protein [Zea mays]
 ref|XP_008651421.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 ref|XP_008651422.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 ref|XP_008651423.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 gb|ACG29390.1| protein binding protein [Zea mays]
 gb|ACL54792.1| unknown [Zea mays]
 tpg|DAA60840.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
 gb|AIB05662.1| orphans transcription factor, partial [Zea mays]
Length=581

 Score =   122 bits (307),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 52/87 (60%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+G++PD F+TE+  R+V+SD+P DL I +N+  Y +HKFPLL KCGLLQRLCS  
Sbjct  1    MKYMKLGSKPDTFYTEEAVRSVVSDIPADLIIHVNNTKYQLHKFPLLLKCGLLQRLCSDT  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
            +D     + + LHDIPGGE+AFELCAK
Sbjct  61   DDGDEEPVPVALHDIPGGEQAFELCAK  87



>ref|XP_006281573.1| hypothetical protein CARUB_v10027680mg [Capsella rubella]
 gb|EOA14471.1| hypothetical protein CARUB_v10027680mg [Capsella rubella]
Length=595

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 75/98 (77%), Gaps = 5/98 (5%)
 Frame = -3

Query  294  IKFYIYSYIAK*EMKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLL  115
            I + +YS     +MKFMKIGT+PD F+T+D +R +I+D P DL I IN+ TY +H+  L+
Sbjct  33   IPYLVYS-----KMKFMKIGTKPDTFYTQDASRILITDSPNDLVIRINNTTYHLHRSSLV  87

Query  114  PKCGLLQRLCSSAEDSGNIALELHDIPGGEEAFELCAK  1
            PKCGLL RLC+ +E+S ++ +EL+DIPGG +AFELCAK
Sbjct  88   PKCGLLSRLCTDSEESDSLTIELNDIPGGADAFELCAK  125



>ref|XP_004956349.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Setaria italica]
 ref|XP_004956350.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X2 [Setaria italica]
 ref|XP_004956351.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X3 [Setaria italica]
 ref|XP_004956352.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X4 [Setaria italica]
 ref|XP_004956353.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X5 [Setaria italica]
Length=582

 Score =   122 bits (306),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/86 (63%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+GT+PD F+TE+  R+V+SDVP DL I +N+  Y +HKFPLL KCGLLQRLCS  
Sbjct  1    MKYMKLGTKPDTFYTEEAVRSVVSDVPADLIIHVNNTKYELHKFPLLLKCGLLQRLCSDT  60

Query  75   EDSGN-IALELHDIPGGEEAFELCAK  1
             D    + + LHDIPGGE+AFELCAK
Sbjct  61   GDEEEPVPVALHDIPGGEDAFELCAK  86



>ref|XP_004159120.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Cucumis 
sativus]
Length=575

 Score =   120 bits (302),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 5/90 (6%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F T++ TRTVIS+ P DL I IN+ITYLIHKFP++ KCGLLQRLCS+ 
Sbjct  1    MKFMKLGTRPDTFHTQEATRTVISETPSDLIIKINNITYLIHKFPVVAKCGLLQRLCSNH  60

Query  75   EDSG-----NIALELHDIPGGEEAFELCAK  1
              S       I +ELH+IPGG + FELCAK
Sbjct  61   SSSNNNGDEKIRIELHEIPGGGDGFELCAK  90



>ref|XP_004139595.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Cucumis 
sativus]
 gb|KGN64976.1| hypothetical protein Csa_1G170000 [Cucumis sativus]
Length=575

 Score =   120 bits (302),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 5/90 (6%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F T++ TRTVIS+ P DL I IN+ITYLIHKFP++ KCGLLQRLCS+ 
Sbjct  1    MKFMKLGTRPDTFHTQEATRTVISETPSDLIIKINNITYLIHKFPVVAKCGLLQRLCSNH  60

Query  75   EDSG-----NIALELHDIPGGEEAFELCAK  1
              S       I +ELH+IPGG + FELCAK
Sbjct  61   SSSNNNGDEKIRIELHEIPGGGDGFELCAK  90



>ref|NP_199591.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
 sp|Q9FIK1.1|Y5780_ARATH RecName: Full=BTB/POZ domain-containing protein At5g47800 [Arabidopsis 
thaliana]
 dbj|BAB11327.1| photoreceptor-interacting protein-like [Arabidopsis thaliana]
 gb|AAO64165.1| putative photoreceptor-interacting protein [Arabidopsis thaliana]
 gb|AAP04068.1| putative photoreceptor-interacting protein [Arabidopsis thaliana]
 dbj|BAF00434.1| photoreceptor-interacting like protein [Arabidopsis thaliana]
 gb|AED95573.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
Length=559

 Score =   120 bits (300),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+T++ +R +I+D P DL I IN+ TY +H+  L+PKCGLL+RLC+  
Sbjct  1    MKFMKIGTKPDTFYTQEASRILITDTPNDLVIRINNTTYHLHRSCLVPKCGLLRRLCTDL  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            E+S  + +EL+DIPGG +AFELCAK
Sbjct  61   EESDTVTIELNDIPGGADAFELCAK  85



>ref|XP_010495804.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Camelina 
sativa]
Length=420

 Score =   118 bits (296),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 49/85 (58%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+T+D +R +I+D P DL + IN+ TY +H+  L+PKCGLL RL + +
Sbjct  1    MKFMKIGTKPDTFYTQDASRILITDTPNDLVVRINNTTYHLHRSSLVPKCGLLPRLFTDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            E+S ++ +EL+DIPGG +AFELCAK
Sbjct  61   EESDSVTIELNDIPGGSDAFELCAK  85



>ref|XP_010481373.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X2 [Camelina sativa]
Length=534

 Score =   118 bits (296),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 49/85 (58%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+T+D +R +I+D P DL + IN+ TY +H+  L+PKCGLL RL + +
Sbjct  1    MKFMKIGTKPDTFYTQDASRILITDTPNDLVVRINNTTYHLHRSSLVPKCGLLPRLFTDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            E+S ++ +EL+DIPGG +AFELCAK
Sbjct  61   EESDSVTIELNDIPGGADAFELCAK  85



>ref|XP_010481372.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X1 [Camelina sativa]
Length=561

 Score =   118 bits (296),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 49/85 (58%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMKIGT+PD F+T+D +R +I+D P DL + IN+ TY +H+  L+PKCGLL RL + +
Sbjct  1    MKFMKIGTKPDTFYTQDASRILITDTPNDLVVRINNTTYHLHRSSLVPKCGLLPRLFTDS  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            E+S ++ +EL+DIPGG +AFELCAK
Sbjct  61   EESDSVTIELNDIPGGADAFELCAK  85



>ref|XP_010530083.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Tarenaya 
hassleriana]
 ref|XP_010530085.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Tarenaya 
hassleriana]
 ref|XP_010530086.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Tarenaya 
hassleriana]
 ref|XP_010530087.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Tarenaya 
hassleriana]
 ref|XP_010530088.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Tarenaya 
hassleriana]
Length=562

 Score =   117 bits (294),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/86 (59%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTV-ISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMKIGT+PD F+TE+ TRT  I+D P DL + IN I Y +H+  +LPK GLLQRLCS 
Sbjct  1    MKFMKIGTKPDTFYTEEATRTAKITDTPNDLVVRINYIAYRLHRLWILPKSGLLQRLCSE  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            +++S ++ +EL+D+PGG +AFELCAK
Sbjct  61   SDESDSVTVELNDMPGGADAFELCAK  86



>ref|XP_009392307.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392308.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392309.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392310.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=565

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTR----TVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRL  88
            MK+MK+GT+PD F+TE+  R    +V+SDVP DL I + +  YL+HKFPLL KCGL+QRL
Sbjct  1    MKYMKLGTKPDTFYTEEAVRCICRSVLSDVPTDLIIHVKNTKYLLHKFPLLLKCGLIQRL  60

Query  87   CSSAEDSGN--IALELHDIPGGEEAFELCAK  1
            CS+A++     I + LHDIPGGEEAFELCAK
Sbjct  61   CSNADNETGQPIPIALHDIPGGEEAFELCAK  91



>ref|XP_006661061.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like [Oryza 
brachyantha]
Length=453

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 68/107 (64%), Gaps = 22/107 (21%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK-----------------  127
            MK+MK+GT+PD F+TE+  R+V+SDVP DL I +N+  Y +HK                 
Sbjct  1    MKYMKLGTKPDTFYTEEAVRSVLSDVPADLIIHVNNTKYQLHKLKFCAHYENAATEGTGS  60

Query  126  -----FPLLPKCGLLQRLCSSAEDSGNIALELHDIPGGEEAFELCAK  1
                 FPLL KCGLLQRLC+  +D   + + LHDIPGGEEAFELCAK
Sbjct  61   NPHYQFPLLLKCGLLQRLCADTDDEPPLPVVLHDIPGGEEAFELCAK  107



>gb|EMT26192.1| BTB/POZ domain-containing protein [Aegilops tauschii]
Length=513

 Score =   114 bits (285),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 9/94 (10%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTR-------TVISDVPGDLTITINSITYLIHKFPLLPKCGLL  97
            MK+MK+G++PD F+TE   R       +V+SD+P DL I +N+  Y +HKFPLL KCGLL
Sbjct  1    MKYMKLGSKPDTFYTEQAVRVYLWLGRSVVSDIPADLIIHVNNTKYQLHKFPLLLKCGLL  60

Query  96   QRLCS--SAEDSGNIALELHDIPGGEEAFELCAK  1
            QRLCS   A++   + + LHDIPGGEEAFE+CAK
Sbjct  61   QRLCSDTEADEQLPVPVALHDIPGGEEAFEICAK  94



>ref|XP_003577186.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Brachypodium 
distachyon]
 ref|XP_010237344.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Brachypodium 
distachyon]
 ref|XP_010237345.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Brachypodium 
distachyon]
 ref|XP_010237346.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Brachypodium 
distachyon]
 ref|XP_010237347.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Brachypodium 
distachyon]
 ref|XP_010237348.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Brachypodium 
distachyon]
 ref|XP_010237349.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Brachypodium 
distachyon]
 ref|XP_010237350.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Brachypodium 
distachyon]
 ref|XP_010237351.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 [Brachypodium 
distachyon]
Length=552

 Score =   114 bits (284),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+GT+PD F+TE   R+V SD+P DL I +N+  Y++HKFPLL KCGLLQRLC+  
Sbjct  1    MKYMKLGTKPDTFYTEQAVRSVASDIPADLIIHVNNTQYMLHKFPLLLKCGLLQRLCADT  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
            +   +  + + L DIPGG +AFELCAK
Sbjct  61   DTDTDEPVPVALDDIPGGPDAFELCAK  87



>ref|XP_010929031.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform 
X2 [Elaeis guineensis]
Length=553

 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 51/87 (59%), Positives = 67/87 (77%), Gaps = 8/87 (9%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+GT+PD F+TE+  R+V+SDVP DL I INS  +L+H      KCGLLQR CSS 
Sbjct  1    MKYMKLGTKPDTFYTEEAVRSVLSDVPADLIIHINSTKFLLH------KCGLLQRFCSSI  54

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
            +++ +  I++ LHD+PGGEEAFELCAK
Sbjct  55   DNNSDQPISIALHDVPGGEEAFELCAK  81



>gb|EEC84214.1| hypothetical protein OsI_30621 [Oryza sativa Indica Group]
Length=593

 Score =   112 bits (279),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 55/109 (50%), Positives = 69/109 (63%), Gaps = 24/109 (22%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK-----------------  127
            MK+MK+GT+PD F+TE+  R+V+SDVP DL I +N+  Y +HK                 
Sbjct  1    MKYMKLGTKPDTFYTEEAVRSVLSDVPADLIIHVNNTKYQLHKLKFCSHSENADTEGTGC  60

Query  126  -----FPLLPKCGLLQRLCSSAE--DSGNIALELHDIPGGEEAFELCAK  1
                 FPLL KCGLLQRLCS  +  D+  + + LHDIPGGEEAFELCAK
Sbjct  61   HPYYQFPLLLKCGLLQRLCSDDDGVDAAPVPVALHDIPGGEEAFELCAK  109



>gb|EEE69314.1| hypothetical protein OsJ_28600 [Oryza sativa Japonica Group]
Length=396

 Score =   106 bits (264),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 67/112 (60%), Gaps = 27/112 (24%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK-----------------  127
            MK+MK+GT+PD F+TE+  R+V+SDVP DL I +N+  Y +HK                 
Sbjct  1    MKYMKLGTKPDTFYTEEAVRSVLSDVPADLIIHVNNTKYQLHKLKFCSHSENADTEGTGC  60

Query  126  -----FPLLPKCGLLQRLCSSAEDSGN-----IALELHDIPGGEEAFELCAK  1
                 FPLL KCGLLQRLCS  +         + + LHDIPGGEEAFELCAK
Sbjct  61   HPYYQFPLLLKCGLLQRLCSDDDGVDGVDAAPVPVALHDIPGGEEAFELCAK  112



>ref|XP_009392315.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=555

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 65/87 (75%), Gaps = 8/87 (9%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+GT+PD F+TE+  R+V+SDVP DL I + +  YL+H      KCGL+QRLCS+A
Sbjct  1    MKYMKLGTKPDTFYTEEAVRSVLSDVPTDLIIHVKNTKYLLH------KCGLIQRLCSNA  54

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
            ++     I + LHDIPGGEEAFELCAK
Sbjct  55   DNETGQPIPIALHDIPGGEEAFELCAK  81



>dbj|BAD26466.1| putative non-phototropic hypocotyl 3 [Oryza sativa Japonica Group]
 dbj|BAD38423.1| putative non-phototropic hypocotyl 3 [Oryza sativa Japonica Group]
Length=594

 Score =   106 bits (265),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 67/112 (60%), Gaps = 27/112 (24%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHK-----------------  127
            MK+MK+GT+PD F+TE+  R+V+SDVP DL I +N+  Y +HK                 
Sbjct  1    MKYMKLGTKPDTFYTEEAVRSVLSDVPADLIIHVNNTKYQLHKLKFCSHSENADTEGTGC  60

Query  126  -----FPLLPKCGLLQRLCSSAEDSGN-----IALELHDIPGGEEAFELCAK  1
                 FPLL KCGLLQRLCS  +         + + LHDIPGGEEAFELCAK
Sbjct  61   HPYYQFPLLLKCGLLQRLCSDDDGVDGVDAAPVPVALHDIPGGEEAFELCAK  112



>ref|XP_010248658.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Nelumbo 
nucifera]
 ref|XP_010248659.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Nelumbo 
nucifera]
 ref|XP_010248660.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Nelumbo 
nucifera]
Length=624

 Score =   104 bits (260),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD FFT +  RTV ++V  DL + +    YL+HKFPLL KC  LQRLC+ S
Sbjct  1    MKFMKLGSRPDTFFTAEDVRTVSTEVSSDLILQVKETRYLLHKFPLLSKCLRLQRLCAES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S N  ++L D PGG EAFE+CAK
Sbjct  61   PESSQNQIIQLPDFPGGAEAFEICAK  86



>gb|KDO82222.1| hypothetical protein CISIN_1g006846mg [Citrus sinensis]
Length=478

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R++ S+V  DL I +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTSEAVRSISSEVSSDLIIQVKGTRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG +AFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGIDAFELCAK  86



>gb|KGN51751.1| hypothetical protein Csa_5G598100 [Cucumis sativus]
Length=599

 Score =   103 bits (257),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLC+ +
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVTSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCAES  60

Query  75   EDS-GNIALELHDIPGGEEAFELCAK  1
             DS  +  ++L D PGG EAFELCAK
Sbjct  61   SDSPQHQIVQLPDFPGGLEAFELCAK  86



>ref|XP_008446157.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Cucumis 
melo]
 ref|XP_008446158.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Cucumis 
melo]
Length=628

 Score =   103 bits (256),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLC+ +
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVTSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCAES  60

Query  75   EDS-GNIALELHDIPGGEEAFELCAK  1
             DS  +  ++L D PGG EAFELCAK
Sbjct  61   SDSPQHQIVQLPDFPGGLEAFELCAK  86



>ref|XP_004135274.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cucumis 
sativus]
Length=627

 Score =   103 bits (256),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLC+ +
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVTSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCAES  60

Query  75   EDS-GNIALELHDIPGGEEAFELCAK  1
             DS  +  ++L D PGG EAFELCAK
Sbjct  61   SDSPQHQIVQLPDFPGGLEAFELCAK  86



>ref|XP_006852352.1| hypothetical protein AMTR_s00049p00216130 [Amborella trichopoda]
 gb|ERN13819.1| hypothetical protein AMTR_s00049p00216130 [Amborella trichopoda]
Length=687

 Score =   103 bits (257),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G RPD F+T +  R+V S+V  DL I + +  YL+HKFPLL KCG LQ+ C   
Sbjct  1    MKFMKLGNRPDTFYTAEAVRSVSSEVTSDLVIQVRTSRYLLHKFPLLSKCGRLQKFCID-  59

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            +D+    +EL D PGG EAFELCAK
Sbjct  60   QDTTQDPIELPDFPGGAEAFELCAK  84



>ref|XP_004172442.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cucumis 
sativus]
Length=627

 Score =   103 bits (256),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLC+ +
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVTSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCAES  60

Query  75   EDS-GNIALELHDIPGGEEAFELCAK  1
             DS  +  ++L D PGG EAFELCAK
Sbjct  61   SDSPQHQIVQLPDFPGGLEAFELCAK  86



>ref|XP_007153783.1| hypothetical protein PHAVU_003G064600g [Phaseolus vulgaris]
 gb|ESW25777.1| hypothetical protein PHAVU_003G064600g [Phaseolus vulgaris]
Length=632

 Score =   103 bits (256),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  RT+ S+V  DL I +    YL+HKFPLL KC  LQRLCS +
Sbjct  1    MKFMKLGSRPDTFYTAESIRTISSEVSSDLIIQVKGTRYLLHKFPLLSKCLRLQRLCSES  60

Query  75   EDSGNIAL-ELHDIPGGEEAFELCAK  1
             DS    + +L + PGG EAFELCAK
Sbjct  61   SDSPQQQIVQLPEFPGGVEAFELCAK  86



>ref|XP_010100409.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB82543.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=645

 Score =   103 bits (256),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R++ S+V  DL I +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTTEAVRSISSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGVEAFELCAK  86



>ref|XP_008221906.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Prunus 
mume]
Length=631

 Score =   102 bits (255),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS-  79
            MKFMK+G+RPD F+T +  R V S+V  DL I +    YL+HKFPLL KC  LQRLCS  
Sbjct  1    MKFMKLGSRPDTFYTTEAVRPVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCSEY  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++LHD P G EAFELCAK
Sbjct  61   QEASQHQIIQLHDFPSGVEAFELCAK  86



>ref|XP_003613103.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES96061.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=636

 Score =   102 bits (254),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  RT+ S+V  DL I +    YL+HKFPLL KC  LQRLCS +
Sbjct  1    MKFMKLGSRPDTFYTSEAIRTISSEVSSDLIIQVRGSRYLLHKFPLLSKCLCLQRLCSES  60

Query  75   --EDSGNIALELHDIPGGEEAFELCAK  1
              + S +  ++L D PGG EAFELCAK
Sbjct  61   PPDSSHHQIVQLPDFPGGVEAFELCAK  87



>ref|XP_003552044.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Glycine 
max]
Length=632

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+R D F+T +  RT+ S+V  DL I +    YL+HKFPLL KC  LQRLCS +
Sbjct  1    MKFMKLGSRSDTFYTAESVRTISSEVSSDLIIQVKGTRYLLHKFPLLSKCLRLQRLCSES  60

Query  75   EDS-GNIALELHDIPGGEEAFELCAK  1
             DS  +  ++L D PGG EAFELCAK
Sbjct  61   SDSPQHQIVQLPDFPGGVEAFELCAK  86



>ref|XP_006357600.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Solanum 
tuberosum]
Length=628

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F T +  R+V S+V  DL + +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFITTEAVRSVNSEVVSDLIVQVKGSRYLLHKFPLLSKCSRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PETSQHQIVQLPDFPGGIEAFELCAK  86



>ref|XP_006483950.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483951.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483952.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform 
X3 [Citrus sinensis]
Length=629

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R++ S+V  DL I +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTSEAVRSISSEVSSDLIIQVKGTRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG +AFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGVDAFELCAK  86



>ref|XP_006438255.1| hypothetical protein CICLE_v10030958mg [Citrus clementina]
 ref|XP_006438256.1| hypothetical protein CICLE_v10030958mg [Citrus clementina]
 ref|XP_006438257.1| hypothetical protein CICLE_v10030958mg [Citrus clementina]
 gb|ESR51495.1| hypothetical protein CICLE_v10030958mg [Citrus clementina]
 gb|ESR51496.1| hypothetical protein CICLE_v10030958mg [Citrus clementina]
 gb|ESR51497.1| hypothetical protein CICLE_v10030958mg [Citrus clementina]
Length=629

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R++ S+V  DL I +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTSEAVRSISSEVSSDLIIQVKGTRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG +AFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGVDAFELCAK  86



>gb|KHG05824.1| hypothetical protein F383_32639 [Gossypium arboreum]
Length=629

 Score =   102 bits (253),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRL-CSS  79
            MKFMK+G+RPD F+T +  RTV S+V  DL I +    YL+HKFPLL KC  LQR+ C S
Sbjct  1    MKFMKLGSRPDTFYTAESVRTVSSEVSSDLIIEVKGCKYLLHKFPLLSKCLRLQRICCES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PETSQHQIIQLPDFPGGIEAFELCAK  86



>ref|XP_009392314.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=559

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 65/91 (71%), Gaps = 12/91 (13%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTR----TVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRL  88
            MK+MK+GT+PD F+TE+  R    +V+SDVP DL I + +  YL+HK      CGL+QRL
Sbjct  1    MKYMKLGTKPDTFYTEEAVRCICRSVLSDVPTDLIIHVKNTKYLLHK------CGLIQRL  54

Query  87   CSSAEDSGN--IALELHDIPGGEEAFELCAK  1
            CS+A++     I + LHDIPGGEEAFELCAK
Sbjct  55   CSNADNETGQPIPIALHDIPGGEEAFELCAK  85



>gb|KDO82220.1| hypothetical protein CISIN_1g006846mg [Citrus sinensis]
 gb|KDO82221.1| hypothetical protein CISIN_1g006846mg [Citrus sinensis]
Length=629

 Score =   101 bits (252),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R++ S+V  DL I +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTSEAVRSISSEVSSDLIIQVKGTRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG +AFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGIDAFELCAK  86



>ref|XP_009770852.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana 
sylvestris]
Length=616

 Score =   101 bits (251),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F T +  R+V S+V  DL + +    YL+HKFPLL KC  LQ+LCS S
Sbjct  1    MKFMKLGSRPDTFITTEAVRSVNSEVTSDLLVQVKGSRYLLHKFPLLSKCSRLQKLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PETSQHQIVQLPDFPGGIEAFELCAK  86



>ref|XP_009614413.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana 
tomentosiformis]
Length=617

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F T +  R+V S+V  DL + +    YL+HKFPLL KC  LQ+LCS S
Sbjct  1    MKFMKLGSRPDTFITTEAVRSVNSEVTSDLIVQVKGSRYLLHKFPLLSKCSRLQKLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PETSHHQIVQLPDFPGGIEAFELCAK  86



>ref|XP_010251055.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nelumbo 
nucifera]
Length=623

 Score =   100 bits (250),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R+V ++V  DL I +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVSTEVSSDLIIQLKGSRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG E FE+CAK
Sbjct  61   PESSQHQIIKLPDFPGGSETFEICAK  86



>ref|XP_004489774.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cicer 
arietinum]
Length=638

 Score =   100 bits (249),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  RT+ S+V  DL I +    YL+HKFPLL KC  LQRLCS +
Sbjct  1    MKFMKLGSRPDTFYTSETVRTISSEVSSDLIIQVKGSRYLLHKFPLLSKCLCLQRLCSES  60

Query  75   --EDSGNIALELHDIPGGEEAFELCAK  1
              + S +  ++L D PGG EAFE+CAK
Sbjct  61   PPDSSHHQIVQLPDFPGGVEAFEVCAK  87



>ref|XP_002452387.1| hypothetical protein SORBIDRAFT_04g024760 [Sorghum bicolor]
 gb|EES05363.1| hypothetical protein SORBIDRAFT_04g024760 [Sorghum bicolor]
Length=643

 Score =   100 bits (249),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 48/85 (56%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD FFT D  R+V ++V  DL I +++  Y +HKFPLL KC LLQ LC+ A
Sbjct  1    MKFMKLGTRPDTFFTADSVRSVCTEVATDLQILVDNCIYHLHKFPLLSKCMLLQALCADA  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             D     +EL   PGG EAFE CAK
Sbjct  61   GD----VVELPGFPGGAEAFEACAK  81



>gb|EPS63042.1| hypothetical protein M569_11744, partial [Genlisea aurea]
Length=581

 Score =   100 bits (248),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS-  79
            MKFMK+G+RPD F+T D  RTV S+V  DL I +    YL+HKFPLL K   LQRLC+  
Sbjct  1    MKFMKLGSRPDTFYTTDSVRTVSSEVSCDLIIQVKGTRYLLHKFPLLSKSLRLQRLCAEM  60

Query  78   AEDSGNIA-LELHDIPGGEEAFELCAK  1
            A+ S N+  ++L D PGG EAFE+C+K
Sbjct  61   ADSSSNVQIIQLPDFPGGVEAFEICSK  87



>ref|XP_006300867.1| hypothetical protein CARUB_v10019960mg [Capsella rubella]
 gb|EOA33765.1| hypothetical protein CARUB_v10019960mg [Capsella rubella]
Length=630

 Score =   100 bits (248),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R V S+V  D TI ++   YL+HKFPLL KC  LQR+CS +
Sbjct  1    MKFMKLGSRPDTFYTSEDLRCVSSEVSSDFTIEVSGSKYLLHKFPLLSKCLRLQRMCSES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             +S    ++L + PGG EAFELCAK
Sbjct  61   PES---IIQLPEFPGGVEAFELCAK  82



>ref|XP_009413442.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413443.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413444.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Musa 
acuminata subsp. malaccensis]
Length=565

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD FFT +  R+V S+V  DL I + +  Y +HKFPLL KC  LQR CS  
Sbjct  1    MKFMKLGTRPDTFFTTESIRSVSSEVSTDLQIQVQNSFYRLHKFPLLSKCLRLQRHCSEL  60

Query  75   EDSGNIA-LELHDIPGGEEAFELCAK  1
            +D+   A ++L D+PGG EAFE CAK
Sbjct  61   KDAAEHAIIQLPDLPGGAEAFETCAK  86



>ref|XP_009379958.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Musa 
acuminata subsp. malaccensis]
Length=619

 Score =   100 bits (248),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G RPD FFT +  R+V S+V  DL I +++  Y +HKFPLL KC  LQ+LCSS 
Sbjct  1    MKFMKLGNRPDTFFTTEAIRSVSSEVSTDLQIQVHNSLYQLHKFPLLSKCLRLQKLCSSL  60

Query  75   ED-SGNIALELHDIPGGEEAFELCAK  1
            +D S +  + L D+PGG EAFE+CAK
Sbjct  61   KDTSEHTVILLPDLPGGAEAFEVCAK  86



>ref|XP_010531578.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Tarenaya 
hassleriana]
 ref|XP_010531581.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Tarenaya 
hassleriana]
Length=632

 Score =   100 bits (248),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T D  R V S+V  D+ I ++   YL+HKFPLL KC  LQR+ S S
Sbjct  1    MKFMKLGSRPDTFYTSDSVRCVSSEVSSDIVIEVSGCKYLLHKFPLLSKCLKLQRIFSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S N  + L D PGG E+FELCAK
Sbjct  61   PEASQNQTIRLPDFPGGAESFELCAK  86



>ref|XP_010470729.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Camelina 
sativa]
 ref|XP_010470730.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Camelina 
sativa]
 ref|XP_010470731.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Camelina 
sativa]
 ref|XP_010470732.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Camelina 
sativa]
Length=630

 Score =   100 bits (248),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R V S+V  D TI ++   YL+HKFPLL KC  LQR+CS +
Sbjct  1    MKFMKLGSRPDTFYTSEDLRCVSSEVSSDFTIEVSGSRYLLHKFPLLSKCLRLQRMCSES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             +S    ++L + PGG EAFELCAK
Sbjct  61   PES---IIQLPEFPGGVEAFELCAK  82



>ref|XP_010511760.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Camelina 
sativa]
 ref|XP_010511761.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Camelina 
sativa]
 ref|XP_010511762.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Camelina 
sativa]
 ref|XP_010511763.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Camelina 
sativa]
Length=630

 Score =   100 bits (248),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R V S+V  D TI ++   YL+HKFPLL KC  LQR+CS +
Sbjct  1    MKFMKLGSRPDTFYTSEDLRCVSSEVSSDFTIEVSGSRYLLHKFPLLSKCLRLQRMCSES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             +S    ++L + PGG EAFELCAK
Sbjct  61   PES---IIQLPEFPGGVEAFELCAK  82



>ref|XP_010415392.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform 
X1 [Camelina sativa]
 ref|XP_010415393.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform 
X1 [Camelina sativa]
 ref|XP_010415394.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform 
X1 [Camelina sativa]
 ref|XP_010415395.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform 
X2 [Camelina sativa]
 ref|XP_010415396.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform 
X2 [Camelina sativa]
 ref|XP_010415397.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform 
X2 [Camelina sativa]
 ref|XP_010415398.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform 
X2 [Camelina sativa]
Length=630

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R V S+V  D TI ++   YL+HKFPLL KC  LQR+CS +
Sbjct  1    MKFMKLGSRPDTFYTSEDLRCVSSEVSSDFTIEVSGSRYLLHKFPLLSKCLRLQRMCSES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             +S    ++L + PGG EAFELCAK
Sbjct  61   PES---IIQLPEFPGGVEAFELCAK  82



>gb|AES89843.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=73

 Score = 92.4 bits (228),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GT+PD F+TE  TRT+ S++P  L I IN +TYL+HKF LLPKC LLQRLC   
Sbjct  1    MKFMKLGTKPDTFYTEQATRTLTSEIPSYLVIQINDVTYLLHKFALLPKCRLLQRLCYDC  60

Query  75   EDS  67
             DS
Sbjct  61   SDS  63



>ref|NP_176957.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
 ref|NP_974103.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
 ref|NP_001185347.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
 sp|Q9C9V6.1|Y1790_ARATH RecName: Full=BTB/POZ domain-containing protein At1g67900 [Arabidopsis 
thaliana]
 gb|AAG52016.1|AC012563_26 unknown protein; 76653-74502 [Arabidopsis thaliana]
 gb|AAM53287.1| unknown protein [Arabidopsis thaliana]
 gb|AAP68226.1| At1g67900 [Arabidopsis thaliana]
 gb|AEE34717.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
 gb|AEE34718.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
 gb|AEE34719.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
Length=631

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R V S+V  D TI ++   YL+HKFPLL KC  LQR+CS +
Sbjct  1    MKFMKLGSRPDTFYTSEDLRCVSSEVSSDFTIEVSGSRYLLHKFPLLSKCLRLQRMCSES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             +S    ++L + PGG EAFELCAK
Sbjct  61   PES---IIQLPEFPGGVEAFELCAK  82



>gb|KHN47740.1| BTB/POZ domain-containing protein, partial [Glycine soja]
Length=109

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  FTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSAEDSGNIALELHDI  37
            +     R+++SD+P DL I I   TYL+HK  LLPKCGLL+RLC  + DS N+ LELHD+
Sbjct  2    YYHHKCRSLVSDIPSDLVIKIYDTTYLLHKSSLLPKCGLLRRLCLDSSDSENVPLELHDM  61

Query  36   PGGEEAFELCAK  1
            PGG +AFE+CAK
Sbjct  62   PGGADAFEICAK  73



>ref|XP_003628937.1| BTB/POZ domain-containing protein [Medicago truncatula]
Length=577

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T+D  R+V S+V  DL I +    YL+HKFPLL KC  LQRLC  +
Sbjct  1    MKFMKLGSRPDIFYTKDSVRSVSSEVSSDLIIQVKGTRYLLHKFPLLSKCLHLQRLCLES  60

Query  75   EDSGNIAL-ELHDIPGGEEAFELCAK  1
             DSGN  + +L D PGGEEAFELCAK
Sbjct  61   LDSGNHQIVQLPDFPGGEEAFELCAK  86



>gb|AET03413.2| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=596

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T+D  R+V S+V  DL I +    YL+HKFPLL KC  LQRLC  +
Sbjct  1    MKFMKLGSRPDIFYTKDSVRSVSSEVSSDLIIQVKGTRYLLHKFPLLSKCLHLQRLCLES  60

Query  75   EDSGNIAL-ELHDIPGGEEAFELCAK  1
             DSGN  + +L D PGGEEAFELCAK
Sbjct  61   LDSGNHQIVQLPDFPGGEEAFELCAK  86



>ref|XP_004239131.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Solanum 
lycopersicum]
Length=610

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS-  79
            MKFMK+G+RPD F T +  R+V S+V  DL + +    YL+HKFPLL KC  LQRLCS  
Sbjct  1    MKFMKLGSRPDTFITTEAVRSVNSEVISDLIVQVKGSRYLLHKFPLLSKCSRLQRLCSEI  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFE+CAK
Sbjct  61   PETSQHQIVQLPDFPGGIEAFEICAK  86



>ref|XP_004509676.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cicer 
arietinum]
Length=605

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R++ S+V  DL I +    YL+HKFPLL K   LQRLCS +
Sbjct  1    MKFMKVGSRPDTFYTTESVRSISSEVSSDLIIQVKGTRYLLHKFPLLSKSLHLQRLCSDS  60

Query  75   EDSGNIAL-ELHDIPGGEEAFELCAK  1
             DS N  + +L D PGG E FELCAK
Sbjct  61   IDSPNHQIVQLPDFPGGIEPFELCAK  86



>ref|XP_003531985.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Glycine 
max]
Length=634

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+R D F+T +  RT+ S+V  D  I +    YL+HKFPLL KC  LQRLCS +
Sbjct  1    MKFMKLGSRSDTFYTAESVRTISSEVSSDFIIQVKGTRYLLHKFPLLSKCFRLQRLCSES  60

Query  75   EDS-GNIALELHDIPGGEEAFELCAK  1
             DS  +  ++L D PGG E FELCAK
Sbjct  61   SDSPQHQIVQLPDFPGGVETFELCAK  86



>emb|CBI16786.3| unnamed protein product [Vitis vinifera]
Length=472

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S++  DL + +    Y++HKFPLL KC  LQRLCS  
Sbjct  1    MKFMKLGSRPDTFYTTEAVRSVSSEISSDLIVQVKGSRYMLHKFPLLSKCLRLQRLCSEF  60

Query  75   EDSGNIAL-ELHDIPGGEEAFELCAK  1
             +S    + +L D PGG +AFELCAK
Sbjct  61   HESAQPQIVQLPDFPGGVDAFELCAK  86



>ref|XP_010556221.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At1g67900 [Tarenaya hassleriana]
Length=618

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F T D  R V S+V  D+ I ++   Y +HKFPLL KC  LQR+ S +
Sbjct  1    MKFMKLGSRPDTFHTSDSVRCVSSEVSSDIVIKVSGSKYFLHKFPLLSKCLRLQRIFSES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            +DS   A+EL D PGG E FELCAK
Sbjct  61   QDS---AIELPDFPGGVETFELCAK  82



>emb|CDY72257.1| BnaCnng76750D, partial [Brassica napus]
Length=506

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R V S+V  D TI ++   Y +HKFPLL KC  LQR+CS +
Sbjct  1    MKFMKLGSRPDTFYTSEDLRCVSSEVSSDYTIEVSGSRYHLHKFPLLSKCLRLQRMCSES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             +S     +L D PGG EAFELCAK
Sbjct  61   PESN----QLPDFPGGVEAFELCAK  81



>emb|CDY72267.1| BnaAnng40470D, partial [Brassica napus]
Length=506

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R V S+V  D TI ++   Y +HKFPLL KC  LQR+CS +
Sbjct  1    MKFMKLGSRPDTFYTSEDLRCVSSEVSSDYTIEVSGSRYHLHKFPLLSKCLRLQRMCSES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             +S     +L D PGG EAFELCAK
Sbjct  61   PESN----QLPDFPGGVEAFELCAK  81



>gb|KHG04804.1| hypothetical protein F383_28791 [Gossypium arboreum]
Length=631

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R+V S+V  DL + +    YL+HKFPLL KC  LQR+CS S
Sbjct  1    MKFMKLGSRPDTFYTNEAVRSVSSEVTSDLIVQVKGSRYLLHKFPLLSKCLRLQRICSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E   +  +++ D PGG EAFELCAK
Sbjct  61   PETLQHQIVQIPDFPGGTEAFELCAK  86



>ref|XP_009105081.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Brassica 
rapa]
 ref|XP_009105082.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Brassica 
rapa]
 ref|XP_009105083.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Brassica 
rapa]
Length=629

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R V S+V  D TI I+   Y +HKFPLL KC  LQR+CS +
Sbjct  1    MKFMKLGSRPDTFYTSEDLRCVSSEVSSDYTIEISGSRYHLHKFPLLSKCLRLQRMCSES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             +S     +L D PGG EAFELCAK
Sbjct  61   PESN----QLPDFPGGVEAFELCAK  81



>ref|XP_004952970.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Setaria 
italica]
Length=640

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+GTRPD FFT +  R+V ++V  DL I ++   Y +HKFPLL KC LLQ LC+ S
Sbjct  1    MKFMKLGTRPDTFFTSEAVRSVSTEVATDLQILVDGCIYHLHKFPLLSKCMLLQALCADS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
                G   +EL   PGG EAFE CAK
Sbjct  61   GASVGGDVVELPGFPGGAEAFEACAK  86



>ref|XP_002282444.2| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Vitis 
vinifera]
 ref|XP_010650462.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Vitis 
vinifera]
 ref|XP_010650467.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Vitis 
vinifera]
 ref|XP_010650472.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Vitis 
vinifera]
Length=630

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S++  DL + +    Y++HKFPLL KC  LQRLCS  
Sbjct  1    MKFMKLGSRPDTFYTTEAVRSVSSEISSDLIVQVKGSRYMLHKFPLLSKCLRLQRLCSEF  60

Query  75   EDSGNIAL-ELHDIPGGEEAFELCAK  1
             +S    + +L D PGG +AFELCAK
Sbjct  61   HESAQPQIVQLPDFPGGVDAFELCAK  86



>gb|ACN27928.1| unknown [Zea mays]
 gb|ACN34653.1| unknown [Zea mays]
 gb|AFW72126.1| putative phototropic-responsive NPH3 family protein [Zea mays]
 gb|AIB05700.1| orphans transcription factor, partial [Zea mays]
Length=624

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 4/86 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFM++GTRPD FF   D  R+V ++V  DL I +++  Y +HKFPLL KC LLQ LC+ 
Sbjct  1    MKFMRLGTRPDTFFAAADSVRSVCTEVATDLQILVDNCLYHLHKFPLLSKCMLLQALCA-  59

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              D+G++ +EL   PGG EAFE CAK
Sbjct  60   --DAGDVVVELPGFPGGAEAFEACAK  83



>ref|NP_001147893.1| LOC100281503 [Zea mays]
 gb|ACG29045.1| transposon protein Mutator sub-class [Zea mays]
Length=624

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 4/86 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFM++GTRPD FF   D  R+V ++V  DL I +++  Y +HKFPLL KC LLQ LC+ 
Sbjct  1    MKFMRLGTRPDTFFAAADSVRSVCTEVATDLQILVDNCLYHLHKFPLLSKCMLLQALCA-  59

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              D+G++ +EL   PGG EAFE CAK
Sbjct  60   --DAGDVVVELPGFPGGAEAFEACAK  83



>ref|XP_010929904.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Elaeis 
guineensis]
Length=619

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD FFT +  R+V S+V  DL I + +  Y +HKFPLL KC  LQ LCS  
Sbjct  1    MKFMKLGTRPDTFFTTEAIRSVSSEVSTDLKIQVQNSFYQLHKFPLLSKCLRLQILCSEL  60

Query  75   EDSGNIA-LELHDIPGGEEAFELCAK  1
             ++   A ++L D+PGG EAFE CAK
Sbjct  61   RNTSEDAIIQLPDLPGGAEAFETCAK  86



>gb|AFW85546.1| putative phototropic-responsive NPH3 family protein [Zea mays]
Length=574

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/88 (48%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDG---TRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLC  85
            MKFMK+G++PDAF T+ G    R V+SD+P D+ + ++   + +HKFPLL K GLLQRL 
Sbjct  1    MKFMKLGSKPDAFQTDGGGGDARYVLSDLPSDIVVHVDDARFYLHKFPLLSKSGLLQRLI  60

Query  84   SSAEDSGNIALELHDIPGGEEAFELCAK  1
              A  +G+  + + D+PGG + FE+CAK
Sbjct  61   VEASQNGSDEVAIQDVPGGAKTFEICAK  88



>ref|XP_006391205.1| hypothetical protein EUTSA_v10019709mg [Eutrema salsugineum]
 dbj|BAJ34381.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ28491.1| hypothetical protein EUTSA_v10019709mg [Eutrema salsugineum]
Length=633

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R V S+V  D  I ++   YL+HKFPLL KC  LQRLCS +
Sbjct  1    MKFMKLGSRPDTFYTSEDLRCVSSEVSSDFPIEVSGSRYLLHKFPLLSKCLRLQRLCSES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             +S    ++L + PGG EAF+LCAK
Sbjct  61   PES----IQLPEFPGGVEAFDLCAK  81



>ref|XP_008658464.1| PREDICTED: uncharacterized protein LOC100279255 isoform X2 [Zea 
mays]
 gb|ACN26355.1| unknown [Zea mays]
 gb|AFW85545.1| putative phototropic-responsive NPH3 family protein [Zea mays]
 gb|AIB05818.1| orphans transcription factor, partial [Zea mays]
Length=637

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/88 (48%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDG---TRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLC  85
            MKFMK+G++PDAF T+ G    R V+SD+P D+ + ++   + +HKFPLL K GLLQRL 
Sbjct  1    MKFMKLGSKPDAFQTDGGGGDARYVLSDLPSDIVVHVDDARFYLHKFPLLSKSGLLQRLI  60

Query  84   SSAEDSGNIALELHDIPGGEEAFELCAK  1
              A  +G+  + + D+PGG + FE+CAK
Sbjct  61   VEASQNGSDEVAIQDVPGGAKTFEICAK  88



>emb|CAN63893.1| hypothetical protein VITISV_019664 [Vitis vinifera]
Length=619

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S++  DL + +    Y++HKFP L KC  LQRLCS  
Sbjct  1    MKFMKLGSRPDTFYTTEAVRSVSSEISSDLIVQVKGSRYMLHKFPXLSKCLRLQRLCSEF  60

Query  75   EDSGNIAL-ELHDIPGGEEAFELCAK  1
             +S    + +L D PGG +AFELCAK
Sbjct  61   HESAQPQIVQLPDFPGGVDAFELCAK  86



>ref|XP_004299219.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Fragaria 
vesca subsp. vesca]
Length=631

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS-  79
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLCS  
Sbjct  1    MKFMKLGSRPDTFYTSEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCSEY  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            AE S +  ++LHD P G EAFELCAK
Sbjct  61   AESSQHQIIQLHDFPSGVEAFELCAK  86



>ref|XP_009786908.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana 
sylvestris]
 ref|XP_009786909.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana 
sylvestris]
Length=612

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 55/85 (65%), Gaps = 1/85 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD FFT +  R+V S++  DL + +    YL+HKFPLL KC  LQRLC   
Sbjct  1    MKFMKLGSRPDTFFTTEAVRSVSSEISSDLIVQVKGSRYLLHKFPLLSKCLRLQRLCVEK  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
                 I +EL D P G E FELCAK
Sbjct  61   TSQHEI-VELQDFPCGIEDFELCAK  84



>ref|XP_003607646.1| hypothetical protein MTR_4g080720 [Medicago truncatula]
Length=77

 Score = 88.6 bits (218),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 4/74 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTR----TVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRL  88
            MKFMK+GT+PD F+TE  TR    T+ S++P  L I IN +TYL+HKF LLPKC LLQRL
Sbjct  1    MKFMKLGTKPDTFYTEQATRYSQQTLTSEIPSYLVIQINDVTYLLHKFALLPKCRLLQRL  60

Query  87   CSSAEDSGNIALEL  46
            C    DS +  +++
Sbjct  61   CYDCSDSKSFIVDI  74



>ref|XP_008678759.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Zea 
mays]
Length=627

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 60/85 (71%), Gaps = 2/85 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD FFT    R+V ++V  DL I +++  Y +HKFPLL KC LLQ LC+ A
Sbjct  1    MKFMKLGTRPDTFFTAGSVRSVCTEVATDLQILVDNCLYHLHKFPLLSKCMLLQALCADA  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
              +G++ +EL   PGG EAFE CA+
Sbjct  61   V-AGDV-VELRGFPGGGEAFEACAR  83



>ref|XP_006655857.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Oryza 
brachyantha]
Length=629

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDG-TRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PDAF T+ G +R V+S++P D+ I +    + +HKFPLL K  LLQRL   
Sbjct  1    MKFMKLGSKPDAFQTDGGDSRYVLSELPSDIVIHVEEARFYLHKFPLLSKSSLLQRLIIE  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A  +G   + +HDIPGG + FE+CAK
Sbjct  61   ASQNGTDEVYIHDIPGGVKTFEICAK  86



>ref|XP_011071147.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Sesamum 
indicum]
 ref|XP_011071148.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Sesamum 
indicum]
 ref|XP_011071149.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Sesamum 
indicum]
Length=619

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQ+LCS  
Sbjct  1    MKFMKLGSRPDTFYTTEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQKLCSET  60

Query  75   EDSGNIAL-ELHDIPGGEEAFELCAK  1
             +S    L +LHD PGG EAFELCAK
Sbjct  61   SESSQPQLVQLHDFPGGVEAFELCAK  86



>gb|KHN22636.1| BTB/POZ domain-containing protein [Glycine soja]
Length=629

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+R D F+T +   T+ S+V  DL I +    YL+HKFPLL KC  LQRLCS +
Sbjct  1    MKFMKLGSRSDTFYTAE---TISSEVSSDLIIQVKGTRYLLHKFPLLSKCLRLQRLCSES  57

Query  75   EDS-GNIALELHDIPGGEEAFELCAK  1
             DS  +  ++L D PGG EAFELCAK
Sbjct  58   SDSPQHQIVQLPDFPGGVEAFELCAK  83



>gb|EAY99934.1| hypothetical protein OsI_21936 [Oryza sativa Indica Group]
Length=642

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDG--TRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS  82
            MKFMK+G++PDAF T+ G  +R V+S++P D+ I +    + +HKFPLL K  LLQRL  
Sbjct  1    MKFMKLGSKPDAFQTDGGGDSRYVLSELPSDIVIHVEEARFYLHKFPLLSKSSLLQRLII  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
             A  +G   + +HDIPGG + FE+CAK
Sbjct  61   EASQNGTDEVYIHDIPGGVKIFEICAK  87



>ref|XP_008778389.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Phoenix 
dactylifera]
Length=618

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD FFT +  R++ S+V  DL I + +  Y +HKFPLL KC  LQ LCS  
Sbjct  1    MKFMKLGTRPDTFFTTEAIRSLSSEVSTDLKIQVQNSLYQLHKFPLLSKCLRLQLLCSEL  60

Query  75   EDSGNIALEL-HDIPGGEEAFELCAK  1
            +++   A+ L  D+PGG EAFE CAK
Sbjct  61   KNTSEDAIILPPDLPGGAEAFETCAK  86



>ref|NP_001056994.1| Os06g0184500 [Oryza sativa Japonica Group]
 dbj|BAD72520.1| non-phototropic hypocotyl 3-like [Oryza sativa Japonica Group]
 dbj|BAF18908.1| Os06g0184500 [Oryza sativa Japonica Group]
 gb|EAZ36060.1| hypothetical protein OsJ_20369 [Oryza sativa Japonica Group]
Length=644

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDG--TRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS  82
            MKFMK+G++PDAF T+ G  +R V+S++P D+ I +    + +HKFPLL K  LLQRL  
Sbjct  1    MKFMKLGSKPDAFQTDGGGDSRYVLSELPSDIVIHVEEARFYLHKFPLLSKSSLLQRLII  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
             A  +G   + +HDIPGG + FE+CAK
Sbjct  61   EASQNGTDEVYIHDIPGGVKIFEICAK  87



>ref|XP_010682456.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682457.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682458.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Beta 
vulgaris subsp. vulgaris]
Length=627

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G++PD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQ+LC+ +
Sbjct  1    MKFMKLGSKPDTFYTSEAVRSVSSEVSSDLVIQVQGCRYLLHKFPLLSKCLRLQKLCAES  60

Query  75   EDSG-NIALELHDIPGGEEAFELCAK  1
             DS  +  ++LHD PGG EAFELCAK
Sbjct  61   PDSSPHQVMKLHDFPGGVEAFELCAK  86



>ref|XP_003575274.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Brachypodium 
distachyon]
Length=656

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 5/89 (6%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD FF+ +  R+V ++V  DL I + +  Y +HKFPLL KC LLQ LC+ +
Sbjct  1    MKFMKLGTRPDTFFSTESARSVCTEVATDLQILVGNCLYNLHKFPLLSKCLLLQALCAES  60

Query  75   ----EDSGNIALELHDIPGGEEAFELCAK  1
                 D+G+  +EL   PGG EAFE CAK
Sbjct  61   GCGGGDNGDF-IELAGFPGGAEAFEACAK  88



>gb|EAZ23655.1| hypothetical protein OsJ_07355 [Oryza sativa Japonica Group]
Length=663

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD FF+ +  R+V ++V  DL I +    Y +HKFPLL KC LLQ LC+ +
Sbjct  1    MKFMKLGTRPDTFFSNESVRSVCTEVATDLQILVGDCLYQLHKFPLLSKCLLLQALCAES  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
               GN    +EL   PGG EAF+ CAK
Sbjct  61   GCGGNGGDVIELPGFPGGVEAFDACAK  87



>ref|XP_006648803.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Oryza 
brachyantha]
Length=618

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD FF+ +  R+V ++V  DL I +    Y +HKFPLL KC LLQ LC+ +
Sbjct  1    MKFMKLGTRPDTFFSNESVRSVCTEVATDLQILVGDCLYQLHKFPLLSKCLLLQALCAES  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
               GN    +EL   PGG EAF+ CAK
Sbjct  61   GCGGNGGEVIELPGFPGGVEAFDACAK  87



>ref|XP_007221979.1| hypothetical protein PRUPE_ppa002809mg [Prunus persica]
 gb|EMJ23178.1| hypothetical protein PRUPE_ppa002809mg [Prunus persica]
Length=631

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS-  79
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLCS  
Sbjct  1    MKFMKLGSRPDTFYTTEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCSEY  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++LHD P G EAFELCAK
Sbjct  61   QEASQHQIIQLHDFPSGVEAFELCAK  86



>ref|XP_002530034.1| signal transducer, putative [Ricinus communis]
 gb|EEF32334.1| signal transducer, putative [Ricinus communis]
Length=631

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGIEAFELCAK  86



>ref|XP_008340094.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Malus 
domestica]
 ref|XP_008340095.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Malus 
domestica]
Length=632

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLCS  
Sbjct  1    MKFMKLGSRPDTFYTTEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCSEY  60

Query  75   EDSGN-IALELHDIPGGEEAFELCAK  1
            ++S N   ++LHD P   EAFELCAK
Sbjct  61   QESSNHHIIQLHDFPSSVEAFELCAK  86



>gb|EAY86511.1| hypothetical protein OsI_07890 [Oryza sativa Indica Group]
Length=653

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+GTRPD F++ +  R+V ++V  DL I +    Y +HKFPLL KC LLQ LC+ +
Sbjct  1    MKFMKLGTRPDTFYSNESVRSVCTEVATDLQILVGDCLYQLHKFPLLSKCLLLQALCAES  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
               GN    +EL   PGG EAF+ CAK
Sbjct  61   GCGGNGGDVIELPGFPGGVEAFDACAK  87



>ref|XP_011045254.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform 
X2 [Populus euphratica]
Length=620

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R+V S+V  DL + +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIVQVTGSRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGVEAFELCAK  86



>ref|XP_006378241.1| hypothetical protein POPTR_0010s05690g [Populus trichocarpa]
 gb|ERP56038.1| hypothetical protein POPTR_0010s05690g [Populus trichocarpa]
Length=620

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R+V S+V  DL + +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIVQVTGSRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGVEAFELCAK  86



>ref|XP_011045253.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform 
X1 [Populus euphratica]
Length=628

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R+V S+V  DL + +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIVQVTGSRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGVEAFELCAK  86



>ref|XP_006378242.1| hypothetical protein POPTR_0010s05690g [Populus trichocarpa]
 ref|XP_002314595.2| hypothetical protein POPTR_0010s05690g [Populus trichocarpa]
 gb|ERP56039.1| hypothetical protein POPTR_0010s05690g [Populus trichocarpa]
 gb|EEF00766.2| hypothetical protein POPTR_0010s05690g [Populus trichocarpa]
Length=628

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R+V S+V  DL + +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIVQVTGSRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGVEAFELCAK  86



>ref|XP_004138701.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Cucumis 
sativus]
 gb|KGN62995.1| hypothetical protein Csa_2G382680 [Cucumis sativus]
Length=612

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDG--TRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS  82
            MKFMK+G++PDAF   DG  TR V S++P D+TI +  + +L+HKFPLL K   LQ+L S
Sbjct  1    MKFMKLGSKPDAFLA-DGKTTRYVSSELPTDVTIFVGEVKFLVHKFPLLSKSNCLQKLVS  59

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
             A +  +  + L D PGG +AFE+CAK
Sbjct  60   KANEENSEEIHLIDFPGGPKAFEICAK  86



>gb|KCW59744.1| hypothetical protein EUGRSUZ_H02493 [Eucalyptus grandis]
Length=518

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS-  79
            MKFMK+G+RPD F+T +  R+V S+V  DL + +    YL+HKFPLL KC  LQRLCS  
Sbjct  1    MKFMKLGSRPDTFYTSEAVRSVSSEVSSDLLVQVKGSRYLLHKFPLLSKCLRLQRLCSEL  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGVEAFELCAK  86



>ref|XP_009630313.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana 
tomentosiformis]
 ref|XP_009630316.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana 
tomentosiformis]
Length=603

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 55/85 (65%), Gaps = 1/85 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD FFT +  R+V S++  DL + +    YL+HKFPLL KC  LQRLC   
Sbjct  1    MKFMKLGSRPDTFFTTEAVRSVSSEILSDLIVQVKGSRYLLHKFPLLSKCLRLQRLCVDK  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
                 I ++L D P G E FELCAK
Sbjct  61   TSQHQI-VQLPDFPCGIEDFELCAK  84



>gb|KDP26695.1| hypothetical protein JCGZ_17853 [Jatropha curcas]
Length=628

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    Y++HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYMLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGIEAFELCAK  86



>ref|XP_010528100.1| PREDICTED: BTB/POZ domain-containing protein At3g26490 [Tarenaya 
hassleriana]
Length=598

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+M++G RPD F+T +  R+V S++  DL I + S  YL+HKFP+L KC  LQ L SS 
Sbjct  1    MKYMQLGCRPDTFYTAEAVRSVSSEILSDLIIQVKSTRYLLHKFPMLSKCLRLQSLMSSK  60

Query  75   --EDSGNIALELHDIPGGEEAFELCAK  1
              E S +  ++L D PG  EAFELCAK
Sbjct  61   CPETSQDQVIQLQDFPGEAEAFELCAK  87



>ref|XP_007158393.1| hypothetical protein PHAVU_002G149400g [Phaseolus vulgaris]
 gb|ESW30387.1| hypothetical protein PHAVU_002G149400g [Phaseolus vulgaris]
Length=632

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLCS +
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLLIQVKGSKYLLHKFPLLSKCLRLQRLCSES  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
             DS +    + L D PGG EAFELCAK
Sbjct  61   PDSSSQHQIVRLPDFPGGVEAFELCAK  87



>ref|XP_010023464.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Eucalyptus 
grandis]
 ref|XP_010023465.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Eucalyptus 
grandis]
 ref|XP_010023466.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Eucalyptus 
grandis]
 ref|XP_010023467.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Eucalyptus 
grandis]
 gb|KCW59742.1| hypothetical protein EUGRSUZ_H02493 [Eucalyptus grandis]
 gb|KCW59743.1| hypothetical protein EUGRSUZ_H02493 [Eucalyptus grandis]
Length=633

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS-  79
            MKFMK+G+RPD F+T +  R+V S+V  DL + +    YL+HKFPLL KC  LQRLCS  
Sbjct  1    MKFMKLGSRPDTFYTSEAVRSVSSEVSSDLLVQVKGSRYLLHKFPLLSKCLRLQRLCSEL  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PESSQHQIVQLPDFPGGVEAFELCAK  86



>ref|XP_007044812.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY00644.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=632

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PETSQHQIIQLPDFPGGIEAFELCAK  86



>ref|XP_010530706.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Tarenaya hassleriana]
 ref|XP_010530707.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Tarenaya hassleriana]
 ref|XP_010530708.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Tarenaya hassleriana]
Length=642

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMKIG++PD+F T+ +  R V +++  D+ I ++   + +HKFPLL KCG LQ+L SS
Sbjct  1    MKFMKIGSKPDSFKTDGNNVRYVENELAADIIINVDGSKFYLHKFPLLSKCGWLQKLVSS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A+ +    ++L DIPGG  AFE CAK
Sbjct  61   ADKNSTDEVDLSDIPGGPTAFETCAK  86



>gb|KHN00400.1| BTB/POZ domain-containing protein [Glycine soja]
Length=636

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQ+LCS  
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQKLCSEP  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
             DS +    ++L D PGG EAFELCAK
Sbjct  61   PDSSSQHQIIQLPDFPGGMEAFELCAK  87



>ref|XP_003519715.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Glycine 
max]
Length=636

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQ+LCS  
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQKLCSEP  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
             DS +    ++L D PGG EAFELCAK
Sbjct  61   PDSSSQHQIIQLPDFPGGMEAFELCAK  87



>emb|CDP13229.1| unnamed protein product [Coffea canephora]
Length=626

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S+V  DL + +    Y++HKFPLL KC  LQRLC+  
Sbjct  1    MKFMKLGSRPDTFYTTEAVRSVSSEVSSDLIVQVKGSRYMLHKFPLLSKCLRLQRLCAEN  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             +S +  ++L D PGG EAFELCAK
Sbjct  61   LESQHQIVQLPDFPGGVEAFELCAK  85



>ref|XP_003578395.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
NPY4-like [Brachypodium distachyon]
Length=640

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+G++PD F TE   R V +++  D+ IT+  + + +HKFPLL K   LQ L +S 
Sbjct  1    MKYMKLGSKPDVFQTEGNIRFVATELATDIVITVGDVKFYLHKFPLLSKSSRLQTLVAST  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             D GN  +++ DIPGG   FE+CAK
Sbjct  61   NDEGNDEVDISDIPGGPSGFEICAK  85



>gb|KHN35451.1| BTB/POZ domain-containing protein [Glycine soja]
Length=631

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 57/86 (66%), Gaps = 4/86 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+R D F+T +   T+ S+V  D  I +    YL+HKFPLL KC  LQRLCS +
Sbjct  1    MKFMKLGSRSDTFYTAE---TISSEVSSDFIIQVKGTRYLLHKFPLLSKCFRLQRLCSES  57

Query  75   EDS-GNIALELHDIPGGEEAFELCAK  1
             DS  +  ++L D PGG E FELCAK
Sbjct  58   SDSPQHQIVQLPDFPGGVETFELCAK  83



>ref|XP_002311763.1| phototropic-responsive NPH3 family protein [Populus trichocarpa]
 gb|EEE89130.1| phototropic-responsive NPH3 family protein [Populus trichocarpa]
Length=628

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T    R+V S+V  DL + +    YL+HKFPLL KC  LQRLCS S
Sbjct  1    MKFMKLGSRPDTFYTAQAVRSVSSEVSSDLIVQVKGSRYLLHKFPLLSKCLRLQRLCSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E S +  ++L D PGG EAFELCAK
Sbjct  61   PETSQHHIVQLPDFPGGVEAFELCAK  86



>gb|AFW68229.1| putative phototropic-responsive NPH3 family protein [Zea mays]
Length=225

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MK+MK+G++PD F TE    R V +++  D+ I++    + +HKFPLL K  LLQRL +S
Sbjct  1    MKYMKLGSKPDVFQTEGSNIRFVATELATDIVISVGDAKFYLHKFPLLSKSSLLQRLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            + D  N  +++ DIPGG  AFE+CAK
Sbjct  61   SNDEKNDEVDISDIPGGPSAFEICAK  86



>ref|XP_008669263.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Zea 
mays]
 tpg|DAA37316.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
 gb|AIB04929.1| orphans transcription factor, partial [Zea mays]
Length=616

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 56/85 (66%), Gaps = 5/85 (6%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK M++GTRPD+FFT    R+V ++V  DL I ++   + +HKFPLL KC LLQ LC   
Sbjct  1    MKLMRLGTRPDSFFTSGPVRSVYTEVATDLQIQVDHCLFRLHKFPLLSKCLLLQALC---  57

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
              +G+ A EL   PGG EAFE CAK
Sbjct  58   --AGSDAAELPGFPGGAEAFEACAK  80



>ref|XP_002446667.1| hypothetical protein SORBIDRAFT_06g020070 [Sorghum bicolor]
 gb|EES10995.1| hypothetical protein SORBIDRAFT_06g020070 [Sorghum bicolor]
Length=654

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 5/85 (6%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK MK+GTRPD+FFT    R+V ++V  DL I ++   + +HKFPLL KC LLQ LC+  
Sbjct  1    MKLMKLGTRPDSFFTSGPVRSVHTEVATDLQIQVDRSLFRLHKFPLLSKCQLLQALCADT  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            +     A+EL   PGG +AFE CAK
Sbjct  61   D-----AVELRGFPGGADAFEACAK  80



>gb|EMT26515.1| BTB/POZ domain-containing protein [Aegilops tauschii]
Length=627

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+GTRPD F++  D  R+V ++V  DL I +    Y +HKFPLL KC LLQ LC+ 
Sbjct  1    MKFMKLGTRPDTFYSSSDSERSVYTEVATDLQILVGKCLYHLHKFPLLSKCLLLQALCAE  60

Query  78   AEDSGN-IALELHDIPGGEEAFELCAK  1
            +   G+   +EL   PGG EAFE+CAK
Sbjct  61   SGCGGDGDVIELAGFPGGAEAFEVCAK  87



>ref|XP_009629742.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009629743.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009629744.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=627

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F TE D  R V +++  D+ I +  + + +HKFPLL K G LQ+L + 
Sbjct  1    MKFMKLGSKPDQFQTEGDNIRYVATELATDMVINVGDVKFYVHKFPLLSKSGSLQKLAAH  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              +  N  + +HD+PGG  AFE+CAK
Sbjct  61   TNEESNDEINIHDVPGGPAAFEICAK  86



>ref|XP_009359209.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Pyrus 
x bretschneideri]
Length=632

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+  +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLCS  
Sbjct  1    MKFMKLGSRPDTFYATEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCSEY  60

Query  75   EDSGN-IALELHDIPGGEEAFELCAK  1
            ++S N   ++LHD P   EAFELCAK
Sbjct  61   QESSNHHIIQLHDFPSSVEAFELCAK  86



>ref|XP_004964658.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Setaria 
italica]
Length=636

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PDAF T+   +R V+SD+P D+ + ++   + +HKFPLL K  LLQRL   
Sbjct  1    MKFMKLGSKPDAFQTDGSDSRYVLSDLPSDIVVHVDDARFYLHKFPLLSKSSLLQRLIIE  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A  +G   + + DIPGG + FE+CAK
Sbjct  61   ASQNGTDEVVIQDIPGGVKTFEICAK  86



>ref|XP_006346315.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006346316.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006346317.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006346318.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006346319.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X5 [Solanum tuberosum]
 ref|XP_006346320.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X6 [Solanum tuberosum]
Length=626

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PDAF T+ +  R V S++  D+ I +  + + +HKFPLL K   LQ+L S+
Sbjct  1    MKFMKLGSKPDAFQTDGNNVRYVASELASDIAINVGDVKFYLHKFPLLSKSATLQKLVSN  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A +     +++HDIPGG  AFE+CAK
Sbjct  61   ASEGNCNEVDIHDIPGGPSAFEICAK  86



>gb|EMT08606.1| Coleoptile phototropism protein 1 [Aegilops tauschii]
Length=622

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+G +PD F TE   R V +++  D+ IT+  + + +HKFPLL K   LQ L +S 
Sbjct  1    MKYMKLGAKPDVFQTEGNIRFVATELATDIVITVGDVKFYLHKFPLLSKSSRLQTLVAST  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            ++ GN  +++ DIPGG  AFE+CAK
Sbjct  61   DEEGNDEVDISDIPGGPSAFEICAK  85



>emb|CDO97269.1| unnamed protein product [Coffea canephora]
Length=622

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 61/86 (71%), Gaps = 2/86 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD+F T+ +  R V S++  D+ + +  I + +HKFPLL K   LQ+L +S
Sbjct  1    MKFMKLGSKPDSFQTDGNNVRYVASELATDIVVNVGDIKFYLHKFPLLSKSSHLQKLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A+D GN  + +HDIPGG  AFE+CAK
Sbjct  61   ADD-GNDEVNIHDIPGGPVAFEICAK  85



>dbj|BAK03079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=627

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFT-EDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G RPD FF+  D  R+V ++V  DL I +    Y +HKFPLL KC LLQ LC+ 
Sbjct  1    MKFMKLGNRPDTFFSPSDSERSVYTEVATDLQILVGKCLYHLHKFPLLSKCLLLQALCAE  60

Query  78   AEDSGNIAL-ELHDIPGGEEAFELCAK  1
            +   G+  L EL   PGG EAFE+CAK
Sbjct  61   SGCGGDGDLIELAGFPGGAEAFEVCAK  87



>gb|KHN14527.1| BTB/POZ domain-containing protein [Glycine soja]
Length=635

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQ+LCS +
Sbjct  1    MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQKLCSES  60

Query  75   EDSGN--IALELHDIPGGEEAFELCAK  1
             +S +    ++L D PGG EAFELCAK
Sbjct  61   PESSSQHQIVQLPDFPGGVEAFELCAK  87



>ref|XP_010086948.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
 gb|EXB25084.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
Length=630

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD+F T+ D +R V S++  D+ + + S+ + +HKFPLL K   LQ+L S+
Sbjct  1    MKFMKLGSKPDSFQTDGDNSRYVASELATDIVVNVGSVKFYLHKFPLLSKSARLQKLVSN  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            + +     + +HDIPGG  AFE+C+K
Sbjct  61   SNEENTDEINIHDIPGGPAAFEICSK  86



>ref|XP_011086648.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Sesamum 
indicum]
 ref|XP_011086649.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Sesamum 
indicum]
 ref|XP_011086650.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Sesamum 
indicum]
Length=626

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLCS +
Sbjct  1    MKFMKLGSRPDTFYTTEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCSES  60

Query  75   EDSGNIAL-ELHDIPGGEEAFELCAK  1
             ++  + + +L + PGG EAFELCAK
Sbjct  61   PEASQLQIVQLPEFPGGIEAFELCAK  86



>ref|XP_004230705.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315185.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315186.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315187.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315188.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315189.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
Length=626

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F T+ +  R V S++  D+ I +  + + +HKFPLL K   LQ+L S+
Sbjct  1    MKFMKLGSKPDNFQTDGNNVRYVASELASDIAINVGDVKFYLHKFPLLSKSATLQKLVSN  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A +  +  +++HDIPGG  AFE+CAK
Sbjct  61   ASEGNSDEVDIHDIPGGPSAFEICAK  86



>ref|XP_002437972.1| hypothetical protein SORBIDRAFT_10g005710 [Sorghum bicolor]
 gb|EER89339.1| hypothetical protein SORBIDRAFT_10g005710 [Sorghum bicolor]
Length=635

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGT--RTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS  82
            MKFMK+G++PDAF T DG+  R V+SD+P D+ I +    + +HKFPLL K  LLQRL  
Sbjct  1    MKFMKLGSKPDAFQT-DGSDARYVLSDLPSDIVIHVEDARFYLHKFPLLCKSSLLQRLII  59

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
             A  +G   + + DIPGG + FE+CAK
Sbjct  60   EASQNGTDEVVIQDIPGGVKTFEICAK  86



>dbj|BAJ87350.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=630

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK+MK+G +PD F TE   R V +++  D+ IT+  + + +HKFPLL K   LQ L +S 
Sbjct  1    MKYMKLGAKPDVFQTEGNIRFVATELATDIVITVGDVKFYLHKFPLLSKSSRLQTLVAST  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            ++ GN  +++ DIPGG  +FE+CAK
Sbjct  61   DEEGNDEVDISDIPGGPSSFEICAK  85



>ref|XP_008389720.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Malus 
domestica]
 ref|XP_008389721.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Malus 
domestica]
Length=633

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFMK+G+R D F+T +  R+V S+V  DL I +    YL+HKFPLL KC  LQRLCS  
Sbjct  1    MKFMKLGSRQDTFYTTEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCSEY  60

Query  75   EDSGN-IALELHDIPGGEEAFELCAK  1
            ++S N   + LHD P G EAFELCAK
Sbjct  61   QESSNHHIIHLHDFPCGVEAFELCAK  86



>ref|XP_009776107.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009776108.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana sylvestris]
Length=627

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F TE D  R V +++  D+ I +  + + +HKFPLL K G LQ+L + 
Sbjct  1    MKFMKLGSKPDQFQTEGDNIRYVATELATDMVIHVGDVKFNVHKFPLLSKSGRLQKLAAH  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              +  N  + +HD+PGG  AFE+CAK
Sbjct  61   TNEESNDEINIHDVPGGPAAFEICAK  86



>ref|XP_004485981.1| PREDICTED: BTB/POZ domain-containing protein At5g03250-like [Cicer 
arietinum]
Length=612

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 59/87 (68%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLC--S  82
            M FMK+G++P+AF  E  T    + +P D+TI +  I++L+HKFPLL + GLL++L   S
Sbjct  1    MAFMKLGSKPEAFRREGQTWVCTTGLPSDVTIEVGEISFLLHKFPLLSRSGLLKKLIAES  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
            + ED  +  L+LHDIPGG + FEL  K
Sbjct  61   TNEDGSSCVLQLHDIPGGAKTFELVTK  87



>ref|XP_004975963.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Setaria 
italica]
Length=631

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MK MK+G RPD FFT    R+V ++V  D+ I ++   + +HKFPLL KC LLQ LC+ +
Sbjct  1    MKLMKLGARPDTFFTSGPVRSVYTEVATDMEILVDHCLFRLHKFPLLSKCLLLQALCAES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
            +     A+EL   PGG EAFE CAK
Sbjct  61   D-----AVELPGFPGGAEAFEACAK  80



>ref|NP_001050649.1| Os03g0609800 [Oryza sativa Japonica Group]
 gb|AAR00589.1| putative NPH3 family protein [Oryza sativa Japonica Group]
 gb|AAR87349.1| transposon protein, putative, mutator sub-class [Oryza sativa 
Japonica Group]
 gb|AAX95837.1| transposon protein, putative, mutator sub-class [Oryza sativa 
Japonica Group]
 gb|ABF97571.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|ABF97572.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12563.1| Os03g0609800 [Oryza sativa Japonica Group]
 gb|EAZ27761.1| hypothetical protein OsJ_11706 [Oryza sativa Japonica Group]
 dbj|BAG89762.1| unnamed protein product [Oryza sativa Japonica Group]
Length=634

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGT-RTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MK MK+G++PD F TE G  R V +++  D+ I+I  + + +HKFPLL K   LQRL +S
Sbjct  1    MKHMKLGSKPDLFQTEGGNIRFVATELATDIVISIGDVKFCLHKFPLLSKSSCLQRLAAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            +   GN  L++ DIPGG  AFE+CAK
Sbjct  61   SNVEGNEELDISDIPGGPSAFEICAK  86



>ref|NP_189280.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
 sp|Q9LIM6.1|Y3649_ARATH RecName: Full=BTB/POZ domain-containing protein At3g26490 [Arabidopsis 
thaliana]
 dbj|BAB02210.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77166.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
Length=588

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 44/88 (50%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFM++G RPD F+T +  R+V SD+  DL I + S  YL+HKFP+L KC  L+ L SS 
Sbjct  1    MKFMELGFRPDTFYTVESVRSVSSDLLNDLVIQVKSTKYLLHKFPMLSKCLRLKNLVSSQ  60

Query  75   EDSGN---IALELHDIPGGEEAFELCAK  1
            E   +     ++L D PG  EAFELCAK
Sbjct  61   ETETSQEQQVIQLVDFPGETEAFELCAK  88



>gb|EAY90980.1| hypothetical protein OsI_12589 [Oryza sativa Indica Group]
Length=634

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGT-RTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MK MK+G++PD F TE G  R V +++  D+ I+I  + + +HKFPLL K   LQRL +S
Sbjct  1    MKHMKLGSKPDLFQTEGGNIRFVATELATDIVISIGDVKFCLHKFPLLSKSSCLQRLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            +   GN  L++ DIPGG  AFE+CAK
Sbjct  61   SNVEGNEELDISDIPGGPSAFEICAK  86



>ref|XP_008445264.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Cucumis melo]
 ref|XP_008445265.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Cucumis melo]
Length=612

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDG--TRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS  82
            MKFMK+G++ DAF   DG  TR V S++P D+TI +  + +L+HKFPLL K   LQ+L S
Sbjct  1    MKFMKLGSKSDAFLA-DGKTTRYVSSELPTDVTIFVGEVKFLVHKFPLLSKSNCLQKLVS  59

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
             A +  +  + L D PGG +AFE+CAK
Sbjct  60   KANEENSEEIHLIDFPGGPKAFEICAK  86



>gb|KHG02234.1| BTB/POZ domain-containing NPY2 -like protein [Gossypium arboreum]
Length=624

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F ++ +  R V S++  D+T+T+  + + +HKFPLL K   LQ+L +S
Sbjct  1    MKFMKLGSKPDTFQSDGNNARYVASELATDITVTVGDVKFYLHKFPLLSKSAYLQKLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              +  N  +++ DIPGG  AFE+CAK
Sbjct  61   GNEENNDEIQISDIPGGPVAFEICAK  86



>emb|CDY13635.1| BnaA06g32880D [Brassica napus]
Length=574

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFM++G RPD F+T +  R+V SD+  DL I + S  YL+HKFP+L KC  L+ L SS 
Sbjct  1    MKFMELGFRPDTFYTVEAVRSVSSDLQNDLIIQVKSTKYLLHKFPMLSKCLRLKNLVSSQ  60

Query  75   EDSGNIA-----LELHDIPGGEEAFELCAK  1
                  +     ++L D PG  EAFELCAK
Sbjct  61   SQEPETSQDQKVIQLVDFPGETEAFELCAK  90



>ref|XP_004982439.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Setaria 
italica]
Length=635

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MK+MK+G++PDAF TE    R V +++  D+ I+I  + + +HKFPLL K   LQRL +S
Sbjct  1    MKYMKLGSKPDAFQTEGSNIRFVATELATDIVISIGDVKFYLHKFPLLSKSSRLQRLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            + +  N  +++ DIPGG  AFE+CAK
Sbjct  61   SNEEKNDEVDISDIPGGHSAFEICAK  86



>gb|EYU29635.1| hypothetical protein MIMGU_mgv1a003178mg [Erythranthe guttata]
Length=602

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F T+ D  R V +++  D+ +++  + + +HKFPLL K   LQ+L ++
Sbjct  1    MKFMKLGSKPDQFQTDGDSIRYVATELATDMVVSVGDVKFYVHKFPLLSKSSHLQKLVAT  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            + D  +  +++HDIPGG  AFE+CAK
Sbjct  61   SSDDISEEIDIHDIPGGPAAFEICAK  86



>ref|NP_001278721.1| putative phototropic-resoponsive NPH3 family protein [Zea mays]
 ref|XP_008643409.1| PREDICTED: putative phototropic-resoponsive NPH3 family protein 
isoform X1 [Zea mays]
 ref|XP_008643410.1| PREDICTED: putative phototropic-resoponsive NPH3 family protein 
isoform X1 [Zea mays]
 gb|ACN27618.1| unknown [Zea mays]
 gb|AFW68230.1| putative phototropic-responsive NPH3 family protein [Zea mays]
Length=643

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MK+MK+G++PD F TE    R V +++  D+ I++    + +HKFPLL K  LLQRL +S
Sbjct  1    MKYMKLGSKPDVFQTEGSNIRFVATELATDIVISVGDAKFYLHKFPLLSKSSLLQRLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            + D  N  +++ DIPGG  AFE+CAK
Sbjct  61   SNDEKNDEVDISDIPGGPSAFEICAK  86



>ref|NP_001053084.1| Os04g0477000 [Oryza sativa Japonica Group]
 emb|CAE05861.1| OSJNBa0044K18.3 [Oryza sativa Japonica Group]
 dbj|BAF14998.1| Os04g0477000 [Oryza sativa Japonica Group]
 dbj|BAG90694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/85 (48%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            M+ MK+G RPD FF+    R+V +D+  D+ I ++   + +HKFPLL KC  LQ LC  +
Sbjct  1    MRVMKLGNRPDTFFSSGPVRSVSTDLATDMQILVDGCLFRLHKFPLLSKCMWLQALCVES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             D G  A+EL   PGG EAFE CAK
Sbjct  61   GDGGG-AVELPAFPGGAEAFEACAK  84



>ref|XP_010065907.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065908.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065909.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065910.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065911.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065912.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 gb|KCW63621.1| hypothetical protein EUGRSUZ_G01249 [Eucalyptus grandis]
Length=625

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD+F  E D  R V S++  D+T++I S+ + +HKFPLL K  LLQ+L ++
Sbjct  1    MKFMKLGSKPDSFQNEGDNVRYVSSELATDITVSIGSVKFYLHKFPLLSKSALLQKLVAA  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              +     + + DIPGG  +FE+CAK
Sbjct  61   TNNDDGNEVNISDIPGGPASFEVCAK  86



>ref|XP_004288238.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Fragaria 
vesca subsp. vesca]
Length=625

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F TE D  R V +++  D+ I +  + + +HKFPLL K   LQ+L ++
Sbjct  1    MKFMKLGSKPDFFQTEGDNIRYVATELGTDVAINVGDVKFYLHKFPLLSKSARLQKLVAT  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              D  +  + +HDIPGG  AFE+CAK
Sbjct  61   TNDDNSDEIHIHDIPGGPAAFEICAK  86



>ref|XP_009152052.1| PREDICTED: BTB/POZ domain-containing protein At3g26490 [Brassica 
rapa]
Length=574

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFM++G RPD F+T +  R+V SD+  DL I + S  YL+HKFP+L KC  L+ L SS 
Sbjct  1    MKFMELGFRPDTFYTVEAVRSVSSDLQNDLIIQVKSTKYLLHKFPMLSKCLRLKDLVSSQ  60

Query  75   EDSGNIA-----LELHDIPGGEEAFELCAK  1
                  +     ++L D PG  EAFELCAK
Sbjct  61   SQEPETSQEQKVIQLVDFPGETEAFELCAK  90



>ref|XP_011099362.1| PREDICTED: BTB/POZ domain-containing protein NPY5 isoform X1 
[Sesamum indicum]
Length=613

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F TE +  R V +++  D+ I++  + + +HKFPLL K   LQ+L +S
Sbjct  1    MKFMKLGSKPDQFQTEGENIRYVAAELATDMVISVGDVKFYLHKFPLLSKSSHLQKLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A D  N  + +HDIPGG  AFE+CAK
Sbjct  61   ASDE-NEEIRIHDIPGGPAAFEICAK  85



>ref|XP_009772494.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Nicotiana 
sylvestris]
Length=626

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F TE D  R V +++  D+ I +  + + +HKFPLL K   LQ+L + 
Sbjct  1    MKFMKLGSKPDQFQTEGDNIRYVATELATDMVINVGDVKFYLHKFPLLSKSYRLQKLVAC  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              +  N  + +HDIPGG  AFE+CAK
Sbjct  61   TNEENNDEINIHDIPGGPAAFEVCAK  86



>ref|XP_006650278.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Oryza 
brachyantha]
Length=634

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGT-RTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MK MK+G++PD F TE G  R V +++  D+ I++  + + +HKFPLL K   LQRL +S
Sbjct  1    MKHMKLGSKPDLFQTEGGNIRFVATELATDIVISVGDVKFYLHKFPLLSKSSRLQRLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            + +  N  L++ DIPGG  AFE+CAK
Sbjct  61   SNEESNNELDISDIPGGPSAFEICAK  86



>ref|XP_011088062.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Sesamum indicum]
Length=624

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F T+ +  R V S++  D+ + +  + + +HKFPLL K   LQ+L SS
Sbjct  1    MKFMKLGSKPDTFQTDGNNIRYVASELATDVIVHVGDVKFYLHKFPLLSKSARLQKLVSS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A +     + +HDIPGG  AFE+CAK
Sbjct  61   ANEGNGDEINVHDIPGGSSAFEVCAK  86



>dbj|BAK04631.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=653

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDG---TRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLC  85
            MKFMK+G++PDAF  + G   +R V+SD+P D+ + ++   + +HKFPLL K  LLQRL 
Sbjct  1    MKFMKLGSKPDAFQADGGGGDSRYVLSDLPSDIVVHVDDARFYLHKFPLLSKSSLLQRLI  60

Query  84   SSAEDSGNIALELHDIPGGEEAFELCAK  1
              A   G   + +  +PGG  AFE+CAK
Sbjct  61   VEASQGGADEVRVDGLPGGARAFEICAK  88



>ref|XP_009126615.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Brassica rapa]
 emb|CDX75198.1| BnaA01g05040D [Brassica napus]
Length=577

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDG-TRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F ++D   +  +SD+  D+T+ +   T+ +HKFPLL K   +QRL S 
Sbjct  1    MKFMKLGSKPDTFESDDKFHKYAVSDLDSDVTVIVGEFTFYLHKFPLLSKSNRMQRLVSE  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A +     + + DIPGG +AFE+CAK
Sbjct  61   ASEENTNDITISDIPGGHKAFEICAK  86



>ref|XP_010099608.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
 gb|EXB80039.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
Length=627

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD+F T+    R V S++  D+T+ +  + + +HKFPLL K   LQ+L S+
Sbjct  1    MKFMKLGSKPDSFQTDGKNVRYVASELASDITVIVGDVKFYLHKFPLLSKSAHLQKLVST  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A D  +  + + DIPGG EAFE+C K
Sbjct  61   ATDEHSDGVYISDIPGGPEAFEICVK  86



>emb|CDX68790.1| BnaC01g06630D [Brassica napus]
Length=572

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDG-TRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F ++D   +  +SD+  D+T+ +   T+ +HKFPLL K   +QRL S 
Sbjct  1    MKFMKLGSKPDTFESDDKFHKYAVSDLDSDVTVIVGEFTFYLHKFPLLSKSNRMQRLVSE  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A +     + + DIPGG +AFE+CAK
Sbjct  61   ASEENTNDITISDIPGGHKAFEICAK  86



>ref|XP_011073694.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Sesamum 
indicum]
 ref|XP_011073695.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Sesamum 
indicum]
Length=634

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 3/86 (3%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F T+ D  R V +++  DL IT+  + + +HKFPLL K   LQ+L + 
Sbjct  1    MKFMKLGSKPDQFQTDGDTIRYVATELATDLVITVGDVKFYVHKFPLLSKSSQLQKLVAG  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              D  N  +++HDIPGG  AFE+CAK
Sbjct  61   TSD--NDEIDIHDIPGGPAAFEICAK  84



>ref|XP_006857240.1| hypothetical protein AMTR_s00065p00211770 [Amborella trichopoda]
 gb|ERN18707.1| hypothetical protein AMTR_s00065p00211770 [Amborella trichopoda]
Length=610

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F  + + TR V S++  D+TI +  + + +HKFPLL K GLLQ+L S 
Sbjct  1    MKFMKLGSKPDCFRGDGNNTRYVASELATDITIFVEEVKFYLHKFPLLSKSGLLQKLVSK  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A       + L D PGG +AFE+CAK
Sbjct  61   ANKENIDEVRLFDFPGGPKAFEICAK  86



>ref|XP_007047500.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047501.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047502.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91657.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91658.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91659.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=622

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD+F T+ D  R V +++  DL + I  + + +HKFPLL K   LQ+L ++
Sbjct  1    MKFMKLGSKPDSFQTDGDNIRYVATELATDLVVNIGDVKFYLHKFPLLSKSARLQKLVAT  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            + D  +  + + DIPGG  AFE+CAK
Sbjct  61   SSDENSDEIHIQDIPGGPAAFEICAK  86



>ref|NP_001146294.1| uncharacterized protein LOC100279869 [Zea mays]
 ref|XP_008672921.1| PREDICTED: uncharacterized protein LOC100279869 isoform X1 [Zea 
mays]
 ref|XP_008672927.1| PREDICTED: uncharacterized protein LOC100279869 isoform X1 [Zea 
mays]
 gb|ACL53641.1| unknown [Zea mays]
 tpg|DAA47266.1| TPA: putative phototropic-responsive NPH3 family protein isoform 
1 [Zea mays]
 tpg|DAA47267.1| TPA: putative phototropic-responsive NPH3 family protein isoform 
2 [Zea mays]
Length=641

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MK+MK+G++PDAF TE +  R+V +++  D+ +T+  + + +HKFPLL K   LQ L +S
Sbjct  1    MKYMKLGSKPDAFQTEGNSIRSVATELAVDIVVTVGDVKFYLHKFPLLSKSSRLQTLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              + G+  +++ DIPGG  AFE+CAK
Sbjct  61   TSEEGSDEVDISDIPGGPAAFEVCAK  86



>ref|XP_003558549.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Brachypodium 
distachyon]
 ref|XP_010229003.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Brachypodium 
distachyon]
Length=605

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 4/87 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVI--SDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS  82
            MKFMK+G+ PD F  +DG+   I  S++  D+T+ I S  + +HKFPLL KC   Q+L  
Sbjct  1    MKFMKLGSNPDTF-QDDGSEVSIVESELVSDITVRIGSTKFYLHKFPLLSKCARFQKLIP  59

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
            +  D  NI + +HDIPGG +AFE+CAK
Sbjct  60   TTGDE-NIEVPIHDIPGGPKAFEICAK  85



>ref|XP_002443443.1| hypothetical protein SORBIDRAFT_08g019560 [Sorghum bicolor]
 gb|EES17281.1| hypothetical protein SORBIDRAFT_08g019560 [Sorghum bicolor]
Length=672

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MK+MK+G++PDAF TE +  R V +++  D+ IT+  + + +HKFPLL K   LQ L +S
Sbjct  1    MKYMKLGSKPDAFQTEGNSIRFVTTELATDIVITVGDVKFYLHKFPLLSKSSRLQTLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              +  N  +++ DIPGG  AFE+CAK
Sbjct  61   TSEESNDEVDISDIPGGPAAFEICAK  86



>ref|XP_009797504.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Nicotiana 
sylvestris]
Length=614

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 5/88 (6%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F  +  G R V S++  D+TI I  + + +HKFPLL K   LQRL S 
Sbjct  1    MKFMKLGSKPDTFQDQGKGVRYVSSELATDVTIIIGEVKFYLHKFPLLSKSNRLQRLVSK  60

Query  78   A--EDSGNIALELHDIPGGEEAFELCAK  1
            A  EDSG   ++L D PGG +AFE+CAK
Sbjct  61   ANEEDSGE--MQLVDFPGGPKAFEICAK  86



>ref|XP_009604823.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Nicotiana 
tomentosiformis]
Length=612

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F  +  G R V S++  D+T+ I  + + +HKFPLL K   LQRL S 
Sbjct  1    MKFMKLGSKPDTFQDQGKGVRYVSSELATDVTVVIGEVKFYLHKFPLLSKSNRLQRLVSK  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A +  +  ++L D PGG +AFE+CAK
Sbjct  61   ANEEDSDEIQLVDFPGGPKAFEICAK  86



>ref|XP_009390548.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=602

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGT-RTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PDAF ++ G  R V+S++P D+ + +  + + +HKFPLL K   LQ L   
Sbjct  1    MKFMKLGSKPDAFQSDGGNIRFVVSELPTDVIVRVGEVRFFLHKFPLLSKSNRLQGLVLK  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A + G   + LHD PGG + FE+C+K
Sbjct  61   AGEGGTDEIYLHDFPGGPKTFEICSK  86



>ref|XP_009394935.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Musa 
acuminata subsp. malaccensis]
Length=612

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGT-RTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLC-S  82
            MKFMK+G++PDAF ++ G  R V+S++P D+++ I  + + +HKFPLL K   LQ L   
Sbjct  1    MKFMKLGSKPDAFQSDGGNIRFVVSELPTDVSVRIGEVRFYLHKFPLLSKSNRLQGLILR  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
              EDS N  + LHD PGG +AFE+CAK
Sbjct  61   VGEDSTN-EIFLHDFPGGPKAFEICAK  86



>gb|KHG03539.1| hypothetical protein F383_27138 [Gossypium arboreum]
Length=632

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS-S  79
            MKFMK+G+RPD F+T +  R+V S+V  DL I +    Y++HKFPLL KC  LQR+CS S
Sbjct  1    MKFMKLGSRPDTFYTTEAVRSVSSEVSSDLIIQVKGSRYMLHKFPLLSKCMRLQRICSES  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
             E      ++L D PGG EAFE CAK
Sbjct  61   PETLQPQIIQLPDFPGGIEAFEFCAK  86



>gb|KHN06014.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=625

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD+F  + D  R V +++  D+ + + ++ + +HKFPLL +    Q+L ++
Sbjct  1    MKFMKLGSKPDSFQNDGDNIRYVATELATDIVVNVGNVKFYLHKFPLLSRSACFQKLITN  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A +  N  + +HDIPGG  AFE+CAK
Sbjct  61   ANEENNDEVHIHDIPGGPAAFEICAK  86



>ref|XP_002468311.1| hypothetical protein SORBIDRAFT_01g043540 [Sorghum bicolor]
 gb|EER95309.1| hypothetical protein SORBIDRAFT_01g043540 [Sorghum bicolor]
Length=609

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVI--SDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS  82
            MKFMK+G+ PD F  +DG    I  S++  D+T+ I +  + +HKFPLL KC   Q+L  
Sbjct  1    MKFMKLGSNPDTF-QDDGNEVSIAASELVSDITVRIGTTKFYLHKFPLLSKCARFQKLIP  59

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
            +  D  NI + +HDIPGG +AFE+CAK
Sbjct  60   TTGDE-NIEIHIHDIPGGAKAFEICAK  85



>ref|XP_009764318.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
 ref|XP_009764381.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
 ref|XP_009764456.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
 ref|XP_009764516.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
Length=624

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F ++ +  R V S++  D+T+ +  + + +HKFPLL K   LQ+L ++
Sbjct  1    MKFMKLGSKPDTFQSDGNNIRYVASELASDITVNVGDVKFYLHKFPLLSKSTSLQKLVAN  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A ++    + +HDIPGG  AFE+CAK
Sbjct  61   ASEANCDEVHIHDIPGGPTAFEICAK  86



>ref|XP_010502573.1| PREDICTED: BTB/POZ domain-containing protein At3g26490 [Camelina 
sativa]
Length=586

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 42/90 (47%), Positives = 57/90 (63%), Gaps = 5/90 (6%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFM++G+RPD F+T +  R+V SD+  DL I + S  YL+HKFP+L KC  L+ + SS 
Sbjct  1    MKFMELGSRPDTFYTVEAVRSVSSDLMNDLIIQVKSTKYLLHKFPMLSKCLRLKNVVSSQ  60

Query  75   EDSGNIA-----LELHDIPGGEEAFELCAK  1
                  +     ++L D PG  EAFELCAK
Sbjct  61   SLETETSQEQQVIQLVDFPGETEAFELCAK  90



>ref|XP_002464238.1| hypothetical protein SORBIDRAFT_01g014760 [Sorghum bicolor]
 gb|EER91236.1| hypothetical protein SORBIDRAFT_01g014760 [Sorghum bicolor]
Length=633

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MK+MK+G++PD F TE    R V +++  D+ I+I  + + +HKFPLL K   LQRL +S
Sbjct  1    MKYMKLGSKPDVFQTEGSNIRFVATELATDIVISIGDVKFYLHKFPLLSKSSRLQRLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            + +  N  +++ DIPGG  AFE+CAK
Sbjct  61   SNEEKNDEVDISDIPGGPSAFEICAK  86



>gb|KHG12565.1| BTB/POZ domain-containing NPY2 -like protein [Gossypium arboreum]
Length=619

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDG-TRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD+F T+ G  R V S++  D+ + +  + + +HKFPLL K   LQ+L ++
Sbjct  1    MKFMKLGSKPDSFQTDGGYIRFVASELATDMVVNVGDVKFYLHKFPLLSKSARLQKLVAA  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              D+    + + DIPGG  AFE+CAK
Sbjct  61   TNDANGDEIHIQDIPGGPAAFEVCAK  86



>ref|XP_009625190.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625197.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625203.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625209.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625213.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625220.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
Length=624

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F ++ +  R V S++  D+T+ +  + + +HKFPLL K   LQ+L ++
Sbjct  1    MKFMKLGSKPDTFQSDGNNIRYVASELASDITVNVGDVKFYLHKFPLLSKSTSLQKLVAN  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A ++    + +HDIPGG  AFE+CAK
Sbjct  61   ASEANCDDVHIHDIPGGPTAFEICAK  86



>emb|CAH66936.1| OSIGBa0116M22.3 [Oryza sativa Indica Group]
Length=627

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            M+ MK+G RPD FF     R+V +D+  D+ I ++   + +HKFPLL KC  LQ LC  +
Sbjct  1    MRVMKLGNRPDTFFLSGPVRSVSTDLATDMQILVDGCLFRLHKFPLLSKCMWLQALCVES  60

Query  75   EDSGNIALELHDIPGGEEAFELCAK  1
             + G  A+EL   PGG EAFE CAK
Sbjct  61   GEGGG-AVELPAFPGGAEAFEACAK  84



>ref|XP_006579940.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006579941.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
Length=624

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD+F  + D  R V +++  D+ + + ++ + +HKFPLL +    Q+L ++
Sbjct  1    MKFMKLGSKPDSFQNDGDNIRYVATELATDIVVNVGNVKFYLHKFPLLSRSTCFQKLITN  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A +  N  + +HDIPGG  AFE+CAK
Sbjct  61   ANEENNDEVHIHDIPGGPAAFEICAK  86



>gb|EYU37575.1| hypothetical protein MIMGU_mgv1a002858mg [Erythranthe guttata]
Length=630

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F  + +  R V S++  D+ + +  + + +HKFPLL K   LQ+L SS
Sbjct  1    MKFMKLGSKPDTFQIDGNNIRYVASELATDVVVQVGDVKFYLHKFPLLSKSARLQKLVSS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            + +  +  + +HDIPGG  AFE+CAK
Sbjct  61   SNEGNSDEINIHDIPGGPTAFEICAK  86



>tpg|DAA50449.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
 gb|AIB05795.1| orphans transcription factor, partial [Zea mays]
Length=362

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MK+MK+G++PD   TE    R V +D+  D+ I I  + + +HKFPLL K   LQRL +S
Sbjct  1    MKYMKLGSKPDVLQTEGSNIRFVATDLATDVVILIGDVKFYLHKFPLLSKSSRLQRLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              +  N  +++ DIPGG  AFE+CAK
Sbjct  61   INEEKNDEVDISDIPGGPSAFEICAK  86



>ref|XP_003593874.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES64125.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=607

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/87 (45%), Positives = 59/87 (68%), Gaps = 2/87 (2%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLC--S  82
            M  MK+G++P+AF  E  T    + +P D+TI +  I++L+HKFPLL + GLL++L   S
Sbjct  1    MASMKLGSKPEAFRREGQTWVCTTGLPSDVTIEVGEISFLLHKFPLLSRSGLLKKLIAES  60

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
            ++ED  +  L+LHD+PGG + FEL  K
Sbjct  61   TSEDGSSSILQLHDVPGGAKTFELITK  87



>ref|XP_008777297.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
 ref|XP_008777298.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
 ref|XP_008777299.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
Length=620

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD F T+ +G R V +++  D+ + + ++ + +HKFPLL K   LQ+L ++
Sbjct  1    MKFMKLGSKPDCFQTDGNGVRFVATELATDMVVHVGNVKFRLHKFPLLSKSSRLQKLVAA  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              D  N  + + DIPGG  AFE+CAK
Sbjct  61   TNDESNDEIHIPDIPGGPAAFEICAK  86



>ref|XP_004985278.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Setaria italica]
 ref|XP_004985279.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Setaria italica]
 ref|XP_004985280.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Setaria italica]
 ref|XP_004985281.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X4 [Setaria italica]
Length=609

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRT--VISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCS  82
            MKFMK+G+ PD F   DG     V S++  D+T+ I +  + +HKFPLL KC   Q+L  
Sbjct  1    MKFMKLGSNPDTF-QGDGNEVSIVASELVSDITVRIGTTKFYLHKFPLLSKCARFQKLIP  59

Query  81   SAEDSGNIALELHDIPGGEEAFELCAK  1
            +  D  NI +++HDIPGG +AFE+CAK
Sbjct  60   TTGDE-NIDIQIHDIPGGAKAFEICAK  85



>gb|KDO57872.1| hypothetical protein CISIN_1g007080mg [Citrus sinensis]
Length=619

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD+F  + +  R V S++  D+ + ++ I + +HKFPLL K   LQ+L ++
Sbjct  1    MKFMKLGSKPDSFQADGNNVRYVASELATDVIVVVDDIKFHLHKFPLLSKSACLQKLVAT  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A ++ N  +++ DIPGG  AFE CAK
Sbjct  61   ANEANNNEVDISDIPGGPSAFETCAK  86



>ref|XP_006486926.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006486927.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486928.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Citrus sinensis]
Length=619

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD+F  + +  R V S++  D+ + ++ I + +HKFPLL K   LQ+L ++
Sbjct  1    MKFMKLGSKPDSFQADGNNVRYVASELATDVIVVVDDIKFHLHKFPLLSKSACLQKLVAT  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A ++ N  +++ DIPGG  AFE CAK
Sbjct  61   ANEANNNEVDISDIPGGPSAFETCAK  86



>ref|XP_004963017.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Setaria italica]
Length=667

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MK+MK+G++PD F T+ +  R V +++  D+ IT+  + + +HKFPLL K   LQ L +S
Sbjct  1    MKYMKLGSKPDVFQTDGNSIRFVTTELATDIVITVGDVKFYLHKFPLLSKSSRLQTLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              D  N  +++ DIPGG  AFE+CAK
Sbjct  61   TNDESNDEVDISDIPGGPAAFEICAK  86



>ref|XP_004963018.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Setaria italica]
Length=634

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTE-DGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MK+MK+G++PD F T+ +  R V +++  D+ IT+  + + +HKFPLL K   LQ L +S
Sbjct  1    MKYMKLGSKPDVFQTDGNSIRFVTTELATDIVITVGDVKFYLHKFPLLSKSSRLQTLVAS  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              D  N  +++ DIPGG  AFE+CAK
Sbjct  61   TNDESNDEVDISDIPGGPAAFEICAK  86



>tpg|DAA61508.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=448

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDG-TRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PDAF ++    R V+SD+  D+ + +  + + +HKFPLL K G LQRL   
Sbjct  1    MKFMKLGSKPDAFQSDGADVRYVVSDLATDVVVHVGEVKFYLHKFPLLSKSGKLQRLVLK  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
            A +     + + D+PGG ++FE+CAK
Sbjct  61   AAEDETDEVRIDDLPGGAKSFEICAK  86



>emb|CDX83620.1| BnaC07g23600D [Brassica napus]
Length=547

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFTEDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSSA  76
            MKFM++G RPD F+T +  R+V SD+  DL I + S  Y +HKFP+L KC  L+ L SS 
Sbjct  1    MKFMELGFRPDTFYTVEAVRSVSSDLLNDLIIQVKSTKYHLHKFPMLSKCLRLKNLVSSQ  60

Query  75   EDSGNIA-----LELHDIPGGEEAFELCAK  1
                  +     ++L D PG  EAFELCAK
Sbjct  61   SQEPETSQDQKVIQLVDFPGETEAFELCAK  90



>gb|KDP32062.1| hypothetical protein JCGZ_12523 [Jatropha curcas]
Length=623

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MKFMKIGTRPDAFFT-EDGTRTVISDVPGDLTITINSITYLIHKFPLLPKCGLLQRLCSS  79
            MKFMK+G++PD+F   ED  R V +++  D+ I +  + + +HKFPLL K   LQ+L ++
Sbjct  1    MKFMKLGSKPDSFQADEDNIRYVATELATDIVINVRDVKFYLHKFPLLSKSARLQKLVAN  60

Query  78   AEDSGNIALELHDIPGGEEAFELCAK  1
              D  +  + + DIPGG  AFE+CAK
Sbjct  61   TNDDNSDEIHIQDIPGGPAAFEICAK  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508176617088