BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3984_g1_i1 len=225 path=[1:0-224]

Length=225
                                                                      Score     E

ref|XP_009586659.1|  PREDICTED: uncharacterized protein LOC104084489  90.1    3e-19   
ref|XP_006363081.1|  PREDICTED: uncharacterized protein LOC102587129  89.0    8e-19   
ref|XP_009779780.1|  PREDICTED: uncharacterized protein LOC104228924  87.0    3e-18   
ref|XP_006363080.1|  PREDICTED: uncharacterized protein LOC102586783  86.7    5e-18   
ref|XP_009586660.1|  PREDICTED: uncharacterized protein LOC104084490  84.3    3e-17   
ref|XP_003604836.1|  hypothetical protein MTR_4g019310                82.8    1e-16   
gb|AES87033.2|  DUF674 family protein                                 82.8    2e-16   
ref|XP_006405220.1|  hypothetical protein EUTSA_v10000435mg           80.1    3e-16   
ref|XP_007133966.1|  hypothetical protein PHAVU_010G007500g           81.6    4e-16   
ref|XP_003516931.1|  PREDICTED: uncharacterized protein LOC100819920  80.9    7e-16   
gb|AFK41672.1|  unknown                                               80.9    7e-16   
ref|XP_009760386.1|  PREDICTED: uncharacterized protein LOC104212737  80.1    8e-16   
ref|XP_007016229.1|  Uncharacterized protein isoform 1                80.1    2e-15   
gb|KHN26224.1|  hypothetical protein glysoja_030421                   79.7    2e-15   
ref|XP_009630965.1|  PREDICTED: uncharacterized protein LOC104120823  79.7    2e-15   
ref|XP_007016225.1|  Uncharacterized protein TCM_041699               79.0    3e-15   
ref|NP_187524.2|  uncharacterized protein                             75.9    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004294258.1|  PREDICTED: uncharacterized protein LOC101294834  77.4    1e-14   
ref|XP_011035219.1|  PREDICTED: uncharacterized protein LOC105133096  77.0    2e-14   
ref|XP_004246358.1|  PREDICTED: uncharacterized protein LOC101258777  76.6    2e-14   
ref|XP_002299836.2|  hypothetical protein POPTR_0001s25450g           76.6    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010087907.1|  hypothetical protein L484_006043                 76.6    2e-14   
ref|XP_004491999.1|  PREDICTED: uncharacterized protein LOC101501027  76.6    2e-14   
ref|XP_006583605.1|  PREDICTED: uncharacterized protein LOC100778734  76.3    3e-14   
ref|XP_009144186.1|  PREDICTED: uncharacterized protein LOC103867855  75.1    4e-14   
ref|XP_002520449.1|  conserved hypothetical protein                   73.6    5e-14   Ricinus communis
ref|XP_007140431.1|  hypothetical protein PHAVU_008G111300g           75.5    6e-14   
emb|CDY44684.1|  BnaA05g29220D                                        75.9    6e-14   
ref|XP_002299837.2|  hypothetical protein POPTR_0001s25440g           75.5    7e-14   Populus trichocarpa [western balsam poplar]
emb|CDX85527.1|  BnaA02g02860D                                        75.1    9e-14   
gb|KDP46572.1|  hypothetical protein JCGZ_08544                       75.1    1e-13   
gb|KEH23019.1|  DUF674 family protein                                 74.7    1e-13   
ref|XP_002873029.1|  hypothetical protein ARALYDRAFT_908051           74.7    1e-13   
gb|ACN78966.1|  unknown                                               74.3    1e-13   Glycine max [soybeans]
gb|KHN20650.1|  hypothetical protein glysoja_047471                   74.7    1e-13   
gb|KHG14396.1|  putative transcriptional regulatory                   74.3    2e-13   
ref|XP_006363077.1|  PREDICTED: uncharacterized protein LOC102585900  74.3    2e-13   
gb|AAD56328.1|AC009326_15  hypothetical protein                       72.8    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KEH23020.1|  DUF674 family protein                                 73.9    2e-13   
ref|XP_002884715.1|  hypothetical protein ARALYDRAFT_478225           72.0    3e-13   
ref|XP_003529918.1|  PREDICTED: uncharacterized protein LOC100812...  73.6    3e-13   
ref|XP_010490603.1|  PREDICTED: uncharacterized protein LOC104768354  73.2    3e-13   
ref|XP_010456353.1|  PREDICTED: uncharacterized protein LOC104737790  73.2    4e-13   
ref|XP_008220133.1|  PREDICTED: uncharacterized protein LOC103320258  73.2    4e-13   
ref|XP_002873025.1|  hypothetical protein ARALYDRAFT_486965           72.8    5e-13   
ref|XP_010468074.1|  PREDICTED: uncharacterized protein LOC104748079  72.8    5e-13   
ref|XP_010435564.1|  PREDICTED: uncharacterized protein LOC104719350  72.4    6e-13   
ref|XP_010424822.1|  PREDICTED: uncharacterized protein LOC104709993  72.4    7e-13   
ref|NP_198548.1|  uncharacterized protein                             72.4    7e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KDP46569.1|  hypothetical protein JCGZ_08541                       72.4    7e-13   
ref|XP_003551651.1|  PREDICTED: uncharacterized protein LOC100818003  72.4    9e-13   
gb|KEH23018.1|  DUF674 family protein                                 72.0    1e-12   
ref|XP_007140468.1|  hypothetical protein PHAVU_008G115000g           71.6    1e-12   
ref|XP_008220154.1|  PREDICTED: uncharacterized protein LOC103320274  71.6    1e-12   
ref|XP_009374356.1|  PREDICTED: uncharacterized protein LOC103963284  69.3    2e-12   
ref|XP_007016228.1|  Uncharacterized protein TCM_041701               71.2    2e-12   
ref|XP_003551654.1|  PREDICTED: uncharacterized protein LOC100820148  71.2    2e-12   
ref|NP_195735.1|  uncharacterized protein                             71.2    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486475.1|  PREDICTED: uncharacterized protein LOC104764608  70.9    2e-12   
emb|CDY53100.1|  BnaCnng24300D                                        70.9    3e-12   
ref|XP_004506699.1|  PREDICTED: uncharacterized protein LOC101510622  68.6    3e-12   
ref|XP_006300213.1|  hypothetical protein CARUB_v10016449mg           70.5    3e-12   
ref|XP_007207273.1|  hypothetical protein PRUPE_ppa014876mg           70.5    3e-12   
ref|XP_003595901.1|  hypothetical protein MTR_2g063210                70.5    3e-12   
ref|XP_007205138.1|  hypothetical protein PRUPE_ppa005154mg           70.5    3e-12   
ref|XP_006363076.1|  PREDICTED: uncharacterized protein LOC102585564  70.5    4e-12   
ref|XP_007140426.1|  hypothetical protein PHAVU_008G110800g           68.2    4e-12   
ref|XP_006393618.1|  hypothetical protein EUTSA_v10012284mg           70.5    4e-12   
gb|KEH23012.1|  MZB10.14 protein                                      70.1    4e-12   
ref|XP_008384883.1|  PREDICTED: uncharacterized protein LOC103447458  67.8    5e-12   
ref|XP_007140467.1|  hypothetical protein PHAVU_008G114900g           67.8    6e-12   
ref|XP_003604753.1|  hypothetical protein MTR_4g017410                69.7    6e-12   
gb|KEH23014.1|  DUF674 family protein                                 69.7    7e-12   
ref|XP_010452021.1|  PREDICTED: uncharacterized protein LOC104734192  69.7    7e-12   
ref|XP_007208707.1|  hypothetical protein PRUPE_ppa017598mg           69.3    9e-12   
ref|XP_008355134.1|  PREDICTED: uncharacterized protein LOC103418800  68.9    9e-12   
ref|XP_008220104.1|  PREDICTED: uncharacterized protein LOC103320235  69.3    9e-12   
ref|XP_003621378.1|  hypothetical protein MTR_7g012680                69.3    1e-11   
ref|XP_004492001.1|  PREDICTED: uncharacterized protein LOC101501664  67.0    1e-11   
gb|KEH23003.1|  DUF674 family protein                                 69.3    1e-11   
ref|XP_008344826.1|  PREDICTED: uncharacterized protein LOC103407720  68.9    1e-11   
ref|XP_004506639.1|  PREDICTED: uncharacterized protein LOC101488456  68.9    1e-11   
gb|KEH22913.1|  DUF674 family protein                                 68.6    1e-11   
gb|AES77596.2|  DUF674 family protein                                 68.9    1e-11   
ref|XP_004295725.1|  PREDICTED: uncharacterized protein LOC101291415  69.7    1e-11   
emb|CAE04151.1|  OSJNBa0009P12.36                                     67.8    2e-11   Oryza sativa [red rice]
ref|XP_010543887.1|  PREDICTED: uncharacterized protein LOC104816656  67.8    2e-11   
ref|XP_009337359.1|  PREDICTED: uncharacterized protein LOC103929826  68.6    2e-11   
emb|CDY53113.1|  BnaCnng24410D                                        68.2    2e-11   
gb|KEH23013.1|  DUF674 family protein                                 68.2    2e-11   
emb|CAH67986.1|  OSIGBa0142I02-OSIGBa0101B20.29                       67.4    2e-11   Oryza sativa [red rice]
gb|KEH37039.1|  DUF674 family protein                                 68.2    2e-11   
tpg|DAA36235.1|  TPA: hypothetical protein ZEAMMB73_238952            68.2    2e-11   
ref|XP_010464553.1|  PREDICTED: uncharacterized protein LOC104745077  68.6    2e-11   
gb|EAY95385.1|  hypothetical protein OsI_17218                        68.2    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_010494298.1|  PREDICTED: uncharacterized protein LOC104771467  68.2    2e-11   
emb|CAH67987.1|  OSIGBa0142I02-OSIGBa0101B20.30                       68.2    2e-11   Oryza sativa [red rice]
ref|XP_008373329.1|  PREDICTED: uncharacterized protein LOC103436666  68.2    2e-11   
emb|CDY44590.1|  BnaA04g10000D                                        68.2    2e-11   
gb|ABK28675.1|  unknown                                               68.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863678.1|  hypothetical protein ARALYDRAFT_331073           68.2    2e-11   
ref|NP_195733.2|  uncharacterized protein                             67.8    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418865.1|  PREDICTED: uncharacterized protein LOC104704481  68.2    2e-11   
ref|XP_002884714.1|  predicted protein                                68.2    3e-11   
emb|CAB69841.1|  putative protein                                     67.8    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139969.1|  PREDICTED: uncharacterized protein LOC103863956  67.8    3e-11   
ref|XP_006289415.1|  hypothetical protein CARUB_v10002914mg           67.8    3e-11   
ref|XP_009337351.1|  PREDICTED: uncharacterized protein LOC103929821  67.8    3e-11   
tpg|DAA36233.1|  TPA: hypothetical protein ZEAMMB73_987454            67.4    3e-11   
emb|CDY44588.1|  BnaA04g10020D                                        67.4    4e-11   
emb|CDX90967.1|  BnaC02g06300D                                        67.4    4e-11   
ref|NP_001118603.1|  uncharacterized protein                          67.4    4e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KEH23021.1|  DUF674 family protein                                 67.4    4e-11   
ref|XP_003595912.1|  hypothetical protein MTR_2g063350                67.4    4e-11   
gb|AAD56330.1|AC009326_17  hypothetical protein                       67.4    4e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EEE58770.1|  hypothetical protein OsJ_10282                        67.4    4e-11   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA36234.1|  TPA: hypothetical protein ZEAMMB73_987454            67.4    4e-11   
ref|NP_001140340.1|  hypothetical protein                             67.0    5e-11   Zea mays [maize]
ref|NP_187526.2|  uncharacterized protein                             67.4    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001053728.2|  Os04g0594500                                     66.6    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008373327.1|  PREDICTED: uncharacterized protein LOC103436664  67.0    5e-11   
gb|EMT20117.1|  hypothetical protein F775_02467                       67.0    5e-11   
ref|XP_010442052.1|  PREDICTED: uncharacterized protein LOC104725145  67.0    6e-11   
gb|KHN13931.1|  hypothetical protein glysoja_016215                   67.0    6e-11   
ref|XP_010104702.1|  hypothetical protein L484_022086                 67.0    6e-11   
gb|EAY95384.1|  hypothetical protein OsI_17217                        67.0    7e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_003551835.2|  PREDICTED: uncharacterized protein LOC100808732  67.0    7e-11   
ref|XP_008220995.1|  PREDICTED: uncharacterized protein LOC103321024  66.2    7e-11   
emb|CAE04150.1|  OSJNBa0009P12.35                                     67.0    7e-11   
ref|XP_002884716.1|  hypothetical protein ARALYDRAFT_478227           66.6    7e-11   
ref|XP_006287625.1|  hypothetical protein CARUB_v10000837mg           66.6    8e-11   
ref|XP_010480428.1|  PREDICTED: uncharacterized protein LOC104759168  66.6    9e-11   
ref|XP_009150349.1|  PREDICTED: uncharacterized protein LOC103873706  65.5    1e-10   
ref|XP_010424823.1|  PREDICTED: uncharacterized protein LOC104709994  66.2    1e-10   
gb|KFK43406.1|  hypothetical protein AALP_AA1G121900                  64.7    1e-10   
gb|AES59109.2|  DUF674 family protein                                 65.9    1e-10   
ref|XP_010418330.1|  PREDICTED: uncharacterized protein LOC104703932  66.2    1e-10   
ref|XP_006603523.1|  PREDICTED: uncharacterized protein LOC102660035  64.3    1e-10   
ref|XP_002873028.1|  predicted protein                                65.9    2e-10   
emb|CDY40320.1|  BnaA10g27480D                                        65.9    2e-10   
ref|XP_003588858.1|  hypothetical protein MTR_1g014060                65.5    2e-10   
gb|EMT05521.1|  hypothetical protein F775_03912                       65.5    2e-10   
gb|KEH22916.1|  DUF674 family protein                                 65.5    2e-10   
gb|KHN08317.1|  hypothetical protein glysoja_034125                   65.5    2e-10   
ref|XP_003595908.1|  hypothetical protein MTR_2g063290                65.1    2e-10   
ref|XP_006418887.1|  hypothetical protein EUTSA_v10002899mg           65.1    2e-10   
ref|XP_009122823.1|  PREDICTED: uncharacterized protein LOC103847491  65.1    3e-10   
ref|XP_009374355.1|  PREDICTED: uncharacterized protein LOC103963283  65.1    3e-10   
gb|KEH41049.1|  DUF674 family protein                                 65.1    3e-10   
gb|KEH23106.1|  DUF674 family protein                                 65.1    3e-10   
gb|KEH22914.1|  DUF674 family protein                                 65.1    3e-10   
ref|XP_010650585.1|  PREDICTED: uncharacterized protein LOC104879...  65.1    3e-10   
ref|XP_003551534.2|  PREDICTED: uncharacterized protein LOC100814631  65.5    3e-10   
ref|XP_010650584.1|  PREDICTED: uncharacterized protein LOC104879...  65.1    3e-10   
ref|NP_001131604.1|  uncharacterized protein LOC100192954             64.7    3e-10   Zea mays [maize]
ref|XP_003529915.1|  PREDICTED: uncharacterized protein LOC100809...  64.7    4e-10   
ref|XP_009337354.1|  PREDICTED: uncharacterized protein LOC103929824  64.3    4e-10   
ref|XP_006415212.1|  hypothetical protein EUTSA_v10009971mg           63.9    4e-10   
ref|XP_007140417.1|  hypothetical protein PHAVU_008G110100g           64.3    5e-10   
gb|KDP46570.1|  hypothetical protein JCGZ_08542                       64.3    5e-10   
ref|XP_008358980.1|  PREDICTED: uncharacterized protein LOC103422699  63.5    5e-10   
ref|XP_009374311.1|  PREDICTED: uncharacterized protein LOC103963244  64.3    5e-10   
gb|KEH23107.1|  DUF674 family protein                                 64.3    5e-10   
ref|XP_009337352.1|  PREDICTED: uncharacterized protein LOC103929...  64.3    6e-10   
ref|XP_004304298.1|  PREDICTED: uncharacterized protein LOC101290973  64.3    6e-10   
gb|KHN08318.1|  hypothetical protein glysoja_034126                   63.9    6e-10   
ref|XP_010543244.1|  PREDICTED: uncharacterized protein LOC104816224  63.9    6e-10   
gb|KHN08316.1|  hypothetical protein glysoja_034124                   63.9    8e-10   
emb|CDY10482.1|  BnaCnng03830D                                        63.9    8e-10   
gb|KEH28913.1|  DUF674 family protein                                 63.5    8e-10   
ref|XP_009337347.1|  PREDICTED: uncharacterized protein LOC103929820  62.8    9e-10   
emb|CDY53099.1|  BnaCnng24290D                                        63.5    9e-10   
ref|XP_009337385.1|  PREDICTED: uncharacterized protein LOC103929848  61.6    9e-10   
ref|XP_006415215.1|  hypothetical protein EUTSA_v10009362mg           62.8    9e-10   
ref|XP_009337339.1|  PREDICTED: uncharacterized protein LOC103929...  62.4    1e-09   
ref|XP_010468073.1|  PREDICTED: uncharacterized protein LOC104748076  63.5    1e-09   
gb|KHN08322.1|  hypothetical protein glysoja_034130                   63.5    1e-09   
gb|EMT03318.1|  hypothetical protein F775_03343                       63.5    1e-09   
ref|XP_007140424.1|  hypothetical protein PHAVU_008G110700g           63.5    1e-09   
ref|XP_010920704.1|  PREDICTED: uncharacterized protein LOC105044482  63.2    1e-09   
ref|XP_007140423.1|  hypothetical protein PHAVU_008G110600g           63.2    1e-09   
ref|XP_002448442.1|  hypothetical protein SORBIDRAFT_06g027210        63.2    1e-09   Sorghum bicolor [broomcorn]
ref|XP_008355532.1|  PREDICTED: uncharacterized protein LOC103419190  63.2    1e-09   
ref|XP_006301791.1|  hypothetical protein CARUB_v10022255mg           62.4    1e-09   
gb|AAT68364.1|  hypothetical protein At3g09110                        62.4    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337338.1|  PREDICTED: uncharacterized protein LOC103929...  62.0    1e-09   
ref|XP_010920193.1|  PREDICTED: uncharacterized protein LOC105044094  62.8    1e-09   
ref|XP_003604765.1|  30S ribosomal protein S18                        61.2    2e-09   
ref|NP_187523.2|  uncharacterized protein                             62.4    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337337.1|  PREDICTED: uncharacterized protein LOC103929...  62.0    2e-09   
ref|XP_007140422.1|  hypothetical protein PHAVU_008G110500g           62.8    2e-09   
ref|NP_195732.1|  uncharacterized protein                             62.8    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002448443.1|  hypothetical protein SORBIDRAFT_06g027220        62.8    2e-09   Sorghum bicolor [broomcorn]
gb|AAD56327.1|AC009326_14  hypothetical protein                       62.4    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892386.1|  hypothetical protein ARALYDRAFT_334016           62.0    2e-09   
ref|XP_009147181.1|  PREDICTED: uncharacterized protein LOC103870768  61.6    2e-09   
ref|XP_009374312.1|  PREDICTED: uncharacterized protein LOC103963245  62.4    3e-09   
ref|XP_008344781.1|  PREDICTED: uncharacterized protein LOC103407672  62.0    3e-09   
ref|XP_008355091.1|  PREDICTED: uncharacterized protein LOC103418765  62.0    3e-09   
ref|XP_006304486.1|  hypothetical protein CARUB_v10011222mg           62.8    3e-09   
ref|XP_010501425.1|  PREDICTED: uncharacterized protein LOC104778675  62.0    3e-09   
gb|EMT32440.1|  hypothetical protein F775_01172                       62.0    3e-09   
gb|KEH28932.1|  DUF674 family protein                                 62.0    3e-09   
ref|XP_007207800.1|  hypothetical protein PRUPE_ppa024376mg           62.0    3e-09   
ref|XP_002892621.1|  hypothetical protein ARALYDRAFT_334407           61.6    4e-09   
emb|CDY44683.1|  BnaA05g29230D                                        62.0    4e-09   
gb|KEH32836.1|  DUF674 family protein                                 61.6    4e-09   
ref|XP_010462637.1|  PREDICTED: uncharacterized protein LOC104743226  61.6    4e-09   
ref|XP_007140420.1|  hypothetical protein PHAVU_008G1102000g          61.2    4e-09   
gb|KEH23089.1|  DUF674 family protein                                 61.2    5e-09   
ref|XP_003595905.1|  hypothetical protein MTR_2g063260                61.2    5e-09   
ref|XP_008384874.1|  PREDICTED: uncharacterized protein LOC103447...  61.6    5e-09   
ref|XP_010462638.1|  PREDICTED: uncharacterized protein LOC104743227  61.6    5e-09   
gb|EMT13594.1|  hypothetical protein F775_01161                       61.6    5e-09   
ref|XP_009122824.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  61.6    5e-09   
ref|XP_010476015.1|  PREDICTED: uncharacterized protein LOC104755353  61.6    5e-09   
gb|KEH23004.1|  MZB10.14 protein                                      61.2    5e-09   
ref|XP_010553071.1|  PREDICTED: uncharacterized protein LOC104823...  61.2    5e-09   
ref|XP_004491998.1|  PREDICTED: uncharacterized protein LOC101500403  61.2    7e-09   
ref|XP_003604759.1|  hypothetical protein MTR_4g017470                60.8    7e-09   
ref|XP_010501424.1|  PREDICTED: uncharacterized protein LOC104778673  59.7    1e-08   
gb|EMT25177.1|  hypothetical protein F775_03443                       60.8    1e-08   
gb|AAU44565.1|  hypothetical protein AT5G43240                        60.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199138.1|  uncharacterized protein                             60.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10587.1|  unnamed protein product                              60.1    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220971.1|  PREDICTED: uncharacterized protein LOC103321003  60.1    2e-08   
ref|XP_010481231.1|  PREDICTED: uncharacterized protein LOC104760079  59.3    2e-08   
ref|XP_008344827.1|  PREDICTED: uncharacterized protein LOC103407721  60.1    2e-08   
emb|CDY10481.1|  BnaCnng03820D                                        59.7    2e-08   
emb|CDY44567.1|  BnaA04g10230D                                        59.7    2e-08   
ref|XP_009139993.1|  PREDICTED: uncharacterized protein LOC103863981  59.7    2e-08   
ref|XP_007207112.1|  hypothetical protein PRUPE_ppa019509mg           59.7    2e-08   
ref|XP_008384882.1|  PREDICTED: uncharacterized protein LOC103447...  59.3    2e-08   
emb|CDY36848.1|  BnaC04g32410D                                        59.3    3e-08   
ref|XP_008384879.1|  PREDICTED: uncharacterized protein LOC103447...  59.3    3e-08   
ref|XP_008384877.1|  PREDICTED: uncharacterized protein LOC103447...  59.3    3e-08   
ref|XP_008649730.1|  PREDICTED: uncharacterized protein LOC103630455  59.3    3e-08   
ref|XP_008384881.1|  PREDICTED: uncharacterized protein LOC103447...  59.3    3e-08   
ref|XP_007140416.1|  hypothetical protein PHAVU_008G110000g           59.3    3e-08   
gb|AFW78327.1|  hypothetical protein ZEAMMB73_424215                  59.3    3e-08   
ref|XP_003622948.1|  Tyrosine/dopa decarboxylase                      59.7    4e-08   
gb|EYU34020.1|  hypothetical protein MIMGU_mgv1a020132mg              58.9    4e-08   
ref|XP_010920714.1|  PREDICTED: uncharacterized protein LOC105044...  58.9    4e-08   
ref|XP_010920713.1|  PREDICTED: uncharacterized protein LOC105044...  58.9    4e-08   
ref|XP_003604756.1|  hypothetical protein MTR_4g017440                58.9    4e-08   
ref|XP_003604839.1|  hypothetical protein MTR_4g019340                58.9    4e-08   
ref|XP_006405504.1|  hypothetical protein EUTSA_v10027836mg           58.2    4e-08   
gb|KEH23102.1|  MZB10.14 protein                                      58.2    6e-08   
ref|XP_003622949.1|  hypothetical protein MTR_7g058710                58.5    6e-08   
ref|XP_003595904.1|  hypothetical protein MTR_2g063240                58.2    6e-08   
ref|XP_003581594.1|  PREDICTED: uncharacterized protein LOC100834580  58.5    6e-08   
gb|EMT05536.1|  hypothetical protein F775_00796                       55.8    6e-08   
emb|CDY47603.1|  BnaC08g04730D                                        54.7    1e-07   
gb|EYU34014.1|  hypothetical protein MIMGU_mgv1a020923mg              57.8    1e-07   
ref|XP_010543245.1|  PREDICTED: uncharacterized protein LOC104816225  57.8    1e-07   
gb|EYU34004.1|  hypothetical protein MIMGU_mgv1a019630mg              57.4    1e-07   
gb|EYU31633.1|  hypothetical protein MIMGU_mgv1a018387mg              57.4    1e-07   
ref|XP_008385083.1|  PREDICTED: uncharacterized protein LOC103447672  57.4    1e-07   
gb|EYU31634.1|  hypothetical protein MIMGU_mgv1a019793mg              57.4    1e-07   
ref|XP_006358726.1|  PREDICTED: uncharacterized protein LOC102598092  57.4    2e-07   
ref|XP_003595907.1|  hypothetical protein MTR_2g063280                57.0    2e-07   
emb|CDY40319.1|  BnaA10g27490D                                        56.6    2e-07   
ref|XP_003595909.1|  hypothetical protein MTR_2g063300                57.0    2e-07   
gb|KEH23093.1|  DUF674 family protein                                 57.0    2e-07   
gb|KEH23091.1|  DUF674 family protein                                 56.6    2e-07   
ref|XP_002892622.1|  hypothetical protein ARALYDRAFT_888410           56.6    2e-07   
gb|AES70948.2|  DUF674 family protein                                 56.6    3e-07   
ref|XP_010321739.1|  PREDICTED: uncharacterized protein LOC104647759  53.9    3e-07   
ref|XP_008220121.1|  PREDICTED: uncharacterized protein LOC103320250  56.2    3e-07   
ref|XP_002892620.1|  predicted protein                                55.8    3e-07   
ref|XP_006603525.1|  PREDICTED: uncharacterized protein LOC102660676  53.1    3e-07   
ref|XP_009761815.1|  PREDICTED: uncharacterized protein LOC104213...  56.2    3e-07   
gb|KEH23103.1|  MZB10.14 protein                                      55.8    4e-07   
ref|XP_009611659.1|  PREDICTED: uncharacterized protein LOC104105...  56.2    4e-07   
gb|AES86963.2|  DUF674 family protein                                 55.8    5e-07   
ref|XP_003604829.1|  hypothetical protein MTR_4g019240                53.5    5e-07   
ref|XP_010325814.1|  PREDICTED: uncharacterized protein LOC104649058  52.4    5e-07   
gb|EYU34009.1|  hypothetical protein MIMGU_mgv1a020636mg              55.5    7e-07   
ref|XP_007212779.1|  hypothetical protein PRUPE_ppa019930mg           52.8    8e-07   
ref|XP_003600697.1|  hypothetical protein MTR_3g065200                55.1    8e-07   
ref|XP_007140466.1|  hypothetical protein PHAVU_008G114800g           54.7    1e-06   
ref|XP_010650634.1|  PREDICTED: uncharacterized protein LOC104879473  52.4    1e-06   
gb|EYU31624.1|  hypothetical protein MIMGU_mgv1a026207mg              54.3    1e-06   
gb|EYU24783.1|  hypothetical protein MIMGU_mgv1a005026mg              54.3    1e-06   
gb|EYU26118.1|  hypothetical protein MIMGU_mgv1a018144mg              53.9    2e-06   
ref|NP_195734.1|  uncharacterized protein                             53.5    2e-06   
ref|XP_009390950.1|  PREDICTED: uncharacterized protein LOC103977222  53.5    2e-06   
ref|XP_010489722.1|  PREDICTED: uncharacterized protein LOC104767386  53.5    3e-06   
gb|EYU34003.1|  hypothetical protein MIMGU_mgv1a021865mg              53.5    3e-06   
ref|XP_003595913.1|  hypothetical protein MTR_2g063360                53.1    4e-06   
ref|XP_002887053.1|  hypothetical protein ARALYDRAFT_894325           52.8    5e-06   
ref|XP_008220983.1|  PREDICTED: uncharacterized protein LOC103321014  52.8    6e-06   
ref|XP_009763991.1|  PREDICTED: uncharacterized protein LOC104215788  50.4    6e-06   
gb|EYU31625.1|  hypothetical protein MIMGU_mgv1a022860mg              52.4    7e-06   
gb|EYU23216.1|  hypothetical protein MIMGU_mgv1a017995mg              52.0    9e-06   
ref|XP_002873026.1|  hypothetical protein ARALYDRAFT_486966           52.0    9e-06   
ref|XP_008246247.1|  PREDICTED: uncharacterized protein LOC103344433  49.7    1e-05   
gb|EYU34012.1|  hypothetical protein MIMGU_mgv1a023826mg              51.2    1e-05   
gb|EYU21164.1|  hypothetical protein MIMGU_mgv1a019505mg              51.6    1e-05   
gb|EYU33994.1|  hypothetical protein MIMGU_mgv1a018806mg              51.2    2e-05   
ref|XP_004514483.1|  PREDICTED: uncharacterized protein LOC101490466  51.2    2e-05   
gb|EYU35288.1|  hypothetical protein MIMGU_mgv1a020267mg              50.4    3e-05   
gb|EYU34026.1|  hypothetical protein MIMGU_mgv1a005416mg              50.4    3e-05   
ref|XP_004506700.1|  PREDICTED: uncharacterized protein LOC101510948  49.3    3e-05   
ref|XP_006390920.1|  hypothetical protein EUTSA_v10019708mg           49.7    4e-05   
gb|EYU33997.1|  hypothetical protein MIMGU_mgv1a021638mg              50.1    4e-05   
ref|XP_010094097.1|  hypothetical protein L484_018114                 50.1    4e-05   
emb|CDX68384.1|  BnaC01g24620D                                        47.4    6e-05   
gb|EMT05538.1|  hypothetical protein F775_00798                       49.7    6e-05   
gb|EYU33999.1|  hypothetical protein MIMGU_mgv1a018334mg              49.3    7e-05   
gb|EYU34002.1|  hypothetical protein MIMGU_mgv1a021746mg              48.9    7e-05   
gb|EYU34021.1|  hypothetical protein MIMGU_mgv1a004707mg              49.3    8e-05   
ref|XP_002531968.1|  conserved hypothetical protein                   47.0    1e-04   
gb|EYU35279.1|  hypothetical protein MIMGU_mgv1a005086mg              48.5    2e-04   
gb|EYU33996.1|  hypothetical protein MIMGU_mgv1a026601mg              48.1    2e-04   
gb|EYU33998.1|  hypothetical protein MIMGU_mgv1a019251mg              47.0    5e-04   
gb|EYU35270.1|  hypothetical protein MIMGU_mgv1a017740mg              46.6    6e-04   
gb|KHN40517.1|  hypothetical protein glysoja_001015                   44.3    6e-04   
ref|NP_001132185.1|  uncharacterized protein LOC100193612             45.1    7e-04   
ref|XP_009124595.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  46.2    0.001   



>ref|XP_009586659.1| PREDICTED: uncharacterized protein LOC104084489 [Nicotiana tomentosiformis]
Length=459

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQL-KIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            ILFSFLTFP+GTIIRLT+ + + KI     CMNNLYRS++N S+ + ++E CK+++LNPR
Sbjct  35   ILFSFLTFPIGTIIRLTNSQPMSKISPISTCMNNLYRSVENLSVKHLYSENCKSVLLNPR  94

Query  175  NPCAIYCSKLKINIDDS  225
            NPC   C KLK+NIDDS
Sbjct  95   NPCNEDCFKLKVNIDDS  111


 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 10/77 (13%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTELCKTMVLN----P  171
            LFSFLTFP+G++IR+     L     +GC++NLY+S+ +    W    C+  +LN    P
Sbjct  290  LFSFLTFPIGSVIRV-----LNGISGLGCIDNLYKSVTDLESKWFP-YCQDRLLNPGVAP  343

Query  172  RNPCAIYCSKLKINIDD  222
            R+ C      + + IDD
Sbjct  344  RHRCQNQLLPISVEIDD  360



>ref|XP_006363081.1| PREDICTED: uncharacterized protein LOC102587129 [Solanum tuberosum]
Length=456

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            ILFSFLTFP+GTIIRLT++ Q  +P    CMNNLY+S++N  +N  +TE CK+++LNPRN
Sbjct  35   ILFSFLTFPIGTIIRLTNNNQ-SMPKIPTCMNNLYKSVENLSVNRLYTENCKSILLNPRN  93

Query  178  PCAIYCSKLKINIDDS  225
            PC   C KLK+ IDDS
Sbjct  94   PCIEDCLKLKVKIDDS  109



>ref|XP_009779780.1| PREDICTED: uncharacterized protein LOC104228924 [Nicotiana sylvestris]
Length=458

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQL-KIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            ILFSFL+FP+GTIIRLT+++ L KI     C+NNLY+S++N S+ + ++E CK+++LNPR
Sbjct  35   ILFSFLSFPIGTIIRLTNNQPLSKISPISTCLNNLYQSVENLSVKHLYSENCKSVLLNPR  94

Query  175  NPCAIYCSKLKINIDDS  225
            NPC   C KLK+NIDDS
Sbjct  95   NPCNEDCFKLKVNIDDS  111



>ref|XP_006363080.1| PREDICTED: uncharacterized protein LOC102586783 [Solanum tuberosum]
Length=453

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLTFP+GTIIRLT++ Q  +P    CMNNLY+S++N S+ +  TE CK+++LNPRN
Sbjct  35   ILFSFLTFPIGTIIRLTNNNQ-PMPKISTCMNNLYKSVENLSVNHLCTENCKSILLNPRN  93

Query  178  PCAIYCSKLKINIDDS  225
            PC   C KLK+ IDDS
Sbjct  94   PCIEDCFKLKVKIDDS  109



>ref|XP_009586660.1| PREDICTED: uncharacterized protein LOC104084490 [Nicotiana tomentosiformis]
 ref|XP_009586661.1| PREDICTED: uncharacterized protein LOC104084490 [Nicotiana tomentosiformis]
 ref|XP_009586662.1| PREDICTED: uncharacterized protein LOC104084490 [Nicotiana tomentosiformis]
Length=478

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            IL S LT P+GTI+RLT  E       +GCMNNLY S++N    N   E CKTM+LNPRN
Sbjct  34   ILVSLLTLPLGTIMRLTKAE----AGAVGCMNNLYHSVENLDEENLFAEYCKTMLLNPRN  89

Query  178  PCAIYCSKLKINIDDS  225
            P   YC KLK+N+DDS
Sbjct  90   PYPKYCMKLKVNVDDS  105



>ref|XP_003604836.1| hypothetical protein MTR_4g019310 [Medicago truncatula]
Length=474

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 11/85 (13%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTS-------HEQLKIPVTI-GCMNNLYRSIQN--SLLNWHTELC  150
            ILFSFLT P+GTIIRL S       HE    P  I GC+NNLY+S++N    + W++ +C
Sbjct  34   ILFSFLTLPLGTIIRLVSKNQHDHIHEINDQPEEILGCINNLYKSVENLNDGVFWNS-IC  92

Query  151  KTMVLNPRNPCAIYCSKLKINIDDS  225
            KTM+L PRNPC I C KLK+N+DDS
Sbjct  93   KTMLLCPRNPCEILCKKLKLNLDDS  117



>gb|AES87033.2| DUF674 family protein [Medicago truncatula]
Length=500

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 11/85 (13%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTS-------HEQLKIPVTI-GCMNNLYRSIQN--SLLNWHTELC  150
            ILFSFLT P+GTIIRL S       HE    P  I GC+NNLY+S++N    + W++ +C
Sbjct  34   ILFSFLTLPLGTIIRLVSKNQHDHIHEINDQPEEILGCINNLYKSVENLNDGVFWNS-IC  92

Query  151  KTMVLNPRNPCAIYCSKLKINIDDS  225
            KTM+L PRNPC I C KLK+N+DDS
Sbjct  93   KTMLLCPRNPCEILCKKLKLNLDDS  117



>ref|XP_006405220.1| hypothetical protein EUTSA_v10000435mg, partial [Eutrema salsugineum]
 gb|ESQ46673.1| hypothetical protein EUTSA_v10000435mg, partial [Eutrema salsugineum]
Length=317

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/76 (49%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSF T PMGTI+RL        PV++GC NNLY+S+ +  + ++ TE CK+M+L PR+
Sbjct  32   VLFSFHTLPMGTIVRLLDKHHKLQPVSVGCFNNLYKSVSDMDVHDFETEDCKSMLLYPRS  91

Query  178  PCAIYCSKLKINIDDS  225
               I+C +LK+NIDD+
Sbjct  92   TKEIHCRRLKLNIDDT  107



>ref|XP_007133966.1| hypothetical protein PHAVU_010G007500g [Phaseolus vulgaris]
 gb|ESW05960.1| hypothetical protein PHAVU_010G007500g [Phaseolus vulgaris]
Length=491

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 56/77 (73%), Gaps = 7/77 (9%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN--WHTELCKTMVLNPR  174
            ILFSFLT P+GTI RL S ++ +I    GCMNNLY+S++NS  +  W+  +CK M+L PR
Sbjct  38   ILFSFLTLPLGTITRLVSKKEEEI----GCMNNLYQSLENSGDDVFWN-HICKKMLLFPR  92

Query  175  NPCAIYCSKLKINIDDS  225
            NPCA  C KLK+ +DD+
Sbjct  93   NPCAALCQKLKLKLDDT  109



>ref|XP_003516931.1| PREDICTED: uncharacterized protein LOC100819920 [Glycine max]
Length=492

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 4/78 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPV-TIGCMNNLYRSIQNS--LLNWHTELCKTMVLNP  171
            ILFSFLT P+GTIIRL S +Q       IGC+NNLY+S++NS   + W+  +CK M+L P
Sbjct  34   ILFSFLTLPLGTIIRLVSKKQGHDEADEIGCINNLYQSLENSGDEVFWN-HICKRMLLCP  92

Query  172  RNPCAIYCSKLKINIDDS  225
            RNPC   C KLK+ +DDS
Sbjct  93   RNPCEALCQKLKVKLDDS  110



>gb|AFK41672.1| unknown [Medicago truncatula]
Length=500

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 59/85 (69%), Gaps = 11/85 (13%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTS-------HEQLKIPVTI-GCMNNLYRSIQN--SLLNWHTELC  150
            ILFSFLT P+GTIIRL S       HE    P  I GC+NNLY+S++N    + W++ +C
Sbjct  34   ILFSFLTLPLGTIIRLVSKNQHDHIHEINDQPEEILGCINNLYKSVENLNDGVFWNS-IC  92

Query  151  KTMVLNPRNPCAIYCSKLKINIDDS  225
            KT++L PRNPC I C KLK+N+DDS
Sbjct  93   KTVLLCPRNPCEILCKKLKLNLDDS  117



>ref|XP_009760386.1| PREDICTED: uncharacterized protein LOC104212737 [Nicotiana sylvestris]
Length=417

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 49/71 (69%), Gaps = 5/71 (7%)
 Frame = +1

Query  16   LTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRNPCAIY  192
            LT P+GTIIRLT  E        GCMNNLY+S++N    N  TE CKTM+LNPRNP   Y
Sbjct  24   LTLPLGTIIRLTKAE----AGAFGCMNNLYQSVENLDEENLFTEHCKTMLLNPRNPYPKY  79

Query  193  CSKLKINIDDS  225
            C KLK+N++DS
Sbjct  80   CMKLKVNVEDS  90



>ref|XP_007016229.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007016230.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY33848.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY33849.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=512

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 54/76 (71%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            IL SFLT P+G+IIRL  ++    PV IGCM+NLY S++N  +  + TE CK+M+L+PRN
Sbjct  37   ILLSFLTMPIGSIIRLIRYQ--PPPVGIGCMDNLYESVENLDVQLFQTEACKSMLLHPRN  94

Query  178  PCAIYCSKLKINIDDS  225
              A  C +LK+ +DDS
Sbjct  95   GAAAQCERLKLTVDDS  110



>gb|KHN26224.1| hypothetical protein glysoja_030421 [Glycine soja]
Length=492

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 4/78 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPV-TIGCMNNLYRSIQNS--LLNWHTELCKTMVLNP  171
            ILFSFLT P+GTIIRL S +Q       IGC+NNLY+S++NS   + W+  +CK M+L P
Sbjct  34   ILFSFLTLPLGTIIRLVSKKQGHDEADEIGCINNLYQSLENSGDEVFWN-HICKRMLLCP  92

Query  172  RNPCAIYCSKLKINIDDS  225
            RNPC   C KLK+ +DD+
Sbjct  93   RNPCEALCQKLKVKLDDT  110



>ref|XP_009630965.1| PREDICTED: uncharacterized protein LOC104120823 [Nicotiana tomentosiformis]
 ref|XP_009630966.1| PREDICTED: uncharacterized protein LOC104120823 [Nicotiana tomentosiformis]
 ref|XP_009630967.1| PREDICTED: uncharacterized protein LOC104120823 [Nicotiana tomentosiformis]
 ref|XP_009630968.1| PREDICTED: uncharacterized protein LOC104120823 [Nicotiana tomentosiformis]
Length=485

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 5/76 (7%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            IL S LT P+GTIIRL   E       +GCMNNLY+S++N S  +   E CKTM+LNPRN
Sbjct  34   ILVSLLTLPLGTIIRLIKAE----AGVVGCMNNLYQSVENLSEEDLFIEQCKTMLLNPRN  89

Query  178  PCAIYCSKLKINIDDS  225
            P   YC +LK+++DDS
Sbjct  90   PYPKYCMRLKMHVDDS  105



>ref|XP_007016225.1| Uncharacterized protein TCM_041699 [Theobroma cacao]
 gb|EOY33844.1| Uncharacterized protein TCM_041699 [Theobroma cacao]
Length=482

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 56/77 (73%), Gaps = 5/77 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVT-IGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            +LFSFLT P+G I+RLT ++Q   P T IGCMNNLY+S++N  +++  TE CKTM+L+P+
Sbjct  29   VLFSFLTMPIGAIVRLTCNQQ---PTTRIGCMNNLYKSVENLEMIHLRTEACKTMLLHPQ  85

Query  175  NPCAIYCSKLKINIDDS  225
            N     C  L++ ID+S
Sbjct  86   NGAEDQCKMLRLKIDES  102



>ref|NP_187524.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAV68858.1| hypothetical protein AT3G09120 [Arabidopsis thaliana]
 gb|AAX23840.1| hypothetical protein At3g09120 [Arabidopsis thaliana]
 gb|AEE74725.1| uncharacterized protein AT3G09120 [Arabidopsis thaliana]
Length=314

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF  LTFPMGTI RL    Q K+P  +GC  NL RS+ + ++ ++ TE CK+M+L+P++
Sbjct  32   VLFGLLTFPMGTIARLLEKHQ-KLPQILGCYKNLSRSVSDMAVDDFKTEACKSMLLSPKS  90

Query  178  PCAIYCSKLKINIDDS  225
               I+C +LK++IDD+
Sbjct  91   SMEIHCRRLKLHIDDT  106



>ref|XP_004294258.1| PREDICTED: uncharacterized protein LOC101294834 [Fragaria vesca 
subsp. vesca]
Length=493

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 2/77 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLK-IPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            +LFSFLTFPMGTII+L S + ++ +PV IGCMNNLY S+ N  +  ++ E+C+  +L+PR
Sbjct  36   VLFSFLTFPMGTIIKLGSKQSVESVPVQIGCMNNLYASVGNIDVQRFNNEVCRHKLLSPR  95

Query  175  NPCAIYCSKLKINIDDS  225
            N     C  +K+ ID+ 
Sbjct  96   NADESRCKDVKLKIDNG  112



>ref|XP_011035219.1| PREDICTED: uncharacterized protein LOC105133096 [Populus euphratica]
Length=489

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLT PMGTI  L S+  L     IGC+NNLY+S++N  +  + TE CK M+L+P N
Sbjct  29   ILFSFLTMPMGTITHLISN--LSPKNGIGCINNLYKSVENIDVKYFRTEACKDMLLHPHN  86

Query  178  PCAIYCSKLKINIDDS  225
              A YC  LK+ IDD+
Sbjct  87   AAAAYCKSLKLKIDDA  102



>ref|XP_004246358.1| PREDICTED: uncharacterized protein LOC101258777 [Solanum lycopersicum]
 ref|XP_010325813.1| PREDICTED: uncharacterized protein LOC101258777 [Solanum lycopersicum]
Length=461

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            I  S LT P+ TIIRL   E       +GCM NLY+S++N  + +   E CKTM+LNPRN
Sbjct  34   IFVSLLTLPLETIIRLIKAE----AGVVGCMYNLYQSVENLDVEDLFIEHCKTMLLNPRN  89

Query  178  PCAIYCSKLKINIDDS  225
            P + YC++LK+NIDDS
Sbjct  90   PYSKYCTRLKVNIDDS  105



>ref|XP_002299836.2| hypothetical protein POPTR_0001s25450g [Populus trichocarpa]
 gb|EEE84641.2| hypothetical protein POPTR_0001s25450g [Populus trichocarpa]
Length=468

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLT PMGTII L S+  L     + CMNNLY+S++N  +  + TE CK M+L+PRN
Sbjct  29   ILFSFLTMPMGTIIHLISN--LSPTNGVVCMNNLYKSVENIDVRYFRTEACKDMLLHPRN  86

Query  178  PCAIYCSKLKINIDDS  225
              A YC  LK+ ID S
Sbjct  87   AAAAYCKSLKLKIDGS  102



>ref|XP_010087907.1| hypothetical protein L484_006043 [Morus notabilis]
 gb|EXB30493.1| hypothetical protein L484_006043 [Morus notabilis]
Length=481

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLT PMGTIIRL S   L     IGCMNNLY S+++  + ++  ++C+TM+L+PRN
Sbjct  33   ILFSFLTNPMGTIIRLASKHSLS--ARIGCMNNLYTSVESIDVQHFQNKVCRTMLLSPRN  90

Query  178  PCAIYCSKLKINIDDS  225
                +C  LK+ IDD+
Sbjct  91   GAESHCMNLKLKIDDA  106



>ref|XP_004491999.1| PREDICTED: uncharacterized protein LOC101501027 [Cicer arietinum]
Length=461

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN---SLLNWHTELCKTMVLNP  171
            +LFSFLTFP+GTI RL   +    PVT+GC+N LYRS+++   S L W  E  K M+L P
Sbjct  37   VLFSFLTFPLGTIARLVEKDSNTGPVTVGCLNTLYRSVKDLDESYL-WD-ETVKQMLLQP  94

Query  172  RNPCAIYCSKLKINIDDS  225
             N    YC+ LK+NIDD+
Sbjct  95   SNFAEDYCNTLKLNIDDT  112



>ref|XP_006583605.1| PREDICTED: uncharacterized protein LOC100778734 [Glycine max]
 gb|KHN40261.1| hypothetical protein glysoja_000759 [Glycine soja]
Length=512

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN--SLLNWHTELCKTMVLNPR  174
            +L SFLTFP+GTI RL   +    PV +GC+++LY S+ N      W TE CK M+L PR
Sbjct  62   VLLSFLTFPLGTIARLVQKDSDVGPVQVGCLSSLYESVANLEKECLW-TEACKEMLLQPR  120

Query  175  NPCAIYCSKLKINIDDS  225
            N    YC  LK+NIDD+
Sbjct  121  NSSEDYCRSLKLNIDDT  137



>ref|XP_009144186.1| PREDICTED: uncharacterized protein LOC103867855 [Brassica rapa]
 ref|XP_009147179.1| PREDICTED: uncharacterized protein LOC103870766 [Brassica rapa]
Length=354

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTI+RL      + P+ +GC NN Y+S+ + ++ ++ TE CKTM+L PR+
Sbjct  31   VLFSLLTLPMGTIVRLLEKHNQQ-PMRLGCFNNNYKSVSDMTIDDFETEACKTMLLYPRS  89

Query  178  PCAIYCSKLKINIDDS  225
               I+C +LK+N+DD+
Sbjct  90   TKEIHCRRLKLNVDDT  105



>ref|XP_002520449.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41862.1| conserved hypothetical protein [Ricinus communis]
Length=230

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 5/74 (7%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWH--TELCKTMVLNPR  174
            +LF+F T P+GT+IR+T  +    PV  GCMNNLY S++N L  W+  TE CKTM+L+P+
Sbjct  26   VLFTFFTMPIGTVIRITGSKLPARPV--GCMNNLYASVEN-LDVWYLRTEACKTMLLHPQ  82

Query  175  NPCAIYCSKLKINI  216
            N  AI+C  LK+ I
Sbjct  83   NGAAIHCKDLKLKI  96



>ref|XP_007140431.1| hypothetical protein PHAVU_008G111300g [Phaseolus vulgaris]
 gb|ESW12425.1| hypothetical protein PHAVU_008G111300g [Phaseolus vulgaris]
Length=506

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 53/75 (71%), Gaps = 3/75 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN--WHTELCKTMVLNPR  174
            +LFSFLT P+GTII+L S  Q   P+ IGC++NLY+S++N   N  W+  +C+ M+L+PR
Sbjct  34   VLFSFLTLPLGTIIKLVSKNQPHQPLEIGCIDNLYQSVENFNPNVFWN-RICQQMLLSPR  92

Query  175  NPCAIYCSKLKINID  219
            NP    C +LK+ +D
Sbjct  93   NPSESACHRLKLKVD  107


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 5/75 (7%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTELCKTMVLNPRNP  180
             LFSFLT P+G+II L + +     +++G ++NLY S+++   +W     K  +LNPR P
Sbjct  282  FLFSFLTIPLGSIINLMNGK-----LSLGSIDNLYTSVKDLKSSWFIGSAKNSLLNPRVP  336

Query  181  CAIYCSKLKINIDDS  225
                C+   I++ + 
Sbjct  337  HQFGCTSQPIHVPEE  351



>emb|CDY44684.1| BnaA05g29220D [Brassica napus]
Length=557

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRL-TSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            +LFS LT PMGTI+RL   H Q   P+ +GC NN Y+S+ + ++ ++ TE CKTM+L PR
Sbjct  31   VLFSLLTLPMGTIVRLLEKHNQQ--PMRLGCFNNNYKSVSDMTIDDFETEACKTMLLYPR  88

Query  175  NPCAIYCSKLKINIDDS  225
            +   I+C +LK+N+DD+
Sbjct  89   STKEIHCRRLKLNVDDT  105



>ref|XP_002299837.2| hypothetical protein POPTR_0001s25440g [Populus trichocarpa]
 gb|EEE84642.2| hypothetical protein POPTR_0001s25440g [Populus trichocarpa]
Length=492

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLT PMGTII L S+  L       CMNNLY+S++N   + + TE CK M+L+P N
Sbjct  29   ILFSFLTMPMGTIIHLISN--LSPTNGFVCMNNLYKSVENIDAMYFRTEACKQMLLHPHN  86

Query  178  PCAIYCSKLKINIDD  222
              A YC  LK+ IDD
Sbjct  87   AAAAYCKSLKLKIDD  101



>emb|CDX85527.1| BnaA02g02860D [Brassica napus]
Length=477

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI RL        PV++GC NNLY S+ +    N+ TE CK M+L PR+
Sbjct  35   VLFSFLTLPMGTIARLFKKHNKDHPVSVGCFNNLYTSVVDMGFDNFQTEACKRMLLCPRS  94

Query  178  PCAIYCSKLKINID  219
               + C +LK+NI+
Sbjct  95   VSDVQCQRLKVNIN  108



>gb|KDP46572.1| hypothetical protein JCGZ_08544 [Jatropha curcas]
Length=505

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 5/75 (7%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVT-IGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            +LFSFLT P+GTI+RLT++   + P+T IGCMNNLY S++N  +  + TE CKTM+L P+
Sbjct  28   VLFSFLTMPIGTIVRLTNN---RPPITAIGCMNNLYASVENLDVKRFRTEACKTMLLRPK  84

Query  175  NPCAIYCSKLKINID  219
            N  A     LK+ ID
Sbjct  85   NGSATQYKDLKLKID  99



>gb|KEH23019.1| DUF674 family protein [Medicago truncatula]
Length=505

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYR-SIQNSLLNWHTELCKTMVLNPRN  177
            +LFSFLT P+GTI RL   +  K PV+IGC+N LY+ +I        TE  K M+L+P+N
Sbjct  53   VLFSFLTLPLGTIARLIEKDSKKGPVSIGCLNKLYQGAIDLDEEYMQTETSKEMILHPKN  112

Query  178  PCAIYCSKLKINIDD  222
                YC  LK+NIDD
Sbjct  113  SSEDYCINLKLNIDD  127



>ref|XP_002873029.1| hypothetical protein ARALYDRAFT_908051 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49288.1| hypothetical protein ARALYDRAFT_908051 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL    Q+  PVT+GC++NLY S+ +  + ++ TE CK M+L PRN
Sbjct  35   VLFSFLTLPMGTIVRLLGKHQVSEPVTVGCISNLYTSVVDMKIDDFETEACKQMLLYPRN  94

Query  178  PC-AIYCSKLKINID  219
                  C K K+NI+
Sbjct  95   YVREAQCRKFKLNIN  109



>gb|ACN78966.1| unknown [Glycine max]
Length=476

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 55/77 (71%), Gaps = 5/77 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ--NSLLNWHTELCKTMVLNPR  174
            +LFSFLT P+GTIIRL +   L  P+ IGC+NNL++S++  N  + W+ ++CK M+L+PR
Sbjct  34   VLFSFLTLPLGTIIRLGN--TLGQPIEIGCINNLFKSVEALNPDVFWN-DICKRMLLSPR  90

Query  175  NPCAIYCSKLKINIDDS  225
            NP      +LK+ +DD+
Sbjct  91   NPLEFSYQRLKLKVDDT  107



>gb|KHN20650.1| hypothetical protein glysoja_047471, partial [Glycine soja]
Length=587

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 5/77 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN--WHTELCKTMVLNPR  174
            +LFSFLT P+GTIIRL +  Q + PV IG +NNLY S+QN   +  W+  +CK M+L+PR
Sbjct  122  VLFSFLTLPLGTIIRLGN--QFQQPVQIGSINNLYESVQNLRPDVFWNN-ICKKMLLSPR  178

Query  175  NPCAIYCSKLKINIDDS  225
            NP      +LK+ +DD+
Sbjct  179  NPLEASYQRLKVKVDDT  195



>gb|KHG14396.1| putative transcriptional regulatory [Gossypium arboreum]
Length=489

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 50/76 (66%), Gaps = 5/76 (7%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVT-IGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            ILFSFLT PMGTI+RLT + +   P T IGCMNNLY S++    L   T+ CKTM+L PR
Sbjct  32   ILFSFLTMPMGTIVRLTRNRR---PTTNIGCMNNLYNSVEILDALYLRTKACKTMLLYPR  88

Query  175  NPCAIYCSKLKINIDD  222
            N  A  C  LK+ I D
Sbjct  89   NGAAAQCKNLKLAIHD  104



>ref|XP_006363077.1| PREDICTED: uncharacterized protein LOC102585900 [Solanum tuberosum]
Length=480

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 10/79 (13%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTEL----CKTMVLN  168
            IL S LT PMGTIIRL   +       +GCMNNLY+S++N  L+   ++    CKTM+LN
Sbjct  34   ILVSLLTLPMGTIIRLIKAKD----GVVGCMNNLYQSVEN--LSEEDDMFLDHCKTMLLN  87

Query  169  PRNPCAIYCSKLKINIDDS  225
            PRNP   YC +LK++++DS
Sbjct  88   PRNPYPKYCMRLKVDVNDS  106



>gb|AAD56328.1|AC009326_15 hypothetical protein [Arabidopsis thaliana]
Length=333

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF  LTFPMGTI RL    Q K+P  +GC  NL RS+ + ++ ++ TE CK+M+L+P++
Sbjct  32   VLFGLLTFPMGTIARLLEKHQ-KLPQILGCYKNLSRSVSDMAVDDFKTEACKSMLLSPKS  90

Query  178  PCAIYCSKLKINIDDS  225
               I+C +LK++IDD+
Sbjct  91   SMEIHCRRLKLHIDDT  106



>gb|KEH23020.1| DUF674 family protein [Medicago truncatula]
Length=490

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LFSFLT P+GTI RL   +    PVTIGC+N+ Y+S+ +       TE  K M+L+P+N
Sbjct  36   VLFSFLTLPLGTIARLVQKDSNIGPVTIGCLNSFYQSVVDLDEECMQTETSKEMILHPKN  95

Query  178  PCAIYCSKLKINIDDS  225
                YC+ LK+NIDD+
Sbjct  96   SSEDYCTNLKLNIDDT  111



>ref|XP_002884715.1| hypothetical protein ARALYDRAFT_478225 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60974.1| hypothetical protein ARALYDRAFT_478225 [Arabidopsis lyrata subsp. 
lyrata]
Length=316

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LF  LT PMGTI RL  + Q K+P  +GC  NL +S+ + +++ + TE CK+M+L+P++
Sbjct  32   VLFGLLTLPMGTIARLLENHQ-KLPQVLGCYKNLKQSVSDMVIDDFETEACKSMLLSPKS  90

Query  178  PCAIYCSKLKINIDDS  225
               I+C +LK+NIDD+
Sbjct  91   SKEIHCRRLKLNIDDT  106



>ref|XP_003529918.1| PREDICTED: uncharacterized protein LOC100812611 isoform X1 [Glycine 
max]
 ref|XP_006583275.1| PREDICTED: uncharacterized protein LOC100812611 isoform X2 [Glycine 
max]
Length=499

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 5/77 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN--WHTELCKTMVLNPR  174
            +LFSFLT P+GTIIRL +  Q + PV IGC+NNLY S+QN   +  W+  +C+ M+L PR
Sbjct  34   VLFSFLTLPLGTIIRLGN--QFQQPVQIGCINNLYESVQNLRPDVFWNN-ICQKMLLAPR  90

Query  175  NPCAIYCSKLKINIDDS  225
            NP      +LK+ +D +
Sbjct  91   NPLEASYQRLKVKVDGT  107



>ref|XP_010490603.1| PREDICTED: uncharacterized protein LOC104768354 [Camelina sativa]
Length=484

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL   E+ +   +IGC +NLY S+ +  + N+ TE C+ M+LNPR+
Sbjct  35   VLFSFLTLPMGTIVRLI--EKHRKSESIGCFSNLYNSVADVGVDNFETEACQEMLLNPRS  92

Query  178  PCAIYCSKLKINID  219
               I+C +LK+NI+
Sbjct  93   VKGIHCKRLKLNIN  106



>ref|XP_010456353.1| PREDICTED: uncharacterized protein LOC104737790 [Camelina sativa]
Length=476

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTI+RL  + +   P+T+GC NNLYRS+ +    ++ TE CK M+L PR+
Sbjct  35   VLFSLLTLPMGTIVRLLENHRNSEPITVGCFNNLYRSVVDLGSDSFETEACKQMLLYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
               + C +LK++I+ +
Sbjct  95   VRDVQCKRLKVHINST  110



>ref|XP_008220133.1| PREDICTED: uncharacterized protein LOC103320258 [Prunus mume]
 ref|XP_008220141.1| PREDICTED: uncharacterized protein LOC103320258 [Prunus mume]
Length=473

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSF+T PMGTIIRL        PV IGCMNNLY S++N     +    CK M+L+PRN
Sbjct  34   VLFSFMTIPMGTIIRLARKHS--DPVAIGCMNNLYASVENFDDQEFWMHTCKDMLLHPRN  91

Query  178  PCAIYCSKLKINIDDS  225
                 C+ LK+ +DD+
Sbjct  92   AADSQCNALKLKLDDA  107



>ref|XP_002873025.1| hypothetical protein ARALYDRAFT_486965 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49284.1| hypothetical protein ARALYDRAFT_486965 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRS-IQNSLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTI+RL  + +   PVT+GC NNLYRS ++ S  ++ TE CK M++  R+
Sbjct  35   VLFSLLTLPMGTIVRLLENHRKSEPVTVGCFNNLYRSVVEMSRDSFETEACKQMLMYLRS  94

Query  178  PCAIYCSKLKINID  219
               + C +LK+NI+
Sbjct  95   VRDVQCKRLKLNIN  108



>ref|XP_010468074.1| PREDICTED: uncharacterized protein LOC104748079 [Camelina sativa]
Length=484

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LF  LT PMGTI RL    Q K+P  +GC  NL RS+ + +++ + TE CK+M+L+P++
Sbjct  32   VLFGLLTLPMGTIARLLEKHQ-KLPQFLGCYKNLNRSVSDMVIDDFETEACKSMLLSPKS  90

Query  178  PCAIYCSKLKINIDDS  225
               IYC +L +NIDD+
Sbjct  91   THDIYCRRLTLNIDDT  106



>ref|XP_010435564.1| PREDICTED: uncharacterized protein LOC104719350 [Camelina sativa]
Length=487

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRL-TSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            +L+SFLT P+GTI+RL  +H +L+  VT+GC+NNLY+S+ + ++ N+ TE CK M++ P+
Sbjct  35   LLYSFLTMPLGTIVRLLENHGRLRQTVTLGCLNNLYKSVVDMNIDNFRTEACKQMLVYPK  94

Query  175  NPCAIYCSKLKINID  219
            +     C  LKINID
Sbjct  95   SVKESQCKMLKINID  109



>ref|XP_010424822.1| PREDICTED: uncharacterized protein LOC104709993 [Camelina sativa]
Length=505

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF+FLT PMGTI+RL    Q   PVT+GC++NLYRS+ +  + ++ TE CK M+L P+N
Sbjct  36   VLFTFLTLPMGTIVRLLEEHQDSEPVTVGCLSNLYRSVVDMKIDDFETEACKQMLLYPKN  95

Query  178  PCAIYCSKLKINID  219
                     K+NID
Sbjct  96   IRESRYINFKLNID  109



>ref|NP_198548.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09104.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED94165.1| uncharacterized protein AT5G37320 [Arabidopsis thaliana]
Length=485

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHE-QLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            + +SFLT P+GTI+RL  H  +LK  V+IGC NNLY+S+ + S+ N+  E CK M++ P+
Sbjct  35   LFYSFLTMPLGTIVRLLEHHGRLKEKVSIGCFNNLYKSLVDMSIDNFRNEACKQMLVYPK  94

Query  175  NPCAIYCSKLKINIDDS  225
            +     C  LKINIDD+
Sbjct  95   SVKERQCRMLKINIDDT  111



>gb|KDP46569.1| hypothetical protein JCGZ_08541 [Jatropha curcas]
Length=482

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 5/75 (7%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVT-IGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            +LFSFLT P+GT +RLT+++    P+T IGCMNNLY S++N ++  + TE CKTM+L P+
Sbjct  28   VLFSFLTMPIGTSVRLTNNQP---PITAIGCMNNLYASVENLNVKRFRTEACKTMLLRPK  84

Query  175  NPCAIYCSKLKINID  219
            N  A     LK+ ID
Sbjct  85   NGSATQYKDLKLKID  99



>ref|XP_003551651.1| PREDICTED: uncharacterized protein LOC100818003 [Glycine max]
Length=509

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 55/77 (71%), Gaps = 5/77 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ--NSLLNWHTELCKTMVLNPR  174
            +LFSFLT P+GTIIRL +   L  P+ IGC+NNL++S++  N  + W+ ++CK M+L+PR
Sbjct  34   VLFSFLTLPLGTIIRLGN--TLGQPIEIGCINNLFKSVEALNPDVFWN-DICKRMLLSPR  90

Query  175  NPCAIYCSKLKINIDDS  225
            NP      +LK+ +DD+
Sbjct  91   NPLEFSYQRLKLKVDDT  107



>gb|KEH23018.1| DUF674 family protein [Medicago truncatula]
Length=471

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LFSFLT P+GTI RL   E    PVT+GC+N+LY  +++       T++ K M+L P N
Sbjct  37   VLFSFLTLPLGTIARLVEKESSVGPVTLGCLNSLYHCVEDLDEGCLGTKINKEMLLQPAN  96

Query  178  PCAIYCSKLKINIDDS  225
                YCS LK+NIDD+
Sbjct  97   SSEDYCSSLKLNIDDT  112



>ref|XP_007140468.1| hypothetical protein PHAVU_008G115000g [Phaseolus vulgaris]
 gb|ESW12462.1| hypothetical protein PHAVU_008G115000g [Phaseolus vulgaris]
Length=470

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWH---TELCKTMVLNP  171
            +L+SFLT P+GTI RL   + L+ PV +G +N LY S+ N  LN     ++ CK M++ P
Sbjct  30   VLYSFLTMPLGTIARLVQQDSLRGPVQVGSLNTLYESVVN--LNKEYLCSDTCKEMLVRP  87

Query  172  RNPCAIYCSKLKINIDDS  225
            RN    +C  LK+NIDD+
Sbjct  88   RNSAEHHCRSLKLNIDDT  105



>ref|XP_008220154.1| PREDICTED: uncharacterized protein LOC103320274 [Prunus mume]
Length=467

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSF+T PMGTIIRL        PV IGCMNNLY S++N     +   +CK M+L PRN
Sbjct  34   VLFSFMTIPMGTIIRLARKHS--DPVAIGCMNNLYASVENIDEQKFWIPICKDMLLRPRN  91

Query  178  PCAIYCSKLKINIDDS  225
                 C+ LK+ +DD+
Sbjct  92   AANPQCNLLKLKLDDA  107



>ref|XP_009374356.1| PREDICTED: uncharacterized protein LOC103963284 [Pyrus x bretschneideri]
Length=277

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWH-TELCKTMVLNPRN  177
            +LFSFLT PMGTI+R T   +  +P+ IGCM+NLY S++   +  H TE C+ M+L P +
Sbjct  35   VLFSFLTIPMGTIVRNT--RKHSVPMEIGCMSNLYASVEKIDVQHHQTEACRRMLLCPHS  92

Query  178  PCAIYCSKLKINIDDS  225
                +C  LK+ IDD 
Sbjct  93   GVEHHCENLKLKIDDD  108



>ref|XP_007016228.1| Uncharacterized protein TCM_041701 [Theobroma cacao]
 gb|EOY33847.1| Uncharacterized protein TCM_041701 [Theobroma cacao]
Length=507

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 50/79 (63%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIP-VTIGCMNNLYRSIQ---NSLLNWHTELCKTMVLN  168
            ILFSFLT PMGTI+RLT +   + P  +IGC+NNLY S++   N  L   TE C TM+L 
Sbjct  45   ILFSFLTMPMGTIVRLTRN---RPPTASIGCLNNLYNSVEVLDNRYL--RTEACMTMLLY  99

Query  169  PRNPCAIYCSKLKINIDDS  225
            PRN     C  LK+ IDD 
Sbjct  100  PRNGAGAQCKNLKLAIDDG  118



>ref|XP_003551654.1| PREDICTED: uncharacterized protein LOC100820148 [Glycine max]
Length=510

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 54/77 (70%), Gaps = 5/77 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ--NSLLNWHTELCKTMVLNPR  174
            +LFSFLT P+GTIIRL +      P+ IGC+NNL++S++  N  + W+ ++CK M+L+PR
Sbjct  34   VLFSFLTLPLGTIIRLGN--TFGQPIEIGCINNLFKSVEALNPDVFWN-DICKRMLLSPR  90

Query  175  NPCAIYCSKLKINIDDS  225
            NP      +LK+ +DD+
Sbjct  91   NPLQFSYQRLKLKVDDT  107



>ref|NP_195735.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB69843.1| putative protein [Arabidopsis thaliana]
 gb|AED90304.1| uncharacterized protein AT5G01150 [Arabidopsis thaliana]
Length=501

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LFS LT PMGTI+RL  + +   PVT+GC NNLYRS+ +   + + TE CK M++ P++
Sbjct  35   VLFSLLTLPMGTIVRLLENHRKSEPVTLGCFNNLYRSVVDMGSDCFETEACKQMLVYPKS  94

Query  178  PCAIYCSKLKINID  219
               + C +LK+NI+
Sbjct  95   VKDLQCKRLKLNIN  108



>ref|XP_010486475.1| PREDICTED: uncharacterized protein LOC104764608 [Camelina sativa]
Length=490

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LF  +T PMGTI RL +  Q K+P  +GC  NL RS+ + +++ + TE CK+M+L+P++
Sbjct  39   VLFGLMTLPMGTIARLLAKHQ-KLPQFLGCYKNLNRSVSDMVIDDFETEACKSMLLSPKS  97

Query  178  PCAIYCSKLKINIDDS  225
               I+C +L +NIDD+
Sbjct  98   SHEIHCRRLTLNIDDT  113



>emb|CDY53100.1| BnaCnng24300D [Brassica napus]
Length=477

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTI+RL     L   + +GC +N+Y+S+ + ++ ++ TE C+TM+L P++
Sbjct  31   VLFSLLTLPMGTIVRLLEKHNLH-QMRLGCFHNIYKSVSDMTIHDFETEACRTMLLYPKS  89

Query  178  PCAIYCSKLKINIDDS  225
               I+C +LK+NIDD+
Sbjct  90   TKEIHCRRLKLNIDDT  105



>ref|XP_004506699.1| PREDICTED: uncharacterized protein LOC101510622 [Cicer arietinum]
Length=240

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 14/88 (16%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQ------------LKIPVTIGCMNNLYRSIQNSLLN--WHT  141
            LFSFL+ P+GTIIRL +                +    +G +NNLY+S+QN   N  W+ 
Sbjct  39   LFSFLSLPLGTIIRLLTTTNNNDQQQEQEQEQSESSTFLGSINNLYKSVQNMTPNNVWNN  98

Query  142  ELCKTMVLNPRNPCAIYCSKLKINIDDS  225
             +CK M+LNPRN C   C+KL +NIDD+
Sbjct  99   PVCKQMLLNPRNSCESLCTKLFLNIDDT  126



>ref|XP_006300213.1| hypothetical protein CARUB_v10016449mg [Capsella rubella]
 gb|EOA33111.1| hypothetical protein CARUB_v10016449mg [Capsella rubella]
Length=470

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L S LT PMGTI+RL    Q      +GC +NLY+S+    + N+ T  CK +++ PR+
Sbjct  35   VLCSLLTLPMGTIVRLLEKHQNPQSSIVGCFHNLYKSVSGMDVDNFETHACKNLLMYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
              A YC KLK+NIDD+
Sbjct  95   AKASYCRKLKLNIDDT  110



>ref|XP_007207273.1| hypothetical protein PRUPE_ppa014876mg [Prunus persica]
 gb|EMJ08472.1| hypothetical protein PRUPE_ppa014876mg [Prunus persica]
Length=466

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 49/78 (63%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN--SLLNW-HTELCKTMVLNP  171
            +LFS LT PMGTIIRL        PV IGCMNNLY S++N      W HT  C+ M+L+P
Sbjct  32   VLFSLLTIPMGTIIRLARKHS--DPVAIGCMNNLYASVENFDDQEFWMHT--CEDMLLHP  87

Query  172  RNPCAIYCSKLKINIDDS  225
            RN     C+ LK+ +DD+
Sbjct  88   RNAADSQCNALKLKLDDA  105



>ref|XP_003595901.1| hypothetical protein MTR_2g063210 [Medicago truncatula]
 gb|KEH23086.1| DUF674 family protein [Medicago truncatula]
Length=494

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWH---TELCKTMVLNPR  174
            LFSFLT P+GTI RL + E     V  G ++ LY+S+ +  L+ H   +  CK M+LNPR
Sbjct  42   LFSFLTLPLGTISRLVAKESDIEAVRFGSLSTLYQSVSD--LDEHYLWSNTCKEMLLNPR  99

Query  175  NPCAIYCSKLKINIDDS  225
            N    YC +LK+NIDD+
Sbjct  100  NSMEAYCQQLKLNIDDT  116



>ref|XP_007205138.1| hypothetical protein PRUPE_ppa005154mg [Prunus persica]
 gb|EMJ06337.1| hypothetical protein PRUPE_ppa005154mg [Prunus persica]
Length=474

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 6/77 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ--NSLLNWHTELCKTMVLNPR  174
            +LFSFLT PMGT+IRL+   Q   P+ IGCM+N+Y S++  +S L + TE C+ M+L PR
Sbjct  29   VLFSFLTIPMGTVIRLSHRSQ---PLGIGCMDNIYGSVESFDSQL-FRTEECRAMLLRPR  84

Query  175  NPCAIYCSKLKINIDDS  225
            N        LK+  DDS
Sbjct  85   NRTEYLLDNLKLKFDDS  101



>ref|XP_006363076.1| PREDICTED: uncharacterized protein LOC102585564 [Solanum tuberosum]
Length=482

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFS LT P+GTII+L    + +    +GCMN+L RS++N S      E CKTM+L+PRN
Sbjct  34   ILFSLLTLPLGTIIQLIRKAEGR---DVGCMNHLRRSVENLSEKYLLIEHCKTMLLSPRN  90

Query  178  PCAIYCSKLKINIDDS  225
            P   YC +LK++++DS
Sbjct  91   PYPKYCMRLKVDVNDS  106



>ref|XP_007140426.1| hypothetical protein PHAVU_008G110800g [Phaseolus vulgaris]
 gb|ESW12420.1| hypothetical protein PHAVU_008G110800g [Phaseolus vulgaris]
Length=241

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRN  177
             L SFLT P+GTI RL + E    P+ +G ++ LY S+ +   N+   + CK M+L PRN
Sbjct  47   FLLSFLTLPLGTIARLVAQESNVQPLKVGSLSTLYESVSHLKENFLWIQRCKEMLLQPRN  106

Query  178  PCAIYCSKLKINIDDS  225
                YC KLK+NIDD+
Sbjct  107  SMEDYCQKLKLNIDDT  122



>ref|XP_006393618.1| hypothetical protein EUTSA_v10012284mg [Eutrema salsugineum]
 gb|ESQ30904.1| hypothetical protein EUTSA_v10012284mg [Eutrema salsugineum]
Length=485

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  7    FSFLTFPMGTIIRL-TSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRNP  180
            +SFLT P+GTI RL   H + +  VTIGC+NNLY+SI +   + + TE CK M+L P++ 
Sbjct  37   YSFLTMPLGTIARLLEQHGRPRGNVTIGCLNNLYKSIVDMRTDHFRTEACKEMLLYPKSV  96

Query  181  CAIYCSKLKINIDDS  225
                C KLKINIDD+
Sbjct  97   KEGLCRKLKINIDDT  111



>gb|KEH23012.1| MZB10.14 protein [Medicago truncatula]
Length=485

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTELCKTMVLNPRNP  180
            IL SFLT P+GTI RL+  +    PV IGC+N+LY+S+        TE  K M+L PRN 
Sbjct  36   ILCSFLTLPLGTIARLSQMDSSMGPVKIGCLNSLYQSVAGLDECLCTETNKEMLLYPRNS  95

Query  181  CAIYCSKLKINIDD  222
               YC  LK+NIDD
Sbjct  96   SEDYCGTLKLNIDD  109



>ref|XP_008384883.1| PREDICTED: uncharacterized protein LOC103447458 [Malus domestica]
 ref|XP_008384884.1| PREDICTED: uncharacterized protein LOC103447458 [Malus domestica]
Length=215

 Score = 67.8 bits (164),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L SFLT PMGTIIRL  ++    P+ IGCM NLY S++N  + ++ ++ C+ M+L P N
Sbjct  34   VLLSFLTIPMGTIIRLAPNQSE--PLEIGCMKNLYASVENMDVKHFRSKACRDMLLCPPN  91

Query  178  PCAIYCSKLKINID  219
               ++C  LK+ ID
Sbjct  92   GAEVHCKNLKLKID  105



>ref|XP_007140467.1| hypothetical protein PHAVU_008G114900g [Phaseolus vulgaris]
 gb|ESW12461.1| hypothetical protein PHAVU_008G114900g [Phaseolus vulgaris]
Length=238

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTELCKTMVLNPRNP  180
            +L SFLT P+GTI RL   +  + PV +GC+++L +S+ ++     ++ CK M+L PRN 
Sbjct  30   VLCSFLTMPLGTIARLVQEKSHRGPVQVGCLDSLLKSVTSNKQYLWSDTCKEMLLRPRNS  89

Query  181  CAIYCSKLKINIDDS  225
                C  LK+NIDD+
Sbjct  90   SEHRCRSLKLNIDDT  104



>ref|XP_003604753.1| hypothetical protein MTR_4g017410 [Medicago truncatula]
 gb|AES86950.1| DUF674 family protein [Medicago truncatula]
Length=506

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTS------HEQLKIPVT---IGCMNNLYRSIQNSLLN--WHTELC  150
            LFSFL+ P+GTI+RL +       +Q ++P +   +  + NLYR+IQN   N  W+  +C
Sbjct  36   LFSFLSLPLGTIVRLLATINSKNDQQKQLPESSPFLENIKNLYRTIQNLDSNDVWNNTVC  95

Query  151  KTMVLNPRNPCAIYCSKLKINIDDS  225
            K M+L+PRNPC   C KL +N+DD+
Sbjct  96   KQMLLHPRNPCEALCMKLFLNVDDT  120



>gb|KEH23014.1| DUF674 family protein [Medicago truncatula]
Length=474

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN---WHTELCKTMVLNPR  174
            L SFLT P+GTI RL   E +  PVTIGC+N+LY+ + N  LN   +  E  K M+L P+
Sbjct  37   LCSFLTLPLGTIARLLQKESIIGPVTIGCLNSLYQGVAN--LNNSYFLYETIKEMLLQPK  94

Query  175  NPCAIYCSKLKINIDDS  225
            N    YC+ LK NIDD+
Sbjct  95   NSSEDYCNTLKFNIDDT  111



>ref|XP_010452021.1| PREDICTED: uncharacterized protein LOC104734192 [Camelina sativa]
Length=484

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSI-QNSLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL   E+ +    IGC +NLY+S  +  + N+ TE C+ M LNPR+
Sbjct  36   VLFSFLTLPMGTIVRLI--EKNRKSDNIGCFSNLYKSAAEVGIDNFETEACQEMWLNPRS  93

Query  178  PCAIYCSKLKINID  219
               I+C +LK+NI+
Sbjct  94   VKEIHCKRLKLNIN  107



>ref|XP_007208707.1| hypothetical protein PRUPE_ppa017598mg [Prunus persica]
 gb|EMJ09906.1| hypothetical protein PRUPE_ppa017598mg [Prunus persica]
Length=508

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL  ++   +P+ IGC+ NLY S+ N  + ++ TE C+ M+L PRN
Sbjct  34   VLFSFLTIPMGTIMRLAPNQS--VPLEIGCIKNLYSSVTNMDVKHFRTEACRDMLLCPRN  91

Query  178  PCAIYCSKLKINIDDS  225
                 C  LK  ID+ 
Sbjct  92   VAESQCRNLKPKIDNG  107



>ref|XP_008355134.1| PREDICTED: uncharacterized protein LOC103418800, partial [Malus 
domestica]
Length=387

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMG I+RL       +PV IGCM NLY+SI+   + N+ +  C+ M+L P N
Sbjct  41   VLFSFLTMPMGRIVRLAED---SVPVEIGCMRNLYQSIEKYDVRNFRSNECRDMLLLPYN  97

Query  178  PCAIYCSKLKINIDDS  225
               + C  LK+ ID+ 
Sbjct  98   SADLQCQNLKLKIDND  113



>ref|XP_008220104.1| PREDICTED: uncharacterized protein LOC103320235 [Prunus mume]
 ref|XP_008220110.1| PREDICTED: uncharacterized protein LOC103320235 [Prunus mume]
Length=479

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ--NSLLNWHTELCKTMVLNPR  174
            +LFSFLT PMGT+IRL+   Q   P+ IGCM+N+Y S++  +S L + TE C+ M+L PR
Sbjct  34   VLFSFLTIPMGTVIRLSHRSQ---PLGIGCMDNIYGSVESFDSQL-FRTEECRAMLLRPR  89

Query  175  NPCAIYCSKLKINIDD  222
            N        LK+  DD
Sbjct  90   NRTEYLLDNLKLKFDD  105



>ref|XP_003621378.1| hypothetical protein MTR_7g012680 [Medicago truncatula]
Length=474

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ---NSLLNWHTELCKTMVLNP  171
            +LFSFLT P+GTI RL S +     V  G +++LY+S+       L  HT  CK M+LNP
Sbjct  40   VLFSFLTLPLGTIARLVSKDSNIEAVKFGSISSLYQSVSKFDQQYLWSHT--CKEMLLNP  97

Query  172  RNPCAIYCSKLKINIDDS  225
            RN    YC KLK+NIDD+
Sbjct  98   RNSMEDYCQKLKLNIDDT  115



>ref|XP_004492001.1| PREDICTED: uncharacterized protein LOC101501664 [Cicer arietinum]
Length=222

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            IL SFLT P+GTI RL   +      TIGC+N+LY+S+QN       TE  K ++L P+N
Sbjct  36   ILCSFLTLPLGTIARLLQKDTNMGSDTIGCLNSLYQSVQNFDEKCLMTETTKKLLLQPKN  95

Query  178  PCAIYCSKLKINIDDS  225
                YCS LK NIDD+
Sbjct  96   SSEKYCSTLKFNIDDT  111



>gb|KEH23003.1| DUF674 family protein [Medicago truncatula]
Length=478

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ--NSLLNWHTELCKTMVLNPRN  177
            LFSFLT P+GTI RL   +    PVTIGC+N LY+S+   +  + W TE  + ++L P++
Sbjct  36   LFSFLTLPLGTIARLVQKDSKIGPVTIGCLNTLYQSVADLDKEVLW-TEESRGLLLQPKS  94

Query  178  PCAIYCSKLKINIDDS  225
                YC+ LK+NIDD+
Sbjct  95   SSEHYCNTLKLNIDDT  110



>ref|XP_008344826.1| PREDICTED: uncharacterized protein LOC103407720 [Malus domestica]
Length=479

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMG I+RL       +PV IGCM NLY+SI+   + N+ +  C+ M+L P N
Sbjct  41   VLFSFLTMPMGRIVRLAED---SVPVEIGCMRNLYQSIEKYDVRNFRSNECRDMLLLPYN  97

Query  178  PCAIYCSKLKINIDDS  225
               + C  LK+ ID+ 
Sbjct  98   SADLQCQNLKLKIDND  113



>ref|XP_004506639.1| PREDICTED: uncharacterized protein LOC101488456 [Cicer arietinum]
Length=504

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 53/86 (62%), Gaps = 12/86 (14%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTS-------HEQLKIP--VTIGCMNNLYRSIQN--SLLNWHTEL  147
            ILFSFLT P+GTIIRL S       H+    P    IGC+NNLY+S++N    + W+   
Sbjct  39   ILFSFLTLPLGTIIRLLSKNQHHNIHDYDDQPQEENIGCINNLYKSVENLSDGVFWNN-T  97

Query  148  CKTMVLNPRNPCAIYCSKLKINIDDS  225
            CK M+L PRN C   C  LK+N+DD+
Sbjct  98   CKEMLLCPRNSCESVCKNLKLNLDDT  123



>gb|KEH22913.1| DUF674 family protein [Medicago truncatula]
Length=388

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LFSFLTFP+GTI RL   E    PV +GC+N  Y S+ +       +E  K M+L P N
Sbjct  36   VLFSFLTFPLGTIARLVQKESSMGPVNVGCLNTFYHSVADLGDECMLSETTKQMLLQPIN  95

Query  178  PCAIYCSKLKINIDDS  225
                YC+ LK+NIDD+
Sbjct  96   FAEDYCNTLKLNIDDT  111



>gb|AES77596.2| DUF674 family protein [Medicago truncatula]
Length=452

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ---NSLLNWHTELCKTMVLNP  171
            +LFSFLT P+GTI RL S +     V  G +++LY+S+       L  HT  CK M+LNP
Sbjct  40   VLFSFLTLPLGTIARLVSKDSNIEAVKFGSISSLYQSVSKFDQQYLWSHT--CKEMLLNP  97

Query  172  RNPCAIYCSKLKINIDDS  225
            RN    YC KLK+NIDD+
Sbjct  98   RNSMEDYCQKLKLNIDDT  115



>ref|XP_004295725.1| PREDICTED: uncharacterized protein LOC101291415 [Fragaria vesca 
subsp. vesca]
Length=952

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 50/74 (68%), Gaps = 3/74 (4%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNS-LLNWHTELCKTMVLNPRNP  180
            LFSFL+ P+GTIIRL  +    +PV IGCMNNLY S+++S + ++ TE C+ M+L PR+ 
Sbjct  33   LFSFLSIPIGTIIRLAHNHS--VPVGIGCMNNLYASVESSDVQHFRTEACRDMLLCPRSR  90

Query  181  CAIYCSKLKINIDD  222
                   LK N++D
Sbjct  91   AGATLKNLKHNVED  104


 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ++FSFLT PMG +IRL  ++ +   + IGCMN LY S++N  + +  TE CK M+L+PR+
Sbjct  492  VIFSFLTIPMGNLIRLAPNQSI---LGIGCMNKLYSSVKNMDVKHLQTEACKDMLLSPRS  548

Query  178  PCAIYCSKLKINID  219
                 C  LK+ ID
Sbjct  549  VAESQCKNLKVKID  562



>emb|CAE04151.1| OSJNBa0009P12.36 [Oryza sativa Japonica Group]
 emb|CAD41561.3| OSJNBa0006A01.16 [Oryza sativa Japonica Group]
Length=360

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT P+GTI+RL   +       IGC++ LY+S++  S   + T+ CK M+L PRN
Sbjct  36   VLFSFLTLPLGTIVRLLGKQS-----QIGCLDELYKSVEALSEDYFQTKACKAMLLRPRN  90

Query  178  PCAIYCSKLKINIDDS  225
                +C +LK+ +DD+
Sbjct  91   AAGSHCDRLKVKVDDT  106



>ref|XP_010543887.1| PREDICTED: uncharacterized protein LOC104816656 [Tarenaya hassleriana]
Length=340

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWH---TELCKTMVLNP  171
            +LFSFL  PMGTI+RL    +    + +GC++NLYRS+  S L +H   T+ C   +L P
Sbjct  34   VLFSFLILPMGTIVRLLEKRKKSETLVVGCLDNLYRSV--SELGFHYFRTQSCMDRLLFP  91

Query  172  RNPCAIYCSKLKINIDDS  225
            +N     C +LKINIDD+
Sbjct  92   QNVMEDQCRRLKINIDDT  109



>ref|XP_009337359.1| PREDICTED: uncharacterized protein LOC103929826 [Pyrus x bretschneideri]
Length=470

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLT-SHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            +LFSFLT PMGTI+ L+ SH     P+ +GCMNNLY S++N  L    TE C+ M+L+PR
Sbjct  34   VLFSFLTMPMGTIVGLSDSHLP---PMRVGCMNNLYESVENIDLQLLKTEECRAMLLHPR  90

Query  175  NPCAIYCSKLKINIDDS  225
            N        LK+ IDDS
Sbjct  91   NAAESLLRCLKLKIDDS  107



>emb|CDY53113.1| BnaCnng24410D [Brassica napus]
Length=389

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTI+RL  + +   PV +GC +NLY+S+ +    ++ TE CK ++L PR+
Sbjct  35   VLFSLLTLPMGTIVRLLENHRKSEPVPVGCFSNLYKSVVDMGTDDFETEACKQILLYPRS  94

Query  178  PCAIYCSKLKINI  216
               + C +LK+N+
Sbjct  95   LRDVQCKRLKLNL  107



>gb|KEH23013.1| DUF674 family protein [Medicago truncatula]
Length=445

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWH---TELCKTMVLNP  171
            IL SFLT P+GT+ RL   +    PV++GC+N+LY+++++  LN      +  K M+L P
Sbjct  36   ILCSFLTMPLGTVARLMQKDSSMGPVSVGCLNSLYQTVKD--LNKECLWKDSDKEMLLQP  93

Query  172  RNPCAIYCSKLKINIDDS  225
            +N    YCS LK NIDDS
Sbjct  94   KNSSEDYCSTLKFNIDDS  111



>emb|CAH67986.1| OSIGBa0142I02-OSIGBa0101B20.29 [Oryza sativa Indica Group]
Length=333

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF FLT P+GT++RL   +       +GC++ LY+S+++ S   +HT+ CK M+L P N
Sbjct  36   VLFGFLTLPLGTVVRLLGRQS-----QVGCLDELYKSVEDLSADYFHTKACKAMLLKPHN  90

Query  178  PCAIYCSKLKINIDDS  225
              A  C  LK+ +DD+
Sbjct  91   TAAELCCLLKVKVDDT  106



>gb|KEH37039.1| DUF674 family protein [Medicago truncatula]
Length=408

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ--NSLLNWHTELCKTMVLNPR  174
            +LFSFLT P+GTI RL + E     V  G +++LY+S++  +    W+ + CK M+L PR
Sbjct  40   VLFSFLTLPLGTIARLVATESNIEAVQFGSISSLYQSVKDLDQQYLWN-QTCKKMLLKPR  98

Query  175  NPCAIYCSKLKINIDDS  225
            N    YC KL +NIDD+
Sbjct  99   NSTETYCQKLNLNIDDT  115



>tpg|DAA36235.1| TPA: hypothetical protein ZEAMMB73_238952 [Zea mays]
Length=408

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT P+GTI+RL   +       +GC++ LY+S+++ +L  + T  CK M+L P N
Sbjct  34   VLFSFLTMPLGTIVRLLDKQS-----QMGCLDQLYKSVEDLNLEYFQTSACKAMLLKPLN  88

Query  178  PCAIYCSKLKINIDDS  225
              + +C +LKIN+D S
Sbjct  89   AASGHCRRLKINVDGS  104


 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 39/69 (57%), Gaps = 5/69 (7%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTELCKTMVLNPRNPC  183
            LFS L+ P+G+ I+L      K     GC+ N+YRSI  S+  +  E C++++L+P+ P 
Sbjct  294  LFSLLSIPLGSAIKLYGQCSAK-----GCLGNVYRSIDGSVQEFVREECQSLLLDPKLPP  348

Query  184  AIYCSKLKI  210
               C   KI
Sbjct  349  FFGCCASKI  357



>ref|XP_010464553.1| PREDICTED: uncharacterized protein LOC104745077 [Camelina sativa]
Length=495

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSI-QNSLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL    +    V +GC NNLY+S+ +  L ++ TE CK ++L PR+
Sbjct  35   VLFSFLTLPMGTIVRLLEKHRTSPQVVVGCFNNLYKSVSEMGLESFQTESCKQVLLYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
                   K+K+ IDD+
Sbjct  95   VYRDKYRKIKLKIDDT  110



>gb|EAY95385.1| hypothetical protein OsI_17218 [Oryza sativa Indica Group]
Length=421

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT P+GTI+RL   +       IGC++ LY+S++  S   + T+ CK M+L PRN
Sbjct  36   VLFSFLTLPLGTIVRLLGKQS-----QIGCLDELYKSVEALSEDYFQTKACKAMLLRPRN  90

Query  178  PCAIYCSKLKINIDDS  225
                +C +LK+ +DD+
Sbjct  91   AAGSHCDRLKVKVDDT  106



>ref|XP_010494298.1| PREDICTED: uncharacterized protein LOC104771467 [Camelina sativa]
 ref|XP_010494299.1| PREDICTED: uncharacterized protein LOC104771467 [Camelina sativa]
Length=496

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 3/77 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTS-HEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            ILFSFLT PMGTI+RL   ++QL+ P  IGC NN+Y S+ + S+ ++ TE CK M+L P 
Sbjct  35   ILFSFLTLPMGTIVRLIEMNQQLQSP-GIGCFNNIYASVVSMSIKHFRTEACKQMLLYPG  93

Query  175  NPCAIYCSKLKINIDDS  225
            +     C  LK+ IDDS
Sbjct  94   SLNHEKCQNLKMRIDDS  110



>emb|CAH67987.1| OSIGBa0142I02-OSIGBa0101B20.30 [Oryza sativa Indica Group]
Length=430

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT P+GTI+RL   +       IGC++ LY+S++  S   + T+ CK M+L PRN
Sbjct  36   VLFSFLTLPLGTIVRLLGKQS-----QIGCLDELYKSVEALSEDYFQTKACKAMLLRPRN  90

Query  178  PCAIYCSKLKINIDDS  225
                +C +LK+ +DD+
Sbjct  91   AAGSHCDRLKVKVDDT  106



>ref|XP_008373329.1| PREDICTED: uncharacterized protein LOC103436666 [Malus domestica]
Length=482

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L SFLT PMGTIIRL  ++    P+ IGCM NLY S++N  + ++ ++ C+ M+L P N
Sbjct  34   VLLSFLTIPMGTIIRLAPNQSE--PLEIGCMKNLYASVENMDVKHFRSKACRDMLLCPPN  91

Query  178  PCAIYCSKLKINID  219
               ++C  LK+ ID
Sbjct  92   GAEVHCKNLKLKID  105



>emb|CDY44590.1| BnaA04g10000D [Brassica napus]
Length=460

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTI+RL  + +    V IGC +NLY+S+ +    ++ TE CK M+L PR+
Sbjct  35   VLFSLLTLPMGTIVRLLENHRKSETVPIGCFSNLYKSVVDMGTDDFETEACKQMLLYPRS  94

Query  178  PCAIYCSKLKINI  216
               ++C +LK+N+
Sbjct  95   LWDVHCRRLKLNL  107



>gb|ABK28675.1| unknown [Arabidopsis thaliana]
Length=453

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTIIRL    +   P+T+GC +NLYRS+    + N+ T++CK ++L+PR+
Sbjct  35   VLFSLLTLPMGTIIRLLEEHRESQPITVGCFSNLYRSVAEMGIDNFKTDVCKHILLHPRS  94

Query  178  PCAIYCSKLKINID  219
               +   +L +NI+
Sbjct  95   VRDLQYKRLMLNIN  108



>ref|XP_002863678.1| hypothetical protein ARALYDRAFT_331073 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39937.1| hypothetical protein ARALYDRAFT_331073 [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSF+T PMG I+RL    Q    ++IGC NN+Y S+ +  + ++ TE CK M+L P +
Sbjct  35   ILFSFMTLPMGKIVRLMEMHQKSQSISIGCFNNIYGSVLSMGMKHFRTEACKQMLLYPGS  94

Query  178  PCAIYCSKLKINIDDS  225
                 C  LKI IDDS
Sbjct  95   LNQEKCRNLKIRIDDS  110



>ref|NP_195733.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90302.1| uncharacterized protein AT5G01130 [Arabidopsis thaliana]
Length=452

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTIIRL    +   P+T+GC +NLYRS+    + N+ T++CK ++L+PR+
Sbjct  35   VLFSLLTLPMGTIIRLLEEHRESQPITVGCFSNLYRSVAEMGIDNFKTDVCKHILLHPRS  94

Query  178  PCAIYCSKLKINID  219
               +   +L +NI+
Sbjct  95   VRDLQYKRLMLNIN  108



>ref|XP_010418865.1| PREDICTED: uncharacterized protein LOC104704481 [Camelina sativa]
Length=500

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L   LT PMGTI+RL    Q     T+GC  NLY+S+ + S+ N+ T+ CK ++L PR+
Sbjct  35   VLCGLLTLPMGTIVRLLEKHQNPQSFTVGCFTNLYKSVSDMSVDNFETQACKDLLLYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
                +C +LK+N+DD+
Sbjct  95   LKESHCRRLKLNLDDT  110



>ref|XP_002884714.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60973.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L S LT PMGTI+RL    Q      +GC +NLY+S+ +  + N+ T+ CK ++L+PR+
Sbjct  35   VLCSLLTLPMGTIVRLLEKHQNPQSAIVGCFHNLYKSVSDMDVDNFQTQACKNLLLHPRS  94

Query  178  PCAIYCSKLKINIDDS  225
              A +  KLK+NIDD+
Sbjct  95   AKASHGRKLKLNIDDT  110



>emb|CAB69841.1| putative protein [Arabidopsis thaliana]
Length=484

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTIIRL    +   P+T+GC +NLYRS+    + N+ T++CK ++L+PR+
Sbjct  35   VLFSLLTLPMGTIIRLLEEHRESQPITVGCFSNLYRSVAEMGIDNFKTDVCKHILLHPRS  94

Query  178  PCAIYCSKLKINID  219
               +   +L +NI+
Sbjct  95   VRDLQYKRLMLNIN  108



>ref|XP_009139969.1| PREDICTED: uncharacterized protein LOC103863956 [Brassica rapa]
Length=460

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTI+RL  + +    V IGC +NLY+S+ +    ++ TE CK M+L PR+
Sbjct  35   VLFSLLTLPMGTIVRLLENHRKSETVPIGCFSNLYKSVVDMGTDDFETEACKQMLLYPRS  94

Query  178  PCAIYCSKLKINI  216
               ++C +LK+N+
Sbjct  95   LWDVHCRRLKLNL  107



>ref|XP_006289415.1| hypothetical protein CARUB_v10002914mg [Capsella rubella]
 gb|EOA22313.1| hypothetical protein CARUB_v10002914mg [Capsella rubella]
Length=513

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSF T PMGTI+RL    Q    + IGC NN+Y S+ +  + ++ TE CK M+L P +
Sbjct  35   ILFSFSTLPMGTIVRLLEMHQKSRSIPIGCFNNIYGSVGSMGMKHFSTEACKQMLLYPGS  94

Query  178  PCAIYCSKLKINIDDS  225
                 C K+K+ IDDS
Sbjct  95   LSQEKCQKVKLRIDDS  110



>ref|XP_009337351.1| PREDICTED: uncharacterized protein LOC103929821 [Pyrus x bretschneideri]
Length=482

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ++ SFLT PMGTIIRL  ++   +P+ IGCM NLY S++N  + ++  + C+ M+L P N
Sbjct  34   VVLSFLTIPMGTIIRLAPNQS--VPLEIGCMKNLYASVENMDVKHFRHKACRDMLLCPPN  91

Query  178  PCAIYCSKLKINID  219
               ++C  LK+ ID
Sbjct  92   GAEVHCKNLKLKID  105



>tpg|DAA36233.1| TPA: hypothetical protein ZEAMMB73_987454 [Zea mays]
Length=437

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT P+GTI+RL   +       +GC++ LY+S+++ +L  + T  CK M+L P N
Sbjct  34   VLFSFLTMPLGTIVRLLDKQS-----QMGCLDQLYKSVEDLNLEYFQTSACKAMLLKPLN  88

Query  178  PCAIYCSKLKINIDDS  225
              + +C +LKIN+D S
Sbjct  89   AASGHCCRLKINVDGS  104



>emb|CDY44588.1| BnaA04g10020D [Brassica napus]
Length=461

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTI+RL  + +   P  IGC +NLY+S+ +  + ++ TE CK M+L PR+
Sbjct  35   VLFSLLTLPMGTIVRLLENHRKSEPEPIGCFSNLYKSVVDMGIDDFETEACKQMLLYPRS  94

Query  178  PCAIYCSKLKINI  216
               + C +LK+N+
Sbjct  95   LRDVECKRLKLNL  107



>emb|CDX90967.1| BnaC02g06300D [Brassica napus]
Length=482

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI  L         V++GC NNLY S+ +    N+ TE CK M+L P++
Sbjct  35   VLFSFLTLPMGTIAMLFKKHNKAHTVSVGCFNNLYTSVVDIGFDNFQTEACKRMLLCPKS  94

Query  178  PCAIYCSKLKINID  219
               + C +LK+NI+
Sbjct  95   VSDVQCQRLKVNIN  108



>ref|NP_001118603.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE74728.1| uncharacterized protein AT3G09140 [Arabidopsis thaliana]
Length=502

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFL  PMGTI+RL    Q    V IGC NNLY+S+    L ++ TE CK ++L PR+
Sbjct  35   VLFSFLALPMGTIVRLLEKHQKSPQVGIGCFNNLYKSVSEMDLESFQTEACKQVLLYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
                    +K+ IDD+
Sbjct  95   VNLEKFRNMKLKIDDT  110



>gb|KEH23021.1| DUF674 family protein [Medicago truncatula]
Length=437

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSI---QNSLLNWHTELCKTMVLNP  171
            +L SFLT P+GTI RL   E    PVT+GC+N+LYRS+       ++ HT   K M+L P
Sbjct  37   VLCSFLTMPLGTIARLVEKESSIGPVTVGCLNSLYRSVVDLDEDCMSSHT--IKQMLLKP  94

Query  172  RNPCAIYCSKLKINIDDS  225
             N    YC+ L++NI+D+
Sbjct  95   TNFAEDYCNTLELNIEDT  112



>ref|XP_003595912.1| hypothetical protein MTR_2g063350 [Medicago truncatula]
 gb|KEH23097.1| DUF674 family protein [Medicago truncatula]
Length=516

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L SFLTFPMGTI RL S       V +G +++LY S+ N     + T +CK M+L PRN
Sbjct  36   VLLSFLTFPMGTIARLVSKNSNIQKVRVGSISSLYDSVVNLEEKQFWTPVCKEMLLRPRN  95

Query  178  PCAIYCSKLKINIDDS  225
                YC  +K+NIDD+
Sbjct  96   TMEEYCEHIKLNIDDT  111



>gb|AAD56330.1|AC009326_17 hypothetical protein [Arabidopsis thaliana]
Length=473

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFL  PMGTI+RL    Q    V IGC NNLY+S+    L ++ TE CK ++L PR+
Sbjct  35   VLFSFLALPMGTIVRLLEKHQKSPQVGIGCFNNLYKSVSEMDLESFQTEACKQVLLYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
                    +K+ IDD+
Sbjct  95   VNLEKFRNMKLKIDDT  110



>gb|EEE58770.1| hypothetical protein OsJ_10282 [Oryza sativa Japonica Group]
Length=555

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT P+GTI+RL   +       IGC++ LY+S++  S   + T+ CK M+L PRN
Sbjct  36   VLFSFLTLPLGTIVRLLGKQS-----QIGCLDELYKSVEALSEDYFQTKACKAMLLRPRN  90

Query  178  PCAIYCSKLKINIDDS  225
                +C +LK+ +DD+
Sbjct  91   AAGSHCDRLKVKVDDT  106


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/64 (36%), Positives = 39/64 (61%), Gaps = 8/64 (13%)
 Frame = +1

Query  37   IIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRNPCAIYCSKLKIN  213
            ++ L SH+       IGC++ LY+S++  S   + T+ CK M+L PRN    +C +LK+ 
Sbjct  202  VLELNSHK-------IGCLDELYKSVEALSEDYFQTKACKAMLLRPRNAAGSHCDRLKVK  254

Query  214  IDDS  225
            +DD+
Sbjct  255  VDDT  258



>tpg|DAA36234.1| TPA: hypothetical protein ZEAMMB73_987454 [Zea mays]
Length=470

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT P+GTI+RL   +       +GC++ LY+S+++ +L  + T  CK M+L P N
Sbjct  34   VLFSFLTMPLGTIVRLLDKQS-----QMGCLDQLYKSVEDLNLEYFQTSACKAMLLKPLN  88

Query  178  PCAIYCSKLKINIDDS  225
              + +C +LKIN+D S
Sbjct  89   AASGHCCRLKINVDGS  104



>ref|NP_001140340.1| hypothetical protein [Zea mays]
 gb|ACF83614.1| unknown [Zea mays]
 tpg|DAA36232.1| TPA: hypothetical protein ZEAMMB73_987454 [Zea mays]
Length=405

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT P+GTI+RL   +       +GC++ LY+S+++ +L  + T  CK M+L P N
Sbjct  34   VLFSFLTMPLGTIVRLLDKQS-----QMGCLDQLYKSVEDLNLEYFQTSACKAMLLKPLN  88

Query  178  PCAIYCSKLKINIDDS  225
              + +C +LKIN+D S
Sbjct  89   AASGHCCRLKINVDGS  104



>ref|NP_187526.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAT67574.1| hypothetical protein At3G09140 [Arabidopsis thaliana]
 gb|AEE74727.1| uncharacterized protein AT3G09140 [Arabidopsis thaliana]
Length=530

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFL  PMGTI+RL    Q    V IGC NNLY+S+    L ++ TE CK ++L PR+
Sbjct  35   VLFSFLALPMGTIVRLLEKHQKSPQVGIGCFNNLYKSVSEMDLESFQTEACKQVLLYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
                    +K+ IDD+
Sbjct  95   VNLEKFRNMKLKIDDT  110



>ref|NP_001053728.2| Os04g0594500 [Oryza sativa Japonica Group]
 dbj|BAF15642.2| Os04g0594500 [Oryza sativa Japonica Group]
Length=403

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 48/76 (63%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF FLT P+GT++RL   +       +GC++ LY+S+++ S   +HT+ CK M++ P N
Sbjct  36   VLFGFLTLPLGTVVRLLGRQS-----QVGCLDELYKSVEDLSADYFHTKACKAMLMKPHN  90

Query  178  PCAIYCSKLKINIDDS  225
              A  C  LK+ +DD+
Sbjct  91   TAAEQCCLLKVKVDDT  106



>ref|XP_008373327.1| PREDICTED: uncharacterized protein LOC103436664 [Malus domestica]
 ref|XP_008373328.1| PREDICTED: uncharacterized protein LOC103436664 [Malus domestica]
Length=483

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 50/74 (68%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L SFLT PMGTIIRL  + QL+ P+ IGCM NLY S++N  + ++ +E C+ M+L P N
Sbjct  34   VLLSFLTIPMGTIIRLAPN-QLE-PLEIGCMKNLYASVKNMDVKHFRSEACRDMLLYPPN  91

Query  178  PCAIYCSKLKINID  219
               ++C  L+  ID
Sbjct  92   GAEVHCKNLEGKID  105



>gb|EMT20117.1| hypothetical protein F775_02467 [Aegilops tauschii]
Length=477

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLT P+G I+RL      K    +GC++ LY+S+      ++ T +CKTM+L+P N
Sbjct  34   ILFSFLTLPLGAIVRL-----FKKQAQMGCLDELYKSVDALGAEHFQTTVCKTMLLSPVN  88

Query  178  PCAIYCSKLKINIDDS  225
              A +C +LK+ +DD+
Sbjct  89   AAAFHCDRLKVKVDDA  104



>ref|XP_010442052.1| PREDICTED: uncharacterized protein LOC104725145 [Camelina sativa]
Length=506

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLT PMGTI+RL    Q      IGC NN+Y S+ + S+ ++ TE CK M+L P +
Sbjct  35   ILFSFLTLPMGTIVRLIEMHQKSQSPGIGCFNNIYASVVSMSIKHFRTEACKQMLLYPGS  94

Query  178  PCAIYCSKLKINIDDS  225
                 C  LK+ IDDS
Sbjct  95   LNHEKCQNLKMMIDDS  110



>gb|KHN13931.1| hypothetical protein glysoja_016215 [Glycine soja]
Length=491

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWH---TELCKTMVLNP  171
            +L SFLT P+GTI+RL + E     V  G +++LY+S++N  L+     T+ CK M+L P
Sbjct  35   VLISFLTLPLGTIVRLANKESNMDLVEFGSLSSLYKSVEN--LDNECLCTDTCKEMLLRP  92

Query  172  RNPCAIYCSKLKINIDDS  225
            RN    YC  +K+NIDD+
Sbjct  93   RNSLEAYCRNMKLNIDDT  110



>ref|XP_010104702.1| hypothetical protein L484_022086 [Morus notabilis]
 gb|EXC01508.1| hypothetical protein L484_022086 [Morus notabilis]
Length=547

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 52/78 (67%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLL---NWHTELCKTMVLNP  171
            +LFSFLT  +GTIIRL   ++  +P+T+GC+NNLY S++N  L   ++H+E  K M  +P
Sbjct  111  VLFSFLTMSLGTIIRLA--QERSMPLTMGCVNNLYESVKNMDLHHFHFHSEAGKLMFSSP  168

Query  172  RNPCAIYCSKLKINIDDS  225
            R+     C  LK+ ID++
Sbjct  169  RSEAENNCMNLKLKIDNT  186



>gb|EAY95384.1| hypothetical protein OsI_17217 [Oryza sativa Indica Group]
Length=590

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF FLT P+GT++RL   +       +GC++ LY+S+++ S   +HT+ CK M+L P N
Sbjct  36   VLFGFLTLPLGTVVRLLGRQS-----QVGCLDELYKSVEDLSADYFHTKACKAMLLKPHN  90

Query  178  PCAIYCSKLKINIDDS  225
              A  C  LK+ +DD+
Sbjct  91   TAAELCCLLKVKVDDT  106



>ref|XP_003551835.2| PREDICTED: uncharacterized protein LOC100808732 [Glycine max]
Length=491

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWH---TELCKTMVLNP  171
            +L SFLT P+GTI+RL + E     V  G +++LY+S++N  L+     T+ CK M+L P
Sbjct  35   VLISFLTLPLGTIVRLANKESNMDLVEFGSLSSLYKSVEN--LDNECLCTDTCKEMLLRP  92

Query  172  RNPCAIYCSKLKINIDDS  225
            RN    YC  +K+NIDD+
Sbjct  93   RNSLEAYCRNMKLNIDDT  110



>ref|XP_008220995.1| PREDICTED: uncharacterized protein LOC103321024 [Prunus mume]
Length=367

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LFSFLT PMGTIIRL       +P+ IGCM NLY  ++++    + TE C+ M+L PRN
Sbjct  34   VLFSFLTIPMGTIIRLACTRS--VPLEIGCMKNLYSRVEHADARVFPTESCREMLLCPRN  91

Query  178  PCAIYCSKLKINIDD  222
                +C  LK+ I +
Sbjct  92   GVESHCENLKLKITN  106



>emb|CAE04150.1| OSJNBa0009P12.35 [Oryza sativa Japonica Group]
 emb|CAE05475.3| OSJNBa0006A01.15 [Oryza sativa Japonica Group]
 gb|EAZ31838.1| hypothetical protein OsJ_15999 [Oryza sativa Japonica Group]
Length=530

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 48/76 (63%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF FLT P+GT++RL   +       +GC++ LY+S+++ S   +HT+ CK M++ P N
Sbjct  36   VLFGFLTLPLGTVVRLLGRQS-----QVGCLDELYKSVEDLSADYFHTKACKAMLMKPHN  90

Query  178  PCAIYCSKLKINIDDS  225
              A  C  LK+ +DD+
Sbjct  91   TAAEQCCLLKVKVDDT  106



>ref|XP_002884716.1| hypothetical protein ARALYDRAFT_478227 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60975.1| hypothetical protein ARALYDRAFT_478227 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSI-QNSLLNWHTELCKTMVLNPRN  177
            +LFSFL  PMGTI+RL    +    V +GC NNLY+S+ +  + ++ TE CK ++L PR+
Sbjct  35   VLFSFLALPMGTIVRLLEEHRKSPQVVVGCFNNLYKSVSEMGIESFQTEACKQILLYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
                   K+K+ IDD+
Sbjct  95   VNLEKYRKIKLKIDDT  110



>ref|XP_006287625.1| hypothetical protein CARUB_v10000837mg [Capsella rubella]
 gb|EOA20523.1| hypothetical protein CARUB_v10000837mg [Capsella rubella]
Length=485

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTI+RL    +      +GC +NLY+S+ +  + N+ TE C+ ++LNPR+
Sbjct  35   VLFSLLTLPMGTIVRLIEKHR---KCELGCFSNLYKSVADVGIENFETEACQQILLNPRS  91

Query  178  PCAIYCSKLKINID  219
               I C +LK+NI+
Sbjct  92   VKEIQCKRLKLNIN  105



>ref|XP_010480428.1| PREDICTED: uncharacterized protein LOC104759168 [Camelina sativa]
Length=506

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF  L  PMG I+RL    +LK   TIGC NNLY S+ N  + ++ +E CK M+L PR 
Sbjct  40   VLFRLLALPMGAIVRLLEKYKLKQAATIGCFNNLYSSVSNLGIHDFMSEACKDMLLYPRY  99

Query  178  PCAIYCSKLKINI  216
                 C +LK+NI
Sbjct  100  VKERQCRRLKLNI  112



>ref|XP_009150349.1| PREDICTED: uncharacterized protein LOC103873706 [Brassica rapa]
Length=354

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L S LT PMGTI+RL    Q      +GC + LY+S+ + S+ ++ T++CK  +L PR+
Sbjct  35   VLCSILTLPMGTIVRLLEKHQTPQSPIVGCFHKLYKSVSDMSVDHFETQVCKNQLLYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
                YC  LK+NIDD+
Sbjct  95   VRESYCGNLKLNIDDT  110



>ref|XP_010424823.1| PREDICTED: uncharacterized protein LOC104709994 [Camelina sativa]
Length=506

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS LT PMGTI+RL  + +   P+T+GC NNLY+S+ +    ++ TE CK M+L P +
Sbjct  35   VLFSLLTLPMGTIVRLLENHRNSEPITVGCFNNLYKSVVDMGSDSFETEACKQMLLYPMS  94

Query  178  PCAIYCSKLKINID  219
               +   +LK+NI+
Sbjct  95   VRDVQSKRLKVNIN  108



>gb|KFK43406.1| hypothetical protein AALP_AA1G121900 [Arabis alpina]
Length=289

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFL  PMGTI+RL  ++  +   TIGC NNLY+S+ +    ++ TE CK +++  R 
Sbjct  37   VLFSFLLRPMGTIVRLLKNQNSQTATTIGCFNNLYKSVVDMGNDDFLTEACKDILVYTRY  96

Query  178  PCAIYCSKLKINIDDS  225
                 C +LK+NIDD+
Sbjct  97   EKERQCRRLKLNIDDT  112



>gb|AES59109.2| DUF674 family protein [Medicago truncatula]
Length=391

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRN  177
            +L SFLT P+GTI RL S E     V +G +++LYR + +    +  ++ CK M+L PRN
Sbjct  26   VLLSFLTLPLGTIARLISQESNIEAVKLGSISSLYRGVSDLDQQYLWSQACKEMLLQPRN  85

Query  178  PCAIYCSKLKINIDDS  225
               IY  ++K+NIDD+
Sbjct  86   STEIYFQQMKLNIDDT  101



>ref|XP_010418330.1| PREDICTED: uncharacterized protein LOC104703932 [Camelina sativa]
Length=523

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L S LT PMGTI+RL    Q   P  +GC +NLY+S+ +  + N+ T+  K  +L PR+
Sbjct  35   VLCSLLTLPMGTIVRLLEKHQNPQPSIVGCFHNLYKSVSDMDVDNFETQTGKKFLLYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
              + +C  LK+NIDD+
Sbjct  95   AKSSHCRNLKLNIDDT  110



>ref|XP_006603523.1| PREDICTED: uncharacterized protein LOC102660035 [Glycine max]
Length=270

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L SFLT P+GTI +  + E    PV +G ++++Y S+ +    +  T+ CK M+L PRN
Sbjct  40   VLLSFLTLPLGTIAKTVAKESNVQPVKVGSLSSMYESMSHFEEKHLWTKTCKEMLLQPRN  99

Query  178  PCAIYCSKLKINIDDS  225
                YC +LK+NIDD+
Sbjct  100  SMEDYCQQLKLNIDDT  115



>ref|XP_002873028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49287.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=516

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSF T PMGTI+RL         + +GC NN+Y S+ +  + ++ TE CK M+L P +
Sbjct  35   ILFSFSTLPMGTIVRLLEMHHKSKAIAVGCFNNIYGSVVSMGMKHFSTEACKQMLLYPGS  94

Query  178  PCAIYCSKLKINIDDS  225
                 C K+K+ IDDS
Sbjct  95   LNQEKCQKIKLKIDDS  110



>emb|CDY40320.1| BnaA10g27480D [Brassica napus]
Length=496

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLT PMGTI+RL    Q    V IGC NN+Y S+ + ++ ++ TE  K M+L P +
Sbjct  35   ILFSFLTLPMGTIVRLLEMHQKSKSVPIGCFNNIYASVASMAMKHFSTEASKQMLLYPGS  94

Query  178  PCAIYCSKLKINIDDS  225
                 C K K+ IDD+
Sbjct  95   LNHDKCQKTKLRIDDT  110



>ref|XP_003588858.1| hypothetical protein MTR_1g014060 [Medicago truncatula]
Length=438

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRN  177
            +L SFLT P+GTI RL S E     V +G +++LYR + +    +  ++ CK M+L PRN
Sbjct  26   VLLSFLTLPLGTIARLISQESNIEAVKLGSISSLYRGVSDLDQQYLWSQACKEMLLQPRN  85

Query  178  PCAIYCSKLKINIDDS  225
               IY  ++K+NIDD+
Sbjct  86   STEIYFQQMKLNIDDT  101



>gb|EMT05521.1| hypothetical protein F775_03912 [Aegilops tauschii]
Length=439

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 6/75 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT P+GTI+R     +L     +GC++ LY+S++N    ++ T+ CKTM+L+PRN
Sbjct  34   VLFSFLTLPLGTIVR-----RLGKQSQVGCLDELYKSVENLGDDHFQTKPCKTMLLSPRN  88

Query  178  PCAIYCSKLKINIDD  222
              A +  +LK+ +DD
Sbjct  89   AAAGHLRRLKVQVDD  103



>gb|KEH22916.1| DUF674 family protein [Medicago truncatula]
Length=472

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            IL SFLT P+GTI RL   E     VT+GC+N+LY+S+ +        E  K M+L P N
Sbjct  38   ILCSFLTMPLGTIARLVEKESSIGQVTVGCLNSLYKSVADLDEGCVSNETIKQMLLQPIN  97

Query  178  PCAIYCSKLKINIDDS  225
                YC+ LKINIDD+
Sbjct  98   SAEDYCNTLKINIDDT  113



>gb|KHN08317.1| hypothetical protein glysoja_034125 [Glycine soja]
Length=437

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRNP  180
            L S LT P+GTI RL + E    PV  G +++LY S+ +    +  T+ CK M+L PRN 
Sbjct  36   LMSILTLPLGTIARLVAKESNIPPVKFGSLSSLYESVSHLEDKYLRTQTCKEMLLQPRNS  95

Query  181  CAIYCSKLKINIDDS  225
               YC ++K+NIDD+
Sbjct  96   MESYCQQMKLNIDDT  110



>ref|XP_003595908.1| hypothetical protein MTR_2g063290 [Medicago truncatula]
 gb|KEH23092.1| DUF674 family protein [Medicago truncatula]
Length=459

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 5/75 (7%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN---SLLNWHTELCKTMVLNPR  174
            LFSFLTFP+GTI RL + E     V  G +++LY+S+++     L  HT  CK M+L PR
Sbjct  36   LFSFLTFPLGTIARLVAEESNIEAVKFGSLSSLYQSVKDLDPQYLWSHT--CKEMLLKPR  93

Query  175  NPCAIYCSKLKINID  219
            N    YC KLK+NI+
Sbjct  94   NSMQPYCWKLKLNIN  108



>ref|XP_006418887.1| hypothetical protein EUTSA_v10002899mg [Eutrema salsugineum]
 gb|ESQ37323.1| hypothetical protein EUTSA_v10002899mg [Eutrema salsugineum]
Length=489

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L S LT PMGTI+RL    Q      +GC +NLY+S+ + ++ N+  +  K ++L PR+
Sbjct  35   VLCSLLTLPMGTIVRLLEKHQAPQSSVVGCFHNLYKSVSDMNVDNFENQARKNLLLYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
                YC KLK+NIDD+
Sbjct  95   IKESYCRKLKLNIDDT  110



>ref|XP_009122823.1| PREDICTED: uncharacterized protein LOC103847491 [Brassica rapa]
Length=541

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLT PMGTI+RL    Q    V IGC NN+Y S+ + ++ ++ TE  K M+L P +
Sbjct  69   ILFSFLTLPMGTIVRLLKMHQKSKSVPIGCFNNIYASVASMAMKHFSTEASKQMLLYPGS  128

Query  178  PCAIYCSKLKINIDDS  225
                 C K K+ IDD+
Sbjct  129  LNHDKCQKTKLRIDDT  144



>ref|XP_009374355.1| PREDICTED: uncharacterized protein LOC103963283 [Pyrus x bretschneideri]
Length=484

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMG I+RL       +PV IGCM NLY+SI+   + ++ +  C+ M+L P N
Sbjct  41   VLFSFLTMPMGRIVRLACKSS--VPVEIGCMRNLYQSIEKIDVHDFRSHACRDMLLLPCN  98

Query  178  PCAIYCSKLKINIDDS  225
                 C  LK+ ID+ 
Sbjct  99   AADCQCKNLKLEIDND  114



>gb|KEH41049.1| DUF674 family protein [Medicago truncatula]
Length=491

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWH--TELCKTMVLNPRN  177
            LFSFL FP+GTI RL + E     V  G +++LY S+ + L   H   + CK M+L PR 
Sbjct  41   LFSFLIFPLGTIARLAAKESNIDAVKFGSLSSLYESVSD-LGEEHLWNKTCKEMLLKPRV  99

Query  178  PCAIYCSKLKINIDDS  225
            P  +Y  KLK NID+S
Sbjct  100  PMGLYYRKLKFNIDES  115



>gb|KEH23106.1| DUF674 family protein [Medicago truncatula]
Length=570

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTEL-CKTMVLNPRNP  180
            LFSFLT P+GTI R  + +     V  G +++LY+S+ N    + + L CK M+L PRN 
Sbjct  41   LFSFLTLPLGTIARFVAKDSNIEAVKFGSISSLYQSVSNLDQQYLSSLTCKEMLLQPRNS  100

Query  181  CAIYCSKLKINIDDS  225
               YC +LK+NIDD+
Sbjct  101  MEDYCRQLKLNIDDT  115



>gb|KEH22914.1| DUF674 family protein [Medicago truncatula]
Length=492

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            IL SFLT P+GTI +L   E     VT+GC+N+LY S+ N     + T+  K M+L P N
Sbjct  36   ILCSFLTIPLGTIAKLVEKESSIGQVTVGCLNSLYGSVANLDEGCFSTKTTKQMLLQPIN  95

Query  178  PCAIYCSKLKINIDDS  225
                YC+ LK+NIDD+
Sbjct  96   SAEDYCNTLKLNIDDT  111



>ref|XP_010650585.1| PREDICTED: uncharacterized protein LOC104879454 isoform X2 [Vitis 
vinifera]
Length=594

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRN  177
            ILFSFLT P+GTIIRL           IGCM+ LY+S++     +  T+ CKTM+LNPR+
Sbjct  151  ILFSFLTLPIGTIIRLAERRS-----GIGCMDYLYKSVEALDEQFLETKACKTMLLNPRS  205

Query  178  PCAIYCSKLKINIDDS  225
               ++C  L + ID +
Sbjct  206  AYEVHCRNLALKIDGT  221


 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 43/62 (69%), Gaps = 7/62 (11%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN--WHTELCKTMVLNPR  174
            ++ SFLTFP+G+II+L     L+   ++GCM+NLYRS+ +S L   + +  CK M+L+P+
Sbjct  406  LVLSFLTFPLGSIIKL-----LRGHSSLGCMDNLYRSVGSSKLEDCFKSTKCKEMLLSPK  460

Query  175  NP  180
             P
Sbjct  461  LP  462



>ref|XP_003551534.2| PREDICTED: uncharacterized protein LOC100814631 [Glycine max]
Length=894

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRNP  180
            L S LT P+GTI RL + E    PV  G +++LY S+ +    +  T+ CK M+L PRN 
Sbjct  468  LMSILTLPLGTIARLVAKESNIPPVKFGSLSSLYESVSHLEDKYLRTQTCKEMLLQPRNS  527

Query  181  CAIYCSKLKINIDDS  225
               YC ++K+NIDD+
Sbjct  528  MESYCQQMKLNIDDT  542


 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRNP  180
            L S LT P+GTI RL + E    PV  G +++LY S+ +    +  T+ CK M+L PRN 
Sbjct  36   LLSILTLPLGTIARLVAKESNIPPVKFGSLSSLYESVSHLEDKYLRTQTCKEMLLQPRNS  95

Query  181  CAIYCSKLKINIDDS  225
               YC  +K+NIDD+
Sbjct  96   MESYCKHVKLNIDDT  110



>ref|XP_010650584.1| PREDICTED: uncharacterized protein LOC104879454 isoform X1 [Vitis 
vinifera]
 emb|CBI36674.3| unnamed protein product [Vitis vinifera]
Length=612

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRN  177
            ILFSFLT P+GTIIRL           IGCM+ LY+S++     +  T+ CKTM+LNPR+
Sbjct  151  ILFSFLTLPIGTIIRLAERRS-----GIGCMDYLYKSVEALDEQFLETKACKTMLLNPRS  205

Query  178  PCAIYCSKLKINIDDS  225
               ++C  L + ID +
Sbjct  206  AYEVHCRNLALKIDGT  221


 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 43/62 (69%), Gaps = 7/62 (11%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN--WHTELCKTMVLNPR  174
            ++ SFLTFP+G+II+L     L+   ++GCM+NLYRS+ +S L   + +  CK M+L+P+
Sbjct  406  LVLSFLTFPLGSIIKL-----LRGHSSLGCMDNLYRSVGSSKLEDCFKSTKCKEMLLSPK  460

Query  175  NP  180
             P
Sbjct  461  LP  462



>ref|NP_001131604.1| uncharacterized protein LOC100192954 [Zea mays]
 gb|ACF80090.1| unknown [Zea mays]
Length=510

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ++FSFLT P+GTI+RL   +       +GC++ LY S+++ +L  + T  CK M+L P N
Sbjct  34   VIFSFLTMPLGTIVRLLDKQS-----QMGCLDQLYNSVEDLNLEYFQTSACKAMLLKPLN  88

Query  178  PCAIYCSKLKINIDDS  225
              + +C +LKIN+D S
Sbjct  89   AASGHCCRLKINVDGS  104


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 39/69 (57%), Gaps = 5/69 (7%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTELCKTMVLNPRNPC  183
            LFS L+ P+G+ I+L      K     GC+ N+YRSI  S+  +  E C++++L+P+ P 
Sbjct  293  LFSLLSIPLGSAIKLYGQCSAK-----GCLGNVYRSIDGSVQEFVREECQSLLLDPKLPP  347

Query  184  AIYCSKLKI  210
               C   KI
Sbjct  348  FFGCCASKI  356



>ref|XP_003529915.1| PREDICTED: uncharacterized protein LOC100809921 isoform X1 [Glycine 
max]
 ref|XP_006583269.1| PREDICTED: uncharacterized protein LOC100809921 isoform X2 [Glycine 
max]
Length=519

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 8/77 (10%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ--NSLLNWHTELCKTMVLNPR  174
            +LFSFLT P+GTI+RL  +      V +G +  LY S++   S + W+ ++CK M+LNPR
Sbjct  35   VLFSFLTLPLGTIVRLLGNS-----VEMGNIKKLYDSVKRLGSDVFWN-DICKQMLLNPR  88

Query  175  NPCAIYCSKLKINIDDS  225
            NP    C +LK+ +DD+
Sbjct  89   NPLEASCQRLKVKVDDT  105



>ref|XP_009337354.1| PREDICTED: uncharacterized protein LOC103929824 [Pyrus x bretschneideri]
 ref|XP_009337355.1| PREDICTED: uncharacterized protein LOC103929824 [Pyrus x bretschneideri]
 ref|XP_009337357.1| PREDICTED: uncharacterized protein LOC103929824 [Pyrus x bretschneideri]
Length=466

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L SFLT P+GTII+L        PV IGCMNNLY S++   +    ++ C+ M+L PRN
Sbjct  30   VLLSFLTIPLGTIIKLGREHS--APVEIGCMNNLYSSVEEIDVSELRSDACREMLLLPRN  87

Query  178  PCAIYCSKLKINID  219
                +C  L + ID
Sbjct  88   AAESHCKNLVLQID  101



>ref|XP_006415212.1| hypothetical protein EUTSA_v10009971mg [Eutrema salsugineum]
 gb|ESQ33565.1| hypothetical protein EUTSA_v10009971mg [Eutrema salsugineum]
Length=353

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +L+  LT PMGTI RL    Q K+P  + C  NL +S+ + +++ + TE CK+M++ P++
Sbjct  32   VLYGLLTLPMGTIARLLEKHQ-KLPQVLCCYKNLNKSVADVVVDDFETEACKSMLMYPKS  90

Query  178  PCAIYCSKLKINIDDS  225
               I+C +LK+NIDD+
Sbjct  91   TKEIHCRRLKLNIDDT  106



>ref|XP_007140417.1| hypothetical protein PHAVU_008G110100g [Phaseolus vulgaris]
 gb|ESW12411.1| hypothetical protein PHAVU_008G110100g [Phaseolus vulgaris]
Length=455

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LFSFLT P+GTI+RL   E    P+ +  ++ +Y+S +N  +    T+ C+ M+L PRN
Sbjct  35   VLFSFLTLPLGTILRLVRKESKLQPLELSSLSLIYQSAENLPIECLRTDTCEEMLLRPRN  94

Query  178  PCAIYCSKLKINIDDS  225
                +C  LKINIDD+
Sbjct  95   SMEDHCRSLKINIDDT  110



>gb|KDP46570.1| hypothetical protein JCGZ_08542 [Jatropha curcas]
Length=453

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 5/67 (7%)
 Frame = +1

Query  25   PMGTIIRLTSHEQLKIPVT-IGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRNPCAIYCS  198
            P+GTI+RLT+++Q   P+T IGCMNNLY S++N  +  + TE CKTM+L P+N  A    
Sbjct  2    PIGTIVRLTNNQQ---PITAIGCMNNLYASVENLDVKRFRTEACKTMLLRPKNGSATQYK  58

Query  199  KLKINID  219
             LK+ ID
Sbjct  59   DLKLKID  65



>ref|XP_008358980.1| PREDICTED: uncharacterized protein LOC103422699 [Malus domestica]
 ref|XP_008358981.1| PREDICTED: uncharacterized protein LOC103422699 [Malus domestica]
 ref|XP_008358982.1| PREDICTED: uncharacterized protein LOC103422699 [Malus domestica]
Length=352

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L SFLT P+GTII+L        PV IGCMNNLY S++   +    ++ C+ M+L PRN
Sbjct  30   VLVSFLTIPLGTIIKLGREHS--APVEIGCMNNLYSSVEEIDVSELRSDACREMLLLPRN  87

Query  178  PCAIYCSKLKINID  219
                +C  L + ID
Sbjct  88   AAESHCKNLVLQID  101



>ref|XP_009374311.1| PREDICTED: uncharacterized protein LOC103963244 [Pyrus x bretschneideri]
Length=479

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMG I+RL       +PV IGCM NLY+SI+   + ++ +  C+ M+L P N
Sbjct  38   VLFSFLTMPMGRIVRLACTSS--VPVEIGCMRNLYQSIEEFDVHDFRSNACRDMLLLPCN  95

Query  178  PCAIYCSKLKINIDDS  225
                 C  LK+ ID+ 
Sbjct  96   AADCQCKNLKLKIDNG  111



>gb|KEH23107.1| DUF674 family protein [Medicago truncatula]
Length=448

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRNP  180
            LFSFLT P+GTI RL + +     VT+G +++L++S+ +    +  T  CK M+L PRN 
Sbjct  22   LFSFLTLPLGTIARLAAKQSNIGAVTVGSLSSLHQSVADLDEQYLWTHACKEMLLKPRNS  81

Query  181  CAIYCSKLKINIDDS  225
              +Y   +K+NIDD+
Sbjct  82   MEVYSQNMKLNIDDT  96



>ref|XP_009337352.1| PREDICTED: uncharacterized protein LOC103929823 isoform X1 [Pyrus 
x bretschneideri]
Length=490

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L SFLT PMGTII L  ++    P+ IGCM NLY S++N  + ++ ++ C+ M+L P N
Sbjct  34   VLLSFLTIPMGTIIGLAPNQSE--PLEIGCMKNLYASVENMDVKHFRSKACRDMLLCPPN  91

Query  178  PCAIYCSKLKINIDDS  225
               ++C  LK  ID S
Sbjct  92   GAEVHCKNLKRKIDRS  107



>ref|XP_004304298.1| PREDICTED: uncharacterized protein LOC101290973 [Fragaria vesca 
subsp. vesca]
Length=486

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMG I+RL       IPV IGCMN LY+SI+   +  + +  C+ M+L P +
Sbjct  36   VLFSFLTIPMGRIVRLARDHS--IPVEIGCMNKLYQSIEKLDVQVFRSNACRDMLLLPYS  93

Query  178  PCAIYCSKLKINIDDS  225
                YC  LK+ I D 
Sbjct  94   AANCYCKNLKLKIVDD  109



>gb|KHN08318.1| hypothetical protein glysoja_034126 [Glycine soja]
Length=476

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRNP  180
            L S LT P+GTI RL + E    PV  G +++LY S+ +    +  T+ CK M+L PRN 
Sbjct  36   LLSILTLPLGTIARLVAKESNIPPVKFGSLSSLYESVSHLEDKYLRTQTCKEMLLQPRNS  95

Query  181  CAIYCSKLKINIDDS  225
               YC  +K+NIDD+
Sbjct  96   MESYCQHVKLNIDDT  110



>ref|XP_010543244.1| PREDICTED: uncharacterized protein LOC104816224 [Tarenaya hassleriana]
Length=482

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSI-QNSLLNWHTELCKTMVLNPRN  177
            +LFSFL  P+GTI+RL         + IGC++NLYRS+ +  +  + T+ C   +L P+N
Sbjct  35   VLFSFLVLPVGTIVRLLEKRIKSGTLVIGCLDNLYRSVSEMGIYYFRTQGCMDRLLFPQN  94

Query  178  PCAIYCSKLKINIDDS  225
                 C +LKINIDD+
Sbjct  95   VMEDQCRRLKINIDDT  110



>gb|KHN08316.1| hypothetical protein glysoja_034124 [Glycine soja]
Length=462

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRNP  180
            L S LT P+GTI RL + E    PV  G +++LY S+ +    +  T+ CK M+L PRN 
Sbjct  36   LLSILTLPLGTIARLVAKESNIPPVKFGSLSSLYESVSHLEDKYLRTQKCKEMLLQPRNS  95

Query  181  CAIYCSKLKINIDDS  225
               YC  +K+NIDD+
Sbjct  96   MESYCQHVKLNIDDT  110



>emb|CDY10482.1| BnaCnng03830D [Brassica napus]
Length=481

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS +T PMGTI  L    +      IGC++NLY+S+ + S+ N+ T  CK M+LNPR+
Sbjct  36   VLFSLMTLPMGTIAGLLKKHK---KSEIGCLSNLYQSVADMSIDNFMTGACKQMLLNPRS  92

Query  178  PCAIYCSKLKINI  216
                YC +LK+N+
Sbjct  93   VKEAYCKRLKLNL  105



>gb|KEH28913.1| DUF674 family protein [Medicago truncatula]
Length=476

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 50/83 (60%), Gaps = 9/83 (11%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRL------TSHEQL-KIPVTIGCMNNLYRSIQN--SLLNWHTELCKT  156
            LFSFL+ P+GTI+RL         +QL K       + NLY+++QN  S   W+  LCK 
Sbjct  40   LFSFLSLPLGTIVRLLATTDKNDRQQLSKSSPFFENIKNLYQTVQNLNSDEVWNNPLCKQ  99

Query  157  MVLNPRNPCAIYCSKLKINIDDS  225
            M+L+PRN C   C KL +NIDDS
Sbjct  100  MLLHPRNSCESLCMKLYLNIDDS  122



>ref|XP_009337347.1| PREDICTED: uncharacterized protein LOC103929820 [Pyrus x bretschneideri]
 ref|XP_009337348.1| PREDICTED: uncharacterized protein LOC103929820 [Pyrus x bretschneideri]
 ref|XP_009337349.1| PREDICTED: uncharacterized protein LOC103929820 [Pyrus x bretschneideri]
 ref|XP_009337350.1| PREDICTED: uncharacterized protein LOC103929820 [Pyrus x bretschneideri]
Length=324

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL+ H Q      IGC++NL+ S+++  L  + T+ C+ M+L+PRN
Sbjct  34   VLFSFLTIPMGTIVRLSHHSQ---SFGIGCIDNLFGSVESLDLQLFRTKECRDMLLHPRN  90

Query  178  PCAIYCSKLKINID  219
                    LK+  D
Sbjct  91   GAEDLLGNLKLKYD  104



>emb|CDY53099.1| BnaCnng24290D [Brassica napus]
Length=489

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTS--HEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNP  171
            +L S LT PMGTI+RL    H+  +    +GC +NLY+S+ +  + N+ T  CK ++++P
Sbjct  32   VLCSLLTLPMGTIVRLLEKHHQNPQSSSIVGCFHNLYKSVSDMDIDNFKTPGCKNLLMHP  91

Query  172  RNPCAIYCSKLKINIDDS  225
            R+    +C KLK+N+DD+
Sbjct  92   RSMKESHCRKLKLNVDDT  109



>ref|XP_009337385.1| PREDICTED: uncharacterized protein LOC103929848 [Pyrus x bretschneideri]
Length=241

 Score = 61.6 bits (148),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L SFLT PMG I+RL++  Q   P+ IGCM+NLY S++N  L  + T  C+ M+L+PR+
Sbjct  49   VLLSFLTIPMGKIVRLSNRSQ---PLRIGCMDNLYGSVENLDLQLFQTAECRDMLLHPRS  105

Query  178  PCAIYCSKLKINID  219
                    LK+  D
Sbjct  106  GAEDLLMNLKLKYD  119



>ref|XP_006415215.1| hypothetical protein EUTSA_v10009362mg [Eutrema salsugineum]
 gb|ESQ33568.1| hypothetical protein EUTSA_v10009362mg [Eutrema salsugineum]
Length=346

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL    +    V +GC+ NLY+S+ +    ++ TE CK +++ PR+
Sbjct  35   VLFSFLTLPMGTIVRLLEKHRKSPQVVVGCLKNLYKSVSDMGAESFQTESCKQVLMYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
                   ++K+ IDD+
Sbjct  95   VNHDKYRRVKLKIDDT  110



>ref|XP_009337339.1| PREDICTED: uncharacterized protein LOC103929816 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009337340.1| PREDICTED: uncharacterized protein LOC103929816 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009337341.1| PREDICTED: uncharacterized protein LOC103929816 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009337342.1| PREDICTED: uncharacterized protein LOC103929816 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009337344.1| PREDICTED: uncharacterized protein LOC103929816 isoform X3 [Pyrus 
x bretschneideri]
Length=305

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL+ H Q      IGC++NL+ S+++  L  + T+ C+ M+L+PRN
Sbjct  34   VLFSFLTIPMGTIVRLSHHSQ---SFGIGCIDNLFGSVESLDLQLFRTKECREMLLHPRN  90

Query  178  PCAIYCSKLKINID  219
                    LK+  D
Sbjct  91   EAEDLLRNLKLKYD  104



>ref|XP_010468073.1| PREDICTED: uncharacterized protein LOC104748076 [Camelina sativa]
Length=557

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L S LT PMGTI+RL    Q      +GC +NLY+S+ +  + N+ T+  K  +L PR+
Sbjct  35   VLCSLLTLPMGTIVRLLEKHQNPQSSIVGCFHNLYKSVSDMDVDNFETQNGKNFLLYPRS  94

Query  178  PCAIYCSKLKINIDDS  225
              A +C  LK+NIDD+
Sbjct  95   AKASHCRNLKLNIDDT  110



>gb|KHN08322.1| hypothetical protein glysoja_034130 [Glycine soja]
Length=560

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWH--TELCKTMVLNPR  174
            +L SFLT P+GTI +  + E    PV +G ++++Y S+ +     H  T+ CK M+L PR
Sbjct  40   VLLSFLTLPLGTIAKTVAKESNVQPVKVGSLSSMYESMSH-FEEKHLWTKTCKEMLLQPR  98

Query  175  NPCAIYCSKLKINIDDS  225
            N    YC +LK+N DD+
Sbjct  99   NSMEDYCQQLKLNFDDT  115



>gb|EMT03318.1| hypothetical protein F775_03343 [Aegilops tauschii]
Length=481

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT P+GTI+RL   +       IGC++ LYRS+++ +  ++ T  CK M+L+P N
Sbjct  34   VLFSFLTLPLGTIVRLLGKQS-----QIGCLDELYRSVESLNQDHFQTMECKAMLLSPVN  88

Query  178  PCAIYCSKLKINIDDS  225
              A +  +LK+  DD+
Sbjct  89   AAAFHLDRLKVKFDDT  104



>ref|XP_007140424.1| hypothetical protein PHAVU_008G110700g [Phaseolus vulgaris]
 ref|XP_007140425.1| hypothetical protein PHAVU_008G110700g [Phaseolus vulgaris]
 gb|ESW12418.1| hypothetical protein PHAVU_008G110700g [Phaseolus vulgaris]
 gb|ESW12419.1| hypothetical protein PHAVU_008G110700g [Phaseolus vulgaris]
Length=501

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWH--TELCKTMVLNPR  174
            +L SFL  P+GTI RL + E    PV +G +++LY S+ N L   H  T  CK M+L+PR
Sbjct  40   VLLSFLALPLGTIARLVAKESNIPPVKLGSLSSLYESVSN-LEEEHLWTPTCKEMLLHPR  98

Query  175  NPCAIYCSKLKINIDDS  225
            +    Y   LK+NIDD+
Sbjct  99   SSMESYYQHLKLNIDDT  115



>ref|XP_010920704.1| PREDICTED: uncharacterized protein LOC105044482 [Elaeis guineensis]
Length=492

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 6/75 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLT P+GTI+RL   +      ++G M+ LY S++N     + T  CKTM+L PRN
Sbjct  32   ILFSFLTLPIGTIVRLLGKKS-----SLGAMDRLYESVENLDARYFQTAPCKTMLLRPRN  86

Query  178  PCAIYCSKLKINIDD  222
               + C  L + +DD
Sbjct  87   VSGVQCEGLALRVDD  101


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 43/76 (57%), Gaps = 8/76 (11%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ---NSLLNWHTELCKTMVLNPR  174
            LFSFLTFP+G+I++L          ++GC++NLY S++   NS     ++ C  M+L P+
Sbjct  284  LFSFLTFPLGSILKLLDKHS-----SLGCIDNLYESVELLSNSYNYMKSKECYDMLLAPK  338

Query  175  NPCAIYCSKLKINIDD  222
             P    C    ++I +
Sbjct  339  LPPYFGCDNQLLDIGE  354



>ref|XP_007140423.1| hypothetical protein PHAVU_008G110600g [Phaseolus vulgaris]
 gb|ESW12417.1| hypothetical protein PHAVU_008G110600g [Phaseolus vulgaris]
Length=442

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWH--TELCKTMVLNPR  174
            +L SFL  P+GTI RL + E    PV +G +++LY S+ N L   H  T  CK M+L+PR
Sbjct  40   VLLSFLALPLGTIARLVAKESNIPPVKLGSLSSLYESVSN-LEEEHLWTPTCKEMLLHPR  98

Query  175  NPCAIYCSKLKINIDDS  225
            +    Y   LK+NIDD+
Sbjct  99   SSMESYYQHLKLNIDDT  115



>ref|XP_002448442.1| hypothetical protein SORBIDRAFT_06g027210 [Sorghum bicolor]
 gb|EES12770.1| hypothetical protein SORBIDRAFT_06g027210 [Sorghum bicolor]
Length=509

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF FLT P+GT++RL   +       +GC++ +Y+S+++ S   +  + CK M+L P N
Sbjct  35   VLFGFLTMPLGTVVRLLDKQS-----QMGCLDEVYKSVEDLSADYFEIKACKAMLLKPLN  89

Query  178  PCAIYCSKLKINIDDS  225
              + +C +LKIN+DD+
Sbjct  90   AASGHCCRLKINVDDT  105



>ref|XP_008355532.1| PREDICTED: uncharacterized protein LOC103419190 [Malus domestica]
Length=479

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMG I+ L    +  +PV IGCM NLY+SI    + N+ + +CK M+L P N
Sbjct  41   VLFSFLTMPMGRIVTLA---ECSVPVEIGCMRNLYQSIMKFDVHNFRSNVCKVMLLFPCN  97

Query  178  PCAIYCSKLKINID  219
               + C  LK+  D
Sbjct  98   SAYLQCKNLKLKXD  111



>ref|XP_006301791.1| hypothetical protein CARUB_v10022255mg, partial [Capsella rubella]
 gb|EOA34689.1| hypothetical protein CARUB_v10022255mg, partial [Capsella rubella]
Length=338

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRNP  180
            L   LT PMGTI+RL    Q      +GC  NLY+S+ N S+ N+ T+ CK ++L P++ 
Sbjct  36   LCGLLTLPMGTIVRLLEKHQNPQSSRVGCFTNLYKSVSNMSVDNFETKACKDLLLYPKSL  95

Query  181  CAIYCSKLKINIDDS  225
               +CS+LK+N+ D+
Sbjct  96   KESHCSRLKMNLADT  110



>gb|AAT68364.1| hypothetical protein At3g09110 [Arabidopsis thaliana]
Length=343

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L S LT PMGTI+RL    Q      +GC++NLY+S+ +  + N+ ++ CK  +L+PR+
Sbjct  35   VLCSLLTLPMGTIVRLLEKHQNPQSSVVGCLHNLYKSVADMDVDNFESQXCKHFLLHPRS  94

Query  178  PCAIYCSKLKINIDDS  225
                +   LK+NIDD+
Sbjct  95   AKGSHGRDLKLNIDDT  110



>ref|XP_009337338.1| PREDICTED: uncharacterized protein LOC103929816 isoform X2 [Pyrus 
x bretschneideri]
Length=314

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL+ H Q      IGC++NL+ S+++  L  + T+ C+ M+L+PRN
Sbjct  43   VLFSFLTIPMGTIVRLSHHSQ---SFGIGCIDNLFGSVESLDLQLFRTKECREMLLHPRN  99

Query  178  PCAIYCSKLKINID  219
                    LK+  D
Sbjct  100  EAEDLLRNLKLKYD  113



>ref|XP_010920193.1| PREDICTED: uncharacterized protein LOC105044094 [Elaeis guineensis]
Length=462

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 47/76 (62%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRN  177
            ILFSFLT P+GT+ R+   +       +GC++ LY +++N    +  TE CKTM+L P +
Sbjct  32   ILFSFLTLPLGTVTRVLRKQSF-----LGCLDGLYETVENLDARYLQTEACKTMLLQPIS  86

Query  178  PCAIYCSKLKINIDDS  225
              A+ C  L +++DD+
Sbjct  87   AAALRCEDLVLSVDDT  102



>ref|XP_003604765.1| 30S ribosomal protein S18 [Medicago truncatula]
Length=262

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTS------HEQLKIPVTIGCMNNLYRSIQN--SLLNWHTELCKTM  159
            LFSFL+ P+GTI+RL +       +Q +    +  + +LY+++QN  S   W+  +CK M
Sbjct  46   LFSFLSLPLGTIVRLLATNSNEKQQQSESSPFLENIKHLYQTVQNLNSDDVWNNNVCKQM  105

Query  160  VLNPRNPCAIYCSKLKINIDDS  225
            +L+PRNPC   C+KL +N++ S
Sbjct  106  LLHPRNPCEALCAKLFLNVEPS  127



>ref|NP_187523.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAV63903.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74724.1| uncharacterized protein AT3G09110 [Arabidopsis thaliana]
Length=343

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L S LT PMGTI+RL    Q      +GC++NLY+S+ +  + N+ ++ CK  +L+PR+
Sbjct  35   VLCSLLTLPMGTIVRLLEKHQNPQSSVVGCLHNLYKSVADMDVDNFESQACKHFLLHPRS  94

Query  178  PCAIYCSKLKINIDDS  225
                +   LK+NIDD+
Sbjct  95   AKGSHGRDLKLNIDDT  110



>ref|XP_009337337.1| PREDICTED: uncharacterized protein LOC103929816 isoform X1 [Pyrus 
x bretschneideri]
Length=334

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL+ H Q      IGC++NL+ S+++  L  + T+ C+ M+L+PRN
Sbjct  63   VLFSFLTIPMGTIVRLSHHSQ---SFGIGCIDNLFGSVESLDLQLFRTKECREMLLHPRN  119

Query  178  PCAIYCSKLKINID  219
                    LK+  D
Sbjct  120  EAEDLLRNLKLKYD  133



>ref|XP_007140422.1| hypothetical protein PHAVU_008G110500g [Phaseolus vulgaris]
 gb|ESW12416.1| hypothetical protein PHAVU_008G110500g [Phaseolus vulgaris]
Length=434

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LFSFLT P+GTI  L   E    P+ +  ++++Y+S++N       T++C+ M+L  RN
Sbjct  35   VLFSFLTLPLGTISNLVRKESKLQPLEVASLSSIYQSVENLDKGCLRTDMCEEMLLRSRN  94

Query  178  PCAIYCSKLKINIDDS  225
                YC  LK+NIDD+
Sbjct  95   SMEDYCRSLKLNIDDT  110



>ref|NP_195732.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB69840.1| putative protein [Arabidopsis thaliana]
 gb|AAU44539.1| hypothetical protein AT5G01120 [Arabidopsis thaliana]
 gb|AED90301.1| uncharacterized protein AT5G01120 [Arabidopsis thaliana]
Length=510

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSF T PMGTI+RL         + IGC NN+Y S+ +  + ++ T+ CK M+L P +
Sbjct  35   ILFSFSTLPMGTIVRLLEMHHKSRSIAIGCFNNIYASVVSMGMKHFSTQACKQMLLFPGS  94

Query  178  PCAIYCSKLKINIDDS  225
                 C  +K+ IDDS
Sbjct  95   LNQDKCQNMKLKIDDS  110



>ref|XP_002448443.1| hypothetical protein SORBIDRAFT_06g027220 [Sorghum bicolor]
 gb|EES12771.1| hypothetical protein SORBIDRAFT_06g027220 [Sorghum bicolor]
Length=512

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/76 (36%), Positives = 49/76 (64%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF FLT P+GT++RL   +       +GC++ +Y+S+++ S   + T+ CK M+L P N
Sbjct  34   VLFGFLTMPLGTVVRLLDKQS-----QMGCLDEVYKSVEDLSADYFQTKACKGMLLKPLN  88

Query  178  PCAIYCSKLKINIDDS  225
              + +C +LK+N+D +
Sbjct  89   AASSHCCRLKVNVDGT  104



>gb|AAD56327.1|AC009326_14 hypothetical protein [Arabidopsis thaliana]
Length=452

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L S LT PMGTI+RL    Q      +GC++NLY+S+ +  + N+ ++ CK  +L+PR+
Sbjct  35   VLCSLLTLPMGTIVRLLEKHQNPQSSVVGCLHNLYKSVADMDVDNFESQACKHFLLHPRS  94

Query  178  PCAIYCSKLKINIDDS  225
                +   LK+NIDD+
Sbjct  95   AKGSHGRDLKLNIDDT  110



>ref|XP_002892386.1| hypothetical protein ARALYDRAFT_334016 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68645.1| hypothetical protein ARALYDRAFT_334016 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF FL  PMGTI+RL    +   P  IGC NNLY+S+ +    ++ TE  K M+L PR+
Sbjct  35   VLFGFLALPMGTIVRLLEKYKQNQP-PIGCFNNLYKSVLDMDKDDFITEASKGMLLYPRH  93

Query  178  PCAIYCSKLKINIDD  222
                 C +LK+NIDD
Sbjct  94   VKEKQCKRLKLNIDD  108



>ref|XP_009147181.1| PREDICTED: uncharacterized protein LOC103870768, partial [Brassica 
rapa]
Length=352

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQL--KIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNP  171
            +L S LT PMGTI+RL    Q   +    +GC +NLY+S+ + ++ N+ T  CK ++++P
Sbjct  32   VLCSLLTLPMGTIVRLLEKHQQNPQSSSIVGCFHNLYKSVSDMAIDNFKTPGCKHLLMHP  91

Query  172  RNPCAIYCSKLKINIDDS  225
            R+    +C KLK+N+DD+
Sbjct  92   RSMKESHCRKLKLNVDDT  109



>ref|XP_009374312.1| PREDICTED: uncharacterized protein LOC103963245 [Pyrus x bretschneideri]
Length=502

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 4/76 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT P+G I+RL       +PV IGCM NL +SI+   + N+ +  C+ M+L P N
Sbjct  40   VLFSFLTMPIGRIVRLAEDS---VPVKIGCMRNLIQSIEKFDVHNFRSNACRDMLLLPCN  96

Query  178  PCAIYCSKLKINIDDS  225
               + C  LK+ ID+ 
Sbjct  97   SADLECKNLKLKIDND  112



>ref|XP_008344781.1| PREDICTED: uncharacterized protein LOC103407672 [Malus domestica]
Length=479

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMG I RL       +PV IGCM NLY+SI+   + ++ +  C+ M+L P N
Sbjct  38   VLFSFLTMPMGRIARLXCTSS--VPVEIGCMRNLYQSIEKFDVHDFRSNACRDMLLLPCN  95

Query  178  PCAIYCSKLKINIDDS  225
                 C  LK+ ID+ 
Sbjct  96   AADCXCKNLKLKIDNG  111



>ref|XP_008355091.1| PREDICTED: uncharacterized protein LOC103418765 [Malus domestica]
Length=479

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 3/76 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMG I RL       +PV IGCM NLY+SI+   + ++ +  C+ M+L P N
Sbjct  38   VLFSFLTMPMGRIARLXCTSS--VPVEIGCMRNLYQSIEKFDVHDFRSNACRDMLLLPCN  95

Query  178  PCAIYCSKLKINIDDS  225
                 C  LK+ ID+ 
Sbjct  96   AADCXCKNLKLKIDNG  111



>ref|XP_006304486.1| hypothetical protein CARUB_v10011222mg [Capsella rubella]
 gb|EOA37384.1| hypothetical protein CARUB_v10011222mg [Capsella rubella]
Length=888

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF FL  PMGTI+RL    + + P  IGC ++LY+S+ +    ++ TE CK ++L PR+
Sbjct  37   VLFGFLALPMGTIVRLLEKYK-ENPAPIGCFSHLYKSVVDMDKDDFMTEACKDLLLYPRH  95

Query  178  PCAIYCSKLKINIDD  222
                 C +LKINIDD
Sbjct  96   VKEKLCRQLKINIDD  110



>ref|XP_010501425.1| PREDICTED: uncharacterized protein LOC104778675 [Camelina sativa]
Length=478

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQL-KIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            +LF FL  PMG I+RL    +L + P  IGC NNL+ S+ N  + ++ +E CK M+L PR
Sbjct  40   VLFRFLALPMGAIVRLMEGHKLNEKPHDIGCFNNLFSSVSNLGIHDFKSEACKDMLLYPR  99

Query  175  NPCAIYCSKLKINI  216
                  C +LK+NI
Sbjct  100  YVKEKQCRRLKLNI  113



>gb|EMT32440.1| hypothetical protein F775_01172 [Aegilops tauschii]
Length=447

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 51/77 (66%), Gaps = 10/77 (13%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLL---NWHTELCKTMVLNP  171
            +LFSFLT P+GTI+RL   +       +GC++ LY+S++  +L   ++ T+ CK M+L+P
Sbjct  34   VLFSFLTLPLGTIVRLFDKQS-----QVGCLDELYKSVE--VLGPDHFQTKACKAMLLSP  86

Query  172  RNPCAIYCSKLKINIDD  222
             N  AI C++LK+ + D
Sbjct  87   LNAAAIRCNRLKVKVVD  103



>gb|KEH28932.1| DUF674 family protein [Medicago truncatula]
Length=531

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 7/81 (9%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTS-----HEQLKIPVTIGCMNNLYRSIQNSLLN--WHTELCKTMV  162
            LFSFL+ P+ TIIRL S      E  +    +G + NLY+++Q    N  W+  + K M+
Sbjct  39   LFSFLSLPLATIIRLLSNNDQQQESSESSPFLGSIKNLYKTVQTLTPNDVWNNPVYKQML  98

Query  163  LNPRNPCAIYCSKLKINIDDS  225
            LNP+NPC   C  L +NIDD+
Sbjct  99   LNPKNPCESLCMNLFMNIDDT  119



>ref|XP_007207800.1| hypothetical protein PRUPE_ppa024376mg [Prunus persica]
 gb|EMJ08999.1| hypothetical protein PRUPE_ppa024376mg [Prunus persica]
Length=455

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTELCKTMVLNPRNP  180
            +L SFLT PMGTII+L  +     P+ IGCM NLY S+++  +      C  M+L+PRN 
Sbjct  34   VLISFLTLPMGTIIKLARNHS--APLGIGCMKNLYASVKDIDVQHFRTNCWDMLLSPRNG  91

Query  181  CAIYCSKLKINIDD  222
                   L++NIDD
Sbjct  92   AGPIVENLEMNIDD  105



>ref|XP_002892621.1| hypothetical protein ARALYDRAFT_334407 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68880.1| hypothetical protein ARALYDRAFT_334407 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 5/79 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLK----IPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVL  165
            +LFSFLT PMGT++RL  + Q K        IGC NNLY+S+ +     +  E CK M+L
Sbjct  37   VLFSFLTLPMGTVVRLFENYQKKNQKAEATVIGCFNNLYKSVLDIGTAIFMKEACKDMLL  96

Query  166  NPRNPCAIYCSKLKINIDD  222
             PR+       +LK+NIDD
Sbjct  97   YPRSVKENQRKQLKLNIDD  115



>emb|CDY44683.1| BnaA05g29230D [Brassica napus]
Length=489

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQL--KIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNP  171
            +L S LT PMGTI+RL    Q   +    +GC +NLY+S+ + ++ N+ T  CK ++++P
Sbjct  32   VLCSLLTLPMGTIVRLLEKHQQNPQSSSIVGCFHNLYKSVSDMAIDNFKTPGCKHLLMHP  91

Query  172  RNPCAIYCSKLKINIDDS  225
            R+    +C KLK+N+DD+
Sbjct  92   RSMKESHCRKLKLNVDDT  109



>gb|KEH32836.1| DUF674 family protein [Medicago truncatula]
Length=443

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTELCKTMVLNPRNP  180
            IL SFLT P+GTI RL   +    PVTIGC+N+LY+S++N  L           L   N 
Sbjct  35   ILCSFLTLPLGTIARLVQKDSNMGPVTIGCLNSLYQSVENIGL-----------LPINNS  83

Query  181  CAIYCSKLKINIDDS  225
               YCS LKINIDD+
Sbjct  84   SEDYCSTLKINIDDT  98



>ref|XP_010462637.1| PREDICTED: uncharacterized protein LOC104743226 [Camelina sativa]
Length=396

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 5/78 (6%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQ----LKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLN  168
            LFSFLT PMGT++RL    Q          IGC NNLY+S+ +    N+ TE CK ++L 
Sbjct  38   LFSFLTLPMGTVVRLIEKYQKNHIFAQATMIGCFNNLYKSVLDIDTANFMTEACKDLLLY  97

Query  169  PRNPCAIYCSKLKINIDD  222
            PR+       +L +NIDD
Sbjct  98   PRSVMENQRKRLNLNIDD  115



>ref|XP_007140420.1| hypothetical protein PHAVU_008G1102000g, partial [Phaseolus vulgaris]
 gb|ESW12414.1| hypothetical protein PHAVU_008G1102000g, partial [Phaseolus vulgaris]
Length=356

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LFSFLT P+GTI+RL   E    P+ +  ++ +Y+S +N  +    T+ C+ M+L PRN
Sbjct  35   VLFSFLTLPLGTILRLVRKESKLQPLELASLSLIYQSAENLPIECLRTDTCEEMLLRPRN  94

Query  178  PCAIYCSKLKINIDDS  225
                +   LKINIDD+
Sbjct  95   SMEDHSRSLKINIDDT  110



>gb|KEH23089.1| DUF674 family protein [Medicago truncatula]
Length=406

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW---HTELCKTMVLNP  171
            +L SFLT P+GTI  +   E     V  G +++LY+S+  S+L+    H+++CK M+LNP
Sbjct  33   VLLSFLTLPLGTIAGIVDKESNIEAVRFGSISSLYQSV--SVLDQQYLHSQICKEMLLNP  90

Query  172  RNPCAIYCSKLKINIDDS  225
             N    YC  +K+NID++
Sbjct  91   INRSGAYCRNMKLNIDNT  108



>ref|XP_003595905.1| hypothetical protein MTR_2g063260 [Medicago truncatula]
Length=406

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW---HTELCKTMVLNP  171
            +L SFLT P+GTI  +   E     V  G +++LY+S+  S+L+    H+++CK M+LNP
Sbjct  33   VLLSFLTLPLGTIAGIVDKESNIEAVRFGSISSLYQSV--SVLDQQYLHSQICKEMLLNP  90

Query  172  RNPCAIYCSKLKINIDDS  225
             N    YC  +K+NID++
Sbjct  91   INRSGAYCRNMKLNIDNT  108



>ref|XP_008384874.1| PREDICTED: uncharacterized protein LOC103447456 isoform X1 [Malus 
domestica]
Length=477

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 48/74 (65%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL+ H Q    + IGC++NL+ S+++  L  + T+ C+ M+L+PRN
Sbjct  34   VLFSFLTIPMGTIVRLSHHSQ---SLGIGCIDNLFGSVESLDLQLFRTKECRDMLLHPRN  90

Query  178  PCAIYCSKLKINID  219
                    LK+  D
Sbjct  91   GAEDLLRNLKLKYD  104



>ref|XP_010462638.1| PREDICTED: uncharacterized protein LOC104743227 [Camelina sativa]
Length=473

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQL-KIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            +LF FL  PMG I+RL    +L + P  +GC NNLY S+ +  + ++ +E CK M+L PR
Sbjct  40   VLFRFLALPMGAIVRLLEGYKLNEKPHDVGCFNNLYSSVSDMGIHDFMSEACKDMLLYPR  99

Query  175  NPCAIYCSKLKINIDD  222
                  C +LK+NI D
Sbjct  100  YVKEKQCRRLKLNIYD  115



>gb|EMT13594.1| hypothetical protein F775_01161 [Aegilops tauschii]
Length=466

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 8/75 (11%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRL-TSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            ILFSFLT P+GT++RL   H Q      IG ++ LYRS+++    ++ T  C+TM+L P 
Sbjct  34   ILFSFLTLPLGTVVRLFDKHSQ------IGFLDELYRSVESLGEEHFQTRDCRTMLLRPV  87

Query  175  NPCAIYCSKLKINID  219
            N  A +C +LK+ +D
Sbjct  88   NAAAAHCDRLKVKVD  102



>ref|XP_009122824.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103847492 
[Brassica rapa]
Length=490

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFS +T PMGTI+ L    Q      IGC +NLY+S+ + S+ ++ T  CK M+L PR+
Sbjct  36   VLFSLMTLPMGTIVGLLKKHQ---NSEIGCFSNLYKSVADMSIDSFMTGACKQMLLKPRS  92

Query  178  PCAIYCSKLKINI  216
                YC +LK+N+
Sbjct  93   VKEAYCKRLKLNL  105



>ref|XP_010476015.1| PREDICTED: uncharacterized protein LOC104755353 [Camelina sativa]
Length=470

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 4/78 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLT---SHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLN  168
            +LFSFLT PMG ++RL       Q+     IGC NNLY+S+ +    N+ TE CK M+L 
Sbjct  37   VLFSFLTIPMGNVVRLIEKYQKNQISEATMIGCFNNLYKSVLDIGTANFMTEACKDMLLY  96

Query  169  PRNPCAIYCSKLKINIDD  222
            PR+        LK+NI D
Sbjct  97   PRSAMENLRKGLKLNIAD  114



>gb|KEH23004.1| MZB10.14 protein [Medicago truncatula]
Length=458

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 42/75 (56%), Gaps = 11/75 (15%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTELCKTMVLNPRNP  180
            IL SFLT P+GTI RL   E    PVTIGC+N+LYRS++           K  +L   N 
Sbjct  41   ILCSFLTLPLGTIARLLQKESSIGPVTIGCLNSLYRSVE-----------KMGLLTNYNS  89

Query  181  CAIYCSKLKINIDDS  225
               YC  L+IN DDS
Sbjct  90   SEDYCRTLRINFDDS  104



>ref|XP_010553071.1| PREDICTED: uncharacterized protein LOC104823279 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010553072.1| PREDICTED: uncharacterized protein LOC104823279 isoform X1 [Tarenaya 
hassleriana]
Length=496

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIR-LTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            ILFSFLT P+GTI+R L  H     P  IGC+ NLY S+ +  + N+ TE+CK M+L PR
Sbjct  35   ILFSFLTLPLGTIVRQLEDHHGKPQPTIIGCLANLYGSVVDMGIDNFSTEVCKEMLLRPR  94

Query  175  NPCAIYCSKLKINI  216
            +       ++K+N+
Sbjct  95   SVNEDRFRRVKVNL  108



>ref|XP_004491998.1| PREDICTED: uncharacterized protein LOC101500403 [Cicer arietinum]
Length=505

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LFSFLTFP+GTI RL   E    P+  G +N LY S+++     +   + K M+L   N
Sbjct  45   VLFSFLTFPLGTISRLLEKESSIGPLRFGSVNTLYHSVEDLDKGCFGKHVSKEMLLQTAN  104

Query  178  PCAIYCSKLKINIDDS  225
                YC  +K+NIDDS
Sbjct  105  SSQHYCRNVKLNIDDS  120



>ref|XP_003604759.1| hypothetical protein MTR_4g017470 [Medicago truncatula]
 gb|AES86956.1| DUF674 family protein [Medicago truncatula]
Length=493

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 11/85 (13%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVT----------IGCMNNLYRSIQN-SLLNWHTELC  150
            +FSFL+ P+GTI+RL S+                  +G + NLY+++QN S   W+   C
Sbjct  39   IFSFLSLPLGTIVRLLSNNNDNNNDQQQRRSQSSSFLGNIKNLYKTVQNISNDVWNNPFC  98

Query  151  KTMVLNPRNPCAIYCSKLKINIDDS  225
            + M+LNPRNPC   C  L +N+D+S
Sbjct  99   RHMLLNPRNPCESLCMNLFLNVDNS  123



>ref|XP_010501424.1| PREDICTED: uncharacterized protein LOC104778673 [Camelina sativa]
Length=312

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 4/78 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLT---SHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLN  168
            +LFSFLT PMG ++RL       Q+     IGC NNLY+ + +    N+ TE CK M+L 
Sbjct  37   VLFSFLTVPMGNVVRLIEKYQKNQISEATMIGCFNNLYKRVLDMGTANFMTEACKDMLLY  96

Query  169  PRNPCAIYCSKLKINIDD  222
            PR+        LK+NI D
Sbjct  97   PRSAMENLRKGLKLNIAD  114



>gb|EMT25177.1| hypothetical protein F775_03443 [Aegilops tauschii]
Length=511

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LF FLT P+GT++RL   +       +GC++ LYRS++  S   +  E CK M+L P N
Sbjct  36   VLFGFLTLPLGTVVRLLGGQS-----QVGCLDELYRSVEGLSTDLFRIEACKAMLLRPIN  90

Query  178  PCAIYCSKLKINIDDS  225
              A  C +L + +DD+
Sbjct  91   AAAKQCCQLTVRVDDT  106



>gb|AAU44565.1| hypothetical protein AT5G43240 [Arabidopsis thaliana]
 gb|AAU44566.1| hypothetical protein AT5G43240 [Arabidopsis thaliana]
Length=512

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSF T PMGTI+RL    +    + IGC +N+Y S+ +  + ++ TE CK M+L P +
Sbjct  35   LLFSFFTLPMGTIVRLLEMYKKSQKIAIGCFSNIYASVVSMGIEHFLTEACKQMLLYPGS  94

Query  178  PCAIYCSKLKINIDDS  225
                 C  LK+ +DDS
Sbjct  95   LNHEKCRNLKLRVDDS  110



>ref|NP_199138.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001119366.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED94927.1| uncharacterized protein AT5G43240 [Arabidopsis thaliana]
 gb|AED94929.1| uncharacterized protein AT5G43240 [Arabidopsis thaliana]
Length=512

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSF T PMGTI+RL    +    + IGC +N+Y S+ +  + ++ TE CK M+L P +
Sbjct  35   LLFSFFTLPMGTIVRLLEMYKKSQKIAIGCFSNIYASVVSMGIEHFLTEACKQMLLYPGS  94

Query  178  PCAIYCSKLKINIDDS  225
                 C  LK+ +DDS
Sbjct  95   LNHEKCRNLKLRVDDS  110



>dbj|BAB10587.1| unnamed protein product [Arabidopsis thaliana]
Length=482

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSF T PMGTI+RL    +    + IGC +N+Y S+ +  + ++ TE CK M+L P +
Sbjct  35   LLFSFFTLPMGTIVRLLEMYKKSQKIAIGCFSNIYASVVSMGIEHFLTEACKQMLLYPGS  94

Query  178  PCAIYCSKLKINIDDS  225
                 C  LK+ +DDS
Sbjct  95   LNHEKCRNLKLRVDDS  110



>ref|XP_008220971.1| PREDICTED: uncharacterized protein LOC103321003 [Prunus mume]
Length=455

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTELCKTMVLNPRNP  180
            +L SFLT PMGTII+L  +     P+ IGCM NLY S+++  +      C  M+L PRN 
Sbjct  34   VLVSFLTLPMGTIIKLARNHS--APLGIGCMKNLYASVKDIDVQHFRTNCWDMLLCPRNG  91

Query  181  CAIYCSKLKINIDD  222
                   L++NIDD
Sbjct  92   AGPIVENLEMNIDD  105



>ref|XP_010481231.1| PREDICTED: uncharacterized protein LOC104760079 [Camelina sativa]
Length=329

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 4/75 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTS---HEQLKIPVTIGCMNNLYRSI-QNSLLNWHTELCKTMVLN  168
            +LFS LT PMGTI+RL       Q    + IGC NNLY+S+ +  + N+ TE  K M+L 
Sbjct  41   VLFSLLTPPMGTIVRLLEKHKQNQRSQGLVIGCFNNLYKSVLEMDINNFTTEASKQMLLQ  100

Query  169  PRNPCAIYCSKLKIN  213
            PR+     C +LK+N
Sbjct  101  PRSLTEKKCRRLKLN  115



>ref|XP_008344827.1| PREDICTED: uncharacterized protein LOC103407721 [Malus domestica]
Length=465

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L SFLT P+GTII+L    +  +PV I C+NNLY S++        ++ C+ M+L PRN
Sbjct  30   VLLSFLTIPLGTIIKLG--REHSVPVEIXCINNLYSSVEEIDARELRSDACREMLLLPRN  87

Query  178  PCAIYCSKLKINID  219
                +C  L + ID
Sbjct  88   AAESHCKNLVLQID  101



>emb|CDY10481.1| BnaCnng03820D [Brassica napus]
Length=502

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLT PMGT++RL    Q    V IGC NN++ S+   ++ ++ ++  K M+L P +
Sbjct  35   ILFSFLTLPMGTLVRLLEMHQKSKSVPIGCFNNIHASVAGMAMKHFSSQASKQMLLYPGS  94

Query  178  PCAIYCSKLKINIDDS  225
                 C K K+ IDD+
Sbjct  95   LNRDKCQKTKLRIDDT  110



>emb|CDY44567.1| BnaA04g10230D [Brassica napus]
Length=485

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 50/77 (65%), Gaps = 4/77 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRL-TSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            +L S L+ PMG I RL  SH+ L+    + C  NL RS+ +  + ++ TE CK+M+L+P+
Sbjct  32   VLISLLSLPMGKIARLLESHKDLQ--TVLACYQNLNRSVADMGIEHFETEACKSMLLSPK  89

Query  175  NPCAIYCSKLKINIDDS  225
            +   I+C KLK+N+ D+
Sbjct  90   SSYEIHCRKLKLNMGDT  106



>ref|XP_009139993.1| PREDICTED: uncharacterized protein LOC103863981 [Brassica rapa]
Length=485

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 50/77 (65%), Gaps = 4/77 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRL-TSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            +L S L+ PMG I RL  SH+ L+    + C  NL RS+ +  + ++ TE CK+M+L+P+
Sbjct  32   VLISLLSLPMGKIARLLESHKDLQ--TVLACYQNLNRSVADMGIEHFETEACKSMLLSPK  89

Query  175  NPCAIYCSKLKINIDDS  225
            +   I+C KLK+N+ D+
Sbjct  90   SSYEIHCRKLKLNMGDT  106



>ref|XP_007207112.1| hypothetical protein PRUPE_ppa019509mg [Prunus persica]
 gb|EMJ08311.1| hypothetical protein PRUPE_ppa019509mg [Prunus persica]
Length=484

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 8/75 (11%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTELCKTMVLNPRNP  180
            +L SFLT PMGTI+R  +   + +     CMNNLY S++  L    TE CK M+L P N 
Sbjct  35   VLLSFLTIPMGTIVRRDTKHSVSL-----CMNNLYASVRRLL---QTEACKEMLLCPHNG  86

Query  181  CAIYCSKLKINIDDS  225
               +C  LK+ ID+ 
Sbjct  87   AESHCENLKLKIDND  101



>ref|XP_008384882.1| PREDICTED: uncharacterized protein LOC103447457 isoform X4 [Malus 
domestica]
Length=464

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL+ H Q      IGC++NL+ S+++  L  +  + C  M+L+PRN
Sbjct  34   VLFSFLTIPMGTIVRLSHHSQ---SFGIGCIDNLFGSVESLDLQLFRXKECXDMLLHPRN  90

Query  178  PCAIYCSKLKINID  219
                    LK+  D
Sbjct  91   EAEDLLRNLKLKYD  104



>emb|CDY36848.1| BnaC04g32410D [Brassica napus]
Length=491

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 50/77 (65%), Gaps = 4/77 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRL-TSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPR  174
            +L S L+ PMG I RL  SH+ L+    + C  NL RS+ +  + ++ TE CK+M+L+P+
Sbjct  32   VLISLLSLPMGKIARLLESHKDLQ--TVLACYQNLNRSVADMGIEHFETEACKSMLLSPK  89

Query  175  NPCAIYCSKLKINIDDS  225
            +   I+C KLK+N+ D+
Sbjct  90   SSYEIHCRKLKLNMGDT  106



>ref|XP_008384879.1| PREDICTED: uncharacterized protein LOC103447457 isoform X2 [Malus 
domestica]
 ref|XP_008384880.1| PREDICTED: uncharacterized protein LOC103447457 isoform X2 [Malus 
domestica]
Length=477

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL+ H Q      IGC++NL+ S+++  L  +  + C  M+L+PRN
Sbjct  47   VLFSFLTIPMGTIVRLSHHSQ---SFGIGCIDNLFGSVESLDLQLFRXKECXDMLLHPRN  103

Query  178  PCAIYCSKLKINID  219
                    LK+  D
Sbjct  104  EAEDLLRNLKLKYD  117



>ref|XP_008384877.1| PREDICTED: uncharacterized protein LOC103447457 isoform X1 [Malus 
domestica]
 ref|XP_008384878.1| PREDICTED: uncharacterized protein LOC103447457 isoform X1 [Malus 
domestica]
Length=491

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL+ H Q      IGC++NL+ S+++  L  +  + C  M+L+PRN
Sbjct  61   VLFSFLTIPMGTIVRLSHHSQ---SFGIGCIDNLFGSVESLDLQLFRXKECXDMLLHPRN  117

Query  178  PCAIYCSKLKINID  219
                    LK+  D
Sbjct  118  EAEDLLRNLKLKYD  131



>ref|XP_008649730.1| PREDICTED: uncharacterized protein LOC103630455 [Zea mays]
Length=514

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT  + TI+RL   +       +GC++ LY+S+++ +L  + T  CK M+L P N
Sbjct  34   VLFSFLTVLLDTIVRLLDKQS-----QLGCLDQLYKSVEDLNLEYFQTSACKAMLLKPLN  88

Query  178  PCAIYCSKLKINIDDS  225
              + +C +LKIN+D S
Sbjct  89   AASGHCCRLKINVDGS  104



>ref|XP_008384881.1| PREDICTED: uncharacterized protein LOC103447457 isoform X3 [Malus 
domestica]
Length=473

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT PMGTI+RL+ H Q      IGC++NL+ S+++  L  +  + C  M+L+PRN
Sbjct  43   VLFSFLTIPMGTIVRLSHHSQ---SFGIGCIDNLFGSVESLDLQLFRXKECXDMLLHPRN  99

Query  178  PCAIYCSKLKINID  219
                    LK+  D
Sbjct  100  EAEDLLRNLKLKYD  113



>ref|XP_007140416.1| hypothetical protein PHAVU_008G110000g [Phaseolus vulgaris]
 gb|ESW12410.1| hypothetical protein PHAVU_008G110000g [Phaseolus vulgaris]
Length=465

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLN-WHTELCKTMVLNPRN  177
            +LFSFLT P+GTI  L   E    P  +  ++++Y+S++N       T+ C+ M+L PRN
Sbjct  21   VLFSFLTLPLGTIASLVRKESKLQPPEVA-LSSIYQSVENLPRECLRTDTCEEMLLLPRN  79

Query  178  PCAIYCSKLKINIDD  222
                +CS LKINIDD
Sbjct  80   SMEDFCSSLKINIDD  94



>gb|AFW78327.1| hypothetical protein ZEAMMB73_424215 [Zea mays]
Length=615

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +LFSFLT  + TI+RL   +       +GC++ LY+S+++ +L  + T  CK M+L P N
Sbjct  135  VLFSFLTVLLDTIVRLLDKQS-----QLGCLDQLYKSVEDLNLEYFQTSACKAMLLKPLN  189

Query  178  PCAIYCSKLKINIDDS  225
              + +C +LKIN+D S
Sbjct  190  AASGHCCRLKINVDGS  205



>ref|XP_003622948.1| Tyrosine/dopa decarboxylase [Medicago truncatula]
 gb|AES79166.1| tyrosine/DOPA decarboxylase [Medicago truncatula]
Length=928

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 13/74 (18%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNWHTELCKTMVLNPRNPC  183
            LF FLT P+GTI RL S E     +  G +++LY+S++             M+L PRN  
Sbjct  546  LFGFLTLPLGTIARLVSEESNIEAMKFGSISSLYQSVE-------------MLLEPRNSM  592

Query  184  AIYCSKLKINIDDS  225
              YC K+K+NIDD+
Sbjct  593  EAYCQKMKLNIDDT  606



>gb|EYU34020.1| hypothetical protein MIMGU_mgv1a020132mg [Erythranthe guttata]
Length=460

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 7/76 (9%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIR-LTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPR  174
            +L SFLT P+GTI R L  H +     TIGC+  LY  ++N    +  T++CK M+LNPR
Sbjct  38   VLLSFLTLPLGTIARILKKHGR-----TIGCLTALYSGLENLGTGYFGTDVCKQMLLNPR  92

Query  175  NPCAIYCSKLKINIDD  222
            +  A  C KLK+++ +
Sbjct  93   SSFASECRKLKLDLGE  108



>ref|XP_010920714.1| PREDICTED: uncharacterized protein LOC105044489 isoform X2 [Elaeis 
guineensis]
Length=477

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLT P+G I+R+   +      ++G M+ LY S++N     + T  CKTM+L+P+N
Sbjct  32   ILFSFLTLPIGIIVRILGKKS-----SLGAMDRLYESVENLDARYFQTAPCKTMLLHPKN  86

Query  178  PCAIYCSKLKINIDDS  225
                 C  L + +DDS
Sbjct  87   VSGFPCEGLALRVDDS  102


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 43/76 (57%), Gaps = 8/76 (11%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ---NSLLNWHTELCKTMVLNPR  174
            LFSFLTFP+G+I+RL          ++GC++NLY S++   N+     ++ C  M+L P+
Sbjct  284  LFSFLTFPLGSILRLLDKHS-----SLGCIDNLYESVELLSNNYNYMKSKECYDMLLAPK  338

Query  175  NPCAIYCSKLKINIDD  222
             P    C    ++I +
Sbjct  339  LPPYFGCDNQLLDIGE  354



>ref|XP_010920713.1| PREDICTED: uncharacterized protein LOC105044489 isoform X1 [Elaeis 
guineensis]
Length=478

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 6/76 (8%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            ILFSFLT P+G I+R+   +      ++G M+ LY S++N     + T  CKTM+L+P+N
Sbjct  32   ILFSFLTLPIGIIVRILGKKS-----SLGAMDRLYESVENLDARYFQTAPCKTMLLHPKN  86

Query  178  PCAIYCSKLKINIDDS  225
                 C  L + +DDS
Sbjct  87   VSGFPCEGLALRVDDS  102


 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 43/76 (57%), Gaps = 8/76 (11%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQ---NSLLNWHTELCKTMVLNPR  174
            LFSFLTFP+G+I+RL          ++GC++NLY S++   N+     ++ C  M+L P+
Sbjct  284  LFSFLTFPLGSILRLLDKHS-----SLGCIDNLYESVELLSNNYNYMKSKECYDMLLAPK  338

Query  175  NPCAIYCSKLKINIDD  222
             P    C    ++I +
Sbjct  339  LPPYFGCDNQLLDIGE  354



>ref|XP_003604756.1| hypothetical protein MTR_4g017440 [Medicago truncatula]
 gb|AES86953.1| DUF674 family protein [Medicago truncatula]
Length=508

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 50/87 (57%), Gaps = 13/87 (15%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQ-----------LKIPVTIGCMNNLYRSIQNSLLN--WHTE  144
            LFSFL+ P+GTI+RL +              L+    +  +  +Y+++Q+   N  W+  
Sbjct  41   LFSFLSLPLGTIVRLLATNNNNNDQQQHQQLLESSPFLDNIKYIYQTVQDITSNDVWNNP  100

Query  145  LCKTMVLNPRNPCAIYCSKLKINIDDS  225
            LCK M+L+PRNPC   C KL +NIDD+
Sbjct  101  LCKQMLLHPRNPCESQCMKLFLNIDDT  127



>ref|XP_003604839.1| hypothetical protein MTR_4g019340 [Medicago truncatula]
 gb|AES87036.1| DUF674 family protein [Medicago truncatula]
Length=506

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 14/87 (16%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRL--TSHEQLKIPVT---------IGCMNNLYRSIQNSLLN--WHTE  144
            LFSFL+ P+ TIIRL  T+++  +             +G + NLY S+Q    N  W+  
Sbjct  65   LFSFLSLPLATIIRLLTTNNDDQQQQQQQESSESSSFLGSIKNLYESVQTLTPNDIWN-P  123

Query  145  LCKTMVLNPRNPCAIYCSKLKINIDDS  225
            +CK M+LNP+NPC   C KL +NIDD+
Sbjct  124  VCKQMLLNPKNPCESLCKKLFLNIDDT  150



>ref|XP_006405504.1| hypothetical protein EUTSA_v10027836mg [Eutrema salsugineum]
 gb|ESQ46957.1| hypothetical protein EUTSA_v10027836mg [Eutrema salsugineum]
Length=329

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/76 (36%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L S ++ PMG I  L  + +    V +GC  NL RS+ +  + ++ TE CK+M+LNP++
Sbjct  32   VLISLMSLPMGKIASLLENHKKFQTVVLGCYRNLSRSVADMGIEHFETEACKSMLLNPKS  91

Query  178  PCAIYCSKLKINIDDS  225
               ++C +LK+N+ D+
Sbjct  92   SKEVHCRRLKLNMGDT  107



>gb|KEH23102.1| MZB10.14 protein [Medicago truncatula]
Length=430

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQN-SLLNWHTELCKTMVLNPRN  177
            +L SFLT P+GTI RL S E     V +G ++ LY+S+ N    N+ +   K +++ P N
Sbjct  42   VLLSFLTLPLGTIARLVSQESNMENVCVGSLSLLYQSVANLDKDNFRSAFEKELLVRPIN  101

Query  178  PCAIYCSKLKINIDDS  225
                YC  LK+NIDD+
Sbjct  102  SMEEYCKYLKLNIDDT  117



>ref|XP_003622949.1| hypothetical protein MTR_7g058710 [Medicago truncatula]
 gb|AES79167.1| DUF674 family protein [Medicago truncatula]
Length=484

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 13/76 (17%)
 Frame = +1

Query  1    ILFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSIQNSLLNW-HTELCKTMVLNPRN  177
            +LFSFLT P+GT ++             G +++LY+S+ N    +  T  CK M+L PRN
Sbjct  38   VLFSFLTLPLGTAVKF------------GSISSLYQSVANLDEQYLWTRTCKEMLLRPRN  85

Query  178  PCAIYCSKLKINIDDS  225
                YC K+K+NIDD+
Sbjct  86   SMESYCQKMKLNIDDT  101



>ref|XP_003595904.1| hypothetical protein MTR_2g063240 [Medicago truncatula]
 gb|KEH23088.1| DUF674 family protein [Medicago truncatula]
Length=434

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +1

Query  4    LFSFLTFPMGTIIRLTSHEQLKIPVTIGCMNNLYRSI----QNSLLNWHTELCKTMVLNP  171
            LFSFLT P+GTI RL + E     V  G +N+LY+S+    Q  L N   + CK M+L P
Sbjct  42   LFSFLTLPLGTIARLVAKESDIEAVIFGSINSLYQSVTDLDQQYLFN---QTCKEMLLTP  98

Query  172  RNPCAIYCSKLKINIDDS  225
            RN        +K+NID++
Sbjct  99   RNFMESLIQHMKLNIDNT  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524286916336