BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c39778_g1_i1 len=1335 path=[1313:0-1334]

Length=1335
                                                                      Score     E

ref|XP_011094531.1|  PREDICTED: probable carboxylesterase 15            483   3e-166   
ref|XP_009767876.1|  PREDICTED: probable carboxylesterase 15            478   3e-164   
ref|XP_009590987.1|  PREDICTED: probable carboxylesterase 15            477   6e-164   
ref|XP_006362298.1|  PREDICTED: probable carboxylesterase 15-like       458   3e-156   
ref|XP_002268704.1|  PREDICTED: probable carboxylesterase 15            454   5e-155   Vitis vinifera
emb|CBI39095.3|  unnamed protein product                                452   2e-154   
ref|XP_004250778.1|  PREDICTED: probable carboxylesterase 15            451   2e-153   
emb|CBI39081.3|  unnamed protein product                                446   1e-151   
ref|XP_002266241.1|  PREDICTED: probable carboxylesterase 15            443   1e-150   Vitis vinifera
ref|XP_004303415.1|  PREDICTED: probable carboxylesterase 15-like       440   3e-149   
ref|XP_002309272.2|  hypothetical protein POPTR_0006s21320g             437   5e-148   Populus trichocarpa [western balsam poplar]
ref|XP_008350223.1|  PREDICTED: probable carboxylesterase 15            436   6e-148   
ref|XP_002524110.1|  Gibberellin receptor GID1, putative                435   2e-147   Ricinus communis
emb|CDP10554.1|  unnamed protein product                                433   1e-146   
ref|XP_011047121.1|  PREDICTED: probable carboxylesterase 15            433   1e-145   
ref|XP_011042528.1|  PREDICTED: probable carboxylesterase 15            430   2e-145   
ref|XP_002322758.1|  hypothetical protein POPTR_0016s06500g             429   3e-145   Populus trichocarpa [western balsam poplar]
gb|KDP21934.1|  hypothetical protein JCGZ_03072                         429   8e-145   
ref|XP_009348479.1|  PREDICTED: probable carboxylesterase 15            428   9e-145   
ref|XP_008241122.1|  PREDICTED: probable carboxylesterase 15            428   1e-144   
ref|XP_010058697.1|  PREDICTED: probable carboxylesterase 15            427   2e-144   
ref|XP_003521507.1|  PREDICTED: probable carboxylesterase 15-like       423   7e-143   
ref|XP_003554498.1|  PREDICTED: probable carboxylesterase 15-like       421   8e-142   
ref|XP_002267394.1|  PREDICTED: probable carboxylesterase 15 isof...    421   9e-142   Vitis vinifera
ref|XP_008391530.1|  PREDICTED: probable carboxylesterase 15            421   9e-142   
ref|XP_007202225.1|  hypothetical protein PRUPE_ppa008578mg             416   6e-140   
gb|KDO70738.1|  hypothetical protein CISIN_1g020140mg                   409   2e-137   
ref|XP_011043887.1|  PREDICTED: probable carboxylesterase 15            409   5e-137   
ref|XP_002313627.1|  hypothetical protein POPTR_0009s15770g             408   7e-137   Populus trichocarpa [western balsam poplar]
ref|XP_006429993.1|  hypothetical protein CICLE_v10012167mg             408   9e-137   
ref|XP_010090529.1|  putative carboxylesterase 15                       408   1e-136   
ref|XP_006481654.1|  PREDICTED: probable carboxylesterase 15-like       408   1e-136   
ref|XP_007163014.1|  hypothetical protein PHAVU_001G198900g             407   2e-136   
gb|KCW90396.1|  hypothetical protein EUGRSUZ_A02538                     405   6e-136   
ref|XP_007029163.1|  Alpha/beta-Hydrolases superfamily protein, p...    405   8e-136   
ref|XP_002527569.1|  Gibberellin receptor GID1, putative                402   2e-134   Ricinus communis
ref|XP_006487818.1|  PREDICTED: probable carboxylesterase 15-like       401   6e-134   
ref|XP_009627722.1|  PREDICTED: probable carboxylesterase 15            400   8e-134   
ref|XP_006424040.1|  hypothetical protein CICLE_v10028832mg             400   1e-133   
ref|XP_010045157.1|  PREDICTED: probable carboxylesterase 15            399   2e-133   
emb|CBI24401.3|  unnamed protein product                                399   3e-133   
ref|XP_008449839.1|  PREDICTED: probable carboxylesterase 15            398   7e-133   
ref|XP_002277507.1|  PREDICTED: probable carboxylesterase 15            397   9e-133   Vitis vinifera
ref|XP_011089000.1|  PREDICTED: probable carboxylesterase 15            398   1e-132   
gb|KDP42951.1|  hypothetical protein JCGZ_23893                         397   2e-132   
ref|XP_004295159.1|  PREDICTED: probable carboxylesterase 15-like       397   2e-132   
ref|XP_004494289.1|  PREDICTED: probable carboxylesterase 15-like       396   4e-132   
ref|XP_007015630.1|  Alpha/beta-Hydrolases superfamily protein          396   5e-132   
ref|XP_006340439.1|  PREDICTED: probable carboxylesterase 15-like       395   1e-131   
gb|KGN48323.1|  Gibberellin receptor GID1                               395   1e-131   
gb|KEH24302.1|  gibberellin receptor GID1, putative                     394   2e-131   
ref|XP_008462636.1|  PREDICTED: probable carboxylesterase 15            394   3e-131   
emb|CAN74724.1|  hypothetical protein VITISV_037263                     393   4e-131   Vitis vinifera
ref|XP_004162022.1|  PREDICTED: probable carboxylesterase 15-like       393   5e-131   
ref|XP_007132516.1|  hypothetical protein PHAVU_011G100900g             393   5e-131   
ref|XP_004142252.1|  PREDICTED: probable carboxylesterase 15-like       392   9e-131   
ref|XP_010677607.1|  PREDICTED: probable carboxylesterase 15 isof...    392   3e-130   
ref|XP_010263117.1|  PREDICTED: probable carboxylesterase 15            391   3e-130   
ref|XP_009778712.1|  PREDICTED: probable carboxylesterase 15            391   3e-130   
ref|XP_004251433.1|  PREDICTED: probable carboxylesterase 15            390   5e-130   
emb|CDP15587.1|  unnamed protein product                                390   2e-129   
gb|EPS60690.1|  hypothetical protein M569_14110                         388   4e-129   
ref|XP_007132515.1|  hypothetical protein PHAVU_011G100800g             388   7e-129   
ref|XP_003527508.1|  PREDICTED: probable carboxylesterase 15-like...    388   8e-129   
ref|XP_010677606.1|  PREDICTED: probable carboxylesterase 15 isof...    388   1e-128   
gb|KEH29724.1|  carboxylesterase                                        385   4e-128   
gb|EYU36009.1|  hypothetical protein MIMGU_mgv1a018241mg                386   4e-128   
ref|XP_004506248.1|  PREDICTED: probable carboxylesterase 15-like       385   6e-128   
gb|ABB89016.1|  CXE carboxylesterase                                    385   7e-128   Actinidia deliciosa [Chinese gooseberry]
gb|KHG17903.1|  putative carboxylesterase 15 -like protein              385   1e-127   
ref|XP_004143400.1|  PREDICTED: LOW QUALITY PROTEIN: probable car...    384   1e-127   
ref|XP_007031033.1|  Alpha/beta-Hydrolases superfamily protein, p...    384   2e-127   
ref|XP_003535834.1|  PREDICTED: probable carboxylesterase 15-like       384   4e-127   
gb|KHN41247.1|  Putative carboxylesterase 15                            380   6e-126   
ref|XP_003519022.1|  PREDICTED: probable carboxylesterase 15-like       380   6e-126   
ref|XP_008811411.1|  PREDICTED: probable carboxylesterase 15            380   1e-125   
ref|XP_006429990.1|  hypothetical protein CICLE_v10012177mg             379   3e-125   
gb|ABB89009.1|  CXE carboxylesterase                                    378   4e-125   Malus pumila [paradise apple]
ref|XP_008359190.1|  PREDICTED: probable carboxylesterase 15            378   7e-125   
ref|XP_008385595.1|  PREDICTED: probable carboxylesterase 15            377   1e-124   
ref|XP_008230629.1|  PREDICTED: probable carboxylesterase 15            377   2e-124   
ref|XP_010105066.1|  putative carboxylesterase 15                       375   5e-124   
ref|XP_006481655.1|  PREDICTED: probable carboxylesterase 15-like       375   6e-124   
ref|XP_010908310.1|  PREDICTED: probable carboxylesterase 15            374   2e-123   
ref|XP_007205520.1|  hypothetical protein PRUPE_ppa008440mg             373   4e-123   
ref|XP_009406562.1|  PREDICTED: probable carboxylesterase 15            369   3e-121   
ref|XP_006433441.1|  hypothetical protein CICLE_v10003873mg             365   4e-120   
ref|XP_006495101.1|  PREDICTED: probable carboxylesterase 15-like       363   3e-119   
ref|XP_006433445.1|  hypothetical protein CICLE_v10001815mg             362   6e-119   
ref|XP_007145753.1|  hypothetical protein PHAVU_007G264900g             360   5e-118   
dbj|BAJ97938.1|  predicted protein                                      359   1e-117   
ref|XP_008652041.1|  PREDICTED: probable carboxylesterase 15            357   5e-117   
ref|XP_009368537.1|  PREDICTED: probable carboxylesterase 15            357   1e-116   
ref|XP_004955528.1|  PREDICTED: probable carboxylesterase 15-like       356   3e-116   
ref|XP_010519985.1|  PREDICTED: probable carboxylesterase 15            353   2e-115   
ref|NP_001058951.1|  Os07g0162900                                       346   2e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006593038.1|  PREDICTED: uncharacterized protein LOC100791656    373   4e-112   
ref|XP_010491228.1|  PREDICTED: probable carboxylesterase 15            343   6e-111   
gb|EAZ02867.1|  hypothetical protein OsI_24998                          342   6e-111   Oryza sativa Indica Group [Indian rice]
ref|XP_006399129.1|  hypothetical protein EUTSA_v10014072mg             342   7e-111   
ref|XP_009130947.1|  PREDICTED: probable carboxylesterase 15            342   1e-110   
emb|CDX81008.1|  BnaC03g02620D                                          341   2e-110   
ref|NP_196275.1|  probable carboxylesterase 15                          340   3e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288164.1|  hypothetical protein CARUB_v10001401mg             339   9e-110   
emb|CDX70090.1|  BnaA10g24390D                                          339   1e-109   
ref|XP_010910204.1|  PREDICTED: probable carboxylesterase 15            339   1e-109   
ref|XP_009122268.1|  PREDICTED: probable carboxylesterase 15            338   1e-109   
ref|XP_010452596.1|  PREDICTED: probable carboxylesterase 15            338   3e-109   
emb|CDX98936.1|  BnaC09g48990D                                          338   3e-109   
ref|XP_002461501.1|  hypothetical protein SORBIDRAFT_02g003630          336   1e-108   Sorghum bicolor [broomcorn]
ref|XP_002873267.1|  hypothetical protein ARALYDRAFT_487467             336   1e-108   
gb|EYU18138.1|  hypothetical protein MIMGU_mgv1a019510mg                328   6e-107   
ref|XP_010423321.1|  PREDICTED: probable carboxylesterase 15            327   4e-105   
ref|XP_003557566.1|  PREDICTED: probable carboxylesterase 15            322   8e-103   
ref|XP_006826391.1|  hypothetical protein AMTR_s00004p00146330          320   2e-102   
ref|XP_008779109.1|  PREDICTED: probable carboxylesterase 15            317   2e-101   
ref|XP_008779106.1|  PREDICTED: probable carboxylesterase 15            317   3e-101   
ref|XP_002463764.1|  hypothetical protein SORBIDRAFT_01g005720          315   2e-100   Sorghum bicolor [broomcorn]
ref|NP_001051515.1|  Os03g0790500                                       310   3e-98    Oryza sativa Japonica Group [Japonica rice]
gb|EAY92127.1|  hypothetical protein OsI_13838                          310   3e-98    Oryza sativa Indica Group [Indian rice]
gb|AAO24912.1|  putative esterase                                       310   3e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004955526.1|  PREDICTED: probable carboxylesterase 15-like       308   1e-97    
ref|XP_002459376.1|  hypothetical protein SORBIDRAFT_02g003600          309   2e-97    Sorghum bicolor [broomcorn]
ref|NP_001058947.1|  Os07g0162400                                       307   3e-97    Oryza sativa Japonica Group [Japonica rice]
gb|ABK22844.1|  unknown                                                 306   4e-97    Picea sitchensis
ref|XP_009368866.1|  PREDICTED: probable carboxylesterase 15            305   7e-97    
gb|EAZ02863.1|  hypothetical protein OsI_24993                          306   7e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_006643767.1|  PREDICTED: probable carboxylesterase 15-like       304   5e-96    
ref|XP_002461499.1|  hypothetical protein SORBIDRAFT_02g003610          304   7e-96    Sorghum bicolor [broomcorn]
ref|XP_008652039.1|  PREDICTED: probable carboxylesterase 15            302   3e-95    
ref|XP_004981490.1|  PREDICTED: probable carboxylesterase 15-like       301   4e-95    
ref|XP_004986199.1|  PREDICTED: probable carboxylesterase 15-like       300   2e-94    
ref|XP_010228720.1|  PREDICTED: probable carboxylesterase 15            300   2e-94    
ref|NP_001042063.1|  Os01g0155000                                       299   4e-94    Oryza sativa Japonica Group [Japonica rice]
gb|EAY72594.1|  hypothetical protein OsI_00460                          299   5e-94    Oryza sativa Indica Group [Indian rice]
emb|CDM81995.1|  unnamed protein product                                298   9e-94    
ref|XP_004955527.1|  PREDICTED: probable carboxylesterase 15-like       298   2e-93    
ref|XP_002459375.1|  hypothetical protein SORBIDRAFT_02g003560          296   5e-93    Sorghum bicolor [broomcorn]
emb|CDM81994.1|  unnamed protein product                                295   9e-93    
ref|XP_002461500.1|  hypothetical protein SORBIDRAFT_02g003620          296   1e-92    Sorghum bicolor [broomcorn]
ref|XP_003561402.1|  PREDICTED: probable carboxylesterase 15            295   3e-92    
emb|CDM82062.1|  unnamed protein product                                294   4e-92    
dbj|BAJ98632.1|  predicted protein                                      294   1e-91    
ref|XP_010653235.1|  PREDICTED: probable carboxylesterase 15 isof...    289   1e-91    
ref|XP_004955512.1|  PREDICTED: probable carboxylesterase 15-like       293   7e-91    
dbj|BAJ98039.1|  predicted protein                                      290   2e-90    
ref|NP_001058948.1|  Os07g0162500                                       289   2e-90    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02864.1|  hypothetical protein OsI_24995                          289   3e-90    Oryza sativa Indica Group [Indian rice]
dbj|BAJ96540.1|  predicted protein                                      289   5e-90    
ref|NP_001142060.1|  uncharacterized protein LOC100274216               288   6e-90    Zea mays [maize]
ref|NP_001183655.1|  hypothetical protein                               288   1e-89    
ref|XP_006429992.1|  hypothetical protein CICLE_v10012167mg             283   6e-89    
emb|CDM82063.1|  unnamed protein product                                285   7e-89    
ref|XP_004955521.1|  PREDICTED: probable carboxylesterase 15-like       285   1e-88    
ref|XP_004955511.1|  PREDICTED: probable carboxylesterase 15-like       284   2e-88    
ref|NP_001058950.1|  Os07g0162700                                       284   3e-88    Oryza sativa Japonica Group [Japonica rice]
dbj|BAC20766.1|  putative cell death associated protein                 284   4e-88    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02866.1|  hypothetical protein OsI_24997                          284   4e-88    Oryza sativa Indica Group [Indian rice]
gb|EMT12641.1|  Putative gibberellin receptor GID1L3                    285   4e-88    
ref|XP_006826392.1|  hypothetical protein AMTR_s00004p00146770          280   2e-87    
dbj|BAK02070.1|  predicted protein                                      281   6e-87    
ref|XP_004955522.1|  PREDICTED: probable carboxylesterase 15-like       280   1e-86    
tpg|DAA42599.1|  TPA: hypothetical protein ZEAMMB73_208866              278   9e-86    
ref|NP_001042057.2|  Os01g0153800                                       278   1e-85    Oryza sativa Japonica Group [Japonica rice]
dbj|BAB44059.1|  putative PrMC3                                         278   1e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002462164.1|  hypothetical protein SORBIDRAFT_02g020810          277   2e-85    Sorghum bicolor [broomcorn]
ref|XP_004173935.1|  PREDICTED: probable carboxylesterase 15-like       273   2e-85    
gb|EAY72585.1|  hypothetical protein OsI_00451                          280   3e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_004955524.1|  PREDICTED: probable carboxylesterase 15-like       276   4e-85    
ref|NP_001058949.1|  Os07g0162600                                       276   4e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561398.2|  PREDICTED: probable carboxylesterase 15            275   9e-85    
dbj|BAK06502.1|  predicted protein                                      275   1e-84    
gb|EEE53894.1|  hypothetical protein OsJ_00420                          276   1e-84    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02865.1|  hypothetical protein OsI_24996                          274   3e-84    Oryza sativa Indica Group [Indian rice]
gb|KDO45120.1|  hypothetical protein CISIN_1g0204061mg                  269   4e-84    
ref|XP_004955523.1|  PREDICTED: probable carboxylesterase 15-like       273   5e-84    
ref|XP_004955525.1|  PREDICTED: probable carboxylesterase 15-like       272   1e-83    
gb|EAY72593.1|  hypothetical protein OsI_00459                          271   1e-83    Oryza sativa Indica Group [Indian rice]
ref|NP_001132851.1|  hypothetical protein                               272   1e-83    Zea mays [maize]
gb|KDO40223.1|  hypothetical protein CISIN_1g026700mg                   266   2e-82    
dbj|BAJ88995.1|  predicted protein                                      267   9e-82    
ref|XP_003568581.1|  PREDICTED: probable carboxylesterase 15            266   2e-81    
ref|NP_001042062.1|  Os01g0154900                                       265   4e-81    Oryza sativa Japonica Group [Japonica rice]
emb|CDM81993.1|  unnamed protein product                                265   9e-81    
ref|XP_003561404.1|  PREDICTED: probable carboxylesterase 15            264   2e-80    
ref|XP_004968253.1|  PREDICTED: probable carboxylesterase 15-like       263   3e-80    
ref|XP_003557563.2|  PREDICTED: probable carboxylesterase 15            264   3e-80    
gb|ABK26127.1|  unknown                                                 263   7e-80    Picea sitchensis
gb|KDO70741.1|  hypothetical protein CISIN_1g0202681mg                  255   1e-78    
ref|XP_003565280.2|  PREDICTED: probable carboxylesterase 15            258   4e-78    
ref|XP_008655646.1|  PREDICTED: probable carboxylesterase 15            257   6e-78    
ref|XP_002455178.1|  hypothetical protein SORBIDRAFT_03g005590          260   8e-78    Sorghum bicolor [broomcorn]
gb|ACF82397.1|  unknown                                                 256   9e-78    Zea mays [maize]
ref|XP_002461497.1|  hypothetical protein SORBIDRAFT_02g003580          255   4e-77    Sorghum bicolor [broomcorn]
ref|XP_010239851.1|  PREDICTED: probable carboxylesterase 15            254   1e-76    
dbj|BAJ94602.1|  predicted protein                                      255   1e-76    
gb|ABK25952.1|  unknown                                                 253   2e-76    Picea sitchensis
gb|ABK25184.1|  unknown                                                 253   3e-76    Picea sitchensis
emb|CDM86907.1|  unnamed protein product                                252   4e-76    
ref|XP_002455176.1|  hypothetical protein SORBIDRAFT_03g005570          252   8e-76    Sorghum bicolor [broomcorn]
gb|ABK26852.1|  unknown                                                 251   2e-75    Picea sitchensis
ref|NP_001148081.1|  gibberellin receptor GID1L2                        251   2e-75    Zea mays [maize]
ref|XP_008652040.1|  PREDICTED: probable carboxylesterase 15            252   2e-75    
ref|XP_008673695.1|  PREDICTED: probable carboxylesterase 15            248   3e-74    
ref|XP_004963490.1|  PREDICTED: probable carboxylesterase 15-like       243   1e-72    
gb|EEE66608.1|  hypothetical protein OsJ_23182                          241   3e-72    Oryza sativa Japonica Group [Japonica rice]
gb|ABK26900.1|  unknown                                                 235   2e-69    Picea sitchensis
ref|XP_003575791.1|  PREDICTED: probable carboxylesterase 15            235   3e-69    
ref|XP_003573773.1|  PREDICTED: probable carboxylesterase 15            232   3e-68    
ref|XP_002461496.1|  hypothetical protein SORBIDRAFT_02g003570          232   8e-68    Sorghum bicolor [broomcorn]
emb|CDY55764.1|  BnaA03g55400D                                          223   5e-66    
ref|XP_002455177.1|  hypothetical protein SORBIDRAFT_03g005580          226   7e-66    Sorghum bicolor [broomcorn]
ref|XP_011085931.1|  PREDICTED: probable carboxylesterase 15 isof...    225   1e-65    
ref|XP_007010790.1|  Alpha/beta-Hydrolases superfamily protein          224   2e-65    
ref|XP_004307205.1|  PREDICTED: probable carboxylesterase 6-like        223   9e-65    
ref|XP_007148812.1|  hypothetical protein PHAVU_005G016400g             222   3e-64    
gb|KDP40570.1|  hypothetical protein JCGZ_24569                         221   3e-64    
ref|XP_004984954.1|  PREDICTED: probable carboxylesterase 17-like       222   4e-64    
ref|XP_010067679.1|  PREDICTED: probable carboxylesterase 15            219   2e-63    
ref|XP_006385976.1|  hypothetical protein POPTR_0003s19190g             219   4e-63    
ref|XP_004955508.1|  PREDICTED: probable carboxylesterase 15-like       218   6e-63    
ref|XP_008673693.1|  PREDICTED: probable carboxylesterase 15            218   8e-63    
ref|XP_008231719.1|  PREDICTED: probable carboxylesterase 15            218   9e-63    
ref|XP_003527517.1|  PREDICTED: probable carboxylesterase 15-like       218   9e-63    
ref|XP_002297728.1|  hsr203J family protein                             217   2e-62    Populus trichocarpa [western balsam poplar]
ref|XP_007218270.1|  hypothetical protein PRUPE_ppa008273mg             217   2e-62    
ref|XP_010106123.1|  putative carboxylesterase 6                        216   3e-62    
ref|XP_009592309.1|  PREDICTED: probable carboxylesterase 15            215   8e-62    
ref|XP_011034694.1|  PREDICTED: probable carboxylesterase 15            215   1e-61    
ref|XP_002304812.2|  hsr203J family protein                             214   2e-61    Populus trichocarpa [western balsam poplar]
gb|KFK25051.1|  hypothetical protein AALP_AA8G060400                    211   2e-61    
gb|AAF62404.1|AF212184_1  cell death associated protein                 214   2e-61    Nicotiana tabacum [American tobacco]
ref|XP_008346678.1|  PREDICTED: probable carboxylesterase 15            214   3e-61    
dbj|BAE16319.1|  hsr203J                                                213   5e-61    Solanum tuberosum [potatoes]
ref|XP_008231718.1|  PREDICTED: probable carboxylesterase 15            213   6e-61    
ref|XP_006472129.1|  PREDICTED: probable carboxylesterase 15-like       207   7e-61    
ref|XP_004499770.1|  PREDICTED: probable carboxylesterase 15-like       213   7e-61    
ref|XP_009788938.1|  PREDICTED: probable carboxylesterase 15            212   9e-61    
ref|XP_009770110.1|  PREDICTED: probable carboxylesterase 17            212   1e-60    
ref|XP_007218280.1|  hypothetical protein PRUPE_ppa008373mg             212   1e-60    
emb|CBI39096.3|  unnamed protein product                                206   1e-60    
ref|XP_007218321.1|  hypothetical protein PRUPE_ppa008412mg             212   2e-60    
ref|XP_006432380.1|  hypothetical protein CICLE_v10001722mg             212   2e-60    
ref|XP_004307204.1|  PREDICTED: probable carboxylesterase 17-like       211   2e-60    
ref|XP_008245519.1|  PREDICTED: probable carboxylesterase 15            211   3e-60    
dbj|BAC15624.1|  hsr203J                                                210   5e-60    Nicotiana tabacum [American tobacco]
ref|XP_009798409.1|  PREDICTED: probable carboxylesterase 15            211   6e-60    
gb|AAD04946.2|  PrMC3                                                   209   7e-60    Pinus radiata
ref|XP_006494564.1|  PREDICTED: probable carboxylesterase 15-like       209   2e-59    
ref|XP_002525545.1|  catalytic, putative                                209   2e-59    Ricinus communis
ref|XP_011020461.1|  PREDICTED: probable carboxylesterase 15            209   3e-59    
dbj|BAA85654.1|  hsr203J homolog                                        208   3e-59    Pisum sativum [garden pea]
ref|XP_006353022.1|  PREDICTED: probable carboxylesterase 15-like       208   4e-59    
ref|XP_010916155.1|  PREDICTED: probable carboxylesterase 17            209   4e-59    
gb|EAZ38785.1|  hypothetical protein OsJ_23187                          204   4e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008344561.1|  PREDICTED: probable carboxylesterase 15            208   5e-59    
ref|XP_004233172.1|  PREDICTED: probable carboxylesterase 15            207   5e-59    
gb|ABB89011.1|  CXE carboxylesterase                                    207   5e-59    Malus pumila [paradise apple]
ref|XP_011041377.1|  PREDICTED: probable carboxylesterase 15            207   7e-59    
ref|XP_002322605.2|  hypothetical protein POPTR_0016s03130g             207   1e-58    Populus trichocarpa [western balsam poplar]
ref|XP_009370628.1|  PREDICTED: probable carboxylesterase 15            207   2e-58    
dbj|BAA74434.1|  unnamed protein product                                206   2e-58    Solanum lycopersicum
ref|XP_008775049.1|  PREDICTED: probable carboxylesterase 17            206   2e-58    
gb|ABB89012.1|  CXE carboxylesterase                                    206   2e-58    Malus pumila [paradise apple]
gb|ADE76723.1|  unknown                                                 207   2e-58    
ref|XP_008375334.1|  PREDICTED: probable carboxylesterase 15            206   2e-58    
ref|XP_009370630.1|  PREDICTED: probable carboxylesterase 15            206   3e-58    
gb|ABK25869.1|  unknown                                                 205   7e-58    Picea sitchensis
dbj|BAD11070.1|  HSR203J like protein                                   204   8e-58    Capsicum chinense [bonnet pepper]
ref|XP_002279965.2|  PREDICTED: probable carboxylesterase 17            205   9e-58    Vitis vinifera
ref|XP_009370631.1|  PREDICTED: probable carboxylesterase 15            204   1e-57    
ref|XP_008445398.1|  PREDICTED: probable carboxylesterase 15            204   1e-57    
ref|XP_002278939.1|  PREDICTED: probable carboxylesterase 6             204   2e-57    Vitis vinifera
gb|ABB89015.1|  CXE carboxylesterase                                    203   2e-57    Actinidia deliciosa [Chinese gooseberry]
emb|CDP12915.1|  unnamed protein product                                202   5e-57    
ref|XP_002972972.1|  hypothetical protein SELMODRAFT_450797             204   5e-57    
ref|XP_002993392.1|  hypothetical protein SELMODRAFT_270047             204   6e-57    
ref|XP_009370632.1|  PREDICTED: probable carboxylesterase 15            202   6e-57    
ref|XP_010692771.1|  PREDICTED: probable carboxylesterase 17            202   8e-57    
ref|XP_007139137.1|  hypothetical protein PHAVU_008G004600g             202   9e-57    
ref|XP_004165288.1|  PREDICTED: LOW QUALITY PROTEIN: probable car...    202   1e-56    
ref|XP_003558312.1|  PREDICTED: probable carboxylesterase 17            202   1e-56    
gb|KEH32986.1|  CXE carboxylesterase                                    202   1e-56    
ref|XP_009361912.1|  PREDICTED: probable carboxylesterase 15            201   1e-56    
ref|XP_002455175.1|  hypothetical protein SORBIDRAFT_03g005560          199   2e-56    
ref|XP_004146771.1|  PREDICTED: probable carboxylesterase 6-like        201   2e-56    
ref|XP_002468158.1|  hypothetical protein SORBIDRAFT_01g040580          202   2e-56    
ref|XP_002278031.1|  PREDICTED: probable carboxylesterase 15            201   3e-56    
gb|EMS62820.1|  putative carboxylesterase 15                            199   3e-56    
gb|EYU26923.1|  hypothetical protein MIMGU_mgv1a009655mg                199   6e-56    
ref|XP_010932611.1|  PREDICTED: probable carboxylesterase 17            199   9e-56    
ref|XP_009370629.1|  PREDICTED: probable carboxylesterase 6             199   1e-55    
ref|XP_008670972.1|  PREDICTED: probable carboxylesterase 15            199   1e-55    
gb|ACF87795.1|  unknown                                                 200   1e-55    
ref|NP_001149748.1|  LOC100283375                                       199   1e-55    
ref|XP_007010789.1|  Alpha/beta-Hydrolases superfamily protein          198   2e-55    
ref|XP_007046274.1|  Alpha/beta-Hydrolases superfamily protein          198   2e-55    
gb|EEE66610.1|  hypothetical protein OsJ_23184                          194   2e-55    
ref|XP_002266969.2|  PREDICTED: probable carboxylesterase 15            201   2e-55    
ref|XP_010244418.1|  PREDICTED: probable carboxylesterase 15            197   4e-55    
gb|ADF18551.1|  HSR203J protein                                         197   4e-55    
ref|XP_008800776.1|  PREDICTED: probable carboxylesterase 17            197   6e-55    
ref|XP_002516731.1|  Lipase, putative                                   197   8e-55    
emb|CDP00594.1|  unnamed protein product                                197   9e-55    
ref|XP_009421110.1|  PREDICTED: probable carboxylesterase 17            196   1e-54    
gb|EAY89312.1|  hypothetical protein OsI_10815                          196   2e-54    
ref|XP_004304137.1|  PREDICTED: probable carboxylesterase 17-like       196   2e-54    
ref|XP_006482268.1|  PREDICTED: probable carboxylesterase 17-like       196   2e-54    
ref|XP_009404788.1|  PREDICTED: probable carboxylesterase 17            196   3e-54    
ref|NP_001152695.1|  gibberellin receptor GID1L2                        195   3e-54    
ref|NP_001049607.1|  Os03g0258200                                       196   3e-54    
gb|ABK22851.1|  unknown                                                 195   3e-54    
gb|KDP32941.1|  hypothetical protein JCGZ_12972                         195   3e-54    
gb|ADE75740.1|  unknown                                                 195   4e-54    
ref|XP_007033296.1|  Carboxyesterase 17                                 195   4e-54    
ref|XP_011074454.1|  PREDICTED: probable carboxylesterase 2             194   5e-54    
gb|ABK23572.1|  unknown                                                 194   7e-54    
ref|XP_006430794.1|  hypothetical protein CICLE_v10012053mg             194   9e-54    
ref|XP_006362556.1|  PREDICTED: probable carboxylesterase 6-like        194   1e-53    
ref|XP_003551853.1|  PREDICTED: probable carboxylesterase 17-like       192   5e-53    
ref|XP_007010791.1|  Alpha/beta-Hydrolases superfamily protein          190   6e-53    
ref|XP_010254388.1|  PREDICTED: probable carboxylesterase 17            191   9e-53    
ref|XP_006302519.1|  hypothetical protein CARUB_v10020617mg             191   1e-52    
ref|XP_007133646.1|  hypothetical protein PHAVU_011G197000g             191   1e-52    
ref|XP_003568461.1|  PREDICTED: probable carboxylesterase 15            191   1e-52    
ref|XP_003530910.1|  PREDICTED: probable carboxylesterase 17-like       191   2e-52    
ref|XP_002975994.1|  hypothetical protein SELMODRAFT_104649             190   2e-52    
ref|XP_002315949.2|  hypothetical protein POPTR_0010s13770g             191   2e-52    
gb|KDP33601.1|  hypothetical protein JCGZ_07172                         189   3e-52    
dbj|BAJ98353.1|  predicted protein                                      190   3e-52    
ref|XP_011011184.1|  PREDICTED: probable carboxylesterase 17            189   8e-52    
ref|XP_002277680.1|  PREDICTED: probable carboxylesterase 6             189   8e-52    
ref|XP_009791632.1|  PREDICTED: probable carboxylesterase 17            189   9e-52    
gb|ABB89024.1|  CXE carboxylesterase                                    189   1e-51    
gb|KDP32942.1|  hypothetical protein JCGZ_12973                         189   1e-51    
emb|CBI21036.3|  unnamed protein product                                187   1e-51    
ref|XP_004173934.1|  PREDICTED: probable carboxylesterase 15-like       182   1e-51    
ref|XP_002285077.1|  PREDICTED: probable carboxylesterase 17            187   1e-51    
ref|XP_002445059.1|  hypothetical protein SORBIDRAFT_07g003466          186   1e-51    
ref|XP_009357117.1|  PREDICTED: probable carboxylesterase 17            190   2e-51    
ref|XP_006363152.1|  PREDICTED: probable carboxylesterase 17-like       187   2e-51    
ref|XP_002529140.1|  catalytic, putative                                188   2e-51    
gb|ABK26297.1|  unknown                                                 187   2e-51    
ref|XP_009618563.1|  PREDICTED: probable carboxylesterase 6             187   3e-51    
ref|XP_008230396.1|  PREDICTED: probable carboxylesterase 17            187   3e-51    
ref|XP_009356465.1|  PREDICTED: probable carboxylesterase 6             188   4e-51    
ref|XP_002285090.3|  PREDICTED: probable carboxylesterase 17            187   4e-51    
ref|XP_006391117.1|  hypothetical protein EUTSA_v10019529mg             187   5e-51    
gb|ABD96915.1|  hypothetical protein                                    187   5e-51    
ref|XP_010245015.1|  PREDICTED: probable carboxylesterase 15            186   5e-51    
ref|XP_010511871.1|  PREDICTED: probable carboxylesterase 6             186   6e-51    
ref|XP_004238946.1|  PREDICTED: probable carboxylesterase 6             187   7e-51    
ref|XP_010558554.1|  PREDICTED: probable carboxylesterase 17            186   7e-51    
ref|XP_010648659.1|  PREDICTED: probable carboxylesterase 17 isof...    186   7e-51    
ref|XP_011008304.1|  PREDICTED: probable carboxylesterase 6             186   9e-51    
gb|ABK22244.1|  unknown                                                 186   9e-51    
gb|KCW86344.1|  hypothetical protein EUGRSUZ_B03032                     186   1e-50    
emb|CAN69539.1|  hypothetical protein VITISV_007805                     185   1e-50    
ref|XP_004135407.1|  PREDICTED: probable carboxylesterase 6-like        186   1e-50    
ref|XP_002285083.1|  PREDICTED: probable carboxylesterase 17            185   1e-50    
gb|ABK22368.1|  unknown                                                 185   2e-50    
ref|XP_002285081.1|  PREDICTED: probable carboxylesterase 17            184   2e-50    
ref|XP_010102838.1|  putative carboxylesterase 6                        186   2e-50    
ref|XP_010044279.1|  PREDICTED: probable carboxylesterase 6             186   2e-50    
ref|XP_008379534.1|  PREDICTED: probable carboxylesterase 17            185   3e-50    
gb|KHN17325.1|  Putative carboxylesterase 17                            183   3e-50    
ref|XP_006437705.1|  hypothetical protein CICLE_v10031957mg             185   3e-50    
gb|EYU36292.1|  hypothetical protein MIMGU_mgv1a009954mg                184   3e-50    
ref|XP_010048207.1|  PREDICTED: probable carboxylesterase 17            183   5e-50    
ref|XP_009352462.1|  PREDICTED: probable carboxylesterase 17            184   6e-50    
gb|KHN37728.1|  Putative carboxylesterase 17                            182   6e-50    
ref|XP_007217618.1|  hypothetical protein PRUPE_ppa016280mg             184   7e-50    
ref|XP_006826793.1|  hypothetical protein AMTR_s00010p00019880          184   7e-50    
gb|ABK26549.1|  unknown                                                 184   8e-50    
ref|XP_002285085.1|  PREDICTED: probable carboxylesterase 17            182   9e-50    
gb|ABK24130.1|  unknown                                                 183   9e-50    
gb|KHN05581.1|  Putative carboxylesterase 17                            183   1e-49    
ref|XP_010670562.1|  PREDICTED: probable carboxylesterase 17            183   1e-49    
ref|XP_002285088.1|  PREDICTED: probable carboxylesterase 17 isof...    182   1e-49    
ref|XP_002968492.1|  hypothetical protein SELMODRAFT_14730              181   2e-49    
ref|XP_009622412.1|  PREDICTED: probable carboxylesterase 17            182   2e-49    
gb|KHN24944.1|  Putative carboxylesterase 17                            181   2e-49    
ref|XP_008446570.1|  PREDICTED: probable carboxylesterase 6             182   3e-49    
ref|XP_010263304.1|  PREDICTED: probable carboxylesterase 17            182   3e-49    
ref|XP_009766513.1|  PREDICTED: probable carboxylesterase 6             182   3e-49    
gb|EAZ38782.1|  hypothetical protein OsJ_23185                          182   4e-49    
ref|XP_002311450.1|  hypothetical protein POPTR_0008s11720g             182   4e-49    
ref|XP_010032629.1|  PREDICTED: probable carboxylesterase 17            181   5e-49    
ref|XP_009347690.1|  PREDICTED: probable carboxylesterase 17            182   5e-49    
ref|XP_002975653.1|  hypothetical protein SELMODRAFT_103821             180   5e-49    
ref|XP_010265194.1|  PREDICTED: probable carboxylesterase 6             181   6e-49    
ref|XP_006373441.1|  hypothetical protein POPTR_0017s13800g             181   6e-49    
ref|XP_010681590.1|  PREDICTED: probable carboxylesterase 6             181   6e-49    
ref|XP_002324857.1|  hypothetical protein POPTR_0018s01650g             180   7e-49    
ref|XP_002268654.1|  PREDICTED: probable carboxylesterase 18            181   7e-49    
ref|XP_008352926.1|  PREDICTED: probable carboxylesterase 6             182   7e-49    
ref|XP_010907932.1|  PREDICTED: probable carboxylesterase 15            181   7e-49    
emb|CDP13505.1|  unnamed protein product                                180   8e-49    
emb|CAN75310.1|  hypothetical protein VITISV_033324                     180   8e-49    
gb|KFK41285.1|  hypothetical protein AALP_AA2G110100                    181   8e-49    
ref|NP_001268122.1|  serine hydrolase-like                              180   8e-49    
ref|XP_004291126.1|  PREDICTED: probable carboxylesterase 2-like        180   9e-49    
ref|XP_010906407.1|  PREDICTED: probable carboxylesterase 17            181   1e-48    
ref|XP_001781188.1|  GLP6 GID1-like protein                             179   1e-48    
dbj|BAJ87262.1|  predicted protein                                      180   2e-48    
ref|XP_010415489.1|  PREDICTED: probable carboxylesterase 6             180   2e-48    
gb|ADE75646.1|  unknown                                                 180   2e-48    
ref|XP_004497111.1|  PREDICTED: probable carboxylesterase 17-like       180   3e-48    
tpe|CAP64323.1|  TPA: putative GID1-like gibberellin receptor           180   3e-48    
gb|EAY98033.1|  hypothetical protein OsI_19949                          180   3e-48    
ref|XP_004233713.1|  PREDICTED: probable carboxylesterase 17            179   3e-48    
ref|XP_010470815.1|  PREDICTED: probable carboxylesterase 6             179   3e-48    
ref|XP_011077141.1|  PREDICTED: probable carboxylesterase 6             179   3e-48    
ref|XP_011021229.1|  PREDICTED: probable carboxylesterase 17            179   3e-48    
ref|XP_002978838.1|  hypothetical protein SELMODRAFT_418575             179   3e-48    
ref|XP_002974251.1|  hypothetical protein SELMODRAFT_101241             179   4e-48    
ref|XP_002978836.1|  hypothetical protein SELMODRAFT_109557             177   5e-48    
ref|XP_007224811.1|  hypothetical protein PRUPE_ppa023588mg             179   5e-48    
gb|EYU40873.1|  hypothetical protein MIMGU_mgv1a018147mg                179   7e-48    
ref|XP_002968441.1|  hypothetical protein SELMODRAFT_89683              177   7e-48    
ref|XP_010492485.1|  PREDICTED: LOW QUALITY PROTEIN: probable car...    178   7e-48    
emb|CBI21033.3|  unnamed protein product                                187   7e-48    
ref|NP_001055531.1|  Os05g0410200                                       179   7e-48    
ref|XP_008243198.1|  PREDICTED: probable carboxylesterase 6             180   8e-48    
ref|XP_010420290.1|  PREDICTED: probable carboxylesterase 17            178   8e-48    
gb|AHW42472.1|  GID1                                                    179   8e-48    
ref|XP_006290116.1|  hypothetical protein CARUB_v10003763mg             178   9e-48    
ref|XP_007142891.1|  hypothetical protein PHAVU_007G025700g             178   1e-47    
ref|XP_009105029.1|  PREDICTED: probable carboxylesterase 6             177   1e-47    
ref|XP_002992802.1|  hypothetical protein SELMODRAFT_136035             177   1e-47    
ref|XP_004297130.1|  PREDICTED: probable carboxylesterase 6-like        178   1e-47    
ref|XP_006379210.1|  hypothetical protein POPTR_0009s10780g             178   1e-47    
gb|KHN11435.1|  Putative carboxylesterase 17                            177   1e-47    
ref|XP_002987495.1|  hypothetical protein SELMODRAFT_126328             176   1e-47    
ref|XP_002975655.1|  hypothetical protein SELMODRAFT_271143             178   2e-47    
ref|XP_003555229.2|  PREDICTED: probable carboxylesterase 17-like       177   2e-47    
ref|XP_010272622.1|  PREDICTED: carboxylesterase 1                      177   2e-47    
ref|XP_011026452.1|  PREDICTED: probable carboxylesterase 6             176   2e-47    
ref|XP_002970604.1|  hypothetical protein SELMODRAFT_93760              176   2e-47    
ref|XP_010274017.1|  PREDICTED: carboxylesterase 1-like                 177   2e-47    
ref|XP_007223144.1|  hypothetical protein PRUPE_ppa009018mg             176   2e-47    
ref|XP_009401278.1|  PREDICTED: probable carboxylesterase 2             177   2e-47    
ref|XP_002284585.2|  PREDICTED: probable carboxylesterase 2             177   2e-47    
ref|XP_010453762.1|  PREDICTED: probable carboxylesterase 17            177   3e-47    
ref|XP_008443740.1|  PREDICTED: probable carboxylesterase 18            177   3e-47    
gb|KDO65317.1|  hypothetical protein CISIN_1g019164mg                   177   3e-47    
ref|XP_001767205.1|  GLP3 GID1-like protein                             176   3e-47    
ref|XP_009402465.1|  PREDICTED: gibberellin receptor GID1C-like         177   3e-47    
ref|XP_009412186.1|  PREDICTED: gibberellin receptor GID1C-like         176   4e-47    
ref|XP_004958497.1|  PREDICTED: probable carboxylesterase 18-like       176   4e-47    
ref|XP_011070822.1|  PREDICTED: probable carboxylesterase 6             176   4e-47    
ref|XP_011000106.1|  PREDICTED: probable carboxylesterase 7             177   4e-47    
ref|XP_009402467.1|  PREDICTED: gibberellin receptor GID1C-like         176   4e-47    
ref|XP_009404702.1|  PREDICTED: gibberellin receptor GID1C-like         176   5e-47    
gb|AFK46820.1|  unknown                                                 176   5e-47    
ref|XP_006374970.1|  hypothetical protein POPTR_0014s03230g             175   6e-47    
gb|KHN33922.1|  Putative carboxylesterase 17                            175   6e-47    
ref|XP_002968491.1|  hypothetical protein SELMODRAFT_89834              174   6e-47    
ref|XP_002305152.2|  hypothetical protein POPTR_0004s10090g             175   7e-47    
gb|ABK24842.1|  unknown                                                 174   8e-47    
ref|XP_002975995.1|  hypothetical protein SELMODRAFT_104161             174   8e-47    
ref|XP_006837038.1|  hypothetical protein AMTR_s00110p00041000          176   9e-47    
ref|XP_008459713.1|  PREDICTED: probable carboxylesterase 18            174   2e-46    
ref|XP_006400140.1|  hypothetical protein EUTSA_v10013981mg             175   2e-46    
ref|XP_004489120.1|  PREDICTED: probable carboxylesterase 17-like       175   2e-46    
ref|XP_010649883.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    174   2e-46    
ref|XP_010059960.1|  PREDICTED: probable carboxylesterase 2             174   2e-46    
gb|ABQ53633.1|  esterase                                                174   2e-46    
ref|XP_010024489.1|  PREDICTED: probable carboxylesterase 15            171   3e-46    
ref|XP_002873755.1|  hypothetical protein ARALYDRAFT_488458             174   3e-46    
ref|XP_004141618.1|  PREDICTED: probable carboxylesterase 18-like       174   3e-46    
emb|CDP01339.1|  unnamed protein product                                173   3e-46    
tpg|DAA53407.1|  TPA: hypothetical protein ZEAMMB73_165603              173   3e-46    
ref|XP_011030283.1|  PREDICTED: probable carboxylesterase 2             173   4e-46    
ref|XP_008805888.1|  PREDICTED: tuliposide A-converting enzyme 2,...    173   4e-46    
ref|XP_009105413.1|  PREDICTED: probable carboxylesterase 6             173   4e-46    
ref|XP_007136667.1|  hypothetical protein PHAVU_009G063600g             173   5e-46    
ref|XP_004170122.1|  PREDICTED: probable carboxylesterase 18-like       173   5e-46    
ref|XP_010059963.1|  PREDICTED: probable carboxylesterase 2             173   5e-46    
ref|XP_006421800.1|  hypothetical protein CICLE_v10007129mg             172   7e-46    
gb|KFK25845.1|  hypothetical protein AALP_AA8G169600                    173   7e-46    
gb|KGN65585.1|  hypothetical protein Csa_1G466560                       173   8e-46    
gb|KDP31595.1|  hypothetical protein JCGZ_14820                         172   8e-46    
gb|KDP29384.1|  hypothetical protein JCGZ_18305                         173   8e-46    
ref|XP_002887194.1|  hypothetical protein ARALYDRAFT_475988             172   9e-46    
ref|NP_197112.1|  carboxyesterase 17                                    172   1e-45    
ref|XP_009349526.1|  PREDICTED: probable carboxylesterase 2             172   1e-45    
ref|XP_002985621.1|  hypothetical protein SELMODRAFT_122894             172   1e-45    
ref|XP_011076496.1|  PREDICTED: carboxylesterase 1-like                 172   1e-45    
ref|XP_006483354.1|  PREDICTED: probable carboxylesterase 17-like       171   1e-45    
ref|XP_008808584.1|  PREDICTED: probable carboxylesterase 15            172   1e-45    
gb|KDP31597.1|  hypothetical protein JCGZ_14822                         172   2e-45    
gb|ABB89002.1|  CXE carboxylesterase                                    171   2e-45    
ref|XP_009400390.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    171   2e-45    
ref|XP_002964555.1|  hypothetical protein SELMODRAFT_166817             171   2e-45    
ref|XP_010092072.1|  putative carboxylesterase 2                        171   2e-45    
ref|XP_003637423.1|  Arylacetamide deacetylase                          172   2e-45    
ref|XP_004147396.1|  PREDICTED: probable carboxylesterase 18-like       171   3e-45    
ref|XP_007222829.1|  hypothetical protein PRUPE_ppa008795mg             171   3e-45    
emb|CDY16790.1|  BnaA09g05920D                                          171   3e-45    



>ref|XP_011094531.1| PREDICTED: probable carboxylesterase 15 [Sesamum indicum]
Length=325

 Score =   483 bits (1243),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 229/323 (71%), Positives = 267/323 (83%), Gaps = 10/323 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPHVVEDC GI+QVYSDGSI RS  EDINFP  V DD S  WKD LFD+ H L+LR+
Sbjct  1    MGSLPHVVEDCLGIVQVYSDGSILRS--EDINFPMEVQDDGSAVWKDCLFDKKHNLHLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKPRS ++A   LPI++FFHGGGFCVGSRTWPNCHSCCLRL + LQ LVVAPDYRLAPEH
Sbjct  59   YKPRSPSAA--KLPILYFFHGGGFCVGSRTWPNCHSCCLRLASALQVLVVAPDYRLAPEH  116

Query  380  RLPAAMDDAFCAVKWVAAQA------STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRL  541
            RLPAA+DDA  AVKW+  QA        D WL DGVDF+R F+LGDSSGGN+AHHLAV L
Sbjct  117  RLPAALDDALTAVKWLQNQALISKSGGGDEWLGDGVDFDRVFILGDSSGGNLAHHLAVEL  176

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
              GSP+++PVRVRGYV+MAPFFGGTVRTKSEAEGPPE FLNLEILDRFWRLS+P G + D
Sbjct  177  RRGSPDLAPVRVRGYVLMAPFFGGTVRTKSEAEGPPEQFLNLEILDRFWRLSVPIGNSAD  236

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HPLANPFGP+SPSLE+++L PILV+VGG EV+KDR+E+Y+ +LK+  K+++YVVFQ  QH
Sbjct  237  HPLANPFGPSSPSLESIELGPILVLVGGNEVMKDRIEDYSKRLKEMGKDMEYVVFQHHQH  296

Query  902  GFFTNDPFSDVSTQVLQQLQHFM  970
            GFF N PFS V+  VLQ++  F+
Sbjct  297  GFFVNQPFSQVANYVLQKINQFI  319



>ref|XP_009767876.1| PREDICTED: probable carboxylesterase 15 [Nicotiana sylvestris]
Length=327

 Score =   478 bits (1230),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 223/320 (70%), Positives = 269/320 (84%), Gaps = 8/320 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGS PHV+EDC GILQ+YSDGSIFRS D+ I+F F V DD SV WKD L+D  + LYLR+
Sbjct  1    MGSFPHVIEDCLGILQLYSDGSIFRSSDDQIDFKFTVQDDGSVVWKDCLYDEKNNLYLRL  60

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP+     A  L I++FFHGGGFCVGSRTWPNCH+CCLRL + LQALV+APDYRLAPE 
Sbjct  61   YKPK----LANKLKIVYFFHGGGFCVGSRTWPNCHNCCLRLSSDLQALVIAPDYRLAPEF  116

Query  380  RLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            RLPAAMDDAF ++KW+  QA   + D+W+KD +  ++ FV+GDSSGGN+AHHL++RL VG
Sbjct  117  RLPAAMDDAFTSMKWLQNQALSKTPDSWMKD-IMIDQVFVIGDSSGGNMAHHLSLRLWVG  175

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPL  730
            SPE++PVRVRGYV+MAPFFGG++RTKSEAEGP EPFLN+EILDRFWRLSLP G T DHPL
Sbjct  176  SPELAPVRVRGYVLMAPFFGGSLRTKSEAEGPAEPFLNVEILDRFWRLSLPIGATADHPL  235

Query  731  ANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
            ANPFGP SP+LE++KLDP+LV+VGG E+LKDRVE+YA KLK+  KEVDY  F G QHGFF
Sbjct  236  ANPFGPLSPNLESMKLDPLLVIVGGNELLKDRVEDYASKLKELKKEVDYFEFDGMQHGFF  295

Query  911  TNDPFSDVSTQVLQQLQHFM  970
            TNDPFS V+ QVLQ++++F+
Sbjct  296  TNDPFSQVANQVLQEIKYFI  315



>ref|XP_009590987.1| PREDICTED: probable carboxylesterase 15 [Nicotiana tomentosiformis]
Length=327

 Score =   477 bits (1228),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 225/320 (70%), Positives = 266/320 (83%), Gaps = 8/320 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPHVVEDC GILQ+YSDGSIFRS DE I+F   V DD SV WKD L+D  + LYLR+
Sbjct  1    MGSLPHVVEDCLGILQLYSDGSIFRSSDEQIDFKITVQDDGSVVWKDCLYDEKNNLYLRL  60

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP+     A  L I++FFHGGGFCVGSRTWPNCH+CCLRL + LQALV+APDYRLAPE 
Sbjct  61   YKPK----LANKLKIVYFFHGGGFCVGSRTWPNCHNCCLRLSSDLQALVIAPDYRLAPEF  116

Query  380  RLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            RLPAAMDDAF +++W+  Q    + D W+ + V  +R FV+GDSSGGN+AHHLA+RLGVG
Sbjct  117  RLPAAMDDAFTSMQWLQNQVLSKTPDCWMNE-VIVDRIFVIGDSSGGNMAHHLALRLGVG  175

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPL  730
            SPE++PVRVRGYV+MAPFFGG++RTKSEAEGP EPFLN+EILDRFWRLSLP G T DHPL
Sbjct  176  SPELAPVRVRGYVLMAPFFGGSLRTKSEAEGPAEPFLNVEILDRFWRLSLPIGATADHPL  235

Query  731  ANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
            ANPFGP SPSLE +KLDP+LV+VGG E+LKDRVE+YA KLK+  KEVDY  F+G QHGFF
Sbjct  236  ANPFGPLSPSLELMKLDPLLVIVGGNELLKDRVEDYARKLKELKKEVDYFEFEGMQHGFF  295

Query  911  TNDPFSDVSTQVLQQLQHFM  970
            TNDPFS V+ Q LQ++++F+
Sbjct  296  TNDPFSQVANQALQEIKYFI  315



>ref|XP_006362298.1| PREDICTED: probable carboxylesterase 15-like [Solanum tuberosum]
Length=337

 Score =   458 bits (1178),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 219/334 (66%), Positives = 265/334 (79%), Gaps = 19/334 (6%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINF-PFPVHDDASVHWKDSLF-----DRTH  181
            MGSLPHVVEDC GILQVYSDGSIFR  D+ INF    V DD SV WKD ++     D   
Sbjct  1    MGSLPHVVEDCLGILQVYSDGSIFRLSDDQINFHNITVKDDGSVVWKDIIYNDRNKDGKE  60

Query  182  GLYLRIYKPRSSA--SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAP  355
             LYLR+YKP ++   +    LPII+FFHGGGFCVGSRTWPNCH+CCLRL + L+AL++AP
Sbjct  61   NLYLRLYKPITTKCITNKQQLPIIYFFHGGGFCVGSRTWPNCHNCCLRLSSELEALIIAP  120

Query  356  DYRLAPEHRLPAAMDDAFCAVKWVAAQAST---------DAWLKDGVDFNRAFVLGDSSG  508
            DYRLAPE+RLPAAMDDAF ++KW+  QA +         D+W+    D++R +V+GDSSG
Sbjct  121  DYRLAPEYRLPAAMDDAFASIKWLQHQALSNKITYDADDDSWINH--DYDRVYVIGDSSG  178

Query  509  GNVAHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFW  688
            GN+AHHLA+R GVGSPE++PVRVRGYV+MAPFFGG+VRTKSE EGP EPFLN++ILDRFW
Sbjct  179  GNIAHHLALRFGVGSPELAPVRVRGYVLMAPFFGGSVRTKSEEEGPDEPFLNMQILDRFW  238

Query  689  RLSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKE  868
            RLSLP G T DHPLANPFGP SP LE+ KLDP+LV+VGG E+LKDRVE+YA K+K+ NK+
Sbjct  239  RLSLPIGATADHPLANPFGPLSPKLESKKLDPLLVIVGGNELLKDRVEDYANKMKELNKD  298

Query  869  VDYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            V Y  F+  QHGFFTNDPFS V+  VLQ++++FM
Sbjct  299  VHYFEFEEMQHGFFTNDPFSQVANMVLQEIKYFM  332



>ref|XP_002268704.1| PREDICTED: probable carboxylesterase 15 [Vitis vinifera]
Length=320

 Score =   454 bits (1168),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 215/321 (67%), Positives = 260/321 (81%), Gaps = 7/321 (2%)
 Frame = +2

Query  17   EMGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLR  196
            EMGS+P+VVED  G+LQVYSDGS  RS    + F  PVHDD SV WKD  FD+ H L+LR
Sbjct  3    EMGSIPYVVEDFQGVLQVYSDGSTLRSAT--LPFNIPVHDDGSVIWKDCAFDKHHNLHLR  60

Query  197  IYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            +Y+P  S  A   LPI+++ HGGGFCVGSRTWPNCH+CCLRL +GL ALVVAPD+RLAPE
Sbjct  61   LYRPAVS-DATAKLPILYYLHGGGFCVGSRTWPNCHNCCLRLASGLHALVVAPDFRLAPE  119

Query  377  HRLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            HRLPAAMDDA+ ++KW+  QA   + +AWL +GVD  R FV+GDSSGGN+AHHLAV+LG 
Sbjct  120  HRLPAAMDDAWTSLKWLQTQALSKNCEAWLSEGVDLERVFVVGDSSGGNMAHHLAVQLGA  179

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            GSPE+ PVRVRGYV+MAPFFGG+VRT+SE EGP E  LNL ILDRFWRLS+P GGT DHP
Sbjct  180  GSPELEPVRVRGYVLMAPFFGGSVRTRSE-EGPSEAMLNLAILDRFWRLSIPEGGTKDHP  238

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            LANPFGPASP LE +KLDPILV+VGG E+LKDR E+YA +LK+  K+++YV F+GK+HGF
Sbjct  239  LANPFGPASPDLEPLKLDPILVVVGGNELLKDRAEDYAKRLKEMKKDIEYVEFEGKEHGF  298

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
            FTNDP+S+    VLQ ++ F+
Sbjct  299  FTNDPYSEAGNAVLQLIKRFI  319



>emb|CBI39095.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   452 bits (1163),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 214/320 (67%), Positives = 259/320 (81%), Gaps = 7/320 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGS+P+VVED  G+LQVYSDGS  RS    + F  PVHDD SV WKD  FD+ H L+LR+
Sbjct  1    MGSIPYVVEDFQGVLQVYSDGSTLRSAT--LPFNIPVHDDGSVIWKDCAFDKHHNLHLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            Y+P  S  A   LPI+++ HGGGFCVGSRTWPNCH+CCLRL +GL ALVVAPD+RLAPEH
Sbjct  59   YRPAVS-DATAKLPILYYLHGGGFCVGSRTWPNCHNCCLRLASGLHALVVAPDFRLAPEH  117

Query  380  RLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            RLPAAMDDA+ ++KW+  QA   + +AWL +GVD  R FV+GDSSGGN+AHHLAV+LG G
Sbjct  118  RLPAAMDDAWTSLKWLQTQALSKNCEAWLSEGVDLERVFVVGDSSGGNMAHHLAVQLGAG  177

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPL  730
            SPE+ PVRVRGYV+MAPFFGG+VRT+SE EGP E  LNL ILDRFWRLS+P GGT DHPL
Sbjct  178  SPELEPVRVRGYVLMAPFFGGSVRTRSE-EGPSEAMLNLAILDRFWRLSIPEGGTKDHPL  236

Query  731  ANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
            ANPFGPASP LE +KLDPILV+VGG E+LKDR E+YA +LK+  K+++YV F+GK+HGFF
Sbjct  237  ANPFGPASPDLEPLKLDPILVVVGGNELLKDRAEDYAKRLKEMKKDIEYVEFEGKEHGFF  296

Query  911  TNDPFSDVSTQVLQQLQHFM  970
            TNDP+S+    VLQ ++ F+
Sbjct  297  TNDPYSEAGNAVLQLIKRFI  316



>ref|XP_004250778.1| PREDICTED: probable carboxylesterase 15 [Solanum lycopersicum]
Length=330

 Score =   451 bits (1160),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 217/329 (66%), Positives = 262/329 (80%), Gaps = 16/329 (5%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINF-PFPVHDDASVHWKDSLF-----DRTH  181
            MGS+PHVVEDC GILQVYSDGSIFR  D+ I+F  FP+ DD SV WKD ++     D   
Sbjct  1    MGSIPHVVEDCLGILQVYSDGSIFRLSDDQIDFHNFPIKDDGSVIWKDIIYNNQNKDGKD  60

Query  182  GLYLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDY  361
             LYLR+YKP+  A     LPII+FFHGGGFCVGSR WPNCHSCC+RL + L+ALV+APDY
Sbjct  61   SLYLRLYKPKCMAKK--QLPIIYFFHGGGFCVGSRVWPNCHSCCIRLSSELEALVIAPDY  118

Query  362  RLAPEHRLPAAMDDAFCAVKWVAAQAST------DAWLKDGVDFNRAFVLGDSSGGNVAH  523
             LAPE+RLPAAMDDAF ++KW+   A +      D+W+    D++R +V+GDSSGGN+AH
Sbjct  119  SLAPEYRLPAAMDDAFTSIKWLQDLALSNKITYDDSWINH--DYDRVYVIGDSSGGNIAH  176

Query  524  HLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLP  703
            HLA+RLGVGSPE+SPVRVRGYV+MAPFFGG+VRTKSE EGP EPFLN++ILDRFWRLSLP
Sbjct  177  HLALRLGVGSPELSPVRVRGYVLMAPFFGGSVRTKSEEEGPDEPFLNMQILDRFWRLSLP  236

Query  704  FGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVV  883
             G TPDHPLANPFGP SP L+  K+DP+LV+VGG E+LKDRVE YA K+K+ N++V Y  
Sbjct  237  IGATPDHPLANPFGPLSPKLQPKKIDPLLVIVGGNELLKDRVEYYASKMKELNEDVHYFE  296

Query  884  FQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            F+  QHGFFTNDPFS V+  VLQ+++ FM
Sbjct  297  FEEMQHGFFTNDPFSQVADLVLQEIKCFM  325



>emb|CBI39081.3| unnamed protein product [Vitis vinifera]
Length=330

 Score =   446 bits (1147),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 213/326 (65%), Positives = 258/326 (79%), Gaps = 7/326 (2%)
 Frame = +2

Query  14   REMGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYL  193
            R+MGS+PH+VED  G+L+VYSDGS  RS    +     VHDD SV WKD  F + H L L
Sbjct  4    RKMGSIPHIVEDFQGVLRVYSDGSTLRSAT--LPLDIQVHDDGSVIWKDCCFHKGHNLQL  61

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            R+YKP + ++A   LPI+++ HGGGFCVGSRTWPNCH+CCLRL +GL ALVVAPDYRLAP
Sbjct  62   RLYKPAAESNATSKLPILYYLHGGGFCVGSRTWPNCHNCCLRLASGLCALVVAPDYRLAP  121

Query  374  EHRLPAAMDDAFCAVKWVAAQA---STDAWLKDG-VDFNRAFVLGDSSGGNVAHHLAVRL  541
            EHRLPAAM+DA  ++KW+ AQA   + DAWL D  VD +R FV+GDSSGGN+AHHLAV L
Sbjct  122  EHRLPAAMEDALTSLKWLQAQALSENCDAWLSDQRVDLSRVFVVGDSSGGNMAHHLAVEL  181

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
            G GSP + PV+VRGYV+MAPFFGGTVRT+SE EGP E  LNLE+LDRFWRLSLP G T D
Sbjct  182  GAGSPGLDPVQVRGYVLMAPFFGGTVRTRSE-EGPSEAMLNLELLDRFWRLSLPVGDTAD  240

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HPLANPFGPASP LE ++LDP+LV+VGG E+LKDR ++YA KLK   K+++YV F+GK+H
Sbjct  241  HPLANPFGPASPLLEPLELDPVLVLVGGSELLKDRAKDYAKKLKDMGKKIEYVEFEGKEH  300

Query  902  GFFTNDPFSDVSTQVLQQLQHFMISK  979
            GFFTNDP+S+V   VLQ +Q F+  K
Sbjct  301  GFFTNDPYSEVGNSVLQVIQGFISQK  326



>ref|XP_002266241.1| PREDICTED: probable carboxylesterase 15 [Vitis vinifera]
 emb|CAN65352.1| hypothetical protein VITISV_004582 [Vitis vinifera]
Length=325

 Score =   443 bits (1140),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 212/324 (65%), Positives = 256/324 (79%), Gaps = 7/324 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGS+PH+VED  G+L+VYSDGS  RS    +     VHDD SV WKD  F + H L LR+
Sbjct  1    MGSIPHIVEDFQGVLRVYSDGSTLRSAT--LPLDIQVHDDGSVIWKDCCFHKGHNLQLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP + ++A   LPI+++ HGGGFCVGSRTWPNCH+CCLRL +GL ALVVAPDYRLAPEH
Sbjct  59   YKPAAESNATSKLPILYYLHGGGFCVGSRTWPNCHNCCLRLASGLCALVVAPDYRLAPEH  118

Query  380  RLPAAMDDAFCAVKWVAAQA---STDAWLKDG-VDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            RLPAAM+DA  ++KW+ AQA   + DAWL D  VD +R FV+GDSSGGN+AHHLAV LG 
Sbjct  119  RLPAAMEDALTSLKWLQAQALSENCDAWLSDQRVDLSRVFVVGDSSGGNMAHHLAVELGA  178

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            GSP + PV+VRGYV+MAPFFGGTVRT+SE EGP E  LNLE+LDRFWRLSLP G T DHP
Sbjct  179  GSPGLDPVQVRGYVLMAPFFGGTVRTRSE-EGPSEAMLNLELLDRFWRLSLPVGDTADHP  237

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            LANPFGPASP LE ++LDP+LV+VGG E+LKDR ++YA KLK   K+++YV F+GK+HGF
Sbjct  238  LANPFGPASPLLEPLELDPVLVLVGGSELLKDRAKDYAKKLKDMGKKIEYVEFEGKEHGF  297

Query  908  FTNDPFSDVSTQVLQQLQHFMISK  979
            FTNDP+S+V   VLQ +Q F+  K
Sbjct  298  FTNDPYSEVGNSVLQVIQGFISQK  321



>ref|XP_004303415.1| PREDICTED: probable carboxylesterase 15-like [Fragaria vesca 
subsp. vesca]
Length=332

 Score =   440 bits (1131),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 211/331 (64%), Positives = 262/331 (79%), Gaps = 12/331 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VEDC G+LQ++SDGS+ R   +DINFPFPV  D SV +KD +FD+   + LR+
Sbjct  1    MGSLPHIVEDCMGVLQLFSDGSVHRCSMKDINFPFPVVHDDSVDFKDVVFDKKLNISLRL  60

Query  200  YKPRSSASAAVS--LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            Y+P+S ASA  +  LP++F+FHGGGFCVGSR WPNCH+CC+RL +GL ALVVAPDYRLAP
Sbjct  61   YRPKSHASATPTNLLPVVFYFHGGGFCVGSRVWPNCHNCCIRLASGLDALVVAPDYRLAP  120

Query  374  EHRLPAAMDDAFCAVKWVAAQA--------STDAWLKDG-VDFNRAFVLGDSSGGNVAHH  526
            EH+LPAA+DDA  AV+W+  +A          DAWL  G VDF+R +V+GDSSGGN+AHH
Sbjct  121  EHKLPAALDDAVSAVEWLQREALMSAGSSGDCDAWLGGGLVDFDRVYVVGDSSGGNMAHH  180

Query  527  LAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPF  706
            +AVRLG GS + +PVRVRGYV++APFFGG  RTKSE EGPPE FLNLEILDRFWRLS+P 
Sbjct  181  VAVRLGSGSVKAAPVRVRGYVLLAPFFGGEERTKSE-EGPPETFLNLEILDRFWRLSMPK  239

Query  707  GGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVF  886
            G + DHP+ NPFGP S SL+ V LDPILVMVGG E+LKDRVE Y+ +LK+  KE++YV F
Sbjct  240  GESRDHPMVNPFGPISLSLKEVDLDPILVMVGGNEMLKDRVEIYSRRLKELGKEIEYVEF  299

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFMISK  979
             G+QHGF TNDP+S+V+ + LQ ++ FMI  
Sbjct  300  DGQQHGFLTNDPYSEVANEALQVIKRFMIEN  330



>ref|XP_002309272.2| hypothetical protein POPTR_0006s21320g [Populus trichocarpa]
 gb|EEE92795.2| hypothetical protein POPTR_0006s21320g [Populus trichocarpa]
Length=325

 Score =   437 bits (1123),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 205/326 (63%), Positives = 262/326 (80%), Gaps = 9/326 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPHVVEDC G++Q++SDG+I+RSKD  I FP P+ +D SV +KD LFD+T+ L+LR+
Sbjct  1    MGSLPHVVEDCGGVVQLFSDGTIYRSKD--IGFPMPIINDESVLFKDCLFDKTYNLHLRL  58

Query  200  YKPRSSA--SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            YKP S +  S    L II + HGGGFCVG+R WPNCH+CCL+L +GL ALVVAPDYRLAP
Sbjct  59   YKPTSISLSSPTKKLSIILYLHGGGFCVGTREWPNCHNCCLKLASGLNALVVAPDYRLAP  118

Query  374  EHRLPAAMDDAFCAVKWVAAQASTD---AWLKDG-VDFNRAFVLGDSSGGNVAHHLAVRL  541
            EHRLPAAM+D   A++W+ AQ  +D   AW+  G VD+++ FVLGDSSGGN+AHHLAV++
Sbjct  119  EHRLPAAMEDGLSALQWLQAQVLSDKGDAWVNGGKVDYDQVFVLGDSSGGNIAHHLAVQI  178

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
            GVGS  ++PVRVRGY+++APFFGG  RTKSE EGP E  LNLEILDRFWRLS+P G + D
Sbjct  179  GVGSTRLAPVRVRGYILLAPFFGGVARTKSE-EGPSEQLLNLEILDRFWRLSMPAGASRD  237

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HPLANPFGP S +LE V LDPI+V+VGG E+L+DR E+YA +LK+  K+++YV F+GKQH
Sbjct  238  HPLANPFGPGSLNLELVALDPIMVIVGGCELLRDRGEDYARRLKEMGKKIEYVEFEGKQH  297

Query  902  GFFTNDPFSDVSTQVLQQLQHFMISK  979
            GFFTNDP+S+ S +V+Q ++ F+I  
Sbjct  298  GFFTNDPYSEASEEVIQVMKKFVIEN  323



>ref|XP_008350223.1| PREDICTED: probable carboxylesterase 15 [Malus domestica]
Length=326

 Score =   436 bits (1122),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 207/323 (64%), Positives = 254/323 (79%), Gaps = 8/323 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VEDC G+LQV+SDGSI R    DINF  PV DD SV +KD  FD+ H L LR+
Sbjct  1    MGSLPHIVEDCMGVLQVFSDGSINRCSLTDINFNIPVIDDGSVGFKDITFDKKHKLSLRL  60

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP+S+   +  LP++F+FHGGGFCVGS  WPNCH+CC+RL +GLQALVV+PDYRLAPEH
Sbjct  61   YKPKSTNQDS-KLPVVFYFHGGGFCVGSHVWPNCHNCCIRLSSGLQALVVSPDYRLAPEH  119

Query  380  RLPAAMDDAFCAVKWVAAQAS------TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRL  541
            +LPAA+DDA  AVKW+  +AS       DAW+    DF+R F+LGDSSGGN+AHHLAVRL
Sbjct  120  KLPAAIDDAVSAVKWLQREASGESTNNCDAWIGGTADFDRVFILGDSSGGNMAHHLAVRL  179

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
              GS + +P+RVRG+V++APFFGG  RTKSE EGP E  L+LEILDRFWRLS+P G T D
Sbjct  180  ATGSIKPAPIRVRGFVLLAPFFGGAERTKSE-EGPCEALLSLEILDRFWRLSMPVGETRD  238

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HP+ NPFGP SP+LE V LDPILV+VGG E+LKDRVE+Y  KLK   K+++YV F+G+QH
Sbjct  239  HPMVNPFGPNSPNLEKVALDPILVIVGGNELLKDRVESYWRKLKDLGKKIEYVEFEGEQH  298

Query  902  GFFTNDPFSDVSTQVLQQLQHFM  970
            GF TNDP+S+VS + LQ ++ FM
Sbjct  299  GFLTNDPYSEVSNEALQVIKRFM  321



>ref|XP_002524110.1| Gibberellin receptor GID1, putative [Ricinus communis]
 gb|EEF38320.1| Gibberellin receptor GID1, putative [Ricinus communis]
Length=325

 Score =   435 bits (1119),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 204/325 (63%), Positives = 255/325 (78%), Gaps = 7/325 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VEDC G+LQ++SDG+IFRSK   I+F  PV +D S+ +KD L+D+TH L+LR+
Sbjct  1    MGSLPHIVEDCMGVLQLFSDGTIFRSKY--IDFDIPVINDNSILFKDCLYDKTHNLHLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP    S+   LP++ F HGGGFCVGSR WPNCH+CCLRL +GL ALVVAPDYRLAPEH
Sbjct  59   YKPALPNSSNKKLPVVIFIHGGGFCVGSRVWPNCHNCCLRLASGLNALVVAPDYRLAPEH  118

Query  380  RLPAAMDDAFCAVKWVAAQAST---DAWLKDG-VDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            RLPAAMDD    +KW+ AQ S+   DAW     VDF++ FV+GDSSGGN+AHHLAVRLG 
Sbjct  119  RLPAAMDDGISVMKWIQAQVSSENGDAWFSSSKVDFDQVFVMGDSSGGNIAHHLAVRLGS  178

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            GS  + P+RVRGY+++APFFGG  RTKSE EGP E  L+L+ILDRFWRLS+P G   DHP
Sbjct  179  GSTGLKPIRVRGYILLAPFFGGIARTKSE-EGPSEQLLSLDILDRFWRLSMPVGEGRDHP  237

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            LANPFGP+S SLE V LDP+LVMVG  E+LKDRVE+YA +LK   K++DY+ F+GKQHGF
Sbjct  238  LANPFGPSSLSLETVALDPVLVMVGSSELLKDRVEDYARRLKHMGKKIDYLEFEGKQHGF  297

Query  908  FTNDPFSDVSTQVLQQLQHFMISKV  982
            FTN+P+S  + +V++ ++ FM   +
Sbjct  298  FTNNPYSQDADKVIEVIRKFMFDNL  322



>emb|CDP10554.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   433 bits (1114),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 205/325 (63%), Positives = 260/325 (80%), Gaps = 13/325 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VED  G++Q+YSDGS+FR  D D N P  +HDD+S+ W+D  FD  + LYLR+
Sbjct  1    MGSLPHIVEDLEGVVQLYSDGSVFRPNDVDFNIP--IHDDSSIVWRDCQFDNQNHLYLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP    +A+  LP+++FFHGGGFCVGSRTWPN H+ CLRL +GLQALVVAPDYRLAPEH
Sbjct  59   YKP---VNASTKLPVVYFFHGGGFCVGSRTWPNNHNACLRLASGLQALVVAPDYRLAPEH  115

Query  380  RLPAAMDDAFCAVKWVAAQASTD------AWLKD-GVDFNRAFVLGDSSGGNVAHHLAVR  538
            RLPAA+DDA  ++KW+ A+A+ D       WL D  VDF+R +++GDSSGGN+AHHLAV+
Sbjct  116  RLPAAVDDALTSLKWLQARATADGAPAQDTWLHDQAVDFDRVYIMGDSSGGNMAHHLAVQ  175

Query  539  LGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTP  718
            LG GSPE++PV +RGYV+MAPFFGGTVRTKSEAEG PEP LN+EILDRFWRLSLP G   
Sbjct  176  LGPGSPELAPVHIRGYVLMAPFFGGTVRTKSEAEGMPEPILNVEILDRFWRLSLPPGKNA  235

Query  719  DHPLANPFGPAS-PSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGK  895
            DHPLANPF P S  +LE+V  DP+LV+ G  E+L+DRVE+YA +LK+  K+V+YV F+GK
Sbjct  236  DHPLANPFSPFSKKNLESVMFDPVLVIAGEIELLRDRVEDYARRLKEAGKKVEYVEFEGK  295

Query  896  QHGFFTNDPFSDVSTQVLQQLQHFM  970
             HGFF NDP+S++  +VLQ+++ +M
Sbjct  296  YHGFFNNDPYSELGDRVLQEIKDWM  320



>ref|XP_011047121.1| PREDICTED: probable carboxylesterase 15 [Populus euphratica]
Length=392

 Score =   433 bits (1113),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 204/327 (62%), Positives = 262/327 (80%), Gaps = 9/327 (3%)
 Frame = +2

Query  17   EMGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLR  196
            +MGSLPHVVEDC G++Q++SDG+I+RSKD  I FP P+ +D SV +KD LFD+T+ L+LR
Sbjct  67   KMGSLPHVVEDCGGVVQLFSDGTIYRSKD--IGFPMPIINDESVLFKDCLFDKTYNLHLR  124

Query  197  IYKPRSSA--SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLA  370
            +YKP S +  S    L II + HGGGFCVG+R WPNCH+CCL+L +GL ALVVAPDYRLA
Sbjct  125  LYKPTSISLSSPTKKLSIILYLHGGGFCVGTREWPNCHNCCLKLASGLNALVVAPDYRLA  184

Query  371  PEHRLPAAMDDAFCAVKWVAAQASTD---AWLKDG-VDFNRAFVLGDSSGGNVAHHLAVR  538
            PEHRLPAAM+D   A++W+ AQ  +D   AW+  G VD+++ FVLGDSSGGN+AHHLAV+
Sbjct  185  PEHRLPAAMEDGLSALQWLQAQGLSDKGDAWVNGGKVDYDQVFVLGDSSGGNIAHHLAVQ  244

Query  539  LGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTP  718
            +GVGS  ++PVRVRGY+++APFFGG  RTKSE EGP E  LNLEILDRFWRLS+P G + 
Sbjct  245  IGVGSTWLAPVRVRGYILLAPFFGGVARTKSE-EGPSEQLLNLEILDRFWRLSMPAGASR  303

Query  719  DHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQ  898
            DHPLANPFGP S +LE V LDPI+V+VGG E+L+DR E YA +LK+  K+++YV F+GKQ
Sbjct  304  DHPLANPFGPDSLNLELVALDPIMVIVGGCELLRDRGEGYARRLKEMGKKIEYVEFEGKQ  363

Query  899  HGFFTNDPFSDVSTQVLQQLQHFMISK  979
            HGFFTNDP+S+ S +V+Q ++ F++  
Sbjct  364  HGFFTNDPYSEASEEVIQVMKKFVLEN  390



>ref|XP_011042528.1| PREDICTED: probable carboxylesterase 15 [Populus euphratica]
Length=325

 Score =   430 bits (1106),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 203/326 (62%), Positives = 260/326 (80%), Gaps = 9/326 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPHVVEDC G++Q++SDG+I+R+KD  I FP P+ +D S+ +KD LFD+T+ L+LR+
Sbjct  1    MGSLPHVVEDCGGVVQLFSDGTIYRTKD--IGFPIPIINDQSIVFKDCLFDKTNNLHLRL  58

Query  200  YKPRSS--ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            YKP S   +S A    +I F HGGGFCVG+R WPN H+CCL+L +GL ALVVAPDYRLAP
Sbjct  59   YKPTSMPPSSPAKKFSVILFLHGGGFCVGTREWPNFHNCCLKLASGLNALVVAPDYRLAP  118

Query  374  EHRLPAAMDDAFCAVKWVAAQASTD---AWLKDG-VDFNRAFVLGDSSGGNVAHHLAVRL  541
            EHRLPAAM+D F A++W+ AQ  +D   AW+  G VD+++ F+LGDSSGGN+AHHLAV++
Sbjct  119  EHRLPAAMEDGFSALQWLQAQGLSDKGDAWVNGGEVDYDKVFILGDSSGGNIAHHLAVQI  178

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
            G GS  ++PVRVRGY++MAPFFGG  RTKSE EGP E  LNLEILDRFWRLS+P G + D
Sbjct  179  GAGSTGLAPVRVRGYILMAPFFGGVARTKSE-EGPSELSLNLEILDRFWRLSMPAGASRD  237

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HPLANPFGP S ++E V LDPILV+VG  E+L+DR E+YA +LK+  K+++YV F+GKQH
Sbjct  238  HPLANPFGPGSLNIELVALDPILVIVGSCELLRDRGEDYARRLKEMGKKIEYVEFEGKQH  297

Query  902  GFFTNDPFSDVSTQVLQQLQHFMISK  979
            GFFTNDP+SD S +V+Q ++ FMI  
Sbjct  298  GFFTNDPYSDASEEVIQDMKRFMIEN  323



>ref|XP_002322758.1| hypothetical protein POPTR_0016s06500g [Populus trichocarpa]
 gb|EEF04519.1| hypothetical protein POPTR_0016s06500g [Populus trichocarpa]
Length=325

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 202/326 (62%), Positives = 260/326 (80%), Gaps = 9/326 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPHVVEDC G++Q++SDG+I+RSKD  I FP P+ +D S+ +KD LFD+T+ L+LR+
Sbjct  1    MGSLPHVVEDCGGVVQLFSDGTIYRSKD--IGFPIPIINDQSIVFKDCLFDKTNNLHLRL  58

Query  200  YKPRSSA--SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            YKP S +  S A    +I F HGGGFCVG+R WPN H+CCL+L +GL ALVVAPDYRLAP
Sbjct  59   YKPTSMSPSSPAKKFSVILFLHGGGFCVGTRDWPNFHNCCLKLASGLNALVVAPDYRLAP  118

Query  374  EHRLPAAMDDAFCAVKWVAAQASTD---AWLKDG-VDFNRAFVLGDSSGGNVAHHLAVRL  541
            EHRLPAAM+D + A++W+ AQ  +D   AW+  G VD+++ F+LGDSSGGN+AHHLAV++
Sbjct  119  EHRLPAAMEDGYSALQWLQAQVLSDKGDAWVNGGEVDYDQVFILGDSSGGNIAHHLAVQI  178

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
            G GS  ++PVRVRGY++MAPFFGG  RTKSE EGP E  LNLEILDRFWRLS+P G + D
Sbjct  179  GAGSTGLAPVRVRGYILMAPFFGGVARTKSE-EGPSEHLLNLEILDRFWRLSMPAGASRD  237

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HPLANPFGP S ++E V LDPILV+VG  E+L+DR E+YA +LK+  K+++YV F+GKQH
Sbjct  238  HPLANPFGPGSLNIELVALDPILVIVGSCELLRDRSEDYARRLKEMGKKIEYVEFEGKQH  297

Query  902  GFFTNDPFSDVSTQVLQQLQHFMISK  979
            GFFTNDP+S+ S +V+Q ++ FMI  
Sbjct  298  GFFTNDPYSEASEEVIQGMKRFMIEN  323



>gb|KDP21934.1| hypothetical protein JCGZ_03072 [Jatropha curcas]
Length=330

 Score =   429 bits (1102),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 206/328 (63%), Positives = 257/328 (78%), Gaps = 14/328 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VEDC G+LQ++SDGSIFR K   INF  PV +D S+  KDSLFD+ H L LR+
Sbjct  1    MGSLPHIVEDCMGVLQLFSDGSIFRPKS--INFNLPVINDNSILIKDSLFDKNHNLSLRL  58

Query  200  YKPRSSASAAVS-----LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            YKP S  S + +     LPII F HGGGFCVGSR WPNCH+CCLRL +GL+ALV++ DYR
Sbjct  59   YKPTSLPSPSSNDKNKKLPIILFIHGGGFCVGSRLWPNCHNCCLRLASGLKALVISIDYR  118

Query  365  LAPEHRLPAAMDDAFCAVKWVAAQA-----STDAWL-KDGVDFNRAFVLGDSSGGNVAHH  526
            LAPEHRLPAA+DDA  A++W+  QA     + DAWL  D VDF++ FV+GDSSGGN+AHH
Sbjct  119  LAPEHRLPAAIDDAVSAMQWLRNQALSESGNGDAWLSNDDVDFDQVFVIGDSSGGNIAHH  178

Query  527  LAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPF  706
            LAVR G GS  ++PVRVRGY+++APFFGG  RT SE EGP E FLNL++LDRFWRLS+P 
Sbjct  179  LAVRFGAGSNGLAPVRVRGYILLAPFFGGLARTMSE-EGPSEQFLNLDVLDRFWRLSMPV  237

Query  707  GGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVF  886
            G + DHPLANPFGP S +LE V LDP+LVMVG  E+LKDRV++YA +L Q  K++DY+ F
Sbjct  238  GESRDHPLANPFGPESLNLEKVGLDPLLVMVGSNELLKDRVKDYAKRLTQMGKKIDYLEF  297

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            +GK+HGFFTN+P+S+ + QV++ +Q FM
Sbjct  298  EGKEHGFFTNNPYSESAFQVIEAIQKFM  325



>ref|XP_009348479.1| PREDICTED: probable carboxylesterase 15 [Pyrus x bretschneideri]
Length=324

 Score =   428 bits (1101),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 205/321 (64%), Positives = 251/321 (78%), Gaps = 6/321 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VEDC G+LQV+SDGSI R    DIN   PV DD SV +KD +FD  H L LR+
Sbjct  1    MGSLPHIVEDCMGVLQVFSDGSIKRCSLTDINVNIPVIDDGSVAFKDIIFDTKHKLSLRL  60

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP+S A+    LP++F+FHGGGFCVGS  WPN H+CC+RL +GLQALVVAP YRLAPEH
Sbjct  61   YKPKS-ANLNSKLPVVFYFHGGGFCVGSHVWPNIHNCCIRLSSGLQALVVAPGYRLAPEH  119

Query  380  RLPAAMDDAFCAVKWVAAQA----STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            +LPAA+DDA  AV+W+  +A    + DAW+    D NR FVLGDSSGGN+AHHLAVRLG+
Sbjct  120  KLPAAIDDAVSAVEWLQKEALGESTNDAWIGGTADLNRVFVLGDSSGGNMAHHLAVRLGM  179

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            GS + +PVRVRGYV++APFFGG  RTKSE EGP E  L+LEILDRFWRLS+P   T D+P
Sbjct  180  GSVKAAPVRVRGYVLLAPFFGGVERTKSE-EGPCEALLSLEILDRFWRLSMPAEETRDNP  238

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            + NPFGP SP+LE V LDPILV+VGG E+LKDRVE+Y  KLK   K+++YV F+G++HGF
Sbjct  239  MVNPFGPNSPNLEKVALDPILVVVGGNELLKDRVESYWKKLKDLGKKIEYVEFEGQEHGF  298

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
             TNDP+S+VS + LQ ++ FM
Sbjct  299  LTNDPYSEVSNEALQVIKRFM  319



>ref|XP_008241122.1| PREDICTED: probable carboxylesterase 15 [Prunus mume]
Length=326

 Score =   428 bits (1101),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 204/326 (63%), Positives = 254/326 (78%), Gaps = 8/326 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VEDC G+LQV+SDG+I R    DI+F  PV DD SV +KD  F++ H L LR+
Sbjct  1    MGSLPHIVEDCMGVLQVFSDGTINRCSLMDIDFNIPVVDDHSVAFKDVTFNKRHNLSLRL  60

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP+S A+    LP++F+FHGGGFCVGS  WPNCH+CCLRL AGL ALVVAPDYRLAPEH
Sbjct  61   YKPKS-ANRNSKLPVVFYFHGGGFCVGSCVWPNCHNCCLRLSAGLHALVVAPDYRLAPEH  119

Query  380  RLPAAMDDAFCAVKWVAAQA------STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRL  541
            +LPA +DDA  AV+W+  +A        DAW+ D  DF+R F++GDSSGGN+AHHLAVRL
Sbjct  120  KLPAPIDDAVSAVEWLQREALMSKSGDCDAWMGDTADFDRVFIVGDSSGGNIAHHLAVRL  179

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
              GS +++PVRVRGYV++APFFGG  RT+SE EGP E  L+L+ILDRFWRLS+P G T D
Sbjct  180  EAGSAKVAPVRVRGYVLLAPFFGGVERTRSE-EGPCEALLSLDILDRFWRLSMPAGETRD  238

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HPL NPFGP SP+LE V LDPILV+VGG E+LKDRVE+Y  KL++  K+++YV F+G+QH
Sbjct  239  HPLVNPFGPNSPTLEKVALDPILVIVGGNEILKDRVESYWRKLEELGKKIEYVEFEGQQH  298

Query  902  GFFTNDPFSDVSTQVLQQLQHFMISK  979
            GF T DP+S+VS + LQ ++ FMI  
Sbjct  299  GFLTADPYSEVSNEALQFIKRFMIEN  324



>ref|XP_010058697.1| PREDICTED: probable carboxylesterase 15 [Eucalyptus grandis]
Length=324

 Score =   427 bits (1099),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 204/322 (63%), Positives = 252/322 (78%), Gaps = 6/322 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPHVVEDC G+LQV+SDGSIFR+ + D    F V + + VH KD L+D+ HGL LR+
Sbjct  1    MGSLPHVVEDCMGVLQVFSDGSIFRADEIDFRNIFVVENKSIVH-KDYLYDKEHGLSLRL  59

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            Y+P S    +  LPI+++ HGGGFCVGSR WPNCH+CC RL +GL ALV++PDYRLAPEH
Sbjct  60   YRPASPPPPSGKLPIVYYLHGGGFCVGSRLWPNCHNCCTRLASGLGALVISPDYRLAPEH  119

Query  380  RLPAAMDDAFCAVKWVAAQAST---DAWLK-DGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            RLPA +DDA  A+KW+ ++A +   D WL     DF R +++GDSSGGN+AHHLAV LG 
Sbjct  120  RLPAPIDDAHSALKWLQSKAKSEDVDGWLDPKAADFGRVYIVGDSSGGNIAHHLAVDLGF  179

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            GSP+++PVRV+GYV++APFFGG  RTKSE EGP E  LNLEILDRFWRLS+P GG  DHP
Sbjct  180  GSPKLAPVRVQGYVLLAPFFGGVARTKSE-EGPCEGLLNLEILDRFWRLSVPSGGDRDHP  238

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            LANPFGP SPSLEA  LDP+LVMVGG E+LKDRV++YA +LK   K V YV ++GKQHGF
Sbjct  239  LANPFGPLSPSLEAAALDPMLVMVGGNEMLKDRVQDYAERLKGMGKNVKYVEYEGKQHGF  298

Query  908  FTNDPFSDVSTQVLQQLQHFMI  973
            FTND +SD   QV+Q+++ FM+
Sbjct  299  FTNDAYSDAGNQVIQEIREFML  320



>ref|XP_003521507.1| PREDICTED: probable carboxylesterase 15-like [Glycine max]
Length=324

 Score =   423 bits (1088),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 211/326 (65%), Positives = 252/326 (77%), Gaps = 9/326 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPHVVEDC G LQ+YSDGSIFRS D  I F      D S+ +KD LFD+   L LR 
Sbjct  1    MGSLPHVVEDCMGFLQLYSDGSIFRSND--IEFKVSPIQDNSITYKDYLFDKRFNLSLRF  58

Query  200  YKPRSSA--SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            YKP+  A       LPI+ F HGGGFC GSRTWP+ H+CC+RL +GLQA+VV+PDYRLAP
Sbjct  59   YKPQHVAPIDNNKKLPIVMFLHGGGFCFGSRTWPHIHNCCMRLASGLQAVVVSPDYRLAP  118

Query  374  EHRLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAA+DDA  AV+W+  Q      DAWL  GVDF+  FV+GDSSGGN+AHHLAVRLG
Sbjct  119  EHRLPAAVDDAVEAVRWLQRQGLSLKEDAWLSGGVDFDCVFVVGDSSGGNIAHHLAVRLG  178

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             GS EM PVRVRGYV+ APFFGG VRTKSE EGPPE  LNLE+LDRFWRLS+P G + DH
Sbjct  179  SGSREMDPVRVRGYVLFAPFFGGEVRTKSE-EGPPEHMLNLELLDRFWRLSMPVGESRDH  237

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            PLANPFGP SP+LE VKLDPILV+VGG E+LKDR +NYA +LK+ +K++ YV F+G +HG
Sbjct  238  PLANPFGPGSPNLEQVKLDPILVIVGGNELLKDRAKNYATRLKKLDKDIKYVEFEGCEHG  297

Query  905  FFTNDPF-SDVSTQVLQQLQHFMISK  979
            FFT+D F S+V+ +V+Q L+ FM++ 
Sbjct  298  FFTHDSFSSEVTEEVIQILKGFMLAN  323



>ref|XP_003554498.1| PREDICTED: probable carboxylesterase 15-like [Glycine max]
Length=324

 Score =   421 bits (1081),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/326 (64%), Positives = 252/326 (77%), Gaps = 9/326 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPHVVEDC G LQ+YSDGSIFRS    I F      D S+ +KD LFD+   L LR 
Sbjct  1    MGSLPHVVEDCMGFLQLYSDGSIFRSNG--IEFKVSPIQDNSITYKDYLFDKRFNLSLRF  58

Query  200  YKPRSS--ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            YKP+    A +   +PI+ F HGGGFC GSRTWP+ H+CC+RL +GLQA VV+PDYRLAP
Sbjct  59   YKPQQQHIALSNKKVPIVIFLHGGGFCFGSRTWPHIHNCCMRLASGLQAAVVSPDYRLAP  118

Query  374  EHRLPAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAA+DDA  AV+W+  Q  +   DAWL  GVDF+R FV+GDSSGGN+AHHLAVRLG
Sbjct  119  EHRLPAAVDDAVEAVRWLQRQGLSLREDAWLSGGVDFDRVFVVGDSSGGNIAHHLAVRLG  178

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             GS EM PVRVRGYV+ APFFGG VRTKSE EGPPE  L+LE+LDRFWRLS+P G + DH
Sbjct  179  SGSREMDPVRVRGYVLFAPFFGGEVRTKSE-EGPPEHMLSLELLDRFWRLSMPVGKSRDH  237

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            PLANPFGP SP+LE  KLDPILV+VGG E+LKDR +NYA +LK+ +K++ YV F+G +HG
Sbjct  238  PLANPFGPGSPNLEQEKLDPILVIVGGNELLKDRAKNYATRLKELDKDIKYVEFEGCEHG  297

Query  905  FFTNDPF-SDVSTQVLQQLQHFMISK  979
            FFT+D F S+V+ +V+Q L+ FM++ 
Sbjct  298  FFTHDSFSSEVAEEVIQILKRFMLAN  323



>ref|XP_002267394.1| PREDICTED: probable carboxylesterase 15 isoform X1 [Vitis vinifera]
Length=320

 Score =   421 bits (1081),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 201/325 (62%), Positives = 253/325 (78%), Gaps = 11/325 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPF--PVHDDASVHWKDSLFDRTHGLYL  193
            M S PH+VED  G+LQVYSDGS+ RS      FPF  P+HDD SV WKDSLF + H L+L
Sbjct  1    MDSAPHLVEDFQGLLQVYSDGSVLRST----TFPFHIPLHDDGSVVWKDSLFHKHHNLHL  56

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            R+YK   S +   +LPI+++FHGGGFCVGSRTWPNCH+CCLRL +GL ALVVAPD+RLAP
Sbjct  57   RLYKTAVSPTKG-NLPILYYFHGGGFCVGSRTWPNCHNCCLRLASGLGALVVAPDFRLAP  115

Query  374  EHRLPAAMDDAFCAVKWVAAQASTD---AWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAA++DA  ++KW+  QA ++    WL +GVD +R FV+GDSSGGN+AH +AV++G
Sbjct  116  EHRLPAAVEDAVSSLKWLQGQAVSEDCEEWLSEGVDLDRVFVVGDSSGGNMAHQVAVQMG  175

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             G  E+ P+RVRG+V+MAPFFGGTVRT+SE EGP +   NLE+ DRFWRLS+P GGT DH
Sbjct  176  AGLLELEPIRVRGFVLMAPFFGGTVRTRSE-EGPSDTMFNLELFDRFWRLSIPEGGTADH  234

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            PL NPFGP SPSLE +KL+PILV+VGG E+LKDR E YA +LK+  K ++YV F+G+ HG
Sbjct  235  PLVNPFGPCSPSLEPLKLNPILVVVGGNELLKDRAEQYAKRLKEMGKGIEYVEFKGEGHG  294

Query  905  FFTNDPFSDVSTQVLQQLQHFMISK  979
            FFTNDP+SD +T VL  ++ F+   
Sbjct  295  FFTNDPYSDAATAVLPVIKRFITQN  319



>ref|XP_008391530.1| PREDICTED: probable carboxylesterase 15 [Malus domestica]
Length=324

 Score =   421 bits (1081),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 200/321 (62%), Positives = 250/321 (78%), Gaps = 6/321 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLP +VEDC G+LQ++SDGSI R    DIN   PV DD SV +KD +FD  H L LR+
Sbjct  1    MGSLPXIVEDCMGVLQIFSDGSIKRCSLTDINVNIPVIDDGSVAFKDIIFDTKHKLSLRL  60

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP+S A+    LP++F+FHGGGFCVGS  WPN H+CC+RL +GLQ+LVVAPDYRLAPEH
Sbjct  61   YKPKS-ANLNSKLPVVFYFHGGGFCVGSHVWPNFHNCCIRLSSGLQSLVVAPDYRLAPEH  119

Query  380  RLPAAMDDAFCAVKWVAAQA----STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            +LPAA+DDA  AV+W+  +A    + DAW+    D +R FVLGDSSGGN+AHHLAVRLG+
Sbjct  120  KLPAAIDDAVSAVEWLQKEALGESTNDAWIGGTADLDRVFVLGDSSGGNMAHHLAVRLGM  179

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            GS + +PVRVRGYV++APFFGG  RT+SE EGP E  L+LEILDRFWRLS+P   T D+P
Sbjct  180  GSVKAAPVRVRGYVLLAPFFGGVERTRSE-EGPCEALLSLEILDRFWRLSMPTEETRDNP  238

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            + NPFGP SP+LE V LDPILV+VGG E+LKDRVE+Y  KLK   K+++YV F+G++HG 
Sbjct  239  MVNPFGPNSPNLEKVALDPILVVVGGNELLKDRVESYWKKLKDLGKKIEYVEFEGQEHGV  298

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
             TNDP+S+VS + LQ ++ FM
Sbjct  299  LTNDPYSEVSNEALQVIKRFM  319



>ref|XP_007202225.1| hypothetical protein PRUPE_ppa008578mg [Prunus persica]
 gb|EMJ03424.1| hypothetical protein PRUPE_ppa008578mg [Prunus persica]
Length=326

 Score =   416 bits (1069),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 200/326 (61%), Positives = 250/326 (77%), Gaps = 8/326 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VEDC G+LQV+SDG+I R    D++F  PV DD SV +KD  FD+ H L LR+
Sbjct  1    MGSLPHIVEDCMGVLQVFSDGTINRCSLMDMDFNIPVVDDNSVAFKDVTFDKRHNLSLRL  60

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP+S A+    LP++F+FHGGGFCVGS  WPN ++CCLRL A L ALVVAPDYRLAPEH
Sbjct  61   YKPKS-ANRNSKLPVVFYFHGGGFCVGSCVWPNFYNCCLRLSAVLHALVVAPDYRLAPEH  119

Query  380  RLPAAMDDAFCAVKWVAAQA------STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRL  541
            +LPA +DDA  AV+W+  +A        DAW+    DF+R F++GDSSGGN+AHHLAVRL
Sbjct  120  KLPAPIDDALSAVEWLQREALMSKSGDCDAWMGGTADFDRVFIVGDSSGGNMAHHLAVRL  179

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
            G GS +++PVRVRGYV++APFFGG  RT+SE EGP E  L+L+ILDRFWRLS+P G T D
Sbjct  180  GAGSAKVAPVRVRGYVLLAPFFGGVERTRSE-EGPCEALLSLDILDRFWRLSMPAGETRD  238

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HPL NPFGP S +LE V LDPILV VGG E+LKDRVE+Y+ KLK+  K+++YV  +G+QH
Sbjct  239  HPLVNPFGPNSLNLEKVALDPILVFVGGNEILKDRVESYSRKLKELGKKIEYVELEGQQH  298

Query  902  GFFTNDPFSDVSTQVLQQLQHFMISK  979
            GF T DP+S+VS + LQ ++ FMI  
Sbjct  299  GFLTADPYSEVSNEALQFIKRFMIEN  324



>gb|KDO70738.1| hypothetical protein CISIN_1g020140mg [Citrus sinensis]
Length=330

 Score =   409 bits (1052),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 200/327 (61%), Positives = 246/327 (75%), Gaps = 12/327 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPF-PVHDDASVHWKDSLFDRTHGLYLR  196
            MGSLP VVED  G+LQ+YSDG++FRSKD   N      +D++SV +KD  +D+ H L+LR
Sbjct  1    MGSLPCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLR  60

Query  197  IYKPRSSASAA----VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            +YKPRS  +++      LPI+ F HGGGFC GSR WPN H+CC RL A L ALVVA DYR
Sbjct  61   LYKPRSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYR  120

Query  365  LAPEHRLPAAMDDAFCAVKWVAAQA-----STDAWLKDGVDFNRAFVLGDSSGGNVAHHL  529
            LAPEHRLPAAM+DAF A+KW+ AQA     + DAW  D V+F+  FVLGDSSGGN+AHHL
Sbjct  121  LAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWF-DEVEFDNVFVLGDSSGGNIAHHL  179

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            AV+LG GS E++PVRVRGYV++APFFGG  RTKSE  GP E  LNLE+LD FWRLSLP G
Sbjct  180  AVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSEL-GPSEAMLNLELLDSFWRLSLPIG  238

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQ  889
             T DHP ANPFGP SPSLE V LDP+LV+    E+LKDR ++YA +LK   K +D+V F+
Sbjct  239  ETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFK  298

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            G+QHGFFTN+PFS+ S + L+ ++ FM
Sbjct  299  GQQHGFFTNEPFSEASNEFLKVVEKFM  325



>ref|XP_011043887.1| PREDICTED: probable carboxylesterase 15 [Populus euphratica]
Length=330

 Score =   409 bits (1051),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 185/319 (58%), Positives = 251/319 (79%), Gaps = 7/319 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P+ V++C G+L+VYSDGSI+RS +   +F  PVHDD SV WKD+ FD TH L+LR+YKP 
Sbjct  14   PYEVDECRGVLRVYSDGSIWRSSEP--SFKVPVHDDGSVVWKDAFFDSTHDLHLRLYKPA  71

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
              +S    LPI ++ HGGGFC+GSR WPNC + C +L   LQA++++PDYRLAPE+RLPA
Sbjct  72   CPSS--TKLPIFYYIHGGGFCIGSRAWPNCQNYCFKLALDLQAVIISPDYRLAPENRLPA  129

Query  392  AMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A++D + AVKW+ AQA +   D WL D  DF++ F+ GDS+GGN+AH+LAVRLG GSPE+
Sbjct  130  AIEDGYMAVKWLQAQAMSEEPDTWLTDVADFSKVFISGDSAGGNIAHNLAVRLGAGSPEL  189

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +PV VRGYV++APFFGGTV++KSEAEGP E FLN E++DRFWRLS+P G T DHPL NPF
Sbjct  190  APVLVRGYVLLAPFFGGTVKSKSEAEGPKEAFLNWELIDRFWRLSIPIGDTTDHPLVNPF  249

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP S SLE ++LDPILV++GG ++LKDR ++YA +L++  K++ YV F+G+QHGFFT +P
Sbjct  250  GPQSRSLEPLELDPILVVMGGSDLLKDRAKDYAERLQEWGKDIQYVEFEGQQHGFFTINP  309

Query  923  FSDVSTQVLQQLQHFMISK  979
             S+ +T+++Q +  F++ K
Sbjct  310  ISEPATKLMQIINTFIVEK  328



>ref|XP_002313627.1| hypothetical protein POPTR_0009s15770g [Populus trichocarpa]
 gb|EEE87582.1| hypothetical protein POPTR_0009s15770g [Populus trichocarpa]
Length=330

 Score =   408 bits (1049),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 184/319 (58%), Positives = 253/319 (79%), Gaps = 7/319 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P+ V++C G+L+VYSDGSI+RS +   +F  PVHDD SV WKD+ FD TH L+LR+YKP 
Sbjct  14   PYEVDECRGVLRVYSDGSIWRSSEP--SFKVPVHDDGSVVWKDAFFDSTHDLHLRLYKPA  71

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
            S +S    LPI ++ HGGGFC+GSR WPNC + C +L   LQA++++PDYRLAPE+RLPA
Sbjct  72   SPSS--TKLPIFYYIHGGGFCIGSRAWPNCQNYCFKLALDLQAVIISPDYRLAPENRLPA  129

Query  392  AMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A++D + AVKW+ AQA +   D WL D  DF++ F+ GDS+GGN+AH+LAVRLG GSPE+
Sbjct  130  AIEDGYMAVKWLQAQAMSEEPDTWLTDVADFSKVFISGDSAGGNIAHNLAVRLGAGSPEL  189

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +PV VRGYV++APFFGGTV++KSEAEGP E FLN E+++RFWRLS+P G T DHPL NPF
Sbjct  190  APVLVRGYVLLAPFFGGTVKSKSEAEGPKEAFLNWELINRFWRLSIPIGDTTDHPLVNPF  249

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP S SLE ++LDPILV++GG ++LKDR ++YA +L++  K++ YV ++G+QHGFFT +P
Sbjct  250  GPQSRSLEPLELDPILVVMGGSDLLKDRAKDYAERLQEWGKDIQYVEYEGQQHGFFTINP  309

Query  923  FSDVSTQVLQQLQHFMISK  979
             S+ +T+++Q ++ F++ K
Sbjct  310  NSEPATKLMQIIKTFIVEK  328



>ref|XP_006429993.1| hypothetical protein CICLE_v10012167mg [Citrus clementina]
 gb|ESR43233.1| hypothetical protein CICLE_v10012167mg [Citrus clementina]
Length=330

 Score =   408 bits (1049),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 199/327 (61%), Positives = 246/327 (75%), Gaps = 12/327 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPF-PVHDDASVHWKDSLFDRTHGLYLR  196
            MGSLP VVED  G+LQ+YSDG++FRSKD   N      +D++SV +KD  +D+ H L+LR
Sbjct  1    MGSLPCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLR  60

Query  197  IYKPRSSASAA----VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            +YKPRS  +++      LPI+ F HGGGFC GSR WPN H+CC RL A L ALVVA DYR
Sbjct  61   LYKPRSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYR  120

Query  365  LAPEHRLPAAMDDAFCAVKWVAAQA-----STDAWLKDGVDFNRAFVLGDSSGGNVAHHL  529
            LAPEHRLPAAM+DAF A+KW+ AQA     + DAW  + V+F+  FVLGDSSGGN+AHHL
Sbjct  121  LAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFGE-VEFDNVFVLGDSSGGNIAHHL  179

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            AV+LG GS E++PVRVRGYV++APFFGG  RTKSE  GP E  LNLE+LD FWRLSLP G
Sbjct  180  AVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSEL-GPSEAMLNLELLDSFWRLSLPIG  238

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQ  889
             T DHP ANPFGP SPSLE V LDP+LV+    E+LKDR ++YA +LK   K +D+V F+
Sbjct  239  ETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFK  298

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            G+QHGFFTN+PFS+ S + L+ ++ FM
Sbjct  299  GQQHGFFTNEPFSEASNEFLKVVEKFM  325



>ref|XP_010090529.1| putative carboxylesterase 15 [Morus notabilis]
 gb|EXB39678.1| putative carboxylesterase 15 [Morus notabilis]
Length=327

 Score =   408 bits (1048),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/316 (60%), Positives = 243/316 (77%), Gaps = 5/316 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P+ V++C G+L+VYSDGS+ RS     +F  PVHDD SV WKD  FD  HGL LR+YKP 
Sbjct  9    PYEVDECRGVLRVYSDGSVVRSSKP--SFDVPVHDDGSVLWKDVEFDPAHGLSLRLYKPA  66

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
            + + A+  LP++F+ HGGGFC+GSR WPNC + C RL + L+A+VV+PDYRLAPE+RLPA
Sbjct  67   ARSPASAKLPVLFYIHGGGFCIGSRGWPNCQNYCFRLASELRAVVVSPDYRLAPENRLPA  126

Query  392  AMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A++D F AVKW+ AQA +   D WL    D+   FV GDS+GGN+AH+LAVRLG  SPE+
Sbjct  127  AIEDGFAAVKWLQAQAESEEPDEWLSRVADYGNVFVSGDSAGGNIAHNLAVRLGARSPEL  186

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
             PVR+RGYV++APFFGGTVR+KSEAEGP + FLN E++DRFWRLS+P G T DHPL NPF
Sbjct  187  GPVRIRGYVLLAPFFGGTVRSKSEAEGPKDAFLNWELIDRFWRLSIPIGETRDHPLVNPF  246

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP+SPSLE V LDPILV+VGG ++LKDRVE YA +LK   K+++YV F+G QHGFFT DP
Sbjct  247  GPSSPSLEGVDLDPILVVVGGSDLLKDRVEEYATRLKNWRKKIEYVEFEGLQHGFFTIDP  306

Query  923  FSDVSTQVLQQLQHFM  970
             S  S +++  ++ F+
Sbjct  307  NSKHSNELMLIIKRFL  322



>ref|XP_006481654.1| PREDICTED: probable carboxylesterase 15-like [Citrus sinensis]
Length=330

 Score =   408 bits (1048),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 199/327 (61%), Positives = 246/327 (75%), Gaps = 12/327 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPF-PVHDDASVHWKDSLFDRTHGLYLR  196
            MGSLP VVED  G+L++YSDG++FRSKD   N      +D++SV +KD  +D+ H L+LR
Sbjct  1    MGSLPCVVEDMGGVLRLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLR  60

Query  197  IYKPRSSASAA----VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            +YKPRS  +++      LPI+ F HGGGFC GSR WPN H+CC RL A L ALVVA DYR
Sbjct  61   LYKPRSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYR  120

Query  365  LAPEHRLPAAMDDAFCAVKWVAAQA-----STDAWLKDGVDFNRAFVLGDSSGGNVAHHL  529
            LAPEHRLPAAM+DAF A+KW+ AQA     + DAW  D V+F+  FVLGDSSGGN+AHHL
Sbjct  121  LAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWF-DEVEFDNVFVLGDSSGGNIAHHL  179

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            AV+LG GS E++PVRVRGYV++APFFGG  RTKSE  GP E  LNLE+LD FWRLSLP G
Sbjct  180  AVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSEL-GPSEAMLNLELLDSFWRLSLPIG  238

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQ  889
             T DHP ANPFGP SPSLE V LDP+LV+    E+LKDR ++YA +LK   K +D+V F+
Sbjct  239  ETRDHPYANPFGPESPSLEVVSLDPMLVVASEIELLKDRAKDYAKRLKAMGKTIDFVEFK  298

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            G+QHGFFTN+PFS+ S + L+ ++ FM
Sbjct  299  GQQHGFFTNEPFSEASNEFLKVVEKFM  325



>ref|XP_007163014.1| hypothetical protein PHAVU_001G198900g [Phaseolus vulgaris]
 gb|ESW35008.1| hypothetical protein PHAVU_001G198900g [Phaseolus vulgaris]
Length=340

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 198/327 (61%), Positives = 245/327 (75%), Gaps = 12/327 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPHVVEDC G LQ++SDGS+FRS D  I+F      D SV +KD LF++   L LR 
Sbjct  1    MGSLPHVVEDCLGFLQLFSDGSVFRSND--IDFKISAVQDHSVTFKDYLFNKRFNLSLRF  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP+       ++PI+ F HGGGFC GSRTWP+ H+CC RL +GLQA V++PDYRLAPEH
Sbjct  59   YKPKHVTLNTKNIPIVIFLHGGGFCFGSRTWPHIHNCCTRLASGLQAAVLSPDYRLAPEH  118

Query  380  RLPAAMDDAFCAVKWVAAQA--------STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAV  535
            RLP+A++DA  AV+W+  Q           D WL   VDF+R FV+GDSSGGN+AHHLAV
Sbjct  119  RLPSAVEDAVEAVRWLQRQGLRQKEDENGGDEWLSGDVDFDRVFVVGDSSGGNIAHHLAV  178

Query  536  RLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGT  715
            RLG GS EM PVRVRGYV+ APFFGG VRTKSE EGP E  LNLE+LDRFWRLS+PFG +
Sbjct  179  RLGSGSSEMDPVRVRGYVLFAPFFGGEVRTKSE-EGPAEHMLNLELLDRFWRLSMPFGES  237

Query  716  PDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGK  895
             DHPLANPFGP SP+LE VKLDPILV+VG  E+LKDR E YA +LK+  K+++Y+ F+G 
Sbjct  238  RDHPLANPFGPGSPNLEEVKLDPILVIVGSNELLKDRAEEYARRLKELGKDIEYLEFEGC  297

Query  896  QHGFFTNDPFSD-VSTQVLQQLQHFMI  973
            +HGFFT+  +S  ++ +V+Q L+ FM+
Sbjct  298  EHGFFTHHSYSSKLAEEVIQILKRFML  324



>gb|KCW90396.1| hypothetical protein EUGRSUZ_A02538 [Eucalyptus grandis]
Length=313

 Score =   405 bits (1042),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 193/310 (62%), Positives = 241/310 (78%), Gaps = 6/310 (2%)
 Frame = +2

Query  56   GILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSSASAAVS  235
            G+LQV+SDGSIFR+ + D    F V + + VH KD L+D+ HGL LR+Y+P S    +  
Sbjct  2    GVLQVFSDGSIFRADEIDFRNIFVVENKSIVH-KDYLYDKEHGLSLRLYRPASPPPPSGK  60

Query  236  LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAMDDAFCA  415
            LPI+++ HGGGFCVGSR WPNCH+CC RL +GL ALV++PDYRLAPEHRLPA +DDA  A
Sbjct  61   LPIVYYLHGGGFCVGSRLWPNCHNCCTRLASGLGALVISPDYRLAPEHRLPAPIDDAHSA  120

Query  416  VKWVAAQAST---DAWLK-DGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSPVRVRG  583
            +KW+ ++A +   D WL     DF R +++GDSSGGN+AHHLAV LG GSP+++PVRV+G
Sbjct  121  LKWLQSKAKSEDVDGWLDPKAADFGRVYIVGDSSGGNIAHHLAVDLGFGSPKLAPVRVQG  180

Query  584  YVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGPASPSL  763
            YV++APFFGG  RTKSE EGP E  LNLEILDRFWRLS+P GG  DHPLANPFGP SPSL
Sbjct  181  YVLLAPFFGGVARTKSE-EGPCEGLLNLEILDRFWRLSVPSGGDRDHPLANPFGPLSPSL  239

Query  764  EAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFSDVSTQ  943
            EA  LDP+LVMVGG E+LKDRV++YA +LK   K V YV ++GKQHGFFTND +SD   Q
Sbjct  240  EAAALDPMLVMVGGNEMLKDRVQDYAERLKGMGKNVKYVEYEGKQHGFFTNDAYSDAGNQ  299

Query  944  VLQQLQHFMI  973
            V+Q+++ FM+
Sbjct  300  VIQEIREFML  309



>ref|XP_007029163.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY09665.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=315

 Score =   405 bits (1041),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 245/312 (79%), Gaps = 10/312 (3%)
 Frame = +2

Query  56   GILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSSASAAVS  235
            G+LQV SDG++FRSK+  I F  PV D+ SVH+KD++FD++H LYLR+YKP S++    +
Sbjct  2    GVLQVLSDGTVFRSKN--IQFNMPVIDEKSVHFKDAMFDKSHNLYLRLYKPTSASVPGNN  59

Query  236  --LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAMDDAF  409
              LPII F HGGGFC+GSR WP CHS CLRL +GL ALVVAPDYRLAPEHRLPAAMDDA 
Sbjct  60   NKLPIIIFIHGGGFCLGSRMWPTCHSSCLRLSSGLNALVVAPDYRLAPEHRLPAAMDDAA  119

Query  410  CAVKWVAAQA----STDAWLKDG-VDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSPVR  574
             A+KW+  QA    + DAW   G VDF++ FV+GDSSGGN+AHHLAVRLG GS E++PVR
Sbjct  120  SAMKWLQGQALSGNTNDAWFGSGEVDFDQVFVVGDSSGGNIAHHLAVRLGAGSTELAPVR  179

Query  575  VRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGPAS  754
            VRGYV++APFFGG VRTKSE +GP E  LNLEILDRFWRLS+P G T DHPLANPFGP S
Sbjct  180  VRGYVLLAPFFGGVVRTKSE-DGPSEALLNLEILDRFWRLSMPIGETRDHPLANPFGPWS  238

Query  755  PSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFSDV  934
            P LE V LDPILV+VGG E+LKDR E+YA +LK   K+++YV F+GK+HG+F  DP SD 
Sbjct  239  PRLETVTLDPILVIVGGNELLKDRAEDYARRLKDMGKKIEYVEFEGKEHGYFNCDPHSDA  298

Query  935  STQVLQQLQHFM  970
            + Q LQ +  FM
Sbjct  299  TNQTLQVISRFM  310



>ref|XP_002527569.1| Gibberellin receptor GID1, putative [Ricinus communis]
 gb|EEF34821.1| Gibberellin receptor GID1, putative [Ricinus communis]
Length=328

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 189/335 (56%), Positives = 254/335 (76%), Gaps = 13/335 (4%)
 Frame = +2

Query  26    SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
             S P+ V++C G+L+VYSDGSI+RS +   +F  PVHD  SV WKD LFD  H L+LR+YK
Sbjct  4     STPYEVDECRGVLRVYSDGSIWRSTEP--SFKVPVHDGGSVLWKDCLFDPVHNLHLRLYK  61

Query  206   PRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
             P SS+S+   LP+ ++ HGGGFC+GSRTWPNC + C +L   LQA++++PDYRLAPE+RL
Sbjct  62    PASSSSS-TKLPVFYYIHGGGFCIGSRTWPNCQNYCFKLALDLQAVIISPDYRLAPENRL  120

Query  386   PAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSP  556
             PAA++D F A+KW+ AQA     D WL +  DF++ F+ GDS+GGN+AH+LAVRLG GSP
Sbjct  121   PAAIEDGFMAMKWLQAQALSEEADTWLSEVADFSKVFISGDSAGGNIAHNLAVRLGAGSP  180

Query  557   EMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLAN  736
             E+SPVRV+GYV++APFFGG VR+ SE EGP + FLN E++DRFWRLS+P G T DHPL N
Sbjct  181   ELSPVRVKGYVLLAPFFGGMVRSVSEVEGPQDAFLNWELIDRFWRLSIPIGDTTDHPLVN  240

Query  737   PFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTN  916
             PFGP S SLE V LDPILV++G  ++LKDR ++YA +LK   K+++YV F+GKQHGFFT 
Sbjct  241   PFGPYSQSLELVNLDPILVIMGESDLLKDRAKDYAERLKAWGKKIEYVGFEGKQHGFFTI  300

Query  917   DPFSDVSTQVLQQLQHFMISKV*NDEIYIRQDLHY  1021
             DP S+ S +++  ++ F+     N+  Y  Q++H+
Sbjct  301   DPNSEASNKLMLLIKSFI-----NENDY--QNIHF  328



>ref|XP_006487818.1| PREDICTED: probable carboxylesterase 15-like [Citrus sinensis]
Length=326

 Score =   401 bits (1030),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 242/314 (77%), Gaps = 7/314 (2%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            +V++C G+L VYSDGSI R      +F  PVHDD SV WKD +FD  H L LR+YKP  +
Sbjct  12   LVDECRGVLFVYSDGSIVRLPKP--SFSVPVHDDGSVVWKDVVFDPVHDLSLRLYKP--A  67

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
               +  LPI ++ HGGGFC+GSRTWPNC + C +L + LQA++++PDYRLAPE+RLPAA+
Sbjct  68   LPVSTKLPIFYYIHGGGFCIGSRTWPNCQNYCFKLASELQAVIISPDYRLAPENRLPAAI  127

Query  398  DDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP  568
            +D + AVKW+ AQA     D WL +  DF + F+ GDS+GGN+AH+LAVRL  GS E++P
Sbjct  128  EDGYMAVKWLQAQAVANEPDTWLTEVADFGKVFISGDSAGGNIAHNLAVRLKAGSLELAP  187

Query  569  VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGP  748
            VRV+GY+++APFFGGTVR KSEAEGP E FLNLE++DRFWRLS+P G T DHPL NPFGP
Sbjct  188  VRVKGYILLAPFFGGTVRKKSEAEGPREAFLNLELIDRFWRLSIPIGETTDHPLINPFGP  247

Query  749  ASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFS  928
             SPSLEAV LDPILV+VGG ++LKDR E+YA  LK   K+V+YV F+GKQHGFFT DP S
Sbjct  248  VSPSLEAVDLDPILVVVGGSDLLKDRGEDYAKTLKNFGKKVEYVEFEGKQHGFFTIDPNS  307

Query  929  DVSTQVLQQLQHFM  970
            + + +++Q ++HF+
Sbjct  308  EGANRLMQIIKHFI  321



>ref|XP_009627722.1| PREDICTED: probable carboxylesterase 15 [Nicotiana tomentosiformis]
Length=327

 Score =   400 bits (1029),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 185/316 (59%), Positives = 242/316 (77%), Gaps = 6/316 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            PH VE+C G+L+VYSDG+I RS     +F  P+ DD SV WKD +FD  H L LR+YKP 
Sbjct  10   PHEVEECRGVLRVYSDGTIVRSSKP--SFEVPIQDDGSVLWKDVVFDAMHNLQLRLYKP-  66

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
            + A++A  LPI ++ HGGGFC+GSRTWPNC + C +L + LQA+V++PDYRLAPE+RLPA
Sbjct  67   ALATSATKLPIFYYIHGGGFCIGSRTWPNCQNYCFKLASELQAVVISPDYRLAPENRLPA  126

Query  392  AMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A++D + AVKW+  QA +   D WL D  DF+R F+ GDS+GGN+AH+LA+RL VGS E+
Sbjct  127  AIEDGYMAVKWLQDQAVSNEPDTWLTDVADFSRVFISGDSAGGNIAHNLAIRLRVGSIEL  186

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +PVRVRGYV + PFFGGT RTK EAEGP E FLN+E++DRFWRLS+P G T DHPL NPF
Sbjct  187  APVRVRGYVYLLPFFGGTTRTKFEAEGPKEAFLNIELIDRFWRLSVPIGETTDHPLVNPF  246

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP SP LE + LDPILV+VGG ++LKDR E+YA +LK+  K+++YV F+G+QHGFFT  P
Sbjct  247  GPNSPDLEKIDLDPILVIVGGCDLLKDRAEDYAKRLKECGKKIEYVEFEGQQHGFFTIYP  306

Query  923  FSDVSTQVLQQLQHFM  970
             S  S +++  ++ F+
Sbjct  307  NSKPSKKLMLTIKKFI  322



>ref|XP_006424040.1| hypothetical protein CICLE_v10028832mg [Citrus clementina]
 gb|ESR37280.1| hypothetical protein CICLE_v10028832mg [Citrus clementina]
Length=326

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 240/314 (76%), Gaps = 7/314 (2%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            +V++C G+L VYSDGSI R      +F  PVHDD SV WKD +FD  H L LR+YKP  +
Sbjct  12   LVDECRGVLFVYSDGSIVRLPKP--SFSVPVHDDGSVVWKDVVFDPVHDLSLRLYKP--A  67

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
               +  LPI ++ HGGGFC+GSR WPNC + C  L + LQA++++PDYRLAPE+RLPAA+
Sbjct  68   LPVSTKLPIFYYIHGGGFCIGSRAWPNCQNYCFNLASELQAVIISPDYRLAPENRLPAAI  127

Query  398  DDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP  568
            +D + AVKW+ AQA     D WL +  DF + F+ GDS+GGN+AH+LAVRL  GS E++P
Sbjct  128  EDGYMAVKWLQAQAVANEPDTWLTEVADFGKVFISGDSAGGNIAHNLAVRLKAGSLELAP  187

Query  569  VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGP  748
            VRV+GY+++APF GGTVRTKSEAEGP E FLNLE++DRFWRLS+P G T DHPL NPFGP
Sbjct  188  VRVKGYILLAPFLGGTVRTKSEAEGPREAFLNLELIDRFWRLSIPIGETTDHPLINPFGP  247

Query  749  ASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFS  928
             SPSLEAV LDPILV+VGG ++LKDR E+YA  LK   K+V+YV F+GKQHGFFT DP S
Sbjct  248  VSPSLEAVDLDPILVVVGGSDLLKDRAEDYAKTLKNFGKKVEYVEFEGKQHGFFTIDPNS  307

Query  929  DVSTQVLQQLQHFM  970
            + + +++Q ++HF+
Sbjct  308  EDANRLMQIIKHFI  321



>ref|XP_010045157.1| PREDICTED: probable carboxylesterase 15 [Eucalyptus grandis]
 gb|KCW87309.1| hypothetical protein EUGRSUZ_B03798 [Eucalyptus grandis]
Length=329

 Score =   399 bits (1026),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/312 (61%), Positives = 242/312 (78%), Gaps = 4/312 (1%)
 Frame = +2

Query  41   VEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSSA  220
            V++C G+L+VYSDGSI RS     +F  PVHDD SV WKD LFD+ H L LR+YKP S++
Sbjct  15   VDECRGVLRVYSDGSIVRSSKP--SFDVPVHDDGSVLWKDVLFDQAHDLRLRLYKPASAS  72

Query  221  SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAMD  400
            +++  LPI ++ HGGGFC+GSR WPNC + C +L + L A+VV+PDYRLAPE+RLPAA++
Sbjct  73   ASSAKLPIFYYIHGGGFCIGSRAWPNCQNYCFKLASELHAVVVSPDYRLAPENRLPAAIE  132

Query  401  DAFCAVKWVAAQA--STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSPVR  574
            D + AVKW+ AQA  ++DAWL D  DF R F+ GDS+GGN+AH+LA RLG G+PE++PV 
Sbjct  133  DGYTAVKWLQAQALEASDAWLADVADFGRVFISGDSAGGNIAHNLAARLGAGAPELAPVV  192

Query  575  VRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGPAS  754
            +RGYV++APFFGGTV TKSEAEGP + FLNLE++DRFWRLS+P G T DHPL NPFGP+S
Sbjct  193  MRGYVLLAPFFGGTVWTKSEAEGPKDAFLNLELIDRFWRLSVPTGDTTDHPLVNPFGPSS  252

Query  755  PSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFSDV  934
              L  + LDPILV+VGG ++LKDR E YA KLK   K+V+YV FQG QHGFFT DP S  
Sbjct  253  LDLRPLDLDPILVVVGGADLLKDRAEEYATKLKAWGKKVEYVEFQGLQHGFFTIDPNSQD  312

Query  935  STQVLQQLQHFM  970
            S +++  ++ FM
Sbjct  313  SKRLMLIIKRFM  324



>emb|CBI24401.3| unnamed protein product [Vitis vinifera]
Length=334

 Score =   399 bits (1025),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 194/325 (60%), Positives = 246/325 (76%), Gaps = 10/325 (3%)
 Frame = +2

Query  14   REMGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYL  193
            R + S P+ VE+C G+L+VYSDGSI RS     +F  PVHDD SV WKD LFD  H L L
Sbjct  15   RPLMSSPYEVEECRGVLRVYSDGSIVRSSQP--SFAVPVHDDGSVLWKDVLFDPQHDLQL  72

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            R+YKP   AS +  LPI ++ HGGGFC+GSRTWPNC + C RL + LQA+V++PDYRLAP
Sbjct  73   RLYKP---ASPSAKLPIFYYIHGGGFCIGSRTWPNCQNYCFRLASELQAVVISPDYRLAP  129

Query  374  EHRLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            E+RLPAA++D + AVKW+ AQA   + D WL +  DF R F+ GDS+GGN+AHHLAV+LG
Sbjct  130  ENRLPAAIEDGYKAVKWLQAQALAENPDTWLTEVADFGRVFISGDSAGGNIAHHLAVQLG  189

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
              S E+ PV VRGYV++APFFGGTVRTKSEAEGP + FLNLE++DRFWRLS+P G T D+
Sbjct  190  --SLELVPVGVRGYVLLAPFFGGTVRTKSEAEGPKDAFLNLELIDRFWRLSIPTGDTTDN  247

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            PL NPFGP SPSLE V L PILV+ GG ++LKDR E+YA +LKQ  K+V+YV F+G+QHG
Sbjct  248  PLVNPFGPLSPSLEPVDLLPILVVAGGSDLLKDRAEDYAKRLKQWEKKVEYVEFEGQQHG  307

Query  905  FFTNDPFSDVSTQVLQQLQHFMISK  979
            FFT  P S+ + +++  ++ F+I  
Sbjct  308  FFTIFPTSEAANKLMLIIKRFVIEN  332



>ref|XP_008449839.1| PREDICTED: probable carboxylesterase 15 [Cucumis melo]
Length=320

 Score =   398 bits (1022),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 188/316 (59%), Positives = 242/316 (77%), Gaps = 7/316 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P  V++C G+L+VYSDGSI RS +   N P  V+DD SV WKD LFD  + L+LR+YKP 
Sbjct  4    PVEVDECRGVLRVYSDGSIVRSSNPSFNVP--VNDDGSVLWKDLLFDPINDLHLRLYKPA  61

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
              +S  +S  + F+ HGGGFC+GSRTWPNC + C RL + L ALV++PDYRLAPE+RLPA
Sbjct  62   DISSPKLS--VFFYIHGGGFCIGSRTWPNCQNYCFRLASQLPALVISPDYRLAPENRLPA  119

Query  392  AMDDAFCAVKWVAAQASTD---AWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A+DD F A++W+ AQA +D    WL D  DF+R F+ GDS+GGN+AHHLAV LG+GSPE+
Sbjct  120  AIDDGFAALRWLQAQAESDHPDPWLADVADFSRVFISGDSAGGNIAHHLAVGLGLGSPEL  179

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +PVRVRGYV++ PFFGGTVRT+SEAEG  E FLNLE++DRFWRLS+P G   DHPL N F
Sbjct  180  APVRVRGYVLLGPFFGGTVRTRSEAEGSKEAFLNLELIDRFWRLSIPIGSDTDHPLVNVF  239

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP S +LEAV++DPI+V+V G ++LKDR   YA +LK+Q K++D V F+GKQHGFFT DP
Sbjct  240  GPTSRNLEAVEMDPIMVVVAGADLLKDRAVEYAEELKKQGKKIDLVEFEGKQHGFFTIDP  299

Query  923  FSDVSTQVLQQLQHFM  970
             S+ S Q++  + HF+
Sbjct  300  NSEASNQLMLLINHFV  315



>ref|XP_002277507.1| PREDICTED: probable carboxylesterase 15 [Vitis vinifera]
Length=317

 Score =   397 bits (1021),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 193/321 (60%), Positives = 244/321 (76%), Gaps = 10/321 (3%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            S P+ VE+C G+L+VYSDGSI RS     +F  PVHDD SV WKD LFD  H L LR+YK
Sbjct  2    SSPYEVEECRGVLRVYSDGSIVRSSQP--SFAVPVHDDGSVLWKDVLFDPQHDLQLRLYK  59

Query  206  PRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
            P   AS +  LPI ++ HGGGFC+GSRTWPNC + C RL + LQA+V++PDYRLAPE+RL
Sbjct  60   P---ASPSAKLPIFYYIHGGGFCIGSRTWPNCQNYCFRLASELQAVVISPDYRLAPENRL  116

Query  386  PAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSP  556
            PAA++D + AVKW+ AQA   + D WL +  DF R F+ GDS+GGN+AHHLAV+LG  S 
Sbjct  117  PAAIEDGYKAVKWLQAQALAENPDTWLTEVADFGRVFISGDSAGGNIAHHLAVQLG--SL  174

Query  557  EMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLAN  736
            E+ PV VRGYV++APFFGGTVRTKSEAEGP + FLNLE++DRFWRLS+P G T D+PL N
Sbjct  175  ELVPVGVRGYVLLAPFFGGTVRTKSEAEGPKDAFLNLELIDRFWRLSIPTGDTTDNPLVN  234

Query  737  PFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTN  916
            PFGP SPSLE V L PILV+ GG ++LKDR E+YA +LKQ  K+V+YV F+G+QHGFFT 
Sbjct  235  PFGPLSPSLEPVDLLPILVVAGGSDLLKDRAEDYAKRLKQWEKKVEYVEFEGQQHGFFTI  294

Query  917  DPFSDVSTQVLQQLQHFMISK  979
             P S+ + +++  ++ F+I  
Sbjct  295  FPTSEAANKLMLIIKRFVIEN  315



>ref|XP_011089000.1| PREDICTED: probable carboxylesterase 15 [Sesamum indicum]
Length=334

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/316 (59%), Positives = 241/316 (76%), Gaps = 6/316 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P  VE+C G+L++YSDGSI+RS     +F  PV+DD SV WKD LFD TH L+LR+YKP 
Sbjct  17   PIEVEECRGVLRIYSDGSIWRSNKS--SFEVPVNDDGSVLWKDVLFDATHNLHLRLYKP-  73

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
            +S   +  LPI ++ HGGGFC+GSR WPNC + C +LC+ LQA++++PDYRLAPE+RLPA
Sbjct  74   ASPPTSTKLPIFYYIHGGGFCIGSRAWPNCQNYCFKLCSELQAVIISPDYRLAPENRLPA  133

Query  392  AMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A++D + ++KW+  QA     D WL D VDF+  F+ GDS+GGN+AH+LAVRLG GS E+
Sbjct  134  AIEDGYASLKWLQDQALAEEPDTWLTDVVDFSHVFISGDSAGGNIAHNLAVRLGAGSGEL  193

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +PVRVRGYV +APFFGGT RT SEAEGP E FLNLE++DRFWRLS+P G T DHPL NPF
Sbjct  194  APVRVRGYVYLAPFFGGTARTGSEAEGPKEAFLNLELIDRFWRLSIPVGETTDHPLVNPF  253

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP SP+LE + LDPILV+VGG ++LKDR   YA KLK+  K+V+Y  F+ +QHGFFT +P
Sbjct  254  GPNSPNLEKMDLDPILVVVGGSDLLKDRAVEYAEKLKKWGKKVEYAEFEEQQHGFFTINP  313

Query  923  FSDVSTQVLQQLQHFM  970
             S  S +++  ++ F+
Sbjct  314  NSQPSKELMLLIKKFI  329



>gb|KDP42951.1| hypothetical protein JCGZ_23893 [Jatropha curcas]
Length=323

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 252/318 (79%), Gaps = 6/318 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            S P+ V++C G+L+VYSDGSI+RS +   +F  PVHDD SV WKD LFD  H L+LR+YK
Sbjct  4    SAPYEVDECRGVLRVYSDGSIWRSTEP--SFKVPVHDDGSVLWKDVLFDPLHNLHLRLYK  61

Query  206  PRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
            P S +S+A  LPI ++ HGGGFC+GSRTWPNC + C +L   LQA++++PDYRLAPE+RL
Sbjct  62   PASPSSSA-KLPIFYYIHGGGFCIGSRTWPNCQNYCFKLALELQAVIISPDYRLAPENRL  120

Query  386  PAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSP  556
            PAA++D F AVKW+ AQA     D+WL +  DF + F+ GDS+GGN+ H+LAV+LG GSP
Sbjct  121  PAAIEDGFMAVKWLQAQALAEAADSWLTEAADFGKVFISGDSAGGNIGHNLAVQLGAGSP  180

Query  557  EMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLAN  736
            +++PVRVRGYV++APFFGGTV +KSEAEGP + FLNLE++DRFWRLS+P G T DHPL N
Sbjct  181  DLAPVRVRGYVLLAPFFGGTVWSKSEAEGPKDAFLNLELIDRFWRLSIPIGDTTDHPLVN  240

Query  737  PFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTN  916
            PFGP S SLEAV+LDPILV++GG ++L+DR ++YA +LK   K+++Y+ F+ +QHGFFT 
Sbjct  241  PFGPQSKSLEAVELDPILVVMGGSDLLRDRAKDYAERLKAWGKKIEYIEFEEQQHGFFTI  300

Query  917  DPFSDVSTQVLQQLQHFM  970
            DP S+ +++++  ++ F+
Sbjct  301  DPNSEPASKLMLIIKTFI  318



>ref|XP_004295159.1| PREDICTED: probable carboxylesterase 15-like [Fragaria vesca 
subsp. vesca]
Length=328

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/316 (60%), Positives = 238/316 (75%), Gaps = 9/316 (3%)
 Frame = +2

Query  29   LPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKP  208
            LP+  E+C G+L+VYSDGSI RS     +F  PVHDD SV WKD +FD T+ L LR+YKP
Sbjct  15   LPY--EECRGVLRVYSDGSIVRSSKP--SFDVPVHDDGSVAWKDVVFDHTNQLQLRLYKP  70

Query  209  RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
             +S S    LPI ++ HGGGFC+GSR WPNC + C +L   LQA++V+PDYRLAPEHRLP
Sbjct  71   AASKS---KLPIFYYIHGGGFCIGSRAWPNCQNYCFQLALSLQAVIVSPDYRLAPEHRLP  127

Query  389  AAMDDAFCAVKWVAAQA--STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            AA+DD F AVKW+ AQA  S D WL D  DF   F+ GDS+GGN+AH+LAV+LG GSPE+
Sbjct  128  AAIDDGFAAVKWLQAQALSSEDTWLTDVADFGNVFISGDSAGGNIAHNLAVQLGAGSPEL  187

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +PVRV+GYV++APFFGGT+ +KSEAEGP E FLN E++DRFWRLS+P G   DHPL NPF
Sbjct  188  APVRVKGYVLLAPFFGGTILSKSEAEGPKEAFLNWELIDRFWRLSIPVGENTDHPLVNPF  247

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP S SLE V  DPILV+VGG ++LKDR  +YA +LK    +++YV F+GKQHGFFT DP
Sbjct  248  GPFSRSLEEVPFDPILVVVGGSDLLKDRAADYANRLKNWGNKIEYVEFEGKQHGFFTIDP  307

Query  923  FSDVSTQVLQQLQHFM  970
             S+ S  ++  ++ F+
Sbjct  308  DSEASKALMLIVKRFI  323



>ref|XP_004494289.1| PREDICTED: probable carboxylesterase 15-like [Cicer arietinum]
Length=322

 Score =   396 bits (1017),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 193/321 (60%), Positives = 242/321 (75%), Gaps = 8/321 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            M SLPHVVEDC G LQ+YSDGSI RS    I F  P+  D SV +KD+LF++   L LR+
Sbjct  1    MDSLPHVVEDCMGFLQLYSDGSINRSNS--IKFQVPIIQDNSVTFKDTLFNKKFNLSLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YK  ++      LPII F HGGGFC GSRTWP+ H+CC+RL + LQA+VVAPDYRLAPEH
Sbjct  59   YK-PNNNIKKNKLPIIVFLHGGGFCFGSRTWPHIHNCCVRLASALQAVVVAPDYRLAPEH  117

Query  380  RLPAAMDDAFCAVKWVAAQAST----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            RLPAA++DA  AV+W+  Q  +    + WL + VDF+R FV+GDSSGGN+AH LAVR G 
Sbjct  118  RLPAAVEDAVDAVRWIQRQGLSLKEGETWLSEDVDFDRVFVVGDSSGGNIAHQLAVRFGS  177

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
                + PVR+RGYV++APFFGG VRTKSE EGP EP LNL++LDRFWRLS+P G + DHP
Sbjct  178  DPTAIEPVRIRGYVLLAPFFGGEVRTKSE-EGPSEPTLNLDLLDRFWRLSMPVGESRDHP  236

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
             ANPFGP+SP+LE +KLDPILV+VGG E+LKDR E+YA +LK   K++ YV F+G +HGF
Sbjct  237  FANPFGPSSPNLEQLKLDPILVIVGGNELLKDRAEDYAKRLKGMGKDIKYVEFEGCEHGF  296

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
            FT+D +S V+ +V+  L+ FM
Sbjct  297  FTHDSYSQVAKEVIHILKRFM  317



>ref|XP_007015630.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY33249.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=331

 Score =   396 bits (1017),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 187/315 (59%), Positives = 241/315 (77%), Gaps = 7/315 (2%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRS  214
            + V++C G+L+VYSDGSI+RS     N P  V DD SV WKD LFD  H L L +YKP S
Sbjct  16   YEVDECRGVLRVYSDGSIWRSPKPSFNVP--VDDDGSVVWKDILFDPVHNLQLTLYKPAS  73

Query  215  SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAA  394
            S+SA   LPI ++ HGGGFC+GSR WPNC + C RL + LQA+V++PDYRLAPE+RLPAA
Sbjct  74   SSSA--KLPIFYYIHGGGFCIGSRAWPNCQNYCFRLSSELQAVVISPDYRLAPENRLPAA  131

Query  395  MDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMS  565
            ++D F  VKW+ AQA   + D WL D  DF+R F+ GDS+GGN+AH+LAV+LG GS +++
Sbjct  132  IEDGFMTVKWLQAQALAENPDPWLTDVADFSRVFICGDSAGGNIAHNLAVQLGAGSSDLA  191

Query  566  PVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFG  745
            PVRVRGYV++APFFGGTVRT+SEAEGP + FLN E++DRFWRLS+P G T DHPL NPFG
Sbjct  192  PVRVRGYVLLAPFFGGTVRTRSEAEGPKDAFLNWELIDRFWRLSIPIGDTTDHPLINPFG  251

Query  746  PASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPF  925
            P S SLE + LDPILV+VGG ++LKDR E YA +LK   K++DYV F+G+QHGFFT +P 
Sbjct  252  PVSRSLEHLNLDPILVVVGGSDLLKDRAEEYAKRLKDWGKKIDYVEFEGQQHGFFTINPN  311

Query  926  SDVSTQVLQQLQHFM  970
            S+ +  ++  ++ F+
Sbjct  312  SEPAKALMLIIKRFI  326



>ref|XP_006340439.1| PREDICTED: probable carboxylesterase 15-like [Solanum tuberosum]
Length=322

 Score =   395 bits (1014),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 239/315 (76%), Gaps = 6/315 (2%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRS  214
            + VE+C G+L+VYSDG+I R      +F  P+HDD S+ WKD +F   + L LR+YKP S
Sbjct  6    YEVEECRGVLRVYSDGTILRLTKP--SFEVPIHDDGSILWKDVVFQAMYNLQLRLYKPAS  63

Query  215  SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAA  394
              SAA  LP+ ++ HGGGFC+GSRTWPNC + C +L + LQA+V++PDYRLAPE+RLPAA
Sbjct  64   PISAA-KLPVFYYIHGGGFCIGSRTWPNCQNYCFKLASELQAVVISPDYRLAPENRLPAA  122

Query  395  MDDAFCAVKWVAAQASTD---AWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMS  565
            ++D + AVKW+  QA +D    WL D  DF+R F+ GDS+GGN+AH+LAVRL  GS E+ 
Sbjct  123  IEDGYAAVKWLQDQAVSDEPDKWLTDVADFSRVFISGDSAGGNIAHNLAVRLQAGSAELD  182

Query  566  PVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFG  745
            PVRVRGYV + PFFGGT+RTK EAEGP + FLN+E++DRFWRLS+P G T DHPL NPFG
Sbjct  183  PVRVRGYVYLLPFFGGTIRTKFEAEGPKDAFLNIELIDRFWRLSIPIGSTTDHPLVNPFG  242

Query  746  PASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPF  925
            P SP+LE + LDPILV+VGG ++LKDR ++YA KLK   K ++YV F+G+QHGFFT DP 
Sbjct  243  PKSPNLENIDLDPILVLVGGCDLLKDRAKDYANKLKNYGKNIEYVEFEGQQHGFFTIDPN  302

Query  926  SDVSTQVLQQLQHFM  970
            S+ S +++  ++ F+
Sbjct  303  SESSKKLMLIIKKFI  317



>gb|KGN48323.1| Gibberellin receptor GID1 [Cucumis sativus]
Length=320

 Score =   395 bits (1014),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/322 (59%), Positives = 239/322 (74%), Gaps = 10/322 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VEDC G+LQ+YSDG++ RS   +I+FPFP+  D+SV ++D L+  +H L+LR+
Sbjct  1    MGSLPHIVEDCMGVLQLYSDGTVSRS--HNIHFPFPLTLDSSVLFRDVLYQPSHALHLRL  58

Query  200  YKP----RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            YKP     SS +    LPI+FFFHGGGFCVGSR+WPN H+CC+RL  GL ALV+APDYRL
Sbjct  59   YKPAPSTTSSPTTNKKLPILFFFHGGGFCVGSRSWPNSHNCCVRLALGLGALVIAPDYRL  118

Query  368  APEHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            APEHRLPAA++D   A++WV+     D W+++  D  R FV+GDSSGGN+AHHLAVR+G 
Sbjct  119  APEHRLPAAVEDGAKAIEWVSKAGKLDEWIEESGDLQRVFVMGDSSGGNIAHHLAVRIGT  178

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
               E     VRG+V+MAPFFGG  RTKSE EGP E F +LE LDRFWRLSLP G   DHP
Sbjct  179  ---ENEKFGVRGFVLMAPFFGGVGRTKSE-EGPAEQFFDLEALDRFWRLSLPIGEDRDHP  234

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            LANPFG +S SLE V L+PILV+VGG E+LKDR E YA  L Q  K ++YV F GKQHGF
Sbjct  235  LANPFGASSMSLEEVNLEPILVIVGGDEMLKDRAETYAKTLSQLGKRIEYVEFDGKQHGF  294

Query  908  FTNDPFSDVSTQVLQQLQHFMI  973
            FTN   + ++ QV+  ++ FM+
Sbjct  295  FTNSQDTQLAHQVIAIIKKFML  316



>gb|KEH24302.1| gibberellin receptor GID1, putative [Medicago truncatula]
Length=323

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/322 (59%), Positives = 238/322 (74%), Gaps = 9/322 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPHVVEDC G LQ+YSDGSI+RS D    F  P  +D SV +KD LFD+   L +R+
Sbjct  1    MGSLPHVVEDCMGFLQLYSDGSIYRSND--FKFQIPTIEDNSVTFKDCLFDKKFNLSIRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YK   + +    LP+I F HGGGFC GSRTWP+ H+CC+ L  GLQALV+APDYRLAPEH
Sbjct  59   YK--PNNNKNKKLPVIMFLHGGGFCFGSRTWPHIHNCCMSLATGLQALVIAPDYRLAPEH  116

Query  380  RLPAAMDDAFCAVKWVAAQAST----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            RLPAA+DDA  AV+W+  Q  +    + WL   VDF R F++GDSSGGN+AH LAVR G 
Sbjct  117  RLPAAIDDAVEAVRWLQRQGLSHGYGEPWLTGDVDFGRVFIMGDSSGGNIAHQLAVRFGS  176

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
                + PVR+RGYV+MAPFFGG +RT+SE EGP E  LNL++LDRFWRLS+P G T DHP
Sbjct  177  DRMAIEPVRIRGYVLMAPFFGGEIRTESE-EGPSEQTLNLDLLDRFWRLSMPVGETRDHP  235

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            LANPFG  SP+LE +KLDPILV+VGG E+LKDR  NYA +LK   K++ Y+ F+G +HGF
Sbjct  236  LANPFGHGSPNLEEMKLDPILVIVGGNELLKDRAANYATRLKGIGKDIKYIEFEGCEHGF  295

Query  908  FTNDPFSDVSTQVLQQLQHFMI  973
            FT+D +S+ + +VL  L+ FM+
Sbjct  296  FTHDSYSETAKEVLHVLKQFML  317



>ref|XP_008462636.1| PREDICTED: probable carboxylesterase 15 [Cucumis melo]
Length=323

 Score =   394 bits (1011),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/325 (59%), Positives = 241/325 (74%), Gaps = 13/325 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VEDC G+LQ+YSDG++ RS  ++I+FPFP+  D SV ++D L+D +H L+LR+
Sbjct  1    MGSLPHIVEDCMGVLQLYSDGTVSRS--DNIHFPFPITLDTSVVFRDVLYDASHALHLRL  58

Query  200  YKPRSSA-------SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPD  358
            YKP SS+       +    LPI+FFFHGGGFCVGSR+WPN H+CC+RL  GL ALV+APD
Sbjct  59   YKPPSSSSSSSSSPTTNKKLPILFFFHGGGFCVGSRSWPNSHNCCVRLALGLDALVIAPD  118

Query  359  YRLAPEHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVR  538
            YRLAPEHRLPAA++D   A++WV      D W+++  D  R FV+GDSSGGN+AHHLAVR
Sbjct  119  YRLAPEHRLPAAVEDGVKAIEWVRKAGKLDEWIEESGDLKRVFVMGDSSGGNIAHHLAVR  178

Query  539  LGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTP  718
            +G+   E     VRG+V+MAPFFGG  RTKSE EGP E   +LE LDRFWRLSLP G   
Sbjct  179  IGI---ENEKFGVRGFVLMAPFFGGVRRTKSE-EGPAEQLFDLEALDRFWRLSLPIGEDR  234

Query  719  DHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQ  898
            DHPLANPFG +S SLE VKL+PILV+VGG E+LKDR ENYA  L Q  K ++YV F+GKQ
Sbjct  235  DHPLANPFGASSMSLEEVKLEPILVIVGGDEMLKDRAENYAKTLSQLGKRIEYVEFEGKQ  294

Query  899  HGFFTNDPFSDVSTQVLQQLQHFMI  973
            HGFFTN     +  QV+  ++ FM+
Sbjct  295  HGFFTNSQDPQLGHQVIAIIKKFML  319



>emb|CAN74724.1| hypothetical protein VITISV_037263 [Vitis vinifera]
Length=317

 Score =   393 bits (1010),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/321 (59%), Positives = 242/321 (75%), Gaps = 10/321 (3%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            S P+ VE+C G+L+VYSDGSI RS     +F  PVHDD SV WKD LFD  H L LR+YK
Sbjct  2    SSPYQVEECRGVLRVYSDGSIVRSSQP--SFAVPVHDDGSVLWKDVLFDPQHDLQLRLYK  59

Query  206  PRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
            P   AS +  LPI ++ HGGGFC+GSRTWPNC + C RL + LQA+V++PDYRLAPE+RL
Sbjct  60   P---ASPSAKLPIFYYIHGGGFCIGSRTWPNCQNYCFRLASELQAVVISPDYRLAPENRL  116

Query  386  PAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSP  556
            PAA++D + AVKW+ AQA   + D WL +  DF R F+ GDS+GGN+AHHLAV+LG  S 
Sbjct  117  PAAIEDGYKAVKWLQAQALAENPDTWLTEVADFGRVFISGDSAGGNIAHHLAVQLG--SL  174

Query  557  EMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLAN  736
            E++PV VRGYV++ PFFGGTVRTKSEAEGP + FLNLE++DRFWRLS+  G T D PL N
Sbjct  175  ELAPVGVRGYVLLGPFFGGTVRTKSEAEGPKDAFLNLELIDRFWRLSITIGDTTDDPLVN  234

Query  737  PFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTN  916
            PFGP SPSLE V L PILV+ GG ++LKDR E+YA +LKQ  K+++YV F+G+QHGFFT 
Sbjct  235  PFGPLSPSLEPVDLLPILVVAGGSDLLKDRAEDYAKRLKQWGKKIEYVEFEGQQHGFFTI  294

Query  917  DPFSDVSTQVLQQLQHFMISK  979
             P S+ + +++  ++ F+I  
Sbjct  295  FPTSEAANKLMLIIKRFVIEN  315



>ref|XP_004162022.1| PREDICTED: probable carboxylesterase 15-like [Cucumis sativus]
Length=320

 Score =   393 bits (1010),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 239/316 (76%), Gaps = 7/316 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P  V++C G+L+VYSDGSI RS +   +F  PV DD SV WKD LFD  H L+LR+YKP 
Sbjct  4    PIEVDECRGVLRVYSDGSIVRSSNP--SFSVPVLDDGSVLWKDLLFDPIHNLHLRLYKPA  61

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
              +S    LP+ F+ HGGGFC+GSRTWPNC + C RL + L ALV++PDYRLAPE+RLPA
Sbjct  62   HISSP--KLPVFFYIHGGGFCIGSRTWPNCQNYCFRLASELSALVISPDYRLAPENRLPA  119

Query  392  AMDDAFCAVKWVAAQASTD---AWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A+DD F A++W+ AQA +D    WL +  DF+  F+ GDS+GGN+AHHLAV LGVGSPE+
Sbjct  120  AIDDGFAALRWLQAQAESDHPDPWLAEVADFSTVFISGDSAGGNIAHHLAVGLGVGSPEL  179

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +PV+VRGYV++ PFFGGTVRT+SEAEG  E FLNLE++DRFWRLS+P G   DHPL N F
Sbjct  180  APVQVRGYVLLGPFFGGTVRTRSEAEGSKEAFLNLELIDRFWRLSIPIGSNTDHPLVNVF  239

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP S +LEAV++DPI+V+V G ++LKDR   Y  +LK+Q K++D V F+ KQHGFFT DP
Sbjct  240  GPTSLNLEAVEMDPIVVVVAGADLLKDRAVEYVEELKKQGKKIDLVEFEEKQHGFFTIDP  299

Query  923  FSDVSTQVLQQLQHFM  970
             S+ S Q++  + HF+
Sbjct  300  NSEASNQLMLLINHFV  315



>ref|XP_007132516.1| hypothetical protein PHAVU_011G100900g [Phaseolus vulgaris]
 gb|ESW04510.1| hypothetical protein PHAVU_011G100900g [Phaseolus vulgaris]
Length=327

 Score =   393 bits (1010),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 239/314 (76%), Gaps = 7/314 (2%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            VVE+C G+L VY+DGSI RS     N P  V+DD  V WKD +FD TH L LR+YKP  S
Sbjct  11   VVEECRGVLHVYTDGSIVRSSRPSFNVP--VNDDGIVLWKDVVFDPTHNLQLRLYKPAHS  68

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
            A +   LP+ +FFHGGGFC+GSRTWPN  + C +L + L A+VVAP+YRLAPE+RLPAA+
Sbjct  69   AGS--KLPVFYFFHGGGFCIGSRTWPNWQNYCFQLTSQLPAVVVAPEYRLAPENRLPAAI  126

Query  398  DDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP  568
            +D F AVKW+ AQA +   D WL    DF+R F+ GDS+GGN+AHHLA  LG+ SPE++P
Sbjct  127  EDGFTAVKWLQAQAVSNEPDPWLSHVADFSRLFISGDSAGGNMAHHLAAGLGLASPELAP  186

Query  569  VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGP  748
            VRVRGY+++ PFF GT+RTKSEAEGP + FLNLE++DR+WRL LP G T DHPL NPFG 
Sbjct  187  VRVRGYLLLGPFFCGTMRTKSEAEGPKDAFLNLELIDRYWRLCLPVGETTDHPLVNPFGA  246

Query  749  ASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFS  928
             S SLE  KLDPILV+  G ++LKDR E+YA +LK+  K+V+YV F+G+QHGFFTNDP S
Sbjct  247  HSKSLEGTKLDPILVVAAGSDLLKDRTEDYAKRLKEWGKDVEYVEFEGQQHGFFTNDPNS  306

Query  929  DVSTQVLQQLQHFM  970
            + ST+++Q ++ F+
Sbjct  307  EASTKLMQVVKQFV  320



>ref|XP_004142252.1| PREDICTED: probable carboxylesterase 15-like [Cucumis sativus]
 gb|KGN54059.1| hypothetical protein Csa_4G279870 [Cucumis sativus]
Length=320

 Score =   392 bits (1008),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 239/316 (76%), Gaps = 7/316 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P  V++C G+L+VYSDGSI RS +   +F  PV DD SV WKD LFD  H L+LR+YKP 
Sbjct  4    PIEVDECRGVLRVYSDGSIVRSSNP--SFSVPVLDDGSVLWKDLLFDPIHNLHLRLYKPA  61

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
              +S    LP+ F+ HGGGFC+GSRTWPNC + C RL + L ALV++PDYRLAPE+RLPA
Sbjct  62   HISSP--KLPVFFYIHGGGFCIGSRTWPNCQNYCFRLASELSALVISPDYRLAPENRLPA  119

Query  392  AMDDAFCAVKWVAAQASTD---AWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A+DD F A++W+ AQA +D    WL +  DF+  F+ GDS+GGN+AHHLAV LGVGSPE+
Sbjct  120  AIDDGFAALRWLQAQAESDHPDPWLAEVADFSTVFISGDSAGGNIAHHLAVGLGVGSPEL  179

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +PV+VRGYV++ PFFGGTVRT+SEAEG  E FLNLE++DRFWRLS+P G   DHPL N F
Sbjct  180  APVQVRGYVLLGPFFGGTVRTRSEAEGSKEAFLNLELIDRFWRLSIPIGSNTDHPLVNVF  239

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP S +LEAV++DPI+V+V G ++LKDR   Y  +LK+Q K++D V F+ KQHGFFT DP
Sbjct  240  GPRSLNLEAVEMDPIVVVVAGADLLKDRAVEYVEELKKQGKKIDLVEFEEKQHGFFTIDP  299

Query  923  FSDVSTQVLQQLQHFM  970
             S+ S Q++  + HF+
Sbjct  300  NSEASNQLMLLINHFV  315



>ref|XP_010677607.1| PREDICTED: probable carboxylesterase 15 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=352

 Score =   392 bits (1008),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 190/350 (54%), Positives = 252/350 (72%), Gaps = 32/350 (9%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVH----------WKDSLF  169
            MGSL  VVEDC G+LQ+YSDGS+ R  + DI+F    HD   +H          W+D +F
Sbjct  1    MGSLAEVVEDCFGVLQLYSDGSVNRVNECDIDFG--DHDKKGIHDIVEEGWLVEWEDFMF  58

Query  170  DRTHGLYLRIYKPRSSASAAVS---LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQA  340
            +  H LYLR+YKP +   +  +   LPI+++ HGGGFC+GSRTWPNCH+ CLRL   LQA
Sbjct  59   EEKHQLYLRVYKPSNKNISINNNKKLPILYYIHGGGFCLGSRTWPNCHNTCLRLSYQLQA  118

Query  341  LVVAPDYRLAPEHRLPAAMDDAFCAVKWVAAQA-----------------STDAWLKDGV  469
            +V+APDYRLAPEH+LPAA++D   A+ W+ +QA                 + +  L+DGV
Sbjct  119  IVIAPDYRLAPEHKLPAAIEDGLNALNWLQSQAKRIKEVRLGEEYYNDQNTCNKLLEDGV  178

Query  470  DFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPP  649
            DF   F++GDSSGGN+AHH+AVRLG GS +++PVRV GYV++APFFGG++RTKSEA+GPP
Sbjct  179  DFESVFIMGDSSGGNIAHHMAVRLGSGSLKLAPVRVCGYVLLAPFFGGSLRTKSEADGPP  238

Query  650  EPFLNLEILDRFWRLSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRV  829
            EP L LE LDRFWRL LP G   DHP+ANPFG +SP+L+ V LDPILV+VGG+E++KDRV
Sbjct  239  EPILTLESLDRFWRLCLPRGEGRDHPVANPFGHSSPNLDMVSLDPILVIVGGKEIMKDRV  298

Query  830  ENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFMISK  979
            E+YA +LK+  K++ Y  F+G+ HGFFT++P S VS Q+L+  + FM +K
Sbjct  299  EDYARRLKELGKDITYAKFEGQHHGFFTHNPCSHVSHQLLELAKRFMFAK  348



>ref|XP_010263117.1| PREDICTED: probable carboxylesterase 15 [Nelumbo nucifera]
Length=327

 Score =   391 bits (1005),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/316 (57%), Positives = 244/316 (77%), Gaps = 7/316 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P+ VEDC G+L++YSDGSI RS  +  +F  PV DD SV WKD LFD T+ L+L++YKP 
Sbjct  11   PYEVEDCRGVLRLYSDGSIVRS--DQPSFVVPVPDDGSVFWKDVLFDPTNNLHLQLYKPA  68

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
            S +     LP+ ++ HGGGFC+G+RTWP+C S CLRL + LQA+V++PDYRL PEHRLPA
Sbjct  69   SPSP--TKLPVFYYIHGGGFCIGARTWPHCQSYCLRLASHLQAVVISPDYRLGPEHRLPA  126

Query  392  AMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A+DD F AV W+ AQA +   D WL    DF R F+ GDS+GGN+AH+LAVRL  GS ++
Sbjct  127  AIDDGFTAVMWLQAQAVSENPDPWLTGVADFGRVFISGDSAGGNIAHNLAVRLADGSAQL  186

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +P+R+RG+V++APFFGGTVRT+SEAEGP E FLNLE++DR+WRLS+P G   DHPL NPF
Sbjct  187  APLRIRGFVLLAPFFGGTVRTRSEAEGPTEAFLNLELIDRYWRLSIPVGDNADHPLVNPF  246

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GPASP LE V+  P+LV+VG  ++L+DR+E+YA +LK+  K+V+YV F+GKQHGFFT +P
Sbjct  247  GPASPILEPVEFGPVLVVVGSSDLLRDRIEDYARRLKELGKKVEYVEFEGKQHGFFTIEP  306

Query  923  FSDVSTQVLQQLQHFM  970
             S+ + ++++  + F+
Sbjct  307  NSEAANELMRVTKRFI  322



>ref|XP_009778712.1| PREDICTED: probable carboxylesterase 15 [Nicotiana sylvestris]
Length=327

 Score =   391 bits (1005),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/316 (57%), Positives = 235/316 (74%), Gaps = 6/316 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            PH VE+C G+L+VYSDG+I RS     +F  P+  D SV W D +FD  H L LR+YKP 
Sbjct  10   PHEVEECRGVLRVYSDGTIVRSSKP--SFEVPIQYDGSVLWIDVVFDAMHNLQLRLYKPT  67

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
               SA   LPI ++ HGGGFC+GSRTWPNC + C +L + LQA++++PDYRLAPE+RLP 
Sbjct  68   FPTSAN-KLPIFYYIHGGGFCIGSRTWPNCQNYCFKLASELQAVIISPDYRLAPENRLPT  126

Query  392  AMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A++D + A+KW+  QA +   D WL D  DF+R F+ GDS+GGN+AH+LAVRL  GS E+
Sbjct  127  AIEDGYMAIKWLQDQAVSNEPDTWLTDVADFSRVFISGDSAGGNIAHNLAVRLKAGSAEL  186

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +PVRVRGYV + PFFGGT RTK EAEGP E FLN+E++DRFWRLS+P G T DHPL NPF
Sbjct  187  APVRVRGYVYLLPFFGGTTRTKFEAEGPKEAFLNIELIDRFWRLSIPIGETTDHPLVNPF  246

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP SP LE + LDPILV+VGG ++LKDR E+YA +LK+  K+++YV F+G+QHGFFT  P
Sbjct  247  GPNSPDLEKIDLDPILVIVGGCDLLKDRAEDYAKRLKEWGKKIEYVEFEGQQHGFFTIYP  306

Query  923  FSDVSTQVLQQLQHFM  970
             SD S +++  +  F+
Sbjct  307  NSDPSKKLMLTINKFI  322



>ref|XP_004251433.1| PREDICTED: probable carboxylesterase 15 [Solanum lycopersicum]
Length=322

 Score =   390 bits (1003),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 238/315 (76%), Gaps = 6/315 (2%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRS  214
            + VE+C G+L VYSDG+I R      +F  P+HDD S+ WKD +F   H L LR+YKP +
Sbjct  6    YEVEECRGVLWVYSDGTILRLTKP--SFEVPIHDDGSILWKDVVFQAMHDLQLRLYKPAN  63

Query  215  SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAA  394
              S+A  LP+ ++ HGGGFC+GSRTWPNC + C +L + LQA+V++PDYRLAPE+RLPAA
Sbjct  64   PTSSA-KLPVFYYIHGGGFCIGSRTWPNCQNYCFKLASELQAVVISPDYRLAPENRLPAA  122

Query  395  MDDAFCAVKWVAAQASTD---AWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMS  565
            ++D + AVKW+  QA +D    WL D  DF+R F+ GDS+GGN+AH+LA+RL  GS E+ 
Sbjct  123  IEDGYAAVKWLRDQAVSDEPDTWLTDVADFSRVFISGDSAGGNIAHNLALRLKAGSAELD  182

Query  566  PVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFG  745
            PVRVRGYV + PFFGGT+RTK EAEGP + FLN+E++DRFWRLS+P G T DHPL NPFG
Sbjct  183  PVRVRGYVYLLPFFGGTIRTKFEAEGPKDAFLNIELIDRFWRLSIPIGSTTDHPLVNPFG  242

Query  746  PASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPF  925
            P SP+LE + LDPILV+VGG ++LKDR ++YA KLK   K ++YV F+G+QHGFFT +P 
Sbjct  243  PNSPNLEKIDLDPILVLVGGCDLLKDRAKDYANKLKNYGKNIEYVEFEGQQHGFFTINPN  302

Query  926  SDVSTQVLQQLQHFM  970
            S+ S +++  ++ F+
Sbjct  303  SESSKKLMLIIKKFI  317



>emb|CDP15587.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 239/316 (76%), Gaps = 6/316 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P+ V++C G+L+VYSDGSI RS     +F  PV DD SV WKD+ FD    L LR+YKP 
Sbjct  20   PYEVDECRGVLRVYSDGSIVRSTKP--SFEVPVEDDGSVLWKDAFFDPERNLQLRLYKP-  76

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
            ++A+++  LPI ++ HGGGFC+GSR WPNC + C +L   L+A++++PDYRLAPE+RLPA
Sbjct  77   ATATSSKKLPIFYYIHGGGFCIGSRAWPNCQNYCFKLAKELEAVIISPDYRLAPENRLPA  136

Query  392  AMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A++D F AVKW+ AQA     D WL D  DF   F+ GDS+GGN++H+LAV+LG GSP++
Sbjct  137  AIEDGFMAVKWLQAQAVAEEQDTWLTDVADFGSVFISGDSAGGNISHNLAVKLGAGSPQL  196

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +PVRV+GYV++APFFGGTV TKSEAEGP + FLN E++DRFWRLS+P G T DHPL NPF
Sbjct  197  APVRVKGYVLLAPFFGGTVVTKSEAEGPKDAFLNWELIDRFWRLSVPAGETTDHPLINPF  256

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP SP+LE   LDPILV+  G ++LKDRVE YA KLK   K+V+Y  F+G+QHGFFT +P
Sbjct  257  GPLSPNLEIADLDPILVVCAGSDLLKDRVEEYAKKLKGWGKKVEYEEFEGQQHGFFTINP  316

Query  923  FSDVSTQVLQQLQHFM  970
             S+ S +++  ++ F+
Sbjct  317  NSEASKKLMGIIKQFI  332



>gb|EPS60690.1| hypothetical protein M569_14110 [Genlisea aurea]
Length=320

 Score =   388 bits (997),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/324 (59%), Positives = 242/324 (75%), Gaps = 10/324 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            M SLP VVED  GI+Q++SDG+I RS +  I+FP  VHDD +  WKD+LFD  + L LR+
Sbjct  1    MSSLPRVVEDILGIIQLFSDGTILRSPE--IDFPMKVHDDGTAIWKDALFDEKNDLRLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            Y+PR  +     LP++F+  GGGFC+GSRTWPN H+CCLRL + L  LVVAPDYR APE+
Sbjct  59   YRPRRHSG----LPVLFYLRGGGFCIGSRTWPNVHTCCLRLASSLGVLVVAPDYRSAPEN  114

Query  380  RLPAAMDDAFCAVKWVAAQA----STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            RLPAA++D+  A+KWV  QA      D WL +GVDF R FV GDSSGGN+AHHLAV L  
Sbjct  115  RLPAAVEDSVAALKWVREQAVDGAEGDEWLGNGVDFGRMFVFGDSSGGNLAHHLAVELRR  174

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            GSPE +P+ VRGY++MAPFFGG+ RTKSE  GP EPF+++++LDRFWRLSLP G T D P
Sbjct  175  GSPEFAPLHVRGYILMAPFFGGSARTKSEDAGPTEPFISVDLLDRFWRLSLPVGSTLDSP  234

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            L+NPFGP SP+LE V L PI+VMVGG EV+KDRVE Y  +LK   KE++YVVF+G+ HGF
Sbjct  235  LSNPFGPGSPNLENVNLAPIMVMVGGNEVMKDRVEAYYERLKAMGKEIEYVVFEGQFHGF  294

Query  908  FTNDPFSDVSTQVLQQLQHFMISK  979
            F N+ +S     VLQ+L  F+++ 
Sbjct  295  FLNESYSPAGDAVLQELNRFILNN  318



>ref|XP_007132515.1| hypothetical protein PHAVU_011G100800g [Phaseolus vulgaris]
 gb|ESW04509.1| hypothetical protein PHAVU_011G100800g [Phaseolus vulgaris]
Length=327

 Score =   388 bits (996),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 186/314 (59%), Positives = 241/314 (77%), Gaps = 7/314 (2%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            VVE+C G+L VYSDGSI RS     + P  V+DD +V WKD +F+  H L LR+YKP  +
Sbjct  11   VVEECRGVLHVYSDGSIVRSSRSSFSVP--VNDDGTVLWKDVVFNSAHDLQLRLYKP--A  66

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
             SA   LPI F+FHGGGFC+GSRTWPNC + C +L + L+ +VVAPDYRLAPE+RLP A+
Sbjct  67   GSAGSKLPIFFYFHGGGFCIGSRTWPNCQNYCFQLASQLRVIVVAPDYRLAPENRLPDAI  126

Query  398  DDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP  568
            +D F AVKW+ AQA +   D WL    DF+R F+ GDS+GGN+AHHLA  LG GSP+++P
Sbjct  127  EDGFTAVKWLQAQAVSNEPDPWLSHVADFSRVFISGDSAGGNIAHHLAAGLGFGSPKLAP  186

Query  569  VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGP  748
            VRVRGYV++APFFGGTVRTKSEAEGP + FLNLE++DRFWRLS+P G T D P+ NPFGP
Sbjct  187  VRVRGYVLLAPFFGGTVRTKSEAEGPKDAFLNLELIDRFWRLSIPIGKTTDDPIVNPFGP  246

Query  749  ASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFS  928
             S SLE + LDPILV+ GG ++LKDR E+YA +LK+  K+++Y+ F+G+QHGFFT DP S
Sbjct  247  KSESLEGINLDPILVVAGGSDLLKDRAEDYARRLKEWGKDIEYLEFEGQQHGFFTIDPNS  306

Query  929  DVSTQVLQQLQHFM  970
            + S +++  ++HF+
Sbjct  307  EPSNKLMFIIKHFI  320



>ref|XP_003527508.1| PREDICTED: probable carboxylesterase 15-like isoform 1 [Glycine 
max]
Length=329

 Score =   388 bits (996),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 184/315 (58%), Positives = 237/315 (75%), Gaps = 7/315 (2%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            VVEDC G+L VY+DGSI RS     N P  ++DD +V WKD +FD    L LR+YKP + 
Sbjct  11   VVEDCRGVLHVYNDGSIVRSSRPSFNVP--INDDGTVLWKDVVFDTALDLQLRLYKP-AD  67

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
             SA   LPI  + HGGGFC+GSRTWPNC + C +L + L+A+VVAPDYRLAPE+RLP A+
Sbjct  68   DSAGSKLPIFIYIHGGGFCIGSRTWPNCQNYCFQLTSRLRAVVVAPDYRLAPENRLPDAI  127

Query  398  DDAFCAVKWVAAQASTDA---WLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP  568
            +D F A+KW+  QA +D    WL    DF+  ++ GDS+GGN+AHHLA RLG GSPE+ P
Sbjct  128  EDGFEALKWLQTQAVSDEPDPWLSHVADFSHVYISGDSAGGNIAHHLAARLGFGSPELDP  187

Query  569  VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGP  748
            VRVRGYV++APFFGGT+RTKSEAEGP + FLNLE++DRFWRLS+P G T DHPL NPFGP
Sbjct  188  VRVRGYVLLAPFFGGTIRTKSEAEGPKDAFLNLELIDRFWRLSIPIGETTDHPLVNPFGP  247

Query  749  ASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEVDYVVFQGKQHGFFTNDPF  925
             S SLEA+  DPILV+ GG ++LKDR E+YA +LK+  NK+++YV F+G+QHGFFT  P 
Sbjct  248  YSQSLEAIDFDPILVVAGGSDLLKDRAEDYAKRLKEWGNKDIEYVEFEGQQHGFFTIYPN  307

Query  926  SDVSTQVLQQLQHFM  970
            S+ S +++  ++ F+
Sbjct  308  SEPSNKLMLIIKQFI  322



>ref|XP_010677606.1| PREDICTED: probable carboxylesterase 15 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=353

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 190/351 (54%), Positives = 252/351 (72%), Gaps = 33/351 (9%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVH----------WKDSLF  169
            MGSL  VVEDC G+LQ+YSDGS+ R  + DI+F    HD   +H          W+D +F
Sbjct  1    MGSLAEVVEDCFGVLQLYSDGSVNRVNECDIDFG--DHDKKGIHDIVEEGWLVEWEDFMF  58

Query  170  DRTHGLYLRIYKPRSSASAAVS---LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQA  340
            +  H LYLR+YKP +   +  +   LPI+++ HGGGFC+GSRTWPNCH+ CLRL   LQA
Sbjct  59   EEKHQLYLRVYKPSNKNISINNNKKLPILYYIHGGGFCLGSRTWPNCHNTCLRLSYQLQA  118

Query  341  LVVAPDY-RLAPEHRLPAAMDDAFCAVKWVAAQA-----------------STDAWLKDG  466
            +V+APDY RLAPEH+LPAA++D   A+ W+ +QA                 + +  L+DG
Sbjct  119  IVIAPDYSRLAPEHKLPAAIEDGLNALNWLQSQAKRIKEVRLGEEYYNDQNTCNKLLEDG  178

Query  467  VDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGP  646
            VDF   F++GDSSGGN+AHH+AVRLG GS +++PVRV GYV++APFFGG++RTKSEA+GP
Sbjct  179  VDFESVFIMGDSSGGNIAHHMAVRLGSGSLKLAPVRVCGYVLLAPFFGGSLRTKSEADGP  238

Query  647  PEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDR  826
            PEP L LE LDRFWRL LP G   DHP+ANPFG +SP+L+ V LDPILV+VGG+E++KDR
Sbjct  239  PEPILTLESLDRFWRLCLPRGEGRDHPVANPFGHSSPNLDMVSLDPILVIVGGKEIMKDR  298

Query  827  VENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFMISK  979
            VE+YA +LK+  K++ Y  F+G+ HGFFT++P S VS Q+L+  + FM +K
Sbjct  299  VEDYARRLKELGKDITYAKFEGQHHGFFTHNPCSHVSHQLLELAKRFMFAK  349



>gb|KEH29724.1| carboxylesterase [Medicago truncatula]
Length=318

 Score =   385 bits (990),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 236/314 (75%), Gaps = 6/314 (2%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            +V++C G+L VY+DGSI R+ +   N    V D  +V WKD +F  TH L+LR+YKP +S
Sbjct  5    IVDECRGVLHVYNDGSIVRTLNPAFNIT--VQDSGTVLWKDVVFSSTHNLHLRLYKPANS  62

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
             S +  LPI ++ HGGGFC+GSRTWPNC + C +L + L+A+VVAPDYRLAPE+RLP A+
Sbjct  63   -SPSKKLPIFYYIHGGGFCIGSRTWPNCQNYCFKLASELEAVVVAPDYRLAPENRLPCAI  121

Query  398  DDAFCAVKWV---AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP  568
            +D F AVKW+   A ++  D WL    DFNR F+ GDS+GGN+AH+LAVRLG GS E++P
Sbjct  122  EDGFMAVKWLQEEALKSEMDPWLSHVADFNRVFISGDSAGGNIAHNLAVRLGFGSVELAP  181

Query  569  VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGP  748
            VRVRGYV++APF GGTVRTKSEAEGP + FLNLE +DR+WRLS+P G   DHPL NPFGP
Sbjct  182  VRVRGYVLLAPFIGGTVRTKSEAEGPVDAFLNLEYIDRYWRLSIPIGEDTDHPLVNPFGP  241

Query  749  ASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFS  928
             S SLE + LDPILV+VG  ++LKDR E+YA +LK   K ++YV F+G+QHGFFT DP S
Sbjct  242  RSKSLEEIDLDPILVVVGENDLLKDRTEDYARRLKNWGKNIEYVEFEGQQHGFFTIDPNS  301

Query  929  DVSTQVLQQLQHFM  970
            + S +++  ++ F+
Sbjct  302  EPSKELMLVIKQFI  315



>gb|EYU36009.1| hypothetical protein MIMGU_mgv1a018241mg [Erythranthe guttata]
Length=335

 Score =   386 bits (992),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 241/315 (77%), Gaps = 7/315 (2%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRS  214
            H V++C G+L+VYSDGSI+RS     +F  PV DD SV WKD++FD  H L LR+YKP  
Sbjct  20   HEVDECRGVLRVYSDGSIWRSNKP--SFEMPVPDDGSVLWKDAVFDAAHSLQLRLYKPAK  77

Query  215  SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAA  394
             +S    LPI ++ HGGGFC+GSR WPNC + C +L + LQA+V++PDYRL+PE+RLPAA
Sbjct  78   PSSP--KLPIFYYIHGGGFCIGSRAWPNCQNYCFKLASQLQAVVISPDYRLSPENRLPAA  135

Query  395  MDDAFCAVKWVAAQASTD---AWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMS  565
            ++D + AVKW+ +QA+ D    WL D  DF+R F+ GDS+GGN+AH+LAVR G GS E++
Sbjct  136  IEDGYSAVKWLQSQATADEPDTWLTDAADFSRVFISGDSAGGNIAHNLAVRFGAGSAELT  195

Query  566  PVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFG  745
            PVRV+GYV +APFFGGTVRTK E +GP E FLN++++DRFWRLS+P G T DHPL NPFG
Sbjct  196  PVRVKGYVYLAPFFGGTVRTKFEDQGPKEAFLNIDLIDRFWRLSIPIGETTDHPLVNPFG  255

Query  746  PASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPF  925
            P SP+LE + LDPILV+VGG ++LKDR E YA KLK+  K+++YV F+G+QHGFFT +P 
Sbjct  256  PVSPNLETMDLDPILVIVGGSDLLKDRAEEYAKKLKKWGKKIEYVEFEGQQHGFFTINPD  315

Query  926  SDVSTQVLQQLQHFM  970
            S  S +++  ++ F+
Sbjct  316  SKPSQELMLVIKKFI  330



>ref|XP_004506248.1| PREDICTED: probable carboxylesterase 15-like [Cicer arietinum]
Length=321

 Score =   385 bits (989),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 178/314 (57%), Positives = 235/314 (75%), Gaps = 7/314 (2%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            +V++C G+L VYSDGSI R+ +   N P  V DD +V WKD +FD  H L LR+YKP  +
Sbjct  5    LVDECRGVLHVYSDGSIVRTANPAFNTP--VQDDGTVLWKDVVFDSAHDLQLRLYKP--A  60

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
             S    LPI ++ HGGGFC+GSRTWPNC + C +L + L  +VVAPDYRLAPE+RLP+A+
Sbjct  61   NSTVTKLPIFYYIHGGGFCIGSRTWPNCQNYCFQLSSQLGVVVVAPDYRLAPENRLPSAI  120

Query  398  DDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP  568
            DD F AVKW+  QA +   D+WL    DF+R F+ GDS+GGN+AHHLA RLG G+PE++P
Sbjct  121  DDGFKAVKWLQEQAVSSEPDSWLNHVADFSRVFISGDSAGGNIAHHLAARLGFGAPELAP  180

Query  569  VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGP  748
            V+VRGYV++APFFGGTV TKSEAEGP + FLN E++DR+WRLS+P G   DHPL NPFG 
Sbjct  181  VKVRGYVLLAPFFGGTVLTKSEAEGPKDAFLNYELIDRYWRLSIPIGENTDHPLVNPFGV  240

Query  749  ASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFS  928
             S +LE + LDPIL++VGG ++LKDR E+YA +LK   K +DYV F+G+QHGFFT DP S
Sbjct  241  HSNNLETIDLDPILLVVGGNDLLKDRAEDYARRLKNWGKNIDYVEFEGQQHGFFTIDPNS  300

Query  929  DVSTQVLQQLQHFM  970
            + + +++  ++ F+
Sbjct  301  EPAKELMLVIKQFI  314



>gb|ABB89016.1| CXE carboxylesterase [Actinidia deliciosa]
Length=326

 Score =   385 bits (989),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 188/317 (59%), Positives = 234/317 (74%), Gaps = 9/317 (3%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P+ V++C G+L+VYSDGSI RS     N P  VHDD SV WKD  FD TH L LR+YKP 
Sbjct  12   PYEVDECRGVLRVYSDGSIVRSPKPSFNVP--VHDDGSVLWKDVTFDATHNLQLRLYKP-  68

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
              ASA  SLPI ++ HGGGFC+GSR WPNC + C RL   L+A+VV+PDYRLAPE+RLPA
Sbjct  69   --ASATESLPIFYYIHGGGFCIGSRAWPNCQNYCFRLALALRAIVVSPDYRLAPENRLPA  126

Query  392  AMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A++D + AVKW+  QA     D WL    DF+R F+ GDS+GGN+AH+LAV LG GS E+
Sbjct  127  AIEDGYAAVKWLRDQAEAAEPDPWLAGVADFSRVFISGDSAGGNIAHNLAVGLGAGSAEL  186

Query  563  SP-VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANP  739
             P VRVRGYV++APFFGGTV T+SE+EGP E FLN E++DRFWRLS+P G T DH L NP
Sbjct  187  GPMVRVRGYVLLAPFFGGTVLTRSESEGPKEAFLNWELIDRFWRLSIPVGETTDHLLVNP  246

Query  740  FGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTND  919
            FGP S  LE++ LDPILV+VGG ++LKDR E+YA KLK   K+V YV F+G+ HGFFT D
Sbjct  247  FGPVSRPLESLDLDPILVVVGGSDLLKDRAEDYANKLKGWGKKVQYVEFEGQHHGFFTID  306

Query  920  PFSDVSTQVLQQLQHFM  970
            P S  S  +++ ++ F+
Sbjct  307  PNSQPSNDLMRIIKQFI  323



>gb|KHG17903.1| putative carboxylesterase 15 -like protein [Gossypium arboreum]
Length=330

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/319 (56%), Positives = 240/319 (75%), Gaps = 7/319 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            PH V++C G+L+VYSDGSI+RS     N P  V+DD S+ WKD +FD  H L LR+YKP 
Sbjct  14   PHEVDECRGVLRVYSDGSIWRSSKPSFNVP--VNDDGSILWKDIVFDPVHDLRLRLYKPA  71

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
            S +S    LP+ ++ HGGGFC+GSR WPNC + C RL + LQA+V++PDYRLAPE+RLPA
Sbjct  72   SPSSP--KLPVFYYIHGGGFCIGSRAWPNCQNYCFRLASNLQAVVISPDYRLAPENRLPA  129

Query  392  AMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            A++D F A+KW+ AQA   + D WL    DF++ F+ GDS+GG +AH+LAV+LG GS ++
Sbjct  130  AIEDGFMAMKWLQAQALANNPDPWLTGVADFSKVFISGDSAGGTIAHNLAVQLGAGSLDL  189

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +PV VRGYV++APFFGGTV T+SEAEGP + FLNLE++DRFWRLS+P G T DHPL NPF
Sbjct  190  APVLVRGYVLLAPFFGGTVLTRSEAEGPKDAFLNLELIDRFWRLSVPMGETTDHPLINPF  249

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP S  LE V LDPILV+VGG ++LKDR + YA +LK   K+++YV F+G+QHGFFT DP
Sbjct  250  GPVSRHLEQVNLDPILVVVGGNDLLKDRGKEYAERLKNWGKKIEYVEFEGQQHGFFTIDP  309

Query  923  FSDVSTQVLQQLQHFMISK  979
             S+ +  ++  ++ F++  
Sbjct  310  NSEPAKALMVIIKRFIVEN  328



>ref|XP_004143400.1| PREDICTED: LOW QUALITY PROTEIN: probable carboxylesterase 15-like 
[Cucumis sativus]
Length=315

 Score =   384 bits (986),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/322 (59%), Positives = 235/322 (73%), Gaps = 15/322 (5%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VEDC G+LQ+YSDG++ RS   +I+FPFP+  D+SV ++D L+  +H L+LR+
Sbjct  1    MGSLPHIVEDCMGVLQLYSDGTVSRS--HNIHFPFPLTLDSSVLFRDVLYQPSHALHLRL  58

Query  200  YKP----RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            YKP     SS +    LPI+FFFHGGGFCVGSR+WPN H+CC+RL  GL ALV+APDYRL
Sbjct  59   YKPAPSTTSSPTTNKKLPILFFFHGGGFCVGSRSWPNSHNCCVRLALGLGALVIAPDYRL  118

Query  368  APEHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            APEHRLPAA D      +WV+     D W+++  D  R FV+GDSSGGN+AHHLAVR+G 
Sbjct  119  APEHRLPAAGD-----XEWVSKAGKLDEWIEESGDLQRVFVMGDSSGGNIAHHLAVRIGT  173

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
               E     VRG+V+MAPFFGG  RTKSE EGP E F +LE LDRFWRLSLP G   DHP
Sbjct  174  ---ENEKFGVRGFVLMAPFFGGVGRTKSE-EGPAEQFFDLEALDRFWRLSLPIGEDRDHP  229

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            LANPFG +S SLE V L+PILV+VGG E+LKDR E YA  L Q  K ++YV F GKQHGF
Sbjct  230  LANPFGASSMSLEEVNLEPILVIVGGDEMLKDRAETYAKTLSQLGKRIEYVEFDGKQHGF  289

Query  908  FTNDPFSDVSTQVLQQLQHFMI  973
            FTN   + ++ QV+  ++ FM+
Sbjct  290  FTNSQDTQLAHQVIAIIKKFML  311



>ref|XP_007031033.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY11535.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=324

 Score =   384 bits (986),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/326 (58%), Positives = 247/326 (76%), Gaps = 10/326 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPHVVEDC G+L++YSDGSI  S++ +I    P+ +DASV +KD LFD    L+LR+
Sbjct  1    MGSLPHVVEDCFGLLKLYSDGSI--SRNPEIPSATPLLNDASVLYKDFLFDSKENLHLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP SS +A   LPI+F+FHGGGFC GSR++P+ H+  +RL A    LV+APD+RLAPE+
Sbjct  59   YKPTSS-TAHAKLPILFYFHGGGFCFGSRSFPHFHNLSIRLAAAFNMLVIAPDHRLAPEN  117

Query  380  RLPAAMDDAFCAVKWVAAQA------STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRL  541
            RLPAA+DDA  A+KW+  QA        D  L  GVDF+R FVLGDSSGGN+AHHLAVR 
Sbjct  118  RLPAAVDDACQALKWLQGQAMHGNDEDMDTLLT-GVDFDRVFVLGDSSGGNLAHHLAVRF  176

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
              GS E++PVRVRGYV++APFFGG VRT+SE E P E F NLE+ +RFWRLS+P G T D
Sbjct  177  KAGSIELAPVRVRGYVLLAPFFGGIVRTRSEEERPCEAFWNLEMYERFWRLSIPAGSTLD  236

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HPL NPFGP+  +L  V LDPILV+VGG E+L+DRVE+YA +LK   K+ ++V F+G+QH
Sbjct  237  HPLVNPFGPSGQNLAEVPLDPILVVVGGGEILRDRVEDYAARLKHLGKKTEFVEFEGQQH  296

Query  902  GFFTNDPFSDVSTQVLQQLQHFMISK  979
            GF T+ PFS+V+ +V+Q+++ F++  
Sbjct  297  GFLTDHPFSEVAEKVIQRIRDFILEN  322



>ref|XP_003535834.1| PREDICTED: probable carboxylesterase 15-like [Glycine max]
Length=332

 Score =   384 bits (985),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 187/330 (57%), Positives = 237/330 (72%), Gaps = 18/330 (5%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINF---PFPVHDDASVHWKDSLFDRTHGLYLRIY  202
            PHVVEDC G+L++ SDG++ RS   +INF   P P   D  V +KD +F +   L+LR Y
Sbjct  5    PHVVEDCMGLLKLLSDGTVLRS---NINFQEQPQPTQHDNLVQFKDFVFLKKFNLHLRFY  61

Query  203  KPRSSASAAVS--------LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPD  358
            KP+   +            LP++ F HGGGFC GSR WP+ HSCC+RL   L+A VVAPD
Sbjct  62   KPKFEDNDDDDNENNNKKLLPVVMFLHGGGFCFGSRAWPHMHSCCVRLATSLRAAVVAPD  121

Query  359  YRLAPEHRLPAAMDDAFCAVKWVAAQAS---TDAWLKDGVDFNRAFVLGDSSGGNVAHHL  529
            YRLAPEHRLPAA+DD   AV+W+  Q      D W+  GVDF+R F+LGDSSGGN+AHHL
Sbjct  122  YRLAPEHRLPAAVDDGVEAVRWLQRQKGHHGGDEWVTRGVDFDRVFILGDSSGGNIAHHL  181

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            AV+LG GS EM PVRVRGYV++ PFFGG VRT+SE  GPPE  L LE+LDRFWRLS+P G
Sbjct  182  AVQLGPGSREMDPVRVRGYVLLGPFFGGVVRTRSEV-GPPEQMLTLELLDRFWRLSIPIG  240

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQ  889
             T DHPLANPFGP SP+L  VKLDPILV+VGG E+LKDR  +YA +L++Q K ++YV F+
Sbjct  241  ETRDHPLANPFGPNSPNLGHVKLDPILVIVGGNELLKDRAADYATRLREQGKNIEYVEFE  300

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFMISK  979
            GK+HGF T+D  S+ + +++Q ++ FM+  
Sbjct  301  GKEHGFLTHDSHSEAAEELVQIIKRFMLEN  330



>gb|KHN41247.1| Putative carboxylesterase 15 [Glycine soja]
Length=321

 Score =   380 bits (976),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 181/312 (58%), Positives = 232/312 (74%), Gaps = 9/312 (3%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            VVEDC G+L VY+DGSI RS     N P  ++DD +V WKD +FD    L LR+YKP + 
Sbjct  11   VVEDCRGVLHVYNDGSIVRSSRPSFNVP--INDDGTVLWKDVVFDTALDLQLRLYKP-AD  67

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
             SA   LPI  + HGGGFC+GSRTWPNC + C +L + L+A+V+APDYRLAPE+RLP+A+
Sbjct  68   DSAGSKLPIFIYIHGGGFCIGSRTWPNCQNYCFQLTSRLRAVVIAPDYRLAPENRLPSAI  127

Query  398  DDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSPVRV  577
            +D+  AV         D WL    DF+  ++ GDS+GGN+AHHLA RLG GSPE+ PVRV
Sbjct  128  EDSLLAV-----NDEPDPWLSHVADFSHVYISGDSAGGNIAHHLAARLGFGSPELDPVRV  182

Query  578  RGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGPASP  757
            RGYV++APFFGGT+RTKSEAEGP + FLNLE++DRFWRLS+P G T DHPL NPFGP S 
Sbjct  183  RGYVLLAPFFGGTIRTKSEAEGPKDAFLNLELIDRFWRLSIPIGETTDHPLVNPFGPYSQ  242

Query  758  SLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEVDYVVFQGKQHGFFTNDPFSDV  934
            SLEA+  DPILV+ GG ++LKDR E+YA  LK+  NK++DYV F+G+QHGFFT DP S+ 
Sbjct  243  SLEAINFDPILVVAGGSDLLKDRAEDYAKWLKEWGNKDIDYVEFEGQQHGFFTIDPNSEP  302

Query  935  STQVLQQLQHFM  970
            S +++  ++ F+
Sbjct  303  SNKLMLIIKQFI  314



>ref|XP_003519022.1| PREDICTED: probable carboxylesterase 15-like [Glycine max]
Length=332

 Score =   380 bits (977),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 186/330 (56%), Positives = 234/330 (71%), Gaps = 18/330 (5%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINF---PFPVHDDASVHWKDSLFDRTHGLYLRIY  202
            PHVVEDC G+L + SDG++ RS   +INF   P P   D  V +KD LF +   L+LR+Y
Sbjct  5    PHVVEDCMGLLTLLSDGTVLRS---NINFQEQPQPTQHDNLVQFKDFLFHKKFNLHLRLY  61

Query  203  KPR---------SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAP  355
            KP+            +   SLP++ F HGGGFC GSR WP+ HSCC+RL   L A VV P
Sbjct  62   KPKFDDNINNDDDKNNNNKSLPVVMFLHGGGFCFGSRVWPHIHSCCVRLATSLHAAVVTP  121

Query  356  DYRLAPEHRLPAAMDDAFCAVKWVAAQA--STDAWLKDGVDFNRAFVLGDSSGGNVAHHL  529
            DYRLAPEHRLPAA+DD   A++W+  Q     D W+  GVDF+RAF+LGDSSGGN+AHHL
Sbjct  122  DYRLAPEHRLPAAVDDGVEALRWLQRQGHHGGDEWVTRGVDFDRAFILGDSSGGNIAHHL  181

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            AV+LG GS EM PVRVRGYV++ PFF G VRT+SE  GPPE  L LE+LDRFWRLS+P G
Sbjct  182  AVQLGPGSREMDPVRVRGYVLLGPFFSGVVRTRSEV-GPPEQMLTLELLDRFWRLSIPIG  240

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQ  889
             T DHPLANPFG  SP+L  VKLDPILV+VGG E+LKDR  +YA +LK+  K ++Y+ F+
Sbjct  241  ETRDHPLANPFGANSPNLGHVKLDPILVIVGGNELLKDRAVDYATRLKELGKNIEYIEFK  300

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFMISK  979
            GK+HGF T+D  S+ + +V+Q ++ FM+  
Sbjct  301  GKEHGFLTHDSHSEAAEEVVQIIKRFMLEN  330



>ref|XP_008811411.1| PREDICTED: probable carboxylesterase 15 [Phoenix dactylifera]
Length=331

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/321 (56%), Positives = 237/321 (74%), Gaps = 8/321 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            S  + VE+C G+L+V SDGS+ RS +   +FP PVHDD SV WKD+ FD  H L+LR+YK
Sbjct  5    SAAYEVEECRGVLRVLSDGSVVRSTNP--SFPVPVHDDGSVDWKDAQFDAAHDLHLRLYK  62

Query  206  PRSS-ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            PR    S     P+ ++FHGGGFC+GSRTWPNC + CLRL A L+A+VVAPDYRLAPEHR
Sbjct  63   PRHRLPSDGPKFPVFYYFHGGGFCIGSRTWPNCQNYCLRLAAELRAVVVAPDYRLAPEHR  122

Query  383  LPAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG--V  547
            LPAA+DD   AVKW++ QAS+   D WL +  DF R F+ GDS+GGN+AHHLAVR G   
Sbjct  123  LPAAIDDGAAAVKWLSRQASSPYPDPWLAEAADFGRVFISGDSAGGNIAHHLAVRFGSAA  182

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            G  E+ PVR+RG+V++ PFFGGT RT SEAE P + FLNLE+ DR+WRLSLP G T DHP
Sbjct  183  GRAELEPVRIRGFVLLMPFFGGTWRTTSEAECPKDAFLNLELNDRYWRLSLPRGATTDHP  242

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            + NPFGP SP L+ V+ +P+LV+VG +++L+DR   YA +LK+  K V    F+G+QHGF
Sbjct  243  VVNPFGPESPELQPVEFEPMLVVVGERDLLRDRTAEYANRLKEGGKPVKLAEFEGQQHGF  302

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
            FT DP+S+ + ++++ ++ F+
Sbjct  303  FTIDPWSEPANELMRVIKRFV  323



>ref|XP_006429990.1| hypothetical protein CICLE_v10012177mg [Citrus clementina]
 gb|ESR43230.1| hypothetical protein CICLE_v10012177mg [Citrus clementina]
Length=328

 Score =   379 bits (972),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 194/326 (60%), Positives = 237/326 (73%), Gaps = 12/326 (4%)
 Frame = +2

Query  20   MGSL-PHVVEDC-SGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYL  193
            MGSL P V+ED   G++Q+ SDG++ RS + D ++P    +D SV  KD  +D  H L+L
Sbjct  1    MGSLDPQVIEDLGKGVIQLLSDGTVLRSNNIDFDYPLD-KNDGSVLIKDCQYDEKHQLHL  59

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            R+YKP S  +++  LPI+ F HGGGFCVGSR WP+ H+CC+RL  GL ALVVA DYRLAP
Sbjct  60   RMYKPPSIITSSRKLPIVVFIHGGGFCVGSRAWPSSHNCCMRLATGLNALVVALDYRLAP  119

Query  374  EHRLPAAMDDAFCAVKWVAAQAST-----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVR  538
            EHRLPAAM+DAF A+KW+  QA +     D W  D V+F+R FVLGDSSGGN+AHHLAVR
Sbjct  120  EHRLPAAMEDAFSAMKWLQDQALSEKVVDDEWFHD-VEFDRVFVLGDSSGGNIAHHLAVR  178

Query  539  LGVGS--PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
            LG G    E++PVRVRGYV++APFFGG  RTKSEA GP E  L L ILD FWRLSLP G 
Sbjct  179  LGGGGGFEELAPVRVRGYVLLAPFFGGVARTKSEA-GPSEEHLTLAILDSFWRLSLPIGV  237

Query  713  TPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQG  892
            T DHP ANPFGP SPSLEAV LDP+LV+ G +E+LKDR ++YA KLK   K + YV F+G
Sbjct  238  TRDHPYANPFGPKSPSLEAVSLDPVLVVAGEKELLKDRAKDYARKLKDMGKNIHYVEFEG  297

Query  893  KQHGFFTNDPFSDVSTQVLQQLQHFM  970
            K+HGFF N P S    + LQ + +FM
Sbjct  298  KEHGFFNNKPSSKAGNEFLQIVGNFM  323



>gb|ABB89009.1| CXE carboxylesterase [Malus pumila]
Length=334

 Score =   378 bits (971),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 235/322 (73%), Gaps = 11/322 (3%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            +LP+  E+C G+L+VYSDGSI RS     +F  PVHDD SV WKD +FD T+ L LR+YK
Sbjct  10   TLPY--EECRGVLRVYSDGSIVRSPKP--SFDVPVHDDGSVDWKDVVFDPTNQLQLRLYK  65

Query  206  PRSS----ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            P ++    +S +  LPI ++ HGGGFC+GSR WPNC + C +L + LQ +VVAPDYRLAP
Sbjct  66   PAATTHTPSSLSKKLPIFYYIHGGGFCIGSRAWPNCQNYCFQLASQLQCVVVAPDYRLAP  125

Query  374  EHRLPAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAAMDD F A+KW+ A A     D WL +  DF   FV GDS+GGN+AH+LAV+LG
Sbjct  126  EHRLPAAMDDGFAAMKWLQAIAEAEDPDTWLTEVADFGNVFVSGDSAGGNIAHNLAVQLG  185

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             GS E+ PVRVRGYV++APFFGGTV  +SEAE P E FLN E++DRFWRLS+P G   DH
Sbjct  186  AGSVELGPVRVRGYVLLAPFFGGTVLARSEAEDPKEAFLNWELIDRFWRLSIPIGEDRDH  245

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            PL NPFGP S SLE V  DPILV+VGG ++LKDR ++YA +LK    +V+YV F+G+QHG
Sbjct  246  PLVNPFGPNSQSLEEVAFDPILVVVGGSDLLKDRAKDYANRLKNWGNKVEYVEFEGQQHG  305

Query  905  FFTNDPFSDVSTQVLQQLQHFM  970
            FFT  P S  + +++  ++ F+
Sbjct  306  FFTIQPSSQPAKELMLIIKRFI  327



>ref|XP_008359190.1| PREDICTED: probable carboxylesterase 15 [Malus domestica]
Length=334

 Score =   378 bits (970),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 234/322 (73%), Gaps = 11/322 (3%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            +LP+  E+C G+L+VYSDGSI RS     +F  PVHDD SV WKD +FD T+ L LR+YK
Sbjct  10   TLPY--EECRGVLRVYSDGSIVRSPKP--SFDVPVHDDGSVDWKDVVFDPTNQLQLRLYK  65

Query  206  P----RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            P     S +S +  LPI ++ HGGGFC+GSR WPNC + C +L + LQ +VVAPDYRLAP
Sbjct  66   PAATTHSPSSLSKKLPIFYYIHGGGFCIGSRAWPNCQNYCFQLXSQLQCVVVAPDYRLAP  125

Query  374  EHRLPAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAAMDD F A+KW+ A A     D WL +  DF   FV GDS+GGN+AH+LAV+LG
Sbjct  126  EHRLPAAMDDGFAAMKWLQAIAEAEDPDTWLTEVADFGNVFVSGDSAGGNIAHNLAVQLG  185

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             GS E+ PVRVRGYV++APFFGGTV  +SEAE P E FLN E++DRFWRLS+P G   DH
Sbjct  186  AGSVELGPVRVRGYVLLAPFFGGTVLARSEAEDPKEAFLNWELIDRFWRLSIPIGEDRDH  245

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            PL NPFGP S SLE V  DPILV+VGG ++LKDR ++YA +LK    +V+YV F+G+QHG
Sbjct  246  PLVNPFGPNSQSLEEVAFDPILVVVGGSDLLKDRAKDYANRLKNWGNKVEYVEFEGQQHG  305

Query  905  FFTNDPFSDVSTQVLQQLQHFM  970
            FFT  P S  + +++  ++ F+
Sbjct  306  FFTIQPSSQPAKELMLIIKRFI  327



>ref|XP_008385595.1| PREDICTED: probable carboxylesterase 15 [Malus domestica]
Length=334

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 234/322 (73%), Gaps = 11/322 (3%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            +LP+  E+C G+L+VYSDGSI RS     +F  PVHDD SV WKD +FD T+ L LR+YK
Sbjct  10   TLPY--EECRGVLRVYSDGSIVRSPKP--SFDVPVHDDGSVDWKDVVFDPTNQLQLRLYK  65

Query  206  P----RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            P     S +S +  LPI ++ HGGGFC+GSR WPNC + C +L + LQ +VVAPDYRLAP
Sbjct  66   PAATTHSPSSLSKKLPIFYYIHGGGFCIGSRAWPNCQNYCFQLTSQLQCVVVAPDYRLAP  125

Query  374  EHRLPAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAAMDD F A+KW+ A A     D WL +  DF   FV GDS+GGN+AH+LAV+LG
Sbjct  126  EHRLPAAMDDGFAAMKWLQAIAEAEDPDTWLTEVADFGNVFVSGDSAGGNIAHNLAVQLG  185

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             GS ++ PVRVRGYV++APFFGGTV  +SEAE P E FLN E++DRFWRLS+P G   DH
Sbjct  186  AGSVQLGPVRVRGYVLLAPFFGGTVLARSEAEDPKEAFLNWELIDRFWRLSIPIGEDRDH  245

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            PL NPFGP S SLE V  DPILV+VGG ++LKDR ++YA +LK    +V+YV F+G+QHG
Sbjct  246  PLVNPFGPNSQSLEEVAFDPILVVVGGSDLLKDRAKDYANRLKNWGNKVEYVEFEGQQHG  305

Query  905  FFTNDPFSDVSTQVLQQLQHFM  970
            FFT  P S  + +++  ++ F+
Sbjct  306  FFTIQPSSQPAKELMLIIKRFI  327



>ref|XP_008230629.1| PREDICTED: probable carboxylesterase 15 [Prunus mume]
Length=332

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/318 (58%), Positives = 233/318 (73%), Gaps = 8/318 (3%)
 Frame = +2

Query  44   EDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRS---  214
            E+C G+L+VYSDGSI RS +   +F FPV DD SV WKD +FD T+ L LR+YKP +   
Sbjct  15   EECRGVLRVYSDGSIVRSPNP--SFDFPVLDDGSVAWKDVVFDPTNHLQLRLYKPAATTR  72

Query  215  SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAA  394
            S S++  LPI ++ HGGGFC+GSR WPNC + C +L + LQ +VV+PDYRLAPEHRLPAA
Sbjct  73   SPSSSKKLPIFYYIHGGGFCIGSRAWPNCQNYCFQLASQLQCVVVSPDYRLAPEHRLPAA  132

Query  395  MDDAFCAVKWVAAQASTD---AWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMS  565
            + D   A++W+ AQA  D    WL D  DF   FV GDS+GGN+AH+LAV+ G GS E+ 
Sbjct  133  IHDGAAALEWLRAQAEADEPDTWLTDVADFENVFVSGDSAGGNIAHNLAVQFGPGSAELG  192

Query  566  PVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFG  745
            PVRVRGY+++APFFGGTV +KSEAEGP + FLN E++DRFWRLS+P G   DHPL NPFG
Sbjct  193  PVRVRGYLLLAPFFGGTVLSKSEAEGPKDAFLNWELIDRFWRLSIPIGENTDHPLVNPFG  252

Query  746  PASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPF  925
            P S SLE V LDPILV+VGG ++LKDR E+YA +LK   K+V+YV F+G+QHGFFT  P 
Sbjct  253  PFSRSLEPVALDPILVVVGGSDLLKDRAEDYAKRLKDWGKKVEYVEFEGEQHGFFTIHPN  312

Query  926  SDVSTQVLQQLQHFMISK  979
            S  +  ++  L+ F+   
Sbjct  313  SQAAKDLMPILKRFITEN  330



>ref|XP_010105066.1| putative carboxylesterase 15 [Morus notabilis]
 gb|EXC03804.1| putative carboxylesterase 15 [Morus notabilis]
Length=314

 Score =   375 bits (962),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 183/280 (65%), Positives = 223/280 (80%), Gaps = 5/280 (2%)
 Frame = +2

Query  56   GILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSSASAAVS  235
            G+LQ+YSDG+++R     I+FPFPV DD+SV +KD +FD+   L LR+YKP+ + SA   
Sbjct  2    GVLQLYSDGTVYRR--HQIDFPFPVVDDSSVAFKDFVFDKKLDLSLRLYKPKFANSAPKK  59

Query  236  LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAMDDAFCA  415
            LP++F+FHGGGFCVG R WPNCHSCCLRL +GL+A+VV+PDYRLAPEH+LPAA+DDA  A
Sbjct  60   LPVVFYFHGGGFCVGPRLWPNCHSCCLRLSSGLEAVVVSPDYRLAPEHKLPAAIDDAVRA  119

Query  416  VKWVAAQAS-TDAWL-KDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSPVRVRGYV  589
            V+W+A   S  DAWL  D V  +R FVLGDSSGGN+AHHLAVR+G G  +  PVRVRG+V
Sbjct  120  VEWLAEDNSCCDAWLGHDAVYLDRVFVLGDSSGGNMAHHLAVRVGSGLVKTGPVRVRGFV  179

Query  590  MMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGPASPSLEA  769
            M+APFFGG VRTKSE +GP E  LNLEILDRFWRLS+P G T DHPL NPFGP SP+LE 
Sbjct  180  MLAPFFGGVVRTKSE-DGPSEALLNLEILDRFWRLSMPEGETRDHPLVNPFGPNSPNLEK  238

Query  770  VKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQ  889
            V  DPILV+VGG E+LKDR ENYA +LK+  K++DYV F+
Sbjct  239  VAFDPILVIVGGNEMLKDRAENYAKRLKEMGKKIDYVEFE  278



>ref|XP_006481655.1| PREDICTED: probable carboxylesterase 15-like [Citrus sinensis]
Length=328

 Score =   375 bits (963),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 193/326 (59%), Positives = 236/326 (72%), Gaps = 12/326 (4%)
 Frame = +2

Query  20   MGSL-PHVVEDC-SGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYL  193
            MGSL P V+ED   G++Q+ SDG++ RS + D ++P    +D SV  KD  +D  H L+L
Sbjct  1    MGSLDPQVIEDLGKGVIQLLSDGTVLRSNNIDFDYPLD-KNDGSVLIKDCQYDEKHQLHL  59

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            R+YK  S  +++  LPI+ F HGGGFCVGSR WP+ H+CC+RL  GL ALVVA DYRLAP
Sbjct  60   RMYKTPSIITSSRKLPIVVFIHGGGFCVGSRAWPSSHNCCMRLATGLNALVVALDYRLAP  119

Query  374  EHRLPAAMDDAFCAVKWVAAQAST-----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVR  538
            EHRLPAAM+DAF A+KW+  QA +     D W  D V+F+R FVLGDSSGGN+AHHLAVR
Sbjct  120  EHRLPAAMEDAFSAMKWLQDQALSEKVVDDEWFHD-VEFDRVFVLGDSSGGNIAHHLAVR  178

Query  539  LGVGS--PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
            LG G    E++PVRVRGYV++APFFGG  RTKSEA GP E  L L ILD FWRLSLP G 
Sbjct  179  LGGGGGFEELAPVRVRGYVLLAPFFGGVARTKSEA-GPSEEHLTLGILDSFWRLSLPIGV  237

Query  713  TPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQG  892
            T DHP ANPFGP SPSLEAV LDP+LV+ G +E+LKDR ++YA KLK   K + YV F+G
Sbjct  238  TRDHPYANPFGPKSPSLEAVSLDPMLVVAGEKELLKDRAKDYARKLKDMGKNIHYVEFEG  297

Query  893  KQHGFFTNDPFSDVSTQVLQQLQHFM  970
            K+HGFF N P S    + LQ + +FM
Sbjct  298  KEHGFFNNKPSSKAGNEFLQIVGNFM  323



>ref|XP_010908310.1| PREDICTED: probable carboxylesterase 15 [Elaeis guineensis]
Length=330

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 236/324 (73%), Gaps = 8/324 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            S  + V++C G+L+V+SDGSI RS +   +FP PV DD SV WKD+ FD  H L LR+YK
Sbjct  4    SAAYEVDECRGVLRVFSDGSIVRSPNP--SFPVPVQDDGSVDWKDAQFDAAHDLQLRLYK  61

Query  206  PRSS-ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            PR    S     P+ ++FHGGGFC+GSRTWPNC + CLRL A L+A+VVAPDYRLAPEHR
Sbjct  62   PRYRLPSDGPKFPVFYYFHGGGFCIGSRTWPNCQNYCLRLAAELRAVVVAPDYRLAPEHR  121

Query  383  LPAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG--V  547
            LPAA+DD   +V+W+  QA +   D WL +  D  R F+ GDS+GGN+AHHLAVR G   
Sbjct  122  LPAAIDDGAASVEWLHRQAVSPDPDPWLAEAADIGRVFISGDSAGGNIAHHLAVRFGSAT  181

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            G  ++ PVR+RG+V + PFFGGT RTKSEAE P + FLNLE+ DR+WRLSLP G T DHP
Sbjct  182  GRAKLEPVRIRGFVHLMPFFGGTRRTKSEAECPKDAFLNLELNDRYWRLSLPRGATADHP  241

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            L NPFGP SP+LE V+ +P+LV+VG +++L+DR   YA +LK+  K V+   FQG+QHGF
Sbjct  242  LVNPFGPESPNLEPVEFEPMLVVVGERDLLRDRAAEYAKRLKEWGKPVELAEFQGQQHGF  301

Query  908  FTNDPFSDVSTQVLQQLQHFMISK  979
            FT DP+S+ + ++++ ++ F+  K
Sbjct  302  FTIDPWSEPANELMRVIKRFVNEK  325



>ref|XP_007205520.1| hypothetical protein PRUPE_ppa008440mg [Prunus persica]
 gb|EMJ06719.1| hypothetical protein PRUPE_ppa008440mg [Prunus persica]
Length=332

 Score =   373 bits (958),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 180/318 (57%), Positives = 231/318 (73%), Gaps = 8/318 (3%)
 Frame = +2

Query  44   EDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRS---  214
            E+C G+L+VY+DGSI RS +   +F  P+ DD SV WKD +FD T+ L LR+YKP +   
Sbjct  15   EECRGVLRVYNDGSIVRSPNP--SFDVPILDDGSVAWKDVVFDPTNHLQLRLYKPAATTR  72

Query  215  SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAA  394
            S S++  LPI ++ HGGGFC+GSR WPNC + C +L + LQ +VV+PDYRLAPEHRLPAA
Sbjct  73   SPSSSKKLPIFYYIHGGGFCIGSRAWPNCQNYCFQLASQLQCVVVSPDYRLAPEHRLPAA  132

Query  395  MDDAFCAVKWVAAQASTD---AWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMS  565
            + D   A++W+ AQA  D    WL D  DF   FV GDS+GGN+AH+LAVR G GS E+ 
Sbjct  133  IHDGAAALQWLRAQAEADEPDTWLTDVADFENVFVSGDSAGGNIAHNLAVRFGPGSAELG  192

Query  566  PVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFG  745
            PVRVRGY+++APFF GTV +KSEAEGP + FLN E++DRFWRLS+P G   DHPL NPFG
Sbjct  193  PVRVRGYLLLAPFFAGTVLSKSEAEGPKDAFLNWELIDRFWRLSIPIGENTDHPLVNPFG  252

Query  746  PASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPF  925
            P S SLE V LDPILV+VGG ++LKDR E+YA +LK   K+V+YV F+G+QHGFFT  P 
Sbjct  253  PFSRSLEPVALDPILVVVGGSDLLKDRAEDYAKRLKNWGKKVEYVEFEGEQHGFFTVHPN  312

Query  926  SDVSTQVLQQLQHFMISK  979
            S  +  ++  L+ F+   
Sbjct  313  SQAAKDLMPILKRFITEN  330



>ref|XP_009406562.1| PREDICTED: probable carboxylesterase 15 [Musa acuminata subsp. 
malaccensis]
Length=331

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 236/319 (74%), Gaps = 6/319 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRT-HGLYLRIY  202
            S P VV++C G+L+V SDG+I RS++   +FP PV DD SV WKD+LF    H L+LR+Y
Sbjct  7    SPPRVVDECRGVLRVLSDGAIVRSQNP--SFPIPVVDDGSVEWKDALFSPAPHALHLRLY  64

Query  203  KPR-SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            +PR S A     LP+ F+FHGGGFC+GSRTWPNC + CLRL + L+ALVVAPDYRLAPEH
Sbjct  65   RPRRSQAPDEGRLPVFFYFHGGGFCIGSRTWPNCQNYCLRLASDLRALVVAPDYRLAPEH  124

Query  380  RLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG--VGS  553
            RLPAA+ DA  +V+W+ +QA+ D WL +  D  R F+ GDSSGGN+AHHLA+R G   G 
Sbjct  125  RLPAAIHDAVASVEWLRSQAAADPWLAESADLARVFISGDSSGGNIAHHLALRFGSPAGR  184

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
              ++P+R+RG+V++ PFFGGT  T+SEAE P + FLN E+ DR+WRLS+P   T DHPL 
Sbjct  185  AALAPLRLRGFVLLMPFFGGTQPTRSEAECPDDAFLNRELNDRYWRLSIPSEATLDHPLV  244

Query  734  NPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFT  913
            NP GP S  LEA ++DPILV+VGG+++L+DR   YA++L+   K V+   F+G+QHGFFT
Sbjct  245  NPLGPESADLEAAEVDPILVVVGGRDLLRDRAAEYAVRLRGWGKPVELAEFEGQQHGFFT  304

Query  914  NDPFSDVSTQVLQQLQHFM  970
             DP+S+ S +++  ++ FM
Sbjct  305  IDPWSEPSGKLMGTIKRFM  323



>ref|XP_006433441.1| hypothetical protein CICLE_v10003873mg [Citrus clementina]
 gb|ESR46681.1| hypothetical protein CICLE_v10003873mg [Citrus clementina]
Length=329

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 240/322 (75%), Gaps = 8/322 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLP VVE+C G+L++YSDGSI RS +  I+F  P  +D S+ +KD +F+    L LR+
Sbjct  1    MGSLPQVVEECFGLLKLYSDGSISRSPN--ISFDVPFINDNSILYKDLIFNENIDLRLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP S  +++  LPI+F+FHGGGFC GSRT+PN H+ C+RL + LQA V+ PDYRL PEH
Sbjct  59   YKPTSIVNSSTKLPIVFYFHGGGFCFGSRTFPNNHNICVRLASILQAAVIEPDYRLGPEH  118

Query  380  RLPAAMDDAFCAVKWVAAQA-----STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            RLPAA++DA CA+KW+  QA       D WL + VDF+R FVLG SSGGN+AHHLAVR G
Sbjct  119  RLPAALEDACCALKWLQGQAIMHANVMDTWLGE-VDFDRVFVLGYSSGGNLAHHLAVRFG  177

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             GS E++PVRVRGYV+M+PFFGG  RT+SE E P +    L + DRFWRLS+P G T DH
Sbjct  178  PGSVELAPVRVRGYVLMSPFFGGCERTRSEEERPIDGIWTLGMYDRFWRLSVPTGATQDH  237

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            PL NPFGP+SPSL  V LDP++V+VGG E+L+DRVENYA KLK+  K+++YV  + +QHG
Sbjct  238  PLVNPFGPSSPSLATVDLDPLVVVVGGNEILRDRVENYARKLKEMGKKIEYVELEEEQHG  297

Query  905  FFTNDPFSDVSTQVLQQLQHFM  970
            +FT+ P    + +V+Q ++ FM
Sbjct  298  YFTDHPLPAAAQRVIQFIKGFM  319



>ref|XP_006495101.1| PREDICTED: probable carboxylesterase 15-like [Citrus sinensis]
Length=329

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/322 (57%), Positives = 239/322 (74%), Gaps = 8/322 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLP VVE+C G+L++YSDGSI RS +  I+F  P  +D S+ +KD +F+    L LR+
Sbjct  1    MGSLPQVVEECFGLLKLYSDGSISRSPN--ISFDVPFINDNSILYKDLIFNENIDLRLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP S  +++  LPI+F+FHGGG C GSRT+PN H+ C+RL + LQA V+ PDYRL PEH
Sbjct  59   YKPTSIVNSSTKLPIVFYFHGGGICFGSRTFPNNHNICVRLASILQAAVIEPDYRLGPEH  118

Query  380  RLPAAMDDAFCAVKWVAAQA-----STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            RLPAA++DA CA+KW+  QA       D WL + VDF+R FVLG SSGGN+AHHLAVR G
Sbjct  119  RLPAALEDACCALKWLQGQAIMHANVMDTWLGE-VDFDRVFVLGYSSGGNLAHHLAVRFG  177

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             GS E++PVRVRGYV+M+PFFGG  RT+SE E P +    L + DRFWRLS+P G T DH
Sbjct  178  PGSVELAPVRVRGYVLMSPFFGGCERTRSEEERPIDGIWTLGMYDRFWRLSVPTGATQDH  237

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            PL NPFGP+SPSL  V LDP++V+VGG E+L+DRVENYA KLK+  K+++YV  + +QHG
Sbjct  238  PLVNPFGPSSPSLATVDLDPLVVVVGGNEILRDRVENYARKLKEMGKKIEYVELEEEQHG  297

Query  905  FFTNDPFSDVSTQVLQQLQHFM  970
            +FT+ P    + +V+Q ++ FM
Sbjct  298  YFTDHPLPAAAQRVIQFIKGFM  319



>ref|XP_006433445.1| hypothetical protein CICLE_v10001815mg [Citrus clementina]
 gb|ESR46685.1| hypothetical protein CICLE_v10001815mg [Citrus clementina]
Length=329

 Score =   362 bits (930),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 238/321 (74%), Gaps = 6/321 (2%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLP VVE+C G+L++YSDGSI RS +  I+F  P  +D S+ +KD +F+    L LR+
Sbjct  1    MGSLPQVVEECFGLLKLYSDGSISRSPN--ISFDVPFINDNSILYKDLIFNENIDLRLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP S  +++  LPI+F+FHGGG C GSRT+PN H+ C+RL + LQA V+ PDYRL PEH
Sbjct  59   YKPTSIVNSSTKLPIVFYFHGGGICFGSRTFPNNHNICVRLASILQAAVIEPDYRLGPEH  118

Query  380  RLPAAMDDAFCAVKWVAAQASTDAWLKDG----VDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            RLPAA++DA CA+KW+  QA   A + D     VDF+R FVLG SSGGN+AHHLAVR G 
Sbjct  119  RLPAALEDACCALKWLQGQAIMHANVMDTRLGEVDFDRVFVLGYSSGGNLAHHLAVRFGP  178

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            GS E++PVRVRGYV+M+PFFGG  RT+SE E P +    L + DRFWRLS+P G T DHP
Sbjct  179  GSVELAPVRVRGYVLMSPFFGGCERTRSEEERPIDGIWTLGMYDRFWRLSVPTGATQDHP  238

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            L NPFGP+SPSL  V LDP++V+VGG E+L+DRVENYA KLK+  K+++YV  + +QHG+
Sbjct  239  LVNPFGPSSPSLATVDLDPLVVVVGGNEILRDRVENYARKLKEMGKKIEYVELEEEQHGY  298

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
            FT+ P    + +V+Q ++ FM
Sbjct  299  FTDHPLPAAAQRVIQFIKGFM  319



>ref|XP_007145753.1| hypothetical protein PHAVU_007G264900g [Phaseolus vulgaris]
 gb|ESW17747.1| hypothetical protein PHAVU_007G264900g [Phaseolus vulgaris]
Length=325

 Score =   360 bits (924),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 231/320 (72%), Gaps = 5/320 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDAS-VHWKDSLFDRTHGLYLRIYKP  208
            PH+VEDC G+L+++SDG++FRS  +    P       + V +KD +F R   L LR+YKP
Sbjct  5    PHIVEDCMGLLKLFSDGTVFRSNIQFQEQPSSTQQHNNLVLFKDYIFHRKFNLQLRLYKP  64

Query  209  R--SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            +  +  +    LP++ F HGGGFC GSR WP+ H+CC RL   L+A+V APDYRLAPEHR
Sbjct  65   KLENDDNGDEKLPLLMFLHGGGFCFGSRAWPHVHACCARLAVALRAVVAAPDYRLAPEHR  124

Query  383  LPAAMDDAFCAVKWVAAQA-STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPE  559
            LPAA+DD   A++W+  Q    DAW    VDF+R FV+GDSSGGN+AHH+AV+LG GS E
Sbjct  125  LPAAVDDCVEALRWLKRQGRGGDAWATRCVDFDRVFVVGDSSGGNIAHHMAVQLGSGSRE  184

Query  560  MSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANP  739
            M PVRVRGYV+M PFFGG VRTKSE  GPPE  L L++LDRFWRLS+P G   DHPLANP
Sbjct  185  MDPVRVRGYVLMGPFFGGVVRTKSEV-GPPEQMLTLDLLDRFWRLSIPIGENRDHPLANP  243

Query  740  FGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTND  919
            FGP+S +L  VKLDPILV+VGG E+LKDR E+YA +LK+  K + YV F+GK+HGF T+D
Sbjct  244  FGPSSRNLADVKLDPILVIVGGNELLKDRAEDYATRLKELGKNIKYVEFKGKEHGFLTHD  303

Query  920  PFSDVSTQVLQQLQHFMISK  979
              S V   +LQ ++HFM+  
Sbjct  304  SSSQVVEDLLQIIKHFMLQN  323



>dbj|BAJ97938.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=327

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 228/319 (71%), Gaps = 9/319 (3%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            + P VV+DC G+L VYSDG+I R   +   F  PV DD +V WKD+ FD   GL LR+Y+
Sbjct  7    AAPVVVDDCRGVLLVYSDGAIVRG--DAPGFATPVRDDGTVEWKDAEFDAPRGLGLRLYR  64

Query  206  PRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
            P         LP+ F++HGGGFC+GSRTWPNC + CLRL A L A+VVAPDYRLAPE+RL
Sbjct  65   PCQRNQL---LPVFFYYHGGGFCIGSRTWPNCQNYCLRLAAELDAVVVAPDYRLAPENRL  121

Query  386  PAAMDDAFCAVKWVAAQA--STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG--VGS  553
            PAA+DD   A+ W+A+QA  + D WL +  DF R F+ GDS+GG +AHHLAVR G   G 
Sbjct  122  PAAIDDGAAALLWLASQACPAGDTWLTEAADFTRVFISGDSAGGTIAHHLAVRFGSAAGR  181

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
             E+  VRVRGYV + PFFGGT RT+SEAE P + FLN  + DR+WRLSLP G T DHP++
Sbjct  182  SELGNVRVRGYVQLMPFFGGTERTRSEAECPDDAFLNRPLNDRYWRLSLPPGATVDHPVS  241

Query  734  NPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFT  913
            NPFGP SP+LEAV+L P LV+VGG+++L+DR  +YA +L+   K V    F+G+QHGFFT
Sbjct  242  NPFGPDSPALEAVELAPTLVVVGGRDILRDRAVDYAARLRAMGKPVGVREFEGQQHGFFT  301

Query  914  NDPFSDVSTQVLQQLQHFM  970
             DP+S  S ++++ L+ F+
Sbjct  302  IDPWSASSAELMRALKRFI  320



>ref|XP_008652041.1| PREDICTED: probable carboxylesterase 15 [Zea mays]
 tpg|DAA59637.1| TPA: hypothetical protein ZEAMMB73_875550 [Zea mays]
Length=328

 Score =   357 bits (917),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 170/312 (54%), Positives = 217/312 (70%), Gaps = 3/312 (1%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRS-  214
            VV++C G+L VYSDG++ R       F  PV DD +V WKD  FD   GL LR+Y PR  
Sbjct  10   VVDECRGVLFVYSDGTVVRRAQP--GFATPVRDDGTVDWKDVTFDEARGLALRLYLPRDR  67

Query  215  SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAA  394
             A A   LP+ F++HGGGFC+GSR WPNC + CLRL + L ALVVAPDYRLAPEHRLPAA
Sbjct  68   GAGAGRRLPVFFYYHGGGFCIGSRAWPNCQNYCLRLASDLGALVVAPDYRLAPEHRLPAA  127

Query  395  MDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSPVR  574
            +DD   AV W+A Q   D W+ +  D  R FV GDS+GG +AHHLAVR G    +++PV 
Sbjct  128  IDDGAAAVLWLARQGGGDPWVAEAADLGRVFVSGDSAGGTIAHHLAVRFGGSPADLAPVA  187

Query  575  VRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGPAS  754
            VRGYV + PFFGG  RT+SEAE P + FL+  + DR+WRLSLP G TPDHP+ANPFGP +
Sbjct  188  VRGYVQLMPFFGGVARTRSEAECPADAFLDRPLNDRYWRLSLPEGATPDHPVANPFGPGA  247

Query  755  PSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFSDV  934
            P L+AV   P LV+VGG+++L DR  +YA +L+   K V    F G+QHGFFT DP+SD 
Sbjct  248  PPLDAVDFAPTLVVVGGRDLLHDRAVDYAARLRAAGKPVVVRDFHGQQHGFFTIDPWSDA  307

Query  935  STQVLQQLQHFM  970
            S ++++ ++ F+
Sbjct  308  SAELMRVIKRFV  319



>ref|XP_009368537.1| PREDICTED: probable carboxylesterase 15 [Pyrus x bretschneideri]
Length=334

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/322 (55%), Positives = 223/322 (69%), Gaps = 11/322 (3%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            +LP+  E+C G+L+VYSDGSI RS     +F  PVHDD SV WKD +FD T+ L LR+YK
Sbjct  10   TLPY--EECRGVLRVYSDGSIVRSPKP--SFDVPVHDDGSVDWKDVVFDPTNQLQLRLYK  65

Query  206  P----RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            P     S +S +  LPI ++ HGGGFC+GSR WPNC + C +L + LQ +VVAPDYRLAP
Sbjct  66   PAATTHSPSSLSKKLPIFYYIHGGGFCIGSRAWPNCQNYCFQLASQLQCVVVAPDYRLAP  125

Query  374  EHRLPAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAA+DD F A+KW+ +QA     D WL +  DF   FV GDS            LG
Sbjct  126  EHRLPAAIDDGFAAMKWLPSQAEAEDPDTWLTEVADFGNVFVSGDSXXXXXXXXXXXXLG  185

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             GS E+ PVRVRGYV++APFFGGTV  +SEAEGP E FLN E++DRFWRLS+P G   DH
Sbjct  186  AGSVELGPVRVRGYVLLAPFFGGTVLARSEAEGPKEAFLNWELIDRFWRLSIPIGEDRDH  245

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            PL NPFGP S SLE V  DPILV+VG  ++LKDR ++YA +LK    +V+YV F+G+QHG
Sbjct  246  PLVNPFGPNSQSLEEVAFDPILVVVGASDLLKDRAQDYANRLKNWGNKVEYVEFEGQQHG  305

Query  905  FFTNDPFSDVSTQVLQQLQHFM  970
            FFT  P S  + +++  ++ F+
Sbjct  306  FFTIQPSSQPAKELMLIIKRFI  327



>ref|XP_004955528.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=338

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/323 (54%), Positives = 224/323 (69%), Gaps = 12/323 (4%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRS  214
             VV++C G+L VYSDG++ R       F  PV DD SV WKD+ FD   GL LR+Y+PR 
Sbjct  14   QVVDECRGVLFVYSDGTVVRRAQP--GFATPVRDDGSVEWKDATFDEAAGLGLRLYRPRE  71

Query  215  SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAA  394
                +  LP+ F++HGGGFC+GSR WPNC + CLRL A L ALVVAPDYRLAPEHRLPAA
Sbjct  72   RGGRS-RLPVFFYYHGGGFCIGSRAWPNCQNYCLRLAADLGALVVAPDYRLAPEHRLPAA  130

Query  395  MDDAFCAVKWVAAQAST-----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV--GS  553
            +DD   AV W+AAQ  T     D W+ +  D  R FV GDS+GG +AHHLAVR G   G 
Sbjct  131  IDDGAAAVLWLAAQGRTPGGGGDPWVAESADLGRVFVSGDSAGGTIAHHLAVRFGSPDGR  190

Query  554  PEMSP--VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
             E++P  V +RGYV + PFFGG  RT+SEAE P + FLN  + DR+WRLSLP G T DHP
Sbjct  191  AELAPAAVAIRGYVQLMPFFGGVQRTRSEAECPDDAFLNRPLNDRYWRLSLPEGATADHP  250

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            +ANPFGP +P LE V+L P LV+VGG+++L DR  +YA +L+   K V+   F+G+QHGF
Sbjct  251  VANPFGPGAPPLEGVELAPTLVVVGGRDILHDRAVDYAARLRAMGKPVEVRDFEGQQHGF  310

Query  908  FTNDPFSDVSTQVLQQLQHFMIS  976
            FT DP+SD S ++++ ++ F+ S
Sbjct  311  FTIDPWSDASAELMRVIKRFVDS  333



>ref|XP_010519985.1| PREDICTED: probable carboxylesterase 15 [Tarenaya hassleriana]
Length=332

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 194/331 (59%), Positives = 246/331 (74%), Gaps = 13/331 (4%)
 Frame = +2

Query  20   MGSLP--HVVEDCSGILQVYSDGSIFRSKDEDINFPFP-----VHDDASVHWKDSLFDRT  178
            MGSLP  HV EDC G+LQ+ SDG++ R++  ++    P     +  D SV +KD +F + 
Sbjct  1    MGSLPRPHVTEDCMGMLQLLSDGTVLRAETLNLISKIPNKTSTLQHDRSVIFKDIVFHKP  60

Query  179  HGLYLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPD  358
            + L LR+YKP +       LPI+ FFHGGGFC GS +WPN H+CCL+L + L A+VVAPD
Sbjct  61   NNLLLRLYKPNNHQPNH-KLPILVFFHGGGFCFGSFSWPNSHNCCLKLASELNAMVVAPD  119

Query  359  YRLAPEHRLPAAMDDAFCAVKWVAAQA---STDAWLKDG-VDFNRAFVLGDSSGGNVAHH  526
            YRLAPEHRLP+A+DDA  A+ WV +Q+    TD W + G VDF+R +V+GDSSGGN+AHH
Sbjct  120  YRLAPEHRLPSALDDAQVALVWVRSQSRGEGTDVWFESGEVDFDRVYVVGDSSGGNIAHH  179

Query  527  LAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPF  706
            LAVRLGVGSP + PVRVRGYV++APFFGG +RTKSE EGP E  LNL+ILD+FWRLSLP 
Sbjct  180  LAVRLGVGSPGLRPVRVRGYVLLAPFFGGEIRTKSE-EGPDEALLNLDILDKFWRLSLPK  238

Query  707  GGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVF  886
            G T DHP+ANP GP SP LE   LDPILV+VGG E+L+DR  +YA KLK+  K++ Y+ F
Sbjct  239  GATRDHPIANPLGPTSPRLEPWSLDPILVIVGGSELLRDRASDYADKLKKMKKKIHYLEF  298

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFMISK  979
            + ++HGFFTNDP SDVS QVL+ ++ FMI  
Sbjct  299  KDEEHGFFTNDPNSDVSEQVLRAVERFMIEN  329



>ref|NP_001058951.1| Os07g0162900 [Oryza sativa Japonica Group]
 dbj|BAC20768.1| putative cell death associated protein [Oryza sativa Japonica 
Group]
 dbj|BAF20865.1| Os07g0162900 [Oryza sativa Japonica Group]
 dbj|BAG97662.1| unnamed protein product [Oryza sativa Japonica Group]
Length=330

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/316 (54%), Positives = 220/316 (70%), Gaps = 9/316 (3%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            VV++C G+L VYSDG++ R       F  PV DD SV WKD++FD   GL +R+Y+PR  
Sbjct  7    VVDECRGVLFVYSDGAVERRAAP--GFATPVRDDGSVEWKDAVFDAARGLGVRLYRPRER  64

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
                  LP+ F++HGGGFC+GSRTWPNC + CLRL A L A+VVAPDYRLAPEHRLPAA 
Sbjct  65   GGG--RLPVFFYYHGGGFCIGSRTWPNCQNYCLRLAAELGAVVVAPDYRLAPEHRLPAAF  122

Query  398  DDAFCAVKWVAAQA--STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG--VGSPEMS  565
            +DA  A+ W+A+QA    D W+ +  DF R FV GDS+GG +AHHLAVR G   G  E++
Sbjct  123  EDAENALLWLASQARPGGDTWVAEAADFGRVFVSGDSAGGTIAHHLAVRFGSASGRAELA  182

Query  566  PVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG-TPDHPLANPF  742
            P RV GYV + PFFGG  RT SEA  P + FLN ++ DR+WRLSLP GG T DHP +NPF
Sbjct  183  PARVAGYVQLMPFFGGVERTPSEAACPDDAFLNRDLNDRYWRLSLPAGGATADHPFSNPF  242

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GPASP L A +  P LV+VGG+++L+DR  +YA +L    K V+ + F+G+QHGFFT DP
Sbjct  243  GPASPDLAAAEFAPTLVVVGGRDLLRDRALDYAARLAAMGKPVEALEFEGQQHGFFTIDP  302

Query  923  FSDVSTQVLQQLQHFM  970
            +S  S  ++  ++ F+
Sbjct  303  WSAASGDLMHAVKLFV  318



>ref|XP_006593038.1| PREDICTED: uncharacterized protein LOC100791656 [Glycine max]
Length=1776

 Score =   373 bits (957),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 171/296 (58%), Positives = 226/296 (76%), Gaps = 5/296 (2%)
 Frame = +2

Query  92    RSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSSASAAVSLPIIFFFHGGGF  271
             R +    +F  PV DDASV WKD +F   H L LR+YKP  S  +   LP+ F+FHGGGF
Sbjct  1476  RPRSSRPSFNVPVIDDASVLWKDVVFAPAHDLQLRLYKPADSTGS--KLPVFFYFHGGGF  1533

Query  272   CVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAMDDAFCAVKWVAAQAST--  445
             C+GSRTWPNC + C +L + L+A+V+APDYRLAPE+RLP+A++D+  AVKW+  QA +  
Sbjct  1534  CIGSRTWPNCQNYCFQLTSRLRAVVIAPDYRLAPENRLPSAIEDSLLAVKWLQTQALSNE  1593

Query  446   -DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVR  622
              D WL    DF+R F+ GDS+GGN+AHHLA RLG GSPE++PVRV+GYV++APFFGGT+R
Sbjct  1594  PDPWLSYVADFSRVFISGDSAGGNIAHHLAARLGFGSPELTPVRVKGYVLLAPFFGGTIR  1653

Query  623   TKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVG  802
             TK EAEGP + FLNLE++DRFWRLS+P G T DHP+ NPFGP S SLEA+  DPILV+ G
Sbjct  1654  TKLEAEGPKDAFLNLELIDRFWRLSVPVGETTDHPVVNPFGPYSESLEAINFDPILVVAG  1713

Query  803   GQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
             G ++LKDR E+YA +LK+  K+++YV F+G+QHGFFT DP S+ S +++  ++ F+
Sbjct  1714  GSDLLKDRAEDYARRLKEWGKDIEYVEFEGQQHGFFTIDPNSEPSNKLMLIIKQFI  1769



>ref|XP_010491228.1| PREDICTED: probable carboxylesterase 15 [Camelina sativa]
Length=363

 Score =   343 bits (880),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 247/333 (74%), Gaps = 12/333 (4%)
 Frame = +2

Query  2    KEREREMGSL---PHVVEDCSGILQVYSDGSIFRSKDED-INFPFPVHDDASVHWKDSLF  169
             ++ R MGSL   P V EDC G+LQ+ S+G++ RSK  D I    P     +V +KDS++
Sbjct  26   NQKGRRMGSLGEEPQVAEDCMGLLQLLSNGTVLRSKSIDHIAQQIPFTSHQTVLFKDSIY  85

Query  170  DRTHGLYLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVV  349
            D+ + L+LR+YKP S+ + A +LP++ FFHGGGFC GSR+WP+ H+ CL L + LQALVV
Sbjct  86   DKPNNLHLRLYKPVSATNRA-ALPVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLQALVV  144

Query  350  APDYRLAPEHRLPAAMDDAFCAVKWVAAQAST---DAWLKD--GVDFNRAFVLGDSSGGN  514
            APDYRLAPEHRLPAA +DA   + W+  QA +   D W +   GVDF+R FV+GDSSGGN
Sbjct  145  APDYRLAPEHRLPAAFEDAEAVLLWLQDQAVSGGADHWFEGGPGVDFDRVFVVGDSSGGN  204

Query  515  VAHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRL  694
            +AH LA RLG GS +++PVRVRGYV++APFFGG  RTKSE +GP E  LNL++LD+FWRL
Sbjct  205  IAHQLAFRLGSGSIDLTPVRVRGYVLLAPFFGGEERTKSE-DGPSEALLNLDLLDKFWRL  263

Query  695  SLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEV  871
            SLP G T DHP+ANPFGP SP LE++ ++P+LV+VGG E+L+DR + YA KLK+   K+V
Sbjct  264  SLPKGATRDHPMANPFGPKSPRLESISIEPMLVIVGGSELLRDRAKEYAYKLKKMGGKKV  323

Query  872  DYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            D + F+ K+HGF++N+P S+ + +VL+ +  FM
Sbjct  324  DCIEFENKEHGFYSNNPSSEAAEEVLRIIGDFM  356



>gb|EAZ02867.1| hypothetical protein OsI_24998 [Oryza sativa Indica Group]
Length=330

 Score =   342 bits (877),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 218/316 (69%), Gaps = 9/316 (3%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            VV++C G+L VYSDG++ R       F  PV DD SV WKD++FD   GL +R+Y+PR  
Sbjct  7    VVDECRGVLFVYSDGAVERRAAP--GFATPVRDDGSVEWKDAVFDAARGLGVRLYRPRER  64

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
                  LP+ F++HGGGFC+GSRTWPNC + CLRL A L A+VVAPDYRLAPEHRLPAA 
Sbjct  65   GGG--RLPVFFYYHGGGFCIGSRTWPNCQNYCLRLAAELGAVVVAPDYRLAPEHRLPAAF  122

Query  398  DDAFCAVKWVAAQA--STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG--VGSPEMS  565
            +DA  A+ W+A+QA    D W+ +  DF R FV GDS+   +AHHLAVR G   G  E++
Sbjct  123  EDAENALLWLASQARPGGDTWVAEAADFGRVFVSGDSAAATIAHHLAVRFGSASGRAELA  182

Query  566  PVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG-TPDHPLANPF  742
            P RV GYV + PFFGG  RT SEA  P + FLN ++ DR+WRLSLP GG T DHP +NPF
Sbjct  183  PARVAGYVQLMPFFGGVERTPSEAACPDDAFLNRDLNDRYWRLSLPAGGATADHPFSNPF  242

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GPASP L A +  P LV+VGG+++L+DR  +YA +L    K V+ + F+G+QHGFFT DP
Sbjct  243  GPASPDLAAAEFAPTLVVVGGRDLLRDRALDYAARLAAMGKPVEALEFEGQQHGFFTIDP  302

Query  923  FSDVSTQVLQQLQHFM  970
            +S  S  ++  ++ F+
Sbjct  303  WSAASGDLMHAVKLFV  318



>ref|XP_006399129.1| hypothetical protein EUTSA_v10014072mg [Eutrema salsugineum]
 gb|ESQ40582.1| hypothetical protein EUTSA_v10014072mg [Eutrema salsugineum]
Length=334

 Score =   342 bits (877),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 180/330 (55%), Positives = 244/330 (74%), Gaps = 14/330 (4%)
 Frame = +2

Query  20   MGSL---PHVVEDCSGILQVYSDGSIFRSKDED-INFPFPVHDDASVHWKDSLFDRTHGL  187
            MGSL   P V EDC G+LQ+ S+G++ RSK  D I    P+ +  +V +KD +F + + L
Sbjct  1    MGSLGEEPQVAEDCMGLLQLLSNGTVLRSKSIDLITQQIPLSNHKTVFFKDLIFHKPNNL  60

Query  188  YLRIYKPRSSASA---AVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPD  358
            +LR+YKP SS+ +     ++P++ FFHGGGFC GSR+WP+ H+ CL L + L ALVVAPD
Sbjct  61   HLRLYKPISSSESHRTVATVPVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLHALVVAPD  120

Query  359  YRLAPEHRLPAAMDDAFCAVKWVAAQAST---DAWLKDG--VDFNRAFVLGDSSGGNVAH  523
            YRLAPEHRLPAA +DA  A+ WV  QA +   D W + G  VDF R +V GDSSGGN+AH
Sbjct  121  YRLAPEHRLPAAFEDAEAALMWVRDQAVSGAGDHWFEGGPVVDFGRVYVFGDSSGGNIAH  180

Query  524  HLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLP  703
            HLA R G GS E+SPVRVRGYV++APFFGG  RTKSE +GP E  L+L++LD+FWRLSLP
Sbjct  181  HLAFRFGSGSIELSPVRVRGYVLLAPFFGGEERTKSE-DGPSEALLSLDLLDKFWRLSLP  239

Query  704  FGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQ-QNKEVDYV  880
             G T DHP+ANPFGP SP LE++ ++P+LV+VGG E+L+DR + YA KLK+ + K++DY+
Sbjct  240  EGATRDHPMANPFGPTSPGLESINIEPMLVIVGGSELLRDRAKEYAFKLKKMEGKKIDYI  299

Query  881  VFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
             F+ ++HGF++N+P SD + Q+++ +  FM
Sbjct  300  EFENEEHGFYSNNPSSDAAEQLIRIIGDFM  329



>ref|XP_009130947.1| PREDICTED: probable carboxylesterase 15 [Brassica rapa]
Length=334

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/327 (55%), Positives = 243/327 (74%), Gaps = 13/327 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDI---NFPFPVHDDASVHWKDSLFDRTHGLY  190
            +G  P V EDC G+LQ+ SDG++ RSK  D+     P   H  ++V +KDS++ + + L+
Sbjct  4    LGEQPQVAEDCMGLLQLLSDGTVVRSKRIDLITQQIPLANHK-SNVLFKDSIYHKPNNLH  62

Query  191  LRIYKPRSSA--SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            LR+YKP S++  SA   LP++ FFHGGGFC GSRTWP+ H+ CL L + L ALVV+PDYR
Sbjct  63   LRLYKPASASNRSATALLPVVVFFHGGGFCFGSRTWPHFHNFCLTLASSLHALVVSPDYR  122

Query  365  LAPEHRLPAAMDDAFCAVKWVAAQAST---DAWLKD--GVDFNRAFVLGDSSGGNVAHHL  529
            LAPEHRLPAA +DA  A+ W+  QA +   D W +   GVDF+R +VLGDSSGGN+AHHL
Sbjct  123  LAPEHRLPAAFEDAEAALTWLRDQAVSGEGDHWFEGGPGVDFDRVYVLGDSSGGNIAHHL  182

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            A R G GS E+SPVRVRGYV++ PFFGG  RTKSE +GP E  L+L++LD+FWRLSLP G
Sbjct  183  AFRFGSGSTELSPVRVRGYVLLGPFFGGVERTKSE-DGPSEALLSLDLLDKFWRLSLPEG  241

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQ-QNKEVDYVVF  886
             T DHP+ANPFGP SP+LE+  ++P+LV+ GG E+L+DR + YA KLK+ + K+VDY+ F
Sbjct  242  ATRDHPMANPFGPTSPALESASIEPMLVIAGGSELLRDRAKEYAYKLKKMEGKKVDYIEF  301

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHF  967
            + ++HGFF+++P SD + Q+L+ + +F
Sbjct  302  ENEEHGFFSSNPSSDAAKQLLRIIGNF  328



>emb|CDX81008.1| BnaC03g02620D [Brassica napus]
Length=334

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/327 (54%), Positives = 242/327 (74%), Gaps = 13/327 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDI---NFPFPVHDDASVHWKDSLFDRTHGLY  190
            +G  P V EDC G+LQ+ SDG++ RSK  D+     P   H  ++V +KDS++ + + L+
Sbjct  4    LGEQPQVAEDCMGLLQLLSDGTVVRSKSIDLITQQIPLANHK-SNVLFKDSIYHKQNNLH  62

Query  191  LRIYKPRSSA--SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            LR+YKP S++  SA   LP++ FFHGGGFC GSRTWP+ H+ CL L + L ALVV+PDYR
Sbjct  63   LRLYKPASASNRSATALLPVVVFFHGGGFCFGSRTWPHFHNFCLTLASSLHALVVSPDYR  122

Query  365  LAPEHRLPAAMDDAFCAVKWVAAQAST---DAWLKD--GVDFNRAFVLGDSSGGNVAHHL  529
            LAPEHRLPAA +DA  A+ W+  QA +   D W +   GVDF+R +VLGDSSGGN+AHHL
Sbjct  123  LAPEHRLPAAFEDAEAALTWLRDQAVSGEGDHWFEGGPGVDFDRVYVLGDSSGGNIAHHL  182

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            A R G GS E+SPVRVRGYV++ PFFGG  RTKSE +GP E  L+L++LD+FWRLSLP G
Sbjct  183  AFRFGSGSTELSPVRVRGYVLLGPFFGGVERTKSE-DGPSEALLSLDLLDKFWRLSLPEG  241

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQ-QNKEVDYVVF  886
             T DHP+ANPFGP SP+LE+  ++P+LV+ GG E+L+DR + YA KLK+ + K+VDY+ F
Sbjct  242  ATRDHPMANPFGPTSPALESASIEPMLVIAGGSELLRDRAKEYAYKLKKMEGKKVDYIEF  301

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHF  967
            + ++HGFF+++P SD + Q+ + + +F
Sbjct  302  ENEEHGFFSSNPSSDATKQLFRIIGNF  328



>ref|NP_196275.1| probable carboxylesterase 15 [Arabidopsis thaliana]
 ref|NP_850782.1| probable carboxylesterase 15 [Arabidopsis thaliana]
 sp|Q9FG13.1|CXE15_ARATH RecName: Full=Probable carboxylesterase 15; AltName: Full=AtCXE15 
[Arabidopsis thaliana]
 dbj|BAB11406.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC43180.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37709.1| At5g06570 [Arabidopsis thaliana]
 gb|AED91035.1| probable carboxylesterase 15 [Arabidopsis thaliana]
 gb|AED91036.1| probable carboxylesterase 15 [Arabidopsis thaliana]
Length=329

 Score =   340 bits (872),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 240/327 (73%), Gaps = 12/327 (4%)
 Frame = +2

Query  20   MGSL---PHVVEDCSGILQVYSDGSIFRSKDED-INFPFPVHDDASVHWKDSLFDRTHGL  187
            MGSL   P V EDC G+LQ+ S+G++ RS+  D I    P  ++ +V +KDS++ + + L
Sbjct  1    MGSLGEEPQVAEDCMGLLQLLSNGTVLRSESIDLITQQIPFKNNQTVLFKDSIYHKPNNL  60

Query  188  YLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            +LR+YKP  SAS   +LP++ FFHGGGFC GSR+WP+ H+ CL L + L ALVV+PDYRL
Sbjct  61   HLRLYKP-ISASNRTALPVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLNALVVSPDYRL  119

Query  368  APEHRLPAAMDDAFCAVKWVAAQASTDA---WLKDG--VDFNRAFVLGDSSGGNVAHHLA  532
            APEHRLPAA +DA   + W+  QA +D    W +DG  VDF+R FV+GDSSGGN+AH LA
Sbjct  120  APEHRLPAAFEDAEAVLTWLWDQAVSDGVNHWFEDGTDVDFDRVFVVGDSSGGNIAHQLA  179

Query  533  VRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
            VR G GS E++PVRVRGYV+M PFFGG  RT SE  GP E  L+L++LD+FWRLSLP G 
Sbjct  180  VRFGSGSIELTPVRVRGYVLMGPFFGGEERTNSE-NGPSEALLSLDLLDKFWRLSLPNGA  238

Query  713  TPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEVDYVVFQ  889
            T DH +ANPFGP SP+LE++ L+P+LV+VGG E+L+DR + YA KLK+   K VDY+ F+
Sbjct  239  TRDHHMANPFGPTSPTLESISLEPMLVIVGGSELLRDRAKEYAYKLKKMGGKRVDYIEFE  298

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFM  970
             K+HGF++N P S+ + QVL+ +  FM
Sbjct  299  NKEHGFYSNYPSSEAAEQVLRIIGDFM  325



>ref|XP_006288164.1| hypothetical protein CARUB_v10001401mg [Capsella rubella]
 gb|EOA21062.1| hypothetical protein CARUB_v10001401mg [Capsella rubella]
Length=332

 Score =   339 bits (869),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 183/329 (56%), Positives = 243/329 (74%), Gaps = 16/329 (5%)
 Frame = +2

Query  20   MGSL---PHVVEDCSGILQVYSDGSIFRSKDEDI---NFPFPVHDDASVHWKDSLFDRTH  181
            MGSL     V EDC G+LQ+ S+G++ RSK  D+     PF  H   +V +KDS++ + +
Sbjct  1    MGSLGEEAQVAEDCMGLLQLLSNGTVLRSKSIDLITQQIPFKSHQ--TVVFKDSIYHKPN  58

Query  182  GLYLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDY  361
             L+LR+YKP  SA+   ++P++ FFHGGGFC GSR+WP+ H+ CL L + LQALVVAPDY
Sbjct  59   NLHLRLYKP-ISATNRTTIPVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLQALVVAPDY  117

Query  362  RLAPEHRLPAAMDDAFCAVKWVAAQA---STDAWLKD--GVDFNRAFVLGDSSGGNVAHH  526
            RLAPEHRLPAA +DA  A+ W+  QA     D W +D  GVDF+R FV+GDSSGGN+AH 
Sbjct  118  RLAPEHRLPAAFEDAEAALVWLQDQALSGDADHWFEDGPGVDFDRVFVVGDSSGGNIAHQ  177

Query  527  LAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPF  706
            LAVR G GS E++PVRVRGYV++ PFFGG  RTKSE +GP E  LNL++LD+FWRLSLP 
Sbjct  178  LAVRSGSGSVELTPVRVRGYVLLGPFFGGEERTKSE-DGPSEALLNLDLLDKFWRLSLPK  236

Query  707  GGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEVDYVV  883
              T +HP+ANPFGP SP LE+V L+P+LV+VGG E+L+DR + YA KLK+   K+VDY+ 
Sbjct  237  DATRNHPMANPFGPMSPRLESVSLEPMLVIVGGSELLRDRAKEYACKLKRMGGKKVDYIE  296

Query  884  FQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            F+ ++HGF++N+P S+ + QVL  ++ FM
Sbjct  297  FKNEEHGFYSNNPSSEAAEQVLGIIRDFM  325



>emb|CDX70090.1| BnaA10g24390D [Brassica napus]
Length=332

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 181/328 (55%), Positives = 241/328 (73%), Gaps = 14/328 (4%)
 Frame = +2

Query  20   MGSL----PHVVEDCSGILQVYSDGSIFRSKDED-INFPFPVHDDASVHWKDSLFDRTHG  184
            MGSL    P V EDC G+LQ+ S+G++ RSK  D I    P+ +  +V +KDS++ + + 
Sbjct  1    MGSLGEEQPQVAEDCMGLLQLLSNGTVLRSKSIDLITQQIPLANHETVLFKDSVYHKPNN  60

Query  185  LYLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            L+LR+YKP   ++  +  P++ FFHGGGFC GSR+WP+ H+ CL L + L ALVVAPDYR
Sbjct  61   LHLRLYKPVLVSNRTI--PVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLHALVVAPDYR  118

Query  365  LAPEHRLPAAMDDAFCAVKWVAAQAST---DAWLKDG--VDFNRAFVLGDSSGGNVAHHL  529
            LAPEHRLPAA DDA  A+ W+  QA +   D W + G  VDF+R +VLGDSSGGN+AHHL
Sbjct  119  LAPEHRLPAAFDDAEAALMWLRDQAVSGEGDHWFEGGPGVDFDRVYVLGDSSGGNIAHHL  178

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            A R G GS E+SPVRVRGYV++ PFFGG  RTKSE +GP E  LNL++LD+FWRLSLP G
Sbjct  179  AFRFGSGSVELSPVRVRGYVLLGPFFGGEERTKSE-DGPSEQKLNLDLLDKFWRLSLPEG  237

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQ-QNKEVDYVVF  886
             T DHP+ANPFGP SP+LE++ ++P+LV+ GG E+LKDR + YA KLK+ + K+VDY+ F
Sbjct  238  ATRDHPMANPFGPTSPALESISIEPMLVIAGGSELLKDRAKEYAYKLKKMRGKKVDYIEF  297

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            + ++HGF+ N P SD + Q+L+ +  FM
Sbjct  298  ENEEHGFYNNSPSSDAAQQLLRIIGDFM  325



>ref|XP_010910204.1| PREDICTED: probable carboxylesterase 15 [Elaeis guineensis]
Length=332

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 228/321 (71%), Gaps = 8/321 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            S PHVVEDC GILQ+ SDG+I RS +   N+P P+ DD +V WKD+ FD    L+LR+YK
Sbjct  6    SPPHVVEDCRGILQILSDGTILRSPNS--NYPVPIRDDGTVEWKDTQFDTAQDLHLRLYK  63

Query  206  PRSS-ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            PR    +    LP+ ++FHGGGFC+GS TW N H+CCLRL A L+A++VAPDYRLAPEHR
Sbjct  64   PRHRLPTDGPKLPVFYYFHGGGFCIGSCTWSNFHNCCLRLAAELRAIIVAPDYRLAPEHR  123

Query  383  LPAAMDDAFCAVKWV---AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG--V  547
            LPAA+DD   AV+ +   AA    D WL +  DF R F+ G+S+GGN+ HHLAVR G   
Sbjct  124  LPAALDDGAAAVELLRRHAASPDEDPWLAEAADFGRVFISGESAGGNIVHHLAVRYGSAA  183

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            G  E+ PVR+RG+VMM PFFGG  RT+SEAE P E FL+LE+ DR+WRLSLP G T DHP
Sbjct  184  GRAELEPVRIRGFVMMMPFFGGIQRTRSEAECPKEAFLSLEMNDRYWRLSLPAGATRDHP  243

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            LANP GP S SLEAV+++P+LV+V   ++L+DR   YA +L+   K V+ V  +G+QHGF
Sbjct  244  LANPDGPESSSLEAVEVEPVLVVVAEHDMLRDRDVEYARRLEGWGKRVELVEIKGQQHGF  303

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
            F    +S+   ++++ ++ FM
Sbjct  304  FAVGAWSEPVGELMKVIKRFM  324



>ref|XP_009122268.1| PREDICTED: probable carboxylesterase 15 [Brassica rapa]
Length=332

 Score =   338 bits (868),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 239/328 (73%), Gaps = 14/328 (4%)
 Frame = +2

Query  20   MGSL----PHVVEDCSGILQVYSDGSIFRSKDED-INFPFPVHDDASVHWKDSLFDRTHG  184
            MGSL    P V EDC G+LQ+ S+G++ RSK  D I    P+ +  +V +KDS+F + + 
Sbjct  1    MGSLGEEQPQVAEDCMGLLQLLSNGTVLRSKSIDLITQQIPLANHETVLFKDSVFHKPNN  60

Query  185  LYLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            L+LR+YKP   ++  +  P++ FFHGGGFC GSR+WP+ H+ CL L + L ALVVAPDYR
Sbjct  61   LHLRLYKPVLVSNRTI--PVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLHALVVAPDYR  118

Query  365  LAPEHRLPAAMDDAFCAVKWVAAQAST---DAWLKDG--VDFNRAFVLGDSSGGNVAHHL  529
            LAPEHRLPAA DDA  A+ W+  QA +   D W + G  VDF+R +VLGDSSGGN+AHHL
Sbjct  119  LAPEHRLPAAFDDAEAALMWLRDQAVSGEGDHWFEGGPGVDFDRVYVLGDSSGGNIAHHL  178

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            A R G GS E+SPVRVRGYV++ PFFGG  RTKSE +GP E  LNL++LD+FWRLSLP G
Sbjct  179  AFRFGSGSVELSPVRVRGYVLLGPFFGGEERTKSE-DGPSEQKLNLDLLDKFWRLSLPEG  237

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKE-VDYVVF  886
             T DHP+ANPFGP SP+LE++ ++P+LV+ GG E+LKDR + YA KLK+   E VDY+ F
Sbjct  238  ATRDHPMANPFGPTSPALESISIEPMLVIAGGSELLKDRAKEYAYKLKKMRGEKVDYIEF  297

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            + ++HGF+ N P SD + Q+L+ +  FM
Sbjct  298  ENEEHGFYNNSPSSDAAQQLLRIIGDFM  325



>ref|XP_010452596.1| PREDICTED: probable carboxylesterase 15 [Camelina sativa]
Length=332

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 246/327 (75%), Gaps = 12/327 (4%)
 Frame = +2

Query  20   MGSL---PHVVEDCSGILQVYSDGSIFRSKDEDI-NFPFPVHDDASVHWKDSLFDRTHGL  187
            MGSL   P VVEDC G+LQ+ S+G++ RSK  D+ +   PV    +V +KD ++ + + L
Sbjct  1    MGSLGEEPQVVEDCIGLLQLLSNGTVLRSKSIDLMSQQIPVTSHQTVLFKDFIYHKPNNL  60

Query  188  YLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            +LR+YKP S+A+ A +LP++ FFHGGGFC GSR+WP+ H+ CL L + LQALVVAPDYRL
Sbjct  61   HLRLYKPVSAANRA-ALPVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLQALVVAPDYRL  119

Query  368  APEHRLPAAMDDAFCAVKWVAAQAST---DAWLK--DGVDFNRAFVLGDSSGGNVAHHLA  532
            APEHRLPAA +DA  A+ W+  QA +   D W +   GVDF+R FV+GDSSGGN+AH LA
Sbjct  120  APEHRLPAAFEDAEAALMWLRDQALSGGDDHWFEGGTGVDFDRVFVVGDSSGGNIAHQLA  179

Query  533  VRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
             RLG G  E++PVRVRGYV++APFFGG  RTKSEA GP E  LNL++LD+FWRLSLP G 
Sbjct  180  FRLGSGLIELTPVRVRGYVLLAPFFGGEERTKSEA-GPSEALLNLDLLDKFWRLSLPKGA  238

Query  713  TPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEVDYVVFQ  889
            T DHP+ANPFGP SP ++++ ++P+LV+VGG E+L+DR + YA KLK+   K+VD + F+
Sbjct  239  TRDHPMANPFGPKSPRIKSISIEPMLVIVGGSELLRDRAKEYAYKLKKMGGKKVDCIEFE  298

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFM  970
             ++HGF++N+P S+ + +VL+ +  FM
Sbjct  299  NEEHGFYSNNPSSEAAEEVLRIIGDFM  325



>emb|CDX98936.1| BnaC09g48990D [Brassica napus]
Length=332

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 181/328 (55%), Positives = 241/328 (73%), Gaps = 14/328 (4%)
 Frame = +2

Query  20   MGSL----PHVVEDCSGILQVYSDGSIFRSKDED-INFPFPVHDDASVHWKDSLFDRTHG  184
            MGSL    P V EDC G+LQ+ S+G++ RSK  D I    P+ +  +V +KDS+F + + 
Sbjct  1    MGSLGEEQPQVAEDCMGLLQLLSNGTVLRSKSIDLITQQIPLANHETVLFKDSVFHKPNN  60

Query  185  LYLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            L+LR+YKP   ++  +  P++ FFHGGGFC GSR+WP+ H+ CL L + L ALVVAPDYR
Sbjct  61   LHLRLYKPVLVSNRTI--PVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLHALVVAPDYR  118

Query  365  LAPEHRLPAAMDDAFCAVKWVAAQAST---DAWLKDG--VDFNRAFVLGDSSGGNVAHHL  529
            LAPEHRLPAA +DA  A+ W+  QA +   D W + G  VDF+R +VLGDSSGGN+AHHL
Sbjct  119  LAPEHRLPAAFEDAEAALVWLRDQAVSSDCDHWFEGGPGVDFDRVYVLGDSSGGNIAHHL  178

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            A R G GS E+SPVRVRGYV++ PFFGG  RTKSE +GP E  LNL++LD+FWRLSLP G
Sbjct  179  AFRFGSGSVELSPVRVRGYVLLGPFFGGEERTKSE-DGPSEKKLNLDLLDKFWRLSLPEG  237

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQ-QNKEVDYVVF  886
             T DHP+ANPFGP SP+LE++ ++P+LV+ GG E+LKDR + YA KLK+ + K+VDY+ F
Sbjct  238  ATRDHPMANPFGPTSPALESISIEPMLVIAGGSELLKDRAKEYAYKLKKMRGKKVDYIEF  297

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            + ++HGF+ N P SD + Q+L+ +  FM
Sbjct  298  ENEEHGFYNNSPSSDAAQQLLRIIGDFM  325



>ref|XP_002461501.1| hypothetical protein SORBIDRAFT_02g003630 [Sorghum bicolor]
 gb|EER98022.1| hypothetical protein SORBIDRAFT_02g003630 [Sorghum bicolor]
Length=327

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 176/318 (55%), Positives = 225/318 (71%), Gaps = 5/318 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P VV++C G+L VYSDGS+ R       F  PV DD +V WKD  FD  HGL LR+Y PR
Sbjct  7    PRVVDECRGVLFVYSDGSVVRRAQP--GFSTPVRDDGTVEWKDVTFDDAHGLGLRLYLPR  64

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
              A+    LP+ F++HGGGFC+GSRTWPN  + CLRL + L ALVVAPDYRLAPEHRLPA
Sbjct  65   ERAAGGRRLPVFFYYHGGGFCIGSRTWPNVQNYCLRLASDLGALVVAPDYRLAPEHRLPA  124

Query  392  AMDDAFCAVKWVAAQAST-DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG--VGSPEM  562
            A+DDA  AV W+AAQA   D W+ +  D  R FV GDS+GG +AHHLAVR G      E+
Sbjct  125  ALDDAAAAVLWLAAQAKEGDPWVAEAADLGRVFVSGDSAGGTIAHHLAVRFGSPAARAEL  184

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            +PV VRGYV + PFFGG  RT+SEAE P + FLN  + DR+WRLSLP G T DHP++NPF
Sbjct  185  APVAVRGYVQLMPFFGGVERTRSEAECPDDAFLNRPLNDRYWRLSLPEGATADHPVSNPF  244

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GP +P+L+AV+  P +V+VGG+++L DR  +YA +LK   K V+   F G+QHGFFT DP
Sbjct  245  GPGAPALDAVEFAPTMVVVGGRDILHDRAVDYADRLKAAGKPVEVRDFDGQQHGFFTIDP  304

Query  923  FSDVSTQVLQQLQHFMIS  976
            +SD S ++++ ++ F+ S
Sbjct  305  WSDASAELMRVVKRFVDS  322



>ref|XP_002873267.1| hypothetical protein ARALYDRAFT_487467 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49526.1| hypothetical protein ARALYDRAFT_487467 [Arabidopsis lyrata subsp. 
lyrata]
Length=329

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 179/327 (55%), Positives = 239/327 (73%), Gaps = 12/327 (4%)
 Frame = +2

Query  20   MGSL---PHVVEDCSGILQVYSDGSIFRSKDED-INFPFPVHDDASVHWKDSLFDRTHGL  187
            MGSL   P V EDC G+LQ+ S+G++ RS+  D I    P  +  +V +KDS++ + + L
Sbjct  1    MGSLGEEPQVTEDCMGLLQLLSNGTVLRSESIDLITQQIPFKNHQTVLFKDSIYHKPNNL  60

Query  188  YLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            +LR+YKP  SAS   +LP++ FFHGGGFC GSR+WP+ H+  + L + L ALVVAPDYRL
Sbjct  61   HLRLYKP-ISASNRTALPVVVFFHGGGFCFGSRSWPHFHNFSVTLASSLNALVVAPDYRL  119

Query  368  APEHRLPAAMDDAFCAVKWVAAQAST---DAWLKDG--VDFNRAFVLGDSSGGNVAHHLA  532
            APEHRLPAA +DA  A+ W+  QA +   D W + G  VDF+R FV+GDSSGGN+AH LA
Sbjct  120  APEHRLPAAFEDAEAALTWLRDQAVSGGVDHWFEGGTDVDFDRVFVVGDSSGGNMAHQLA  179

Query  533  VRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
            VR G GS E++PVRVRGYV+M PFFGG  RT SE  GP E  LNL++LD+FWRLSLP G 
Sbjct  180  VRFGSGSIELTPVRVRGYVLMGPFFGGEERTNSE-NGPSEALLNLDLLDKFWRLSLPKGA  238

Query  713  TPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEVDYVVFQ  889
              DHP+ANPFGP SP+LE + ++P+LV+VGG E+L+DR + YA KLK+   K+VDY+ F+
Sbjct  239  IRDHPMANPFGPMSPTLELISIEPMLVIVGGSELLRDRAKEYAYKLKKMGGKKVDYIEFE  298

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFM  970
             ++HGF++N+P S+ + QVL+ +  FM
Sbjct  299  NEEHGFYSNNPSSEAAEQVLRTIGDFM  325



>gb|EYU18138.1| hypothetical protein MIMGU_mgv1a019510mg [Erythranthe guttata]
Length=231

 Score =   328 bits (841),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 189/230 (82%), Gaps = 10/230 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VEDC GI+Q++SDGS+ RS  +D+ FP  V DD S  WKD LFD+ H L LR+
Sbjct  1    MGSLPHIVEDCLGIVQLFSDGSVSRS--DDVKFPMEVQDDGSAVWKDCLFDKEHDLSLRL  58

Query  200  YKPRS-SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            YKPRS SA+AA +LPI++FF GGGFCVGSRTWPNCHSCCLRL + LQ LVVAPDYRLAPE
Sbjct  59   YKPRSPSAAAAAALPILYFFRGGGFCVGSRTWPNCHSCCLRLASALQVLVVAPDYRLAPE  118

Query  377  HRLPAAMDDAFCAVKWVAAQA------STDAWLKDG-VDFNRAFVLGDSSGGNVAHHLAV  535
            HRLPAA+DDAF AVKW+ +QA        D WL  G VDF+R FV+GDSSGGN+AHHLAV
Sbjct  119  HRLPAAVDDAFTAVKWLQSQALLSDDGGADEWLAKGSVDFDRVFVVGDSSGGNLAHHLAV  178

Query  536  RLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRF  685
             L  GSP ++PVRVRGYV+MAPFFGGTVRTKSEAEGPPE FLN+EILDR+
Sbjct  179  ELRRGSPSLAPVRVRGYVLMAPFFGGTVRTKSEAEGPPEQFLNIEILDRY  228



>ref|XP_010423321.1| PREDICTED: probable carboxylesterase 15 [Camelina sativa]
Length=332

 Score =   327 bits (838),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 177/327 (54%), Positives = 236/327 (72%), Gaps = 12/327 (4%)
 Frame = +2

Query  20   MGSL---PHVVEDCSGILQVYSDGSIFRSKDED-INFPFPVHDDASVHWKDSLFDRTHGL  187
            MGSL   P V EDC G+LQ+ SDG++ RSK  D I    P     +V +KD ++ + + +
Sbjct  1    MGSLGEEPQVAEDCMGLLQLLSDGTVLRSKSIDHITQQIPFTSHQTVLFKDFIYHKPNSI  60

Query  188  YLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            +LR+YKP  SA+   +LP++ FFHGGGFC GSR+WP+ H+ CL L + LQALVVAPDYRL
Sbjct  61   HLRLYKP-VSATNRTALPVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLQALVVAPDYRL  119

Query  368  APEHRLPAAMDDAFCAVKWVAAQA---STDAWLKD--GVDFNRAFVLGDSSGGNVAHHLA  532
            APEHRLPAA +DA  A+ W+  QA     D W +   GVDF+R FV+GDSSGGN+AH LA
Sbjct  120  APEHRLPAAFEDAEAALMWLRDQALPGGADHWFEGGVGVDFDRVFVVGDSSGGNIAHQLA  179

Query  533  VRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
             RLG GS E++ VRVRGYV++APFFGG  RTKSE +GP E  LNL++LD+FWRLSLP   
Sbjct  180  FRLGSGSIELTRVRVRGYVLLAPFFGGEERTKSE-DGPSEALLNLDLLDKFWRLSLPKRA  238

Query  713  TPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEVDYVVFQ  889
            T DHP+ANPFGP SP LE++ ++P+LV+VG  E+L+DR + YA  LK    K+VD + F+
Sbjct  239  TRDHPMANPFGPKSPGLESINIEPMLVIVGSSELLRDRAKEYAYNLKNMGGKKVDCIEFE  298

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFM  970
             ++HGF++N+P S+ + +VL+ +  FM
Sbjct  299  NEEHGFYSNNPSSEAAEEVLRIIGDFM  325



>ref|XP_003557566.1| PREDICTED: probable carboxylesterase 15 [Brachypodium distachyon]
Length=338

 Score =   322 bits (824),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 172/317 (54%), Positives = 223/317 (70%), Gaps = 11/317 (3%)
 Frame = +2

Query  44   EDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSSAS  223
            ++C G+L VYSDGS+ R       F  PV DD SV WKD++FD  HGL LR+YKPR   +
Sbjct  18   DECRGVLFVYSDGSVVRRAGP--GFATPVRDDGSVEWKDAVFDAAHGLGLRLYKPRDRKN  75

Query  224  AAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAMDD  403
              + LP+ F+FHGGGFC+GSRTWPNC + CLRL A L A+VVAPDYRLAPEHRLPAA+DD
Sbjct  76   HDL-LPVFFYFHGGGFCIGSRTWPNCQNYCLRLAAELDAVVVAPDYRLAPEHRLPAALDD  134

Query  404  AFCAVKWVAAQ---ASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMS---  565
            A  A+ W+A+       D WL +  DF R FV GDS+GG +AHHLAVR G  +   S   
Sbjct  135  AAAALLWLASHAAPGGGDPWLTEAADFGRIFVSGDSAGGTIAHHLAVRFGCPTARTSLGP  194

Query  566  PVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFG  745
             VRV+GYV + PFFGGT RT+SEAE P + FLN  + DR+WRLSLP G T DHP +NPF 
Sbjct  195  GVRVKGYVQLMPFFGGTERTRSEAECPDDAFLNRPLNDRYWRLSLPDGATADHPASNPFA  254

Query  746  P--ASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTND  919
            P  +  +LEA ++ P LV+VGG+++L+DR  +YA +L+   K V+   F+G+QHGFFT D
Sbjct  255  PGESREALEAAEMAPTLVVVGGRDILRDRAVDYAARLRAMGKPVEVREFEGQQHGFFTID  314

Query  920  PFSDVSTQVLQQLQHFM  970
            P+SD S ++++ L+ F+
Sbjct  315  PWSDASAELMRALKRFV  331



>ref|XP_006826391.1| hypothetical protein AMTR_s00004p00146330 [Amborella trichopoda]
 gb|ERM93628.1| hypothetical protein AMTR_s00004p00146330 [Amborella trichopoda]
Length=327

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 219/320 (68%), Gaps = 6/320 (2%)
 Frame = +2

Query  11   EREMGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLY  190
            E++    P+ +E+C G+LQ++S+GSI RS     +F  PV DD SV WKD  FD+   L+
Sbjct  10   EKKFSDTPYEIENCRGVLQIFSNGSIVRSPQP--SFQIPVEDDGSVLWKDVGFDKALDLH  67

Query  191  LRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLA  370
            LR+YKP S  +    LPI ++FHGGG+C+GSRTWPN H+ CL+L   L A+V+APDYRLA
Sbjct  68   LRVYKPLSHENN--RLPIFYYFHGGGYCIGSRTWPNFHNFCLKLSRELPAIVIAPDYRLA  125

Query  371  PEHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            PE+RLP+A+DDAF AV+W+A    TD +L    DF R ++ GDS+GGN+AHHLAV L  G
Sbjct  126  PENRLPSAIDDAFSAVRWLATDGITDQFLSQTADFGRVYISGDSAGGNIAHHLAVGLSEG  185

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPL  730
              E   + ++G+V++ PFFGG   T SEA  P + FL L++ DR+WRLSLP G   DHPL
Sbjct  186  GHEN--LTIKGFVLLMPFFGGVEHTLSEATCPQDAFLKLDLNDRYWRLSLPEGTDRDHPL  243

Query  731  ANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
            +NPFGP +  L +V   P+L +VG +++L+DR   Y  +L +  K+V+ V  +G+QHGFF
Sbjct  244  SNPFGPGAKDLGSVDFIPMLDVVGERDLLRDRGVEYGKRLVEMGKKVEVVELKGQQHGFF  303

Query  911  TNDPFSDVSTQVLQQLQHFM  970
            T  P S  + +++ +++ F+
Sbjct  304  TIYPNSQEAKELMDRIRAFI  323



>ref|XP_008779109.1| PREDICTED: probable carboxylesterase 15 [Phoenix dactylifera]
Length=334

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 224/321 (70%), Gaps = 6/321 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            S PHVVEDC G+LQV SDGSI RS +  I  P PV DD +V WKD  FD  H L+LR+YK
Sbjct  6    SPPHVVEDCLGVLQVLSDGSILRSPNPVIPVPVPVLDDGTVVWKDVQFDAAHDLHLRLYK  65

Query  206  PRSSA-SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            PR+   S  + LP+ ++FH GGFC GS TW    +CCLRL A L+A+VV PDYRLAPEHR
Sbjct  66   PRNRLPSDGLKLPVFYYFHVGGFCFGSCTWSANQNCCLRLAAELRAVVVNPDYRLAPEHR  125

Query  383  LPAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG--V  547
            LPAA+DD   AV+W+  QA +   D WL +  DF R F+ G+S+GGN+AHHLAVR G   
Sbjct  126  LPAAIDDGASAVEWLRRQAVSPDQDPWLAEAADFGRVFISGESAGGNIAHHLAVRFGSAA  185

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            G  E+ PV++ G++++ PF GG  RT+SEA+ P E F NLE  DR+WRLSLP GGT DHP
Sbjct  186  GRAELHPVQICGFLLIMPFIGGIQRTRSEAQCPKEAFFNLEANDRYWRLSLPAGGTRDHP  245

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            LANPFGP SPSLEAV+++P+LV+V   ++L+DR  +YA + +   K V  V F+G+QHGF
Sbjct  246  LANPFGPESPSLEAVEVEPVLVVVAENDLLRDRGVDYAKRFEGWGKRVKLVEFKGQQHGF  305

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
            F     S+   +++  ++ FM
Sbjct  306  FCFGASSEPVDELMTVIKRFM  326



>ref|XP_008779106.1| PREDICTED: probable carboxylesterase 15 [Phoenix dactylifera]
 ref|XP_008779108.1| PREDICTED: probable carboxylesterase 15 [Phoenix dactylifera]
Length=332

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 226/321 (70%), Gaps = 8/321 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            S PHVVEDC GILQV SDGSI RS +  +  P  V DD +V WKD  FD  + L+LR+YK
Sbjct  6    SPPHVVEDCLGILQVLSDGSILRSPNPVVPVP--VRDDGTVVWKDVQFDAAYDLHLRLYK  63

Query  206  PRSSA-SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            PR+   S  + LP+ ++FHGGGFC GS T     +CCLRL A L+A+VVAPDYRLAPEHR
Sbjct  64   PRNRLPSDGLKLPVFYYFHGGGFCFGSCTLSAYQNCCLRLAAELRAVVVAPDYRLAPEHR  123

Query  383  LPAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG--V  547
            LPAA+DD   AV+W+  QA +   D WL +  DF R F+ G+S+GGN+AHH+AVR G   
Sbjct  124  LPAAIDDGASAVEWLRRQAVSPDQDPWLAEAADFGRVFISGESAGGNIAHHMAVRFGSAA  183

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            G  E+ PV++ G+V+M PF GG  RT+SEA+ P E FLNLE  DR+WRLSLP GGT DHP
Sbjct  184  GRAELHPVQICGFVLMMPFIGGIQRTRSEAQCPKELFLNLEANDRYWRLSLPAGGTRDHP  243

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            LANPFGP SPSLEAV+++P+LV+V   ++L+DR  +YA +L+   K V  V F+G+QH F
Sbjct  244  LANPFGPESPSLEAVEVEPVLVVVAENDLLRDRGVDYAKRLEGWGKRVKLVEFKGQQHAF  303

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
            F    +S+   +++  ++ FM
Sbjct  304  FYFGAWSEPVDELMTVIKRFM  324



>ref|XP_002463764.1| hypothetical protein SORBIDRAFT_01g005720 [Sorghum bicolor]
 gb|EER90762.1| hypothetical protein SORBIDRAFT_01g005720 [Sorghum bicolor]
Length=332

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 210/323 (65%), Gaps = 8/323 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            S PHVVED   +LQ+ SDG++ R  D D   P  V     V WKD ++D TH L LR+Y+
Sbjct  5    SPPHVVEDMPHVLQLLSDGTVVRFADYDTLPPPSVPPALPVQWKDVVYDATHDLKLRVYR  64

Query  206  PRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
            P   +     LP++ +FHGGG+ +G+   PN H+CCLRL A L A+V++ DYRLAPEHRL
Sbjct  65   PPPDSCGNNKLPVLVYFHGGGYVLGTFALPNFHACCLRLAAELPAVVLSADYRLAPEHRL  124

Query  386  PAAMDDAFCAVKWVAAQA----STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            PAA+DDA   + WV AQA      D WL +  D  R FV GDS+GGN+ HH+AVRL   S
Sbjct  125  PAALDDAASVMDWVRAQAVDAAGGDPWLAESADLRRVFVTGDSAGGNIVHHVAVRLASAS  184

Query  554  PEMSP----VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
             E+SP    VRV G+VM+ PFFGG  RT SEAE PP PFL L   D+ WRL+LP G T D
Sbjct  185  GELSPGLDPVRVAGHVMLCPFFGGAERTASEAEFPPGPFLTLPWYDQAWRLALPPGATRD  244

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HP ANPFGP SP+L  V L P LV+   +++L+DR  +Y  +LK   + V++V F+G+ H
Sbjct  245  HPFANPFGPESPALGGVALPPTLVVAAERDLLRDRQADYVARLKATEQPVEHVEFEGQHH  304

Query  902  GFFTNDPFSDVSTQVLQQLQHFM  970
            GFF  +P  D  ++V++ ++ F+
Sbjct  305  GFFAVEPAGDAGSEVVRLVRRFV  327



>ref|NP_001051515.1| Os03g0790500 [Oryza sativa Japonica Group]
 gb|ABF99276.1| PrMC3, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13429.1| Os03g0790500 [Oryza sativa Japonica Group]
 dbj|BAG97967.1| unnamed protein product [Oryza sativa Japonica Group]
Length=360

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/319 (48%), Positives = 213/319 (67%), Gaps = 6/319 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDAS-VHWKDSLFDRTHGLYLRIYKP  208
            P+VVEDC   LQ++SDG++ R +D +I  P  +    S V WKD ++D   GL LR+Y+P
Sbjct  26   PYVVEDCGPNLQLFSDGTVIRFEDYNILPPPVLPPALSTVQWKDVVYDAGRGLKLRVYRP  85

Query  209  RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
             ++  A   LP++ +FHGGG+ +GS    N H+CCLRL   L A+V++ DYRLAPEHRLP
Sbjct  86   PAATVAGEKLPVLVYFHGGGYFIGSFEMDNFHACCLRLAHELPAVVLSADYRLAPEHRLP  145

Query  389  AAMDDAFCAVKWVAAQA-----STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            AA DDA  A+ WV  QA     + D WL +  DF R FV GDS+G  + HH+A+RLG G 
Sbjct  146  AAHDDAATAMSWVRDQAVASGDAADPWLAESADFGRVFVSGDSAGAGIVHHVALRLGSGQ  205

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
              + P RV G  ++ P+FGG  RT+SEAE PP PFL L   D+ WRL+LP G T DHPLA
Sbjct  206  IAVDPARVAGCALLFPYFGGEERTRSEAEYPPGPFLTLPFSDQGWRLALPRGATRDHPLA  265

Query  734  NPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFT  913
            NPFGP SP+++AV L P+LV+V   ++L+DR  +YA +L+   K+V+ V F+G+ HGFF 
Sbjct  266  NPFGPESPAMDAVALPPLLVVVAQLDLLRDRDVDYAARLRAMGKQVEMVEFEGQHHGFFA  325

Query  914  NDPFSDVSTQVLQQLQHFM  970
             +P  D  +++++ ++ F+
Sbjct  326  VEPLGDAGSELVRVVRRFV  344



>gb|EAY92127.1| hypothetical protein OsI_13838 [Oryza sativa Indica Group]
Length=342

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 213/319 (67%), Gaps = 6/319 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDAS-VHWKDSLFDRTHGLYLRIYKP  208
            P+VVEDC   LQ++SDG++ R +D +I  P  +    S V WKD ++D   GL LR+Y+P
Sbjct  8    PYVVEDCGPNLQLFSDGTVIRFEDYNILPPPVLPPALSTVQWKDVVYDAGRGLKLRVYRP  67

Query  209  RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
             ++  A   LP++ +FHGGG+ +GS    N H+CCLRL   L A+V++ DYRLAPEHRLP
Sbjct  68   PAATVAGEKLPVLVYFHGGGYFIGSFEMDNFHACCLRLAHELPAVVLSADYRLAPEHRLP  127

Query  389  AAMDDAFCAVKWVAAQA-----STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            AA DDA  A+ WV  QA     + D WL +  DF R FV GDS+G  + HH+A+RLG G 
Sbjct  128  AAHDDAATAMSWVRDQAVASGDAADPWLAESADFGRVFVSGDSAGAGIVHHVALRLGSGQ  187

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
              + P RV G  ++ P+FGG  RT+SEAE PP PFL L   D+ WRL+LP G T DHPLA
Sbjct  188  IAVDPARVAGCALLFPYFGGEERTRSEAENPPGPFLTLPFSDQGWRLALPRGATRDHPLA  247

Query  734  NPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFT  913
            NPFGP +P+++AV L P+LV+V   ++L+DR  +YA +L+   K+V+ V F+G+ HGFF 
Sbjct  248  NPFGPENPAMDAVALPPLLVVVAQLDLLRDRDVDYAARLRAMGKQVEMVEFEGQHHGFFA  307

Query  914  NDPFSDVSTQVLQQLQHFM  970
             +P  D  +++++ ++ F+
Sbjct  308  VEPLGDAGSELVRVVRRFV  326



>gb|AAO24912.1| putative esterase [Oryza sativa Japonica Group]
 gb|EAZ28859.1| hypothetical protein OsJ_12897 [Oryza sativa Japonica Group]
Length=342

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/319 (48%), Positives = 213/319 (67%), Gaps = 6/319 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDAS-VHWKDSLFDRTHGLYLRIYKP  208
            P+VVEDC   LQ++SDG++ R +D +I  P  +    S V WKD ++D   GL LR+Y+P
Sbjct  8    PYVVEDCGPNLQLFSDGTVIRFEDYNILPPPVLPPALSTVQWKDVVYDAGRGLKLRVYRP  67

Query  209  RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
             ++  A   LP++ +FHGGG+ +GS    N H+CCLRL   L A+V++ DYRLAPEHRLP
Sbjct  68   PAATVAGEKLPVLVYFHGGGYFIGSFEMDNFHACCLRLAHELPAVVLSADYRLAPEHRLP  127

Query  389  AAMDDAFCAVKWVAAQA-----STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            AA DDA  A+ WV  QA     + D WL +  DF R FV GDS+G  + HH+A+RLG G 
Sbjct  128  AAHDDAATAMSWVRDQAVASGDAADPWLAESADFGRVFVSGDSAGAGIVHHVALRLGSGQ  187

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
              + P RV G  ++ P+FGG  RT+SEAE PP PFL L   D+ WRL+LP G T DHPLA
Sbjct  188  IAVDPARVAGCALLFPYFGGEERTRSEAEYPPGPFLTLPFSDQGWRLALPRGATRDHPLA  247

Query  734  NPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFT  913
            NPFGP SP+++AV L P+LV+V   ++L+DR  +YA +L+   K+V+ V F+G+ HGFF 
Sbjct  248  NPFGPESPAMDAVALPPLLVVVAQLDLLRDRDVDYAARLRAMGKQVEMVEFEGQHHGFFA  307

Query  914  NDPFSDVSTQVLQQLQHFM  970
             +P  D  +++++ ++ F+
Sbjct  308  VEPLGDAGSELVRVVRRFV  326



>ref|XP_004955526.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=349

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/320 (49%), Positives = 207/320 (65%), Gaps = 9/320 (3%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDD-ASVHWKDSLFDRTHGLYLRIYKPRS  214
            VVED  G L+V  DG++ RS       P    D   SV WK++++D+   L +R+YKP S
Sbjct  21   VVEDIYGFLRVLEDGTVLRSAAGPAFCPATFPDSHPSVQWKEAVYDKAKNLRVRMYKPSS  80

Query  215  SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAA  394
            +A+    LP++  FHGGGFC+GS TW N H+ CLRL A   A+V++  YRLAPEHRLPAA
Sbjct  81   AAAGGSKLPVLVHFHGGGFCLGSCTWANVHAFCLRLAAEAGAVVLSAGYRLAPEHRLPAA  140

Query  395  MDDAFCAVKWVAAQ----ASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV---GS  553
            +DDA   ++W+  Q    A  D+WL +  DF R FV GDS+GG +AHHLAVR      G 
Sbjct  141  VDDAGGFLRWLREQSANAADDDSWLAEAADFGRVFVTGDSAGGTIAHHLAVRAATTKRGE  200

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
             ++ PV VRGYV++ PFFGG  RT+SEAE P E  LNL++ DRFWRLSLP G T DHP A
Sbjct  201  LDLDPVTVRGYVLLMPFFGGVRRTRSEAECPAEVLLNLDLFDRFWRLSLPAGATRDHPAA  260

Query  734  NPFGPASPSLEAVKL-DPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
            NPFGP SP L AV    P+LV+ GG +++ DR  +YA +L    K V+   F G+ HGF+
Sbjct  261  NPFGPESPDLAAVDFRRPVLVVAGGLDMMHDRAVDYAERLAAMGKPVELAEFAGEPHGFY  320

Query  911  TNDPFSDVSTQVLQQLQHFM  970
            T DP S+ + +++  +  F+
Sbjct  321  TLDPGSEATGELIGLVSRFV  340



>ref|XP_002459376.1| hypothetical protein SORBIDRAFT_02g003600 [Sorghum bicolor]
 gb|EER95897.1| hypothetical protein SORBIDRAFT_02g003600 [Sorghum bicolor]
Length=367

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/336 (48%), Positives = 218/336 (65%), Gaps = 24/336 (7%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFP--FPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            VVED  G L+V SDG+I RS ++ +  P  FP     SV WK+ ++D+ + L +R+YKP 
Sbjct  24   VVEDIYGFLRVLSDGTILRSPEQPVFCPATFP-SSHPSVQWKEEVYDKANNLRVRMYKPL  82

Query  212  SSASAAV-----SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            S+A+         LP++  FHGGGFC+GS TW N H+ CLRL A   A+V++  YRLAPE
Sbjct  83   STAAGGGGEAGKKLPVLVHFHGGGFCLGSCTWANVHAYCLRLAAEAGAVVLSAGYRLAPE  142

Query  377  HRLPAAMDDAFCAVKWVAAQASTDA------WLKDGVDFNRAFVLGDSSGGNVAHHLAVR  538
            HRLP A+DD    ++W+ AQ++ DA      WL +  DF R FV GDS+GGN+AHHLAVR
Sbjct  143  HRLPTAVDDGVGFLRWLRAQSTMDAAAAADGWLTEAADFGRVFVTGDSAGGNIAHHLAVR  202

Query  539  LGVGSP---------EMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWR  691
             G+            ++ PV VRGYV++ PFFGG  RT SEAE P E  LNL++ DRFWR
Sbjct  203  AGLSDTKRGEVDLDLDLRPVTVRGYVLLMPFFGGVRRTPSEAECPAEVLLNLDLFDRFWR  262

Query  692  LSLPFGGTPDHPLANPFGPASPSLEAVKLD-PILVMVGGQEVLKDRVENYAMKLKQQNKE  868
            LSLP GGT DHP ANPFGP SP L +V    P+LV+VGG ++++DR  +YA +L    K 
Sbjct  263  LSLPAGGTRDHPAANPFGPDSPELGSVDFRAPVLVVVGGLDMMRDRAVDYAERLAAMGKP  322

Query  869  VDYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFMIS  976
            V+ V F GK HGF+ ++P S+ + +++  +  F+ S
Sbjct  323  VELVEFAGKPHGFYLHEPGSEATGELIGLVSRFLHS  358



>ref|NP_001058947.1| Os07g0162400 [Oryza sativa Japonica Group]
 dbj|BAC15963.1| putative cell death associated protein [Oryza sativa Japonica 
Group]
 dbj|BAD30762.1| putative cell death associated protein [Oryza sativa Japonica 
Group]
 dbj|BAF20861.1| Os07g0162400 [Oryza sativa Japonica Group]
 dbj|BAG87310.1| unnamed protein product [Oryza sativa Japonica Group]
Length=327

 Score =   307 bits (786),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/320 (46%), Positives = 213/320 (67%), Gaps = 5/320 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P+VVEDC G +Q+ SDG++ RS +   +   P   DA+V WKD  +D  H L  R+Y+PR
Sbjct  7    PYVVEDCRGAVQLMSDGTVRRSAEPAFHVDLPDDADAAVEWKDVTYDAEHDLNARLYRPR  66

Query  212  S-SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
               A+    +P++ +FHGGGFC+GS  WPN H+ CLRL A L A+V++ DYRLAPEHRLP
Sbjct  67   HLGAANDARVPVVAYFHGGGFCIGSGRWPNFHAWCLRLAAELPAVVLSFDYRLAPEHRLP  126

Query  389  AAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP  568
            AA +D   A+ WV   A+ D WL D  DF+R FV GDS+GGN+ HH+AVR G     + P
Sbjct  127  AAQEDGATAMAWVRDSAARDPWLADAADFSRVFVAGDSAGGNITHHMAVRFGKAG--LGP  184

Query  569  -VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFG  745
             VR+RG+V++ P   G  RT++E E  P  FL  E+ DR+ RL LP G T D+P+ NP G
Sbjct  185  QVRLRGHVLLMPAMAGETRTRAELECRPGAFLTAEMSDRYARLILPGGATRDYPVLNPAG  244

Query  746  PASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEVDYVVFQGKQHGFFTNDP  922
            P +P LEAV + P LV+    ++L+DR E+YA +++++  KEV +V F G+QHGFF  DP
Sbjct  245  PEAPGLEAVAMAPSLVVAAEHDILRDRNEHYARRMREEWGKEVAFVEFAGEQHGFFEVDP  304

Query  923  FSDVSTQVLQQLQHFMISKV  982
            +S+ + ++++ ++ F++  +
Sbjct  305  WSERADELVRLIRSFVVEHM  324



>gb|ABK22844.1| unknown [Picea sitchensis]
Length=319

 Score =   306 bits (784),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 208/317 (66%), Gaps = 12/317 (4%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            VVEDC G+LQVYS+G+I RS+      PF   DD  V  KD +F+ + GL LR+Y P  +
Sbjct  5    VVEDCRGVLQVYSNGTITRSQKPSFVAPF--EDDGRVLSKDVVFEPSLGLELRLYIP--A  60

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
                  LPI  +FHGGGFC+GSRTWPN H+ CLRL A L A+VVAPDYRL PEHRLP A+
Sbjct  61   LVVTTKLPIFVYFHGGGFCIGSRTWPNFHNYCLRLAASLNAIVVAPDYRLGPEHRLPDAL  120

Query  398  DDAFCAVKWV------AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPE  559
            DD F A++W+      A  ++ + WL D  DF R +V GDS+GG++AHH++VR    S +
Sbjct  121  DDGFWALRWIRAQAAAAGSSAAEPWLADHADFARVYVSGDSAGGSIAHHVSVR--AQSED  178

Query  560  MSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANP  739
               ++++GYV +  F+GG  R  SEA  P +  LNLE+ DRFWRLSLP G   DHP+ NP
Sbjct  179  WGQMKIKGYVHLMAFYGGEDRKPSEAMCPTDARLNLELNDRFWRLSLPVGANRDHPICNP  238

Query  740  FGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTND  919
              P +P L  V L P+LV+ GG+++L+DR   YA  LK   KEV+  VF+ ++HGFFT  
Sbjct  239  LAPGAPCLSNVALPPVLVVAGGRDLLRDREIEYAEVLKSSGKEVELAVFEEEEHGFFTLT  298

Query  920  PFSDVSTQVLQQLQHFM  970
            P S  S ++++++  FM
Sbjct  299  PNSPASGRLMERIIQFM  315



>ref|XP_009368866.1| PREDICTED: probable carboxylesterase 15 [Pyrus x bretschneideri]
Length=291

 Score =   305 bits (780),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 158/319 (50%), Positives = 201/319 (63%), Gaps = 48/319 (15%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            +LP+  E+C G+L+VYSDGSI RS     +F  PV DD SV WKD +FD T+ L LR+YK
Sbjct  10   TLPY--EECRGVLRVYSDGSIVRSPKP--SFDIPVDDDGSVAWKDVVFDPTNQLQLRLYK  65

Query  206  P----RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            P     S +S +  LPI F+ HGGGFC+GSR WPNC + C +L + LQ +VVAPDYRLAP
Sbjct  66   PTVTTHSPSSLSKKLPIFFYIHGGGFCIGSRAWPNCQNYCFQLASQLQCVVVAPDYRLAP  125

Query  374  EHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            EHRLP                                         N+AHHL V LG GS
Sbjct  126  EHRLPC----------------------------------------NIAHHLTVHLGAGS  145

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
             E+ PVRV+GYV++ PFFGGTV T+SEAEGP E FLN E++DRFWRLS+P G   DHPL 
Sbjct  146  VELGPVRVKGYVLLVPFFGGTVLTRSEAEGPKEAFLNWELIDRFWRLSIPIGEDRDHPLV  205

Query  734  NPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFT  913
            NPF P S SLE V  DPILV+VGG ++LKDR ++YA +LK    ++D V F+G+ H FFT
Sbjct  206  NPFVPNSRSLEGVAFDPILVIVGGSDLLKDRAQDYADRLKNWGNKIDCVEFEGQHHAFFT  265

Query  914  NDPFSDVSTQVLQQLQHFM  970
              P S  + +++  ++ F+
Sbjct  266  IQPNSQPAKELMLFIKRFI  284



>gb|EAZ02863.1| hypothetical protein OsI_24993 [Oryza sativa Indica Group]
Length=327

 Score =   306 bits (783),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/320 (46%), Positives = 212/320 (66%), Gaps = 5/320 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P+VVEDC G +Q+ SDG++ RS     +   P   DA+V WKD  +D  H L  R+Y+PR
Sbjct  7    PYVVEDCRGAVQLMSDGTVRRSAKPAFHVDLPDDADAAVEWKDVTYDAEHDLNARLYRPR  66

Query  212  S-SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
               A+    +P++ +FHGGGFC+GS  WPN H+ CLRL A L A+V++ DYRLAPEHRLP
Sbjct  67   HLGAANDARVPVVAYFHGGGFCIGSGRWPNFHAWCLRLAAELPAVVLSFDYRLAPEHRLP  126

Query  389  AAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP  568
            AA +D   A+ WV   A+ D WL D  DF+R FV GDS+GGN+ HH+AVR G     + P
Sbjct  127  AAQEDGATAMAWVRDSAARDPWLADAADFSRVFVAGDSAGGNITHHMAVRFGKAG--LGP  184

Query  569  -VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFG  745
             VR+RG+V++ P   G  RT++E E  P  FL  E+ DR+ RL LP G T D+P+ NP G
Sbjct  185  QVRLRGHVLLMPAMAGETRTRAELECRPGAFLTAEMSDRYARLILPGGATRDYPVLNPAG  244

Query  746  PASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEVDYVVFQGKQHGFFTNDP  922
            P +P LEAV + P LV+    ++L+DR E+YA +++++  KEV +V F G+QHGFF  DP
Sbjct  245  PEAPGLEAVAMAPSLVVAAEHDILRDRNEHYARRMREEWGKEVAFVEFAGEQHGFFEVDP  304

Query  923  FSDVSTQVLQQLQHFMISKV  982
            +S+ + ++++ ++ F++  +
Sbjct  305  WSERADELVRLIRSFVVEHM  324



>ref|XP_006643767.1| PREDICTED: probable carboxylesterase 15-like [Oryza brachyantha]
Length=333

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 203/318 (64%), Gaps = 7/318 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPF-PVHDDASVHWKDSLFDRTHGLYLRIYKP  208
            PHVVED SG++Q+ SDG++ R     +     P HD   V WKD ++D  HGL +R+Y+P
Sbjct  7    PHVVEDFSGVVQLLSDGTVVRGDGAALLPSLEPNHDVPGVQWKDVVYDAAHGLRVRVYRP  66

Query  209  RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
              +      LP++ +FHGGG+C+G+   PN H+ CLR  + L ALV++  YRLAPEHRLP
Sbjct  67   --TVGDGGKLPVLVYFHGGGYCIGAVEEPNFHTFCLRAASELPALVLSVQYRLAPEHRLP  124

Query  389  AAMDDAFCAVKWVAAQAS----TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSP  556
            AA+DD      W++ QA+     D WL +  DF R FV G S+G N+AHH+ VRL  G P
Sbjct  125  AAIDDGAAFFSWISGQAALGAGADPWLAESADFARTFVSGVSAGANLAHHVTVRLASGQP  184

Query  557  EMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLAN  736
             + PVRV GYV++  FF G  RT SEA  P    L +E+ D+ WR+SLP G T DHP+AN
Sbjct  185  VVDPVRVAGYVLIDAFFAGVERTASEASPPANVSLTVEMADQLWRMSLPVGATRDHPVAN  244

Query  737  PFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTN  916
            PFGP SPSL  V L P LV+  G +VL DRV +YA +LK+  K V+   F+G+QHGF   
Sbjct  245  PFGPDSPSLALVALPPALVVAPGGDVLYDRVVDYAARLKEMGKSVELAEFEGEQHGFSVL  304

Query  917  DPFSDVSTQVLQQLQHFM  970
             P+S  S++ ++ L+ FM
Sbjct  305  QPWSPASSEFIRVLKQFM  322



>ref|XP_002461499.1| hypothetical protein SORBIDRAFT_02g003610 [Sorghum bicolor]
 gb|EER98020.1| hypothetical protein SORBIDRAFT_02g003610 [Sorghum bicolor]
Length=350

 Score =   304 bits (779),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 159/321 (50%), Positives = 210/321 (65%), Gaps = 11/321 (3%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFP--FPVHDDASVHWKDSLFDRTHGLYLRIYKP  208
             V ED  G L+V SDG++ RS    +  P  FP     SV WK++++D+   L +R+YKP
Sbjct  18   EVAEDLFGFLRVLSDGTVLRSPAGPVFCPTTFP-GSHPSVQWKEAVYDKAKNLRVRMYKP  76

Query  209  RSSASAAVS--LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
             ++ASAA    LP++  FHGGGFC+GS TW N H  CLRL A   A+V++  YRLAPEHR
Sbjct  77   TTTASAAAGKKLPVLVHFHGGGFCLGSCTWANVHEFCLRLAADAGAVVLSAGYRLAPEHR  136

Query  383  LPAAMDDAFCAVKWVAAQ--ASTDAWLKDGV-DFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            LPAA DD    ++W+  Q  A+ D WL +   DF R FV GDS+GG +AHHLAVR     
Sbjct  137  LPAAFDDGAGFMRWLRDQSVAAADGWLAEAAADFGRVFVTGDSAGGTIAHHLAVR-AAAE  195

Query  554  PEMSP--VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            PE  P  V VRGYV++ PFFGG  RT SEAE P E F NL+++DRFWRLSLP G T DHP
Sbjct  196  PEPEPGHVTVRGYVLLMPFFGGVRRTASEAECPEEAFPNLDLVDRFWRLSLPAGATRDHP  255

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
             ANPFGP SP L +V   P+LV+VGG ++++DR  +YA +L    K V+   F GK HGF
Sbjct  256  AANPFGPDSPDLGSVDFPPVLVVVGGLDLIRDRTVDYAERLAAMGKPVEVAKFAGKPHGF  315

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
            + ++P S+ + +++Q +  F+
Sbjct  316  YLHEPGSEATGELIQTVARFV  336



>ref|XP_008652039.1| PREDICTED: probable carboxylesterase 15 [Zea mays]
 tpg|DAA59631.1| TPA: hypothetical protein ZEAMMB73_835930 [Zea mays]
Length=348

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/320 (48%), Positives = 211/320 (66%), Gaps = 8/320 (3%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFP--FPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            VVED  G L+V  DG++ RS +E    P  FP     SV WK++++D+ + L +R+YKP 
Sbjct  23   VVEDIYGFLRVLGDGTVLRSPEEPAFCPASFP-SSHPSVQWKEAVYDKPNNLRVRMYKPS  81

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
            ++      LP++  FHGGGFC+GS TW N H+ CLRL A   A+V++  YRLAPEHRLP 
Sbjct  82   AAGRTREKLPVLVHFHGGGFCLGSCTWANVHAFCLRLAAEAGAVVLSAGYRLAPEHRLPT  141

Query  392  AMDDAFCAVKWVAAQ--ASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS--PE  559
            A+DD    ++W+  Q  A+ D WL +  DF R FV GDS+GGN+AHHLAVR    +    
Sbjct  142  AVDDGAGFLRWLRDQSSAAADGWLAEAADFGRVFVTGDSAGGNIAHHLAVRAEADADVDV  201

Query  560  MSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANP  739
            + PV VRGYV++ PFFGG  RT+SEA+ P E  LNL++ DRFWRL+LP G T DHP ANP
Sbjct  202  LRPVTVRGYVLLMPFFGGVRRTRSEAKCPAEVLLNLDLFDRFWRLALPPGATRDHPAANP  261

Query  740  FGPASPSLEAVKLD-PILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTN  916
            FGP SP L +V    P+LV+VGG ++++DR  +YA +L    K V+ V F GK HGF+ +
Sbjct  262  FGPDSPDLGSVHFRAPLLVVVGGLDMMRDRTVDYAQRLAAMGKPVELVEFAGKPHGFYLH  321

Query  917  DPFSDVSTQVLQQLQHFMIS  976
            +P S+ + +++  +  F+ S
Sbjct  322  EPGSEATGELIGLVSRFLRS  341



>ref|XP_004981490.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=328

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 158/318 (50%), Positives = 210/318 (66%), Gaps = 6/318 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            S PHVVED   +LQ+ SDG++ R  D +   P  V     V WKD ++D  HGL LR Y+
Sbjct  5    SPPHVVEDLPHVLQLLSDGTVVRFDDYNTLPPPAVPPAPPVQWKDVVYDAAHGLKLRAYR  64

Query  206  PRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
            P     A   LP++ +FHGGG+ +G+   PN H+CCLRL   L A+V++ DYRLAPEHRL
Sbjct  65   P---PDACGKLPVLVYFHGGGYVLGTFALPNFHACCLRLAGELPAVVLSADYRLAPEHRL  121

Query  386  PAAMDDAFCAVKWVAAQAST--DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS-P  556
            PAA+DDA   + WV  QA+   D WL +  DF R FV GDS+GGN+ HH+AVRLG G  P
Sbjct  122  PAALDDAAAVMSWVRLQAAAGGDPWLAESADFGRVFVAGDSAGGNIVHHVAVRLGSGELP  181

Query  557  EMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLAN  736
             + P  V G+VM+ P FGG  RT SEAE PP PFL L   D+ WRL+LP G T DHP  N
Sbjct  182  GLGPASVAGHVMLCPLFGGVERTASEAELPPGPFLTLPFYDQIWRLALPRGATRDHPFVN  241

Query  737  PFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTN  916
            PFGP SP+L  V L P LV+  G+++L+DRV +YA +L+   K V+ VVF+G+ HGFF  
Sbjct  242  PFGPESPALGGVALPPTLVVAAGRDLLRDRVADYAARLRAMGKPVELVVFEGQHHGFFVV  301

Query  917  DPFSDVSTQVLQQLQHFM  970
            +PF + +++V++ ++ F+
Sbjct  302  EPFGEAASEVVRLIRRFV  319



>ref|XP_004986199.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=345

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 158/321 (49%), Positives = 204/321 (64%), Gaps = 8/321 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASV-HWKDSLFDRTHGLYLRIYKP  208
            PHVV D +G+ Q+ SDG+  R  D     P       S   WKD  +D  H L LR+Y+P
Sbjct  18   PHVVADFAGMAQLLSDGTFVRHTDAASALPPASSPSTSSAQWKDVAYDPDHDLKLRMYRP  77

Query  209  RSSASAAVS--LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
             S+   A S  LP++ +FHGGGFCVGS + PN H  CLRL   L A+V++ DYRLAPE+R
Sbjct  78   DSADDEAASEKLPVLVYFHGGGFCVGSFSLPNTHVSCLRLAGELPAIVLSADYRLAPENR  137

Query  383  LPAAMDDAFCAVKWVAAQAST----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            LPAA DDA   V W+  QA++    D WL +  DF R FV GDS+GGN+AHH+AV +G G
Sbjct  138  LPAAHDDARTLVSWMRNQAASPADADPWLAESADFGRVFVTGDSAGGNIAHHVAVAVGSG  197

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPF-GGTPDHP  727
               +SP RV GYV+  PFF G  RT SEAE PP PFL L + D+F RLSLP  G T DHP
Sbjct  198  MLGVSPARVAGYVLFWPFFAGVERTASEAEYPPGPFLTLTVSDQFLRLSLPSEGDTRDHP  257

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
              NPFGP SP L  V L P LV+  G+++L+DRV  YA +L+   K V+ V FQG+ HGF
Sbjct  258  AVNPFGPDSPPLGGVALPPTLVVAAGRDLLRDRVAGYAARLRAMGKPVELVEFQGEHHGF  317

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
            F  +P+ D   ++++ ++ F+
Sbjct  318  FIVEPWGDAGDELIRVVRRFV  338



>ref|XP_010228720.1| PREDICTED: probable carboxylesterase 15 [Brachypodium distachyon]
Length=342

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 212/329 (64%), Gaps = 14/329 (4%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINF---PFPVHDDASVHWKDSLFDRTHGLYLR  196
            S PHVVED    LQ+ SDG++ R +  + +    P P      V WKD ++D   GL LR
Sbjct  5    SPPHVVEDLPPFLQLLSDGTVIRDRSAEYSILPTPPPPGRQPDVRWKDVVYDAARGLKLR  64

Query  197  IYKPRSSASAAVS---LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            +YKP  S S++ +   LP++ +FHGGG+ + S   PN HSCCLRL   L ALV + DYRL
Sbjct  65   VYKPPLSPSSSGNNKKLPVLVYFHGGGYVICSFDLPNFHSCCLRLAGELPALVFSADYRL  124

Query  368  APEHRLPAAMDDAFCAVKWVAAQAST------DAWLKDGVDFNRAFVLGDSSGGNVAHHL  529
            APEHRLPAA  DA   + WV AQA+       D WL D  DF+R FV GDS+GG + + +
Sbjct  125  APEHRLPAAFHDAASVLSWVRAQATATGTENADPWLADSADFSRVFVSGDSAGGGIVNQV  184

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            A+RLG G  ++ P+RV G+VM+ P FGG  RT SEAE PP P L+L +LD+ WRL+LP G
Sbjct  185  ALRLGSGQLDLGPLRVAGHVMLFPLFGGEQRTASEAEYPPGPHLSLPVLDKGWRLALPVG  244

Query  710  GTPDHPLANPFGPASPSLEAV--KLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVV  883
             T DHPLANP GP SP+LE V   L P+LV+VGG ++L+DR  +YA +L+     V+ V 
Sbjct  245  ATRDHPLANPLGPGSPALELVAGALPPLLVVVGGLDLLRDRAVDYAARLEAMGHAVELVE  304

Query  884  FQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            F+G+ HGFF  +P+ +   +++  ++ F+
Sbjct  305  FEGQHHGFFAVEPYGEAGHELVCLVKRFV  333



>ref|NP_001042063.1| Os01g0155000 [Oryza sativa Japonica Group]
 dbj|BAB44070.1| putative PrMC3 [Oryza sativa Japonica Group]
 dbj|BAB64639.1| putative PrMC3 [Oryza sativa Japonica Group]
 dbj|BAF03977.1| Os01g0155000 [Oryza sativa Japonica Group]
 gb|EAZ10597.1| hypothetical protein OsJ_00429 [Oryza sativa Japonica Group]
 dbj|BAG93577.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87397.1| unnamed protein product [Oryza sativa Japonica Group]
Length=337

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 212/321 (66%), Gaps = 9/321 (3%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDED----INFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            PHVVED  G++Q+ SDG++ RS        +  P    D   V WKD ++D THGL LR+
Sbjct  9    PHVVEDYRGVIQLLSDGTVVRSDAGSGAGALLPPEDFPDVPGVQWKDLVYDATHGLKLRV  68

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            Y+P  +A  A  LP++  FHGGG+C+G+   P+ H CC RL + L+A+V++ DYRL PEH
Sbjct  69   YRP-PTAGDAERLPVLVCFHGGGYCLGTFEKPSFHCCCQRLASELRAVVLSADYRLGPEH  127

Query  380  RLPAAMDDAFCAVKWVAAQAST----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            RLPAA+DD    + W+  QA +    D+WL +  DF R FV G+S+GGN++HH+AV +G 
Sbjct  128  RLPAAIDDGAAVLSWLRDQAMSGPGADSWLAESADFARVFVAGESAGGNMSHHVAVLIGS  187

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            G   + P+RV GY+++ PFFGG  R  SEAE P   F   ++ D+ WRLSLP G T DHP
Sbjct  188  GQLTVDPLRVAGYMLLTPFFGGVERAPSEAEPPAGAFFTPDMSDKLWRLSLPEGATRDHP  247

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            +ANPFGP SPSL AV   P+LV+V G+++L DR  +YA +LK+  K V+ V F+ ++H F
Sbjct  248  VANPFGPDSPSLAAVAFPPVLVVVAGRDILHDRTVHYAARLKEMEKPVELVTFEEEKHLF  307

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
             +  P+S+ + ++++ ++ F+
Sbjct  308  LSLQPWSEPANELIRVMKRFI  328



>gb|EAY72594.1| hypothetical protein OsI_00460 [Oryza sativa Indica Group]
Length=340

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 212/321 (66%), Gaps = 9/321 (3%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDED----INFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            PHVVED  G++Q+ SDG++ RS        +  P    D   V WKD ++D THGL LR+
Sbjct  9    PHVVEDYRGVIQLLSDGTVVRSDAGAGAGALLPPEDFPDVPGVQWKDLVYDATHGLKLRV  68

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            Y+P  +A  A  LP++  FHGGG+C+G+   P+ H CC RL + L+A+V++ DYRL PEH
Sbjct  69   YRP-PTAGDAERLPVLVCFHGGGYCLGTFEKPSFHCCCQRLASELRAVVLSADYRLGPEH  127

Query  380  RLPAAMDDAFCAVKWVAAQAST----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            RLPAA+DD    + W+  QA +    D+WL +  DF R FV G+S+GGN++HH+AV +G 
Sbjct  128  RLPAAIDDGAAVLSWLRDQAMSGPGADSWLAESADFARVFVAGESAGGNMSHHVAVLIGS  187

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            G   + P+RV GY+++ PFFGG  R  SEAE P   F   ++ D+ WRLSLP G T DHP
Sbjct  188  GQLTVDPLRVAGYMLLTPFFGGVERAPSEAEPPAGAFFTPDMSDKLWRLSLPEGATRDHP  247

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            +ANPFGP SPSL AV   P+LV+V G+++L DR  +YA +LK+  K V+ V F+ ++H F
Sbjct  248  VANPFGPDSPSLAAVAFPPVLVVVAGRDILHDRTVHYAARLKEMEKPVELVTFEEEKHLF  307

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
             +  P+S+ + ++++ ++ F+
Sbjct  308  LSLQPWSEPANELIRVMKRFI  328



>emb|CDM81995.1| unnamed protein product [Triticum aestivum]
Length=334

 Score =   298 bits (763),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 149/324 (46%), Positives = 209/324 (65%), Gaps = 6/324 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            + PHVVED  GI+Q+ SDGS+ R  +  +    P+ D   V WKD ++   HGL +R+Y+
Sbjct  5    TAPHVVEDLLGIVQLLSDGSVVRGDESVLGPKEPLPDVPGVEWKDVVYHAAHGLRVRVYR  64

Query  206  PRSSASAA--VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            P S++S A  V LP++ +FHGGG+C+GS + P  H+ CLR  A L A+V++  YRLAPEH
Sbjct  65   PASASSVAGSVKLPVLVYFHGGGYCLGSFSQPTFHAFCLRAAAELPAVVLSVQYRLAPEH  124

Query  380  RLPAAMDDAFCAVKWVAAQAST----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            RLPAA+DD    + W+  QA      D WL    DF R F+ G S+G N+AHHL V++  
Sbjct  125  RLPAAIDDGAQFLSWLRGQAELGTGGDPWLAASADFARTFISGVSAGANLAHHLTVQVAT  184

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
                +SPVRV GYV+++ FFGG  RT SEA+ P    L +EI ++ W +SLP G T DHP
Sbjct  185  ARLPVSPVRVVGYVLLSAFFGGAERTASEADQPTGVTLPVEICEQLWHMSLPVGATRDHP  244

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            +ANPFGP SPSL  V+L P LV+    +VL+DRV  YA +LK   K+V+ V F+G+QHGF
Sbjct  245  VANPFGPESPSLAPVELPPALVVAPLGDVLRDRVLGYAARLKDMGKDVELVEFEGQQHGF  304

Query  908  FTNDPFSDVSTQVLQQLQHFMISK  979
                PF++ + ++++ L  F+  +
Sbjct  305  SVLQPFAEAADELMRVLGRFVYQR  328



>ref|XP_004955527.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=352

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 211/329 (64%), Gaps = 24/329 (7%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFP--FPVHDDASVHWKDSLFDRTHGLYLRIYKP  208
             VVED  G LQV SDG++FRS  E +  P  FP     SV WK++++D+   L +R+YKP
Sbjct  18   EVVEDLFGFLQVLSDGTVFRSPAEPVFCPTTFPA-SHPSVQWKETVYDKAKNLRVRMYKP  76

Query  209  RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
               A+A   LP++  FHGGGFC+GS TW N H+ CLRL A   A+V++  YRLAPEHRLP
Sbjct  77   ---AAAGNKLPVLVHFHGGGFCLGSCTWGNVHAFCLRLAADAGAVVLSAGYRLAPEHRLP  133

Query  389  AAMDDAFCAVKWVAAQAST-----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG---  544
            AA+DD    ++W+  Q++      DAWL +  DF R FV GDS+GG +AHHLAVR G   
Sbjct  134  AALDDGAGFMRWLREQSANAGEALDAWLAEAADFGRVFVTGDSAGGTIAHHLAVRAGSAA  193

Query  545  -------VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLP  703
                    G P  +   VRGYV++ PF GG  RT SEAE P E F NL+++DRFWRLSLP
Sbjct  194  AAEQGETAGDPAFT---VRGYVLLMPFLGGVRRTPSEAECPAEAFPNLDLVDRFWRLSLP  250

Query  704  FGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVV  883
             G T DHP ANPFGP SP L +V L P+LV+ GG ++++DR   YA +L    K V+   
Sbjct  251  AGATRDHPAANPFGPDSPDLGSVDLRPVLVVAGGLDLIRDRTVEYAERLAAMGKPVELAE  310

Query  884  FQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            F GK HGF+ ++P S+ + ++++ +  F+
Sbjct  311  FAGKAHGFYLHEPGSEATGELIRAVAQFL  339



>ref|XP_002459375.1| hypothetical protein SORBIDRAFT_02g003560 [Sorghum bicolor]
 gb|EER95896.1| hypothetical protein SORBIDRAFT_02g003560 [Sorghum bicolor]
Length=331

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 151/308 (49%), Positives = 211/308 (69%), Gaps = 4/308 (1%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKP-  208
            PHVVEDC G+LQ+ SDG++ RS    +    P  +D  V WKD  +DR H L  R+Y+P 
Sbjct  8    PHVVEDCRGVLQLMSDGTVRRSAVPALPVDVPDDEDCGVEWKDVTWDRQHDLNARLYRPG  67

Query  209  RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
               A+    +P++ +FHGGGFC+GS  WPN H+ CLRLC+ L A+V++ DYRLAPEHRLP
Sbjct  68   HLGAANDARIPVVAYFHGGGFCIGSGRWPNYHAWCLRLCSELPAVVLSFDYRLAPEHRLP  127

Query  389  AAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV-GSPEMS  565
            AA +D   A+ W+   A+TD WL D  DF RAFV GDS+GGN+AHH+A  LG  G   ++
Sbjct  128  AAQEDGARAMAWLTRSAATDPWLADAADFARAFVAGDSAGGNIAHHVAAELGKGGGRRLA  187

Query  566  P-VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
            P VR+RG +++AP F G  RT++E E P + FL  E+ DR+ RL+LP G   D P+ +P 
Sbjct  188  PAVRIRGALLLAPAFAGEARTRAELECPRDAFLTTEMFDRYARLALPDGADRDDPVLSPA  247

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEVDYVVFQGKQHGFFTND  919
            GP +P+LEAV++ P+LV+ GG++VL+DR + YA ++K++  KEV+YV   G  HGFF  D
Sbjct  248  GPRAPALEAVEMAPVLVVAGGRDVLRDRNKQYARRMKEEWGKEVEYVEIAGADHGFFQVD  307

Query  920  PFSDVSTQ  943
            P+S+ + +
Sbjct  308  PWSERADE  315



>emb|CDM81994.1| unnamed protein product [Triticum aestivum]
Length=327

 Score =   295 bits (756),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 201/319 (63%), Gaps = 4/319 (1%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P VVED  G++Q+ SDGS+ R  +  +    P+ D   V WKD L+   HGL +R+Y+P 
Sbjct  7    PRVVEDFLGVVQLLSDGSVVRGDEAVLRSNEPLPDVPGVQWKDVLYHAAHGLSVRVYRPA  66

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
            SS +    LP++ +FHGGG+C+GS   PN HS CL   A + A+V++  YRLAPEHRLPA
Sbjct  67   SSVAGGSKLPVLVYFHGGGYCLGSFAEPNFHSFCLGAAAEISAVVLSVQYRLAPEHRLPA  126

Query  392  AMDDAFCAVKWVAAQAS----TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPE  559
            A+DD    + W+  QA      D WL +  DF R F+ G S+G N+AHH+ V++  G   
Sbjct  127  AIDDGASFLSWLRGQAELGAGADPWLAESADFARTFLSGHSAGANLAHHVTVQVASGEIA  186

Query  560  MSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANP  739
             +PVR+ GY++++ FF G  RT +EA+ P    L   + D+ WR+SLP G + DHPLANP
Sbjct  187  TTPVRIVGYILLSAFFAGADRTATEADPPAGVSLTTAMADQLWRMSLPVGASMDHPLANP  246

Query  740  FGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTND  919
            FGP SPSL  V+L P LV+    +VL+DRV  Y  +LK   K V+ V F+G+QHGF    
Sbjct  247  FGPESPSLAPVELPPALVVAPLSDVLRDRVLGYGARLKDMGKAVEVVQFEGEQHGFSVRQ  306

Query  920  PFSDVSTQVLQQLQHFMIS  976
            PFS+ + ++L+ ++ F+ S
Sbjct  307  PFSEAADELLRVIKRFVYS  325



>ref|XP_002461500.1| hypothetical protein SORBIDRAFT_02g003620 [Sorghum bicolor]
 gb|EER98021.1| hypothetical protein SORBIDRAFT_02g003620 [Sorghum bicolor]
Length=369

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 214/330 (65%), Gaps = 17/330 (5%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFP--FPVHDDASVHWKDSLFDRTHGLYLRIYKP  208
             VVED  G+++V SDG++ RS    +  P  FP  +  SV WK++++ + + L +R+YKP
Sbjct  30   EVVEDIFGLVRVLSDGTVVRSPAGPVFCPTTFP-ENHPSVEWKEAVYGKANNLLVRMYKP  88

Query  209  RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
             +S +     P++  FHGGGFC+GS TW N H+ CLRL A   A+V++  YRLAPEHRLP
Sbjct  89   SASPAGGKKAPVLVHFHGGGFCIGSCTWGNVHAFCLRLAADTGAVVLSAGYRLAPEHRLP  148

Query  389  AAMDDAFCAVKWVAAQ--ASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG----  550
            AA+DD    ++W+  Q  +S+DAWL +  DF R FV GDS+G  +AHHLAVR GVG    
Sbjct  149  AAVDDGAAFMRWLREQSSSSSDAWLTEAADFGRVFVTGDSAGATIAHHLAVRAGVGVATD  208

Query  551  -----SPEMSPVRVRGYVMMAPFFGGTVRTKSE-AEGPPEP--FLNLEILDRFWRLSLPF  706
                 + E   V +RGYV++ PFFGG  RT SE AE P      L+L++LDRFWR+SLP 
Sbjct  209  DAGEAAGEADQVTIRGYVLLLPFFGGVERTPSEQAECPAGAGSVLSLDVLDRFWRVSLPA  268

Query  707  GGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVF  886
            G T DHP+ANPFGP SP L +V   P+LV+V G ++L+DR   YA +L    K V+ V F
Sbjct  269  GATRDHPVANPFGPDSPELGSVDFRPVLVVVAGLDLLRDRAVGYAGRLAAVGKPVELVEF  328

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFMIS  976
             G  HGFF ++P S+ + ++++ ++ F+ S
Sbjct  329  AGAAHGFFLHEPGSEATGELIRAVRRFVDS  358



>ref|XP_003561402.1| PREDICTED: probable carboxylesterase 15 [Brachypodium distachyon]
Length=363

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 161/335 (48%), Positives = 216/335 (64%), Gaps = 25/335 (7%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFP--FPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            VVED  G+L+V SDG+I RS D     P  FP  +  SV WK++++D+ + L +RIYKP 
Sbjct  15   VVEDVFGLLRVLSDGTILRSPDPPAFCPKTFPT-EHPSVQWKEAVYDKPNDLRVRIYKPA  73

Query  212  SSASAA----VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            +  + A      LP++ +FHGGGFC+GS TW N HS CLRL A   A+V++  YRLAPEH
Sbjct  74   ADMAMAEEKKQKLPVLVYFHGGGFCIGSCTWANTHSFCLRLAADAGAVVLSAGYRLAPEH  133

Query  380  RLPAAMDDAFCAVKWVAAQAST--------DAW-LKDGVDFNRAFVLGDSSGGNVAHHLA  532
            RLPAA+ DA   + W++AQ           D W L +  DF R FV GDS+GG +AHHLA
Sbjct  134  RLPAALHDAAGVLAWLSAQQQQQSAGDEDGDTWCLAEVADFRRVFVTGDSAGGTLAHHLA  193

Query  533  VRLGVGSPEMSP-----VRVRGYVMMAPFFGGTVRTKSE-AEGP---PEPFLNLEILDRF  685
            V  G G  E +      V V+GYV++ PFFGG  RT SE AE P   P P ++L+ LDR+
Sbjct  194  VSFGSGEKEKAALVSNDVTVKGYVLLMPFFGGEKRTASEEAESPTTFPPPLMSLDTLDRY  253

Query  686  WRLSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNK  865
            WRL+LP G T DHPLANPFG  SP LEAV+L P+L +  GQ++L+DRV +Y  +LK   K
Sbjct  254  WRLALPAGATRDHPLANPFGANSPGLEAVELPPVLAVAAGQDMLRDRVVDYVERLKAMGK  313

Query  866  EVDYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
             V+ V F  + HGFFT DP++  + ++++ L+ F+
Sbjct  314  PVELVEFAAEPHGFFTLDPWNHATGELIRLLRRFV  348



>emb|CDM82062.1| unnamed protein product [Triticum aestivum]
Length=333

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 147/320 (46%), Positives = 206/320 (64%), Gaps = 5/320 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            + PHVVED  G++Q+ SD S+ R  +  +    P+ D   V WKD ++   HGL +R+Y+
Sbjct  5    TAPHVVEDLLGVVQLLSDASVVRGDESVLGPKEPLPDVPGVEWKDVVYHAAHGLSVRVYR  64

Query  206  PRSSASA-AVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            P SS+ A +V LP++ +FHGGG+C+GS   P  H+ CLR  A L A+V++  YRLAPEHR
Sbjct  65   PASSSVACSVKLPVLVYFHGGGYCLGSFAQPTFHAFCLRAAAELPAVVLSVQYRLAPEHR  124

Query  383  LPAAMDDAFCAVKWVAAQAS----TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            LPAA+DD    + W+  QA      D WL +  DF RAF+ G S+G N+AHHL V++   
Sbjct  125  LPAAIDDGAAVLSWLRGQAELGAGADPWLAESADFARAFISGVSAGANLAHHLTVQVATA  184

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPL  730
               +SPVRV GYV+++ FFGG  RT  EA+ P    L +EI ++ W +SLP G T DHP+
Sbjct  185  RLPVSPVRVVGYVLLSAFFGGAERTALEADPPTGVSLPVEICEQLWHMSLPVGATRDHPV  244

Query  731  ANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
            ANPFGP SPSL  V+L P LV+    +VL DRV  YA +LK   K+V+ V F+G+QHGF 
Sbjct  245  ANPFGPESPSLAPVELPPALVVAPLGDVLCDRVLGYAARLKGMGKDVELVEFEGQQHGFS  304

Query  911  TNDPFSDVSTQVLQQLQHFM  970
               PF + + ++++ L+ F+
Sbjct  305  VLRPFGEAADELMRVLRRFV  324



>dbj|BAJ98632.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 207/325 (64%), Gaps = 10/325 (3%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDE-DINFPFPVHDDASVHWKDSLFDRTHGLYLRIY  202
            S PHVVED    LQ+ SDG++ R  D   +  P P      V WKD ++D +H L LRIY
Sbjct  33   SPPHVVEDVPPFLQLLSDGTVIRFTDGYPLPIPSPPPGQPVVDWKDVVYDASHSLKLRIY  92

Query  203  KPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            +P +++S+   LP++ +FHGGG+ +GS   PN H+CC+RL   L A+VV+ DYRLAPEHR
Sbjct  93   RPAAASSSGNKLPVVVYFHGGGYTIGSFDMPNFHACCVRLAGELPAVVVSADYRLAPEHR  152

Query  383  LPAAMDDAFCAVKWV--------AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVR  538
             PA +DDA   V WV        AA+ S D WL +  +F + FV GDS+GG V HH AVR
Sbjct  153  FPAGLDDAANVVSWVRAQAAAVAAAEDSADPWLSETANFGQVFVAGDSAGGGVVHHTAVR  212

Query  539  LGVGS-PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGT  715
            L  G    + PV V G  M+ P FGG  RT SEAE PP PFL+L  +D+ WRL LP G T
Sbjct  213  LASGRIGPLDPVCVAGCAMLCPLFGGEARTASEAEFPPGPFLSLPAVDQAWRLVLPAGST  272

Query  716  PDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGK  895
             DHPLANPFGP SP L+ V L P+LV+    ++L+DR  +YA +LK   K ++ V F+G+
Sbjct  273  RDHPLANPFGPDSPVLDGVALPPMLVVTAEHDLLRDRAADYAARLKAIGKPMELVEFEGQ  332

Query  896  QHGFFTNDPFSDVSTQVLQQLQHFM  970
             HGFF  +P+ D  ++V++ ++ F+
Sbjct  333  HHGFFAVEPYGDAGSEVVRLVKRFV  357



>ref|XP_010653235.1| PREDICTED: probable carboxylesterase 15 isoform X2 [Vitis vinifera]
Length=232

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 176/227 (78%), Gaps = 11/227 (5%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPF--PVHDDASVHWKDSLFDRTHGLYL  193
            M S PH+VED  G+LQVYSDGS+ RS      FPF  P+HDD SV WKDSLF + H L+L
Sbjct  1    MDSAPHLVEDFQGLLQVYSDGSVLRST----TFPFHIPLHDDGSVVWKDSLFHKHHNLHL  56

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            R+YK   S +   +LPI+++FHGGGFCVGSRTWPNCH+CCLRL +GL ALVVAPD+RLAP
Sbjct  57   RLYKTAVSPTKG-NLPILYYFHGGGFCVGSRTWPNCHNCCLRLASGLGALVVAPDFRLAP  115

Query  374  EHRLPAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAA++DA  ++KW+  QA +   + WL +GVD +R FV+GDSSGGN+AH +AV++G
Sbjct  116  EHRLPAAVEDAVSSLKWLQGQAVSEDCEEWLSEGVDLDRVFVVGDSSGGNMAHQVAVQMG  175

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRF  685
             G  E+ P+RVRG+V+MAPFFGGTVRT+SE EGP +   NLE+ DR 
Sbjct  176  AGLLELEPIRVRGFVLMAPFFGGTVRTRSE-EGPSDTMFNLELFDRL  221



>ref|XP_004955512.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=402

 Score =   293 bits (749),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 143/326 (44%), Positives = 216/326 (66%), Gaps = 8/326 (2%)
 Frame = +2

Query  32    PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
             P+VVEDC G++Q+ SDG++ RS D  +       DD  V WKD  ++  HGL +R+Y+P 
Sbjct  61    PYVVEDCRGVMQLMSDGTVRRSADPPVAAEITA-DDCGVEWKDVTWEPEHGLNVRLYRPL  119

Query  212   SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
              +A+ A  +P++ +FHGGGFC+GS  W + HSCCLRL A L A+V++  YRLAPEHR+PA
Sbjct  120   RAANDA-RIPVVAYFHGGGFCIGSGRWSSFHSCCLRLAAELPAVVLSFYYRLAPEHRIPA  178

Query  392   AMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP-  568
             A +D   A+ W+ A A+ D WL +  DF R FV GDS+GGN+AHH+A     G   + P 
Sbjct  179   AQEDGAKAMSWLRATAAADPWLANAADFARVFVAGDSAGGNIAHHVAT--AFGKTGLGPA  236

Query  569   VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGP  748
             VR+RG+V++ P   G  RT++E E PP  +L  E  D++ RL+LP G T DHP  NP GP
Sbjct  237   VRLRGHVLLMPAMAGEARTRAELECPPGAYLTTETCDKYCRLALPGGATRDHPAINPAGP  296

Query  749   ASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFS  928
              +P LEAV++ P+LV+   ++VL++R   YA ++ +  K+ +YV   G +HGFF+ DP+S
Sbjct  297   EAPGLEAVEMPPVLVVAAERDVLRERNAAYARRM-EWGKDEEYVELAGVEHGFFSRDPWS  355

Query  929   DVSTQVLQQLQHFMISKV*NDEIYIR  1006
             + + ++L+ ++ F++    +D +++R
Sbjct  356   ERADELLRLVRRFVVEH--HDCLHLR  379



>dbj|BAJ98039.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99851.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 207/322 (64%), Gaps = 7/322 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            + PHVVED  G++Q+ SDGS+ R  +  +    P  D   V WKD ++    GL +R+Y+
Sbjct  5    TAPHVVEDLLGLVQLLSDGSVVRGDEAVLAPKEPFPDVPGVQWKDVVYHAARGLRVRVYR  64

Query  206  PRSSASAAV---SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            P S++SA      LP++ +FHGGG+C+GS   P  H+ CLR  A L A+V++  YRLAPE
Sbjct  65   PASASSAVAGGGKLPVLVYFHGGGYCLGSFAQPTFHAFCLRATAELPAVVLSVQYRLAPE  124

Query  377  HRLPAAMDDAFCAVKWVAAQAS----TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            HRLPAA+DD    + W+  QA      D WL +  DF R F+ G S+G N+AHHLAV++ 
Sbjct  125  HRLPAAIDDGAAFLSWLRGQAELGACADPWLAESADFARTFLSGVSAGANLAHHLAVQVA  184

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
            +    +SPVR+ GYV+++ FFGGT RT SEA+   +  L +E+ ++ W +SLP G T DH
Sbjct  185  LARLAVSPVRIVGYVLLSAFFGGTERTASEADLTTDVSLPVEMCEQLWHMSLPVGATRDH  244

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            P+ANPFGP SPSL  V+L P LV+    +VL+DRV  YA +LK   K+V+ V F+G+QHG
Sbjct  245  PVANPFGPESPSLAPVELPPALVVAPLGDVLRDRVLGYAARLKDMGKDVELVEFEGQQHG  304

Query  905  FFTNDPFSDVSTQVLQQLQHFM  970
            F    PF   + ++++ L+ F+
Sbjct  305  FSVLQPFGVAADELMRVLRRFV  326



>ref|NP_001058948.1| Os07g0162500 [Oryza sativa Japonica Group]
 dbj|BAC15965.1| putative cell death associated protein [Oryza sativa Japonica 
Group]
 dbj|BAD30764.1| putative cell death associated protein [Oryza sativa Japonica 
Group]
 dbj|BAF20862.1| Os07g0162500 [Oryza sativa Japonica Group]
 dbj|BAG87987.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97503.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97595.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 204/316 (65%), Gaps = 7/316 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVH---DDASVHWKDSLFDRTHGLYLRIY  202
            PHVVEDC G LQ+ SDG++ R+       PF V    DD  V WKD ++D  HGL +R+Y
Sbjct  12   PHVVEDCRGALQLLSDGTVVRAAAPPP--PFYVRLDIDDGRVEWKDVVYDAAHGLGVRMY  69

Query  203  KPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            +P ++  A   LP++ +FHGGGFC+GS TWPN H+ CLRL A L A+V++ DYRLAPEHR
Sbjct  70   RPAATGGAEEKLPVVVYFHGGGFCIGSCTWPNFHAGCLRLAAELPAVVLSFDYRLAPEHR  129

Query  383  LPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            LPAA +DA  A+ W+  Q  +D WL D  D  + FV G+S+GGN AHHLAVR G     +
Sbjct  130  LPAAHEDAAAALIWLRDQLLSDPWLADAADARKVFVSGESAGGNFAHHLAVRFGAAG--L  187

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPF  742
             PVRV GYV++ P F     T SE   P   FL  ++ DR+ RL+LP G   DHPL NPF
Sbjct  188  DPVRVAGYVLLMPAFISERPTPSELAAPATAFLTRDMCDRYCRLALPAGADKDHPLVNPF  247

Query  743  GPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDP  922
            GPAS SLEAV +  +LV+    ++L+D+   YA ++K   K+V+ VVF G++H FF   P
Sbjct  248  GPASRSLEAVDVGRVLVVAADGDLLRDKNVEYAERMKAMGKDVELVVFAGEEHAFFGVKP  307

Query  923  FSDVSTQVLQQLQHFM  970
             S  + ++++ ++ F+
Sbjct  308  MSAATGELVEVIRRFI  323



>gb|EAZ02864.1| hypothetical protein OsI_24995 [Oryza sativa Indica Group]
Length=328

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 204/318 (64%), Gaps = 11/318 (3%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVH-----DDASVHWKDSLFDRTHGLYLR  196
            PHVVEDC G LQ+ SDG++ R+       P P H     +D  V WKD+++D  HGL +R
Sbjct  12   PHVVEDCRGALQLLSDGTVVRAAAA----PPPFHVRLDINDGRVEWKDAVYDAAHGLGVR  67

Query  197  IYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            +Y+P ++  A   LP++ +FHGGGFC+GS TWPN H+ CLRL A L A+V++ DYRLAPE
Sbjct  68   MYRPAATEGAEEKLPVVVYFHGGGFCIGSCTWPNFHAGCLRLAAELPAVVLSFDYRLAPE  127

Query  377  HRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSP  556
            HRLPAA +DA  A+ W+  Q  +D WL D  D  + FV G+S+GGN AHHLAVR G    
Sbjct  128  HRLPAAHEDAAAALIWLRDQLLSDPWLADAADARKVFVSGESAGGNFAHHLAVRFGAAG-  186

Query  557  EMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLAN  736
             + PVRV GYV++ P F     T SE   P   FL  ++ DR+ RL+LP G   DHPL N
Sbjct  187  -LDPVRVAGYVLLMPAFISERPTPSELAAPATAFLTRDMCDRYCRLALPAGADKDHPLVN  245

Query  737  PFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTN  916
            PFGPAS SLEA  +  +LV+    ++L+D+   YA ++K   K+V+ VVF G++H FF  
Sbjct  246  PFGPASRSLEAADVGRVLVVAADGDLLRDKNVEYAERMKAMGKDVELVVFAGEEHAFFGV  305

Query  917  DPFSDVSTQVLQQLQHFM  970
             P S  + ++++ ++ F+
Sbjct  306  KPMSAATGELVEVIRRFI  323



>dbj|BAJ96540.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 150/329 (46%), Positives = 213/329 (65%), Gaps = 20/329 (6%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDED----INFPFPVHDDASVHWKDSLFDRTHGLYLRIY  202
            +VVED  GIL+V SDG++ RS D+     I FP    D  SV WK++++D+   L +R+Y
Sbjct  15   NVVEDLYGILRVLSDGTVVRSPDQPEFCPITFPC---DHPSVQWKEAVYDKGKNLRVRMY  71

Query  203  KPRSSAS-AAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            KP      A   LP++  +HGGGFC+GS TW N HS CLRL A   A+V++  YRLAPEH
Sbjct  72   KPSGGGEQAGRKLPVLVHYHGGGFCLGSCTWGNIHSFCLRLAAEAGAVVLSAGYRLAPEH  131

Query  380  RLPAAMDDAFCAVKWVAAQAST----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            RLPAA+DDA   ++W+  ++ +    D WL +  DF R FV GDS+GG +AHHLAVR G 
Sbjct  132  RLPAALDDAAGFLEWLRERSVSAEGEDRWLTEAADFGRVFVTGDSAGGTLAHHLAVRAGT  191

Query  548  GSPE-----MSPVRVRGYVMMAPFFGGTVRTKSEAEGPP---EPFLNLEILDRFWRLSLP  703
             +       +  + ++GY+++ PFFGG  RT+SEA   P    PFLNL +LDRFWRLSLP
Sbjct  192  SAAPKHGDGVDSLTIKGYILLMPFFGGVDRTRSEAVEFPLAETPFLNLAVLDRFWRLSLP  251

Query  704  FGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVV  883
             G + DHP+ANPFG  SP+L +V+  P+LV+  G ++L DR  +YA +L +  K ++ V 
Sbjct  252  EGASRDHPIANPFGADSPALGSVEFPPVLVVSSGTDLLHDRTVDYAERLARMGKPLEVVD  311

Query  884  FQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            F    HGFFT +P+S+ + ++++ +  F+
Sbjct  312  FPDDPHGFFTQEPWSETTGELIRLVSVFV  340



>ref|NP_001142060.1| uncharacterized protein LOC100274216 [Zea mays]
 gb|ACF84282.1| unknown [Zea mays]
 gb|ACF87560.1| unknown [Zea mays]
 gb|AFW67402.1| hypothetical protein ZEAMMB73_391585 [Zea mays]
Length=339

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 212/322 (66%), Gaps = 11/322 (3%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASV-HWKDSLFDRTHGLYLRIYKPR  211
            HVVED   +LQ+ SDG++ R  D D   P  V        WKD ++D THGL LR+Y P 
Sbjct  10   HVVEDMPHVLQLLSDGTVVRFADYDTLPPPSVPPAPLPVRWKDVVYDATHGLKLRVYSPS  69

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
              AS    LP++ +FHGGG+ +G+   P+ H+CCLRL   L A+V++ DYRLAPEHRLPA
Sbjct  70   PPASCG-KLPVLVYFHGGGYVLGTFALPSFHACCLRLAGELPAVVLSADYRLAPEHRLPA  128

Query  392  AMDDAFCAVKWVAAQA----STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVR-LG-VGS  553
            A+DDA   ++WV AQA      D WL D  D  R FV GDS+GGN+ HH+AVR LG   S
Sbjct  129  ALDDAAAVMRWVRAQAVAAGGGDPWLADSADPGRVFVAGDSAGGNIVHHVAVRRLGSAAS  188

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
             E+ PVRV G+VM+ PFFGG  RT SE+E PP PFL L   D+ WRL+LP G T DHP A
Sbjct  189  GELDPVRVAGHVMLCPFFGGAERTASESEFPPGPFLTLPWYDQAWRLALPPGATRDHPFA  248

Query  734  NPFGPASPS---LEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            NPFGP SP+   L  V L P LV+  GQ++L+DR  +Y  +LK   + V++V F+G+ HG
Sbjct  249  NPFGPESPALLGLRDVALPPTLVVAAGQDLLRDRQADYVARLKAMGQHVEHVEFEGQHHG  308

Query  905  FFTNDPFSDVSTQVLQQLQHFM  970
            FFT +P SD S+++++ ++ F+
Sbjct  309  FFTVEPASDASSELVRLVKRFV  330



>ref|NP_001183655.1| hypothetical protein [Zea mays]
 gb|ACR37878.1| unknown [Zea mays]
 tpg|DAA60966.1| TPA: hypothetical protein ZEAMMB73_499627 [Zea mays]
Length=351

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/323 (46%), Positives = 202/323 (63%), Gaps = 7/323 (2%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKD-EDINFPFPVHDDASVHWKDSLFDRTHGLYLRIY  202
            + PHVV+DC GI+Q+ SDG++ RS D   I     V  +  V WKD ++D  H L LR+Y
Sbjct  14   TAPHVVDDCLGIVQLLSDGTVTRSADYSAIPLLGEVPSNLPVQWKDVVYDPAHALRLRMY  73

Query  203  KPRSSASAAVS---LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            +P  +     +   LP++ +FHGGGFC+ S   P+ H+  LRL A L ALV++ DYRL P
Sbjct  74   RPTDTDGGKTTNNKLPVLVYFHGGGFCICSFEMPHFHAGGLRLAAELPALVLSADYRLGP  133

Query  374  EHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            EHRLPAA  DA   + W+ AQA  D WL +  D  R FV GDS+GGN+AHH+AV+ G G 
Sbjct  134  EHRLPAAHRDAEAVLSWLRAQAEADPWLVESADMGRVFVCGDSAGGNIAHHIAVQYGTGH  193

Query  554  PEMSP-VRVRGYVMMAPFFGGTVRTKSEAEG--PPEPFLNLEILDRFWRLSLPFGGTPDH  724
              + P VR+ GY+M+ P+F    RT SE  G      F++  +LD+ WRL+LP G T DH
Sbjct  194  LALGPVVRLGGYIMLWPYFAAEERTASETAGLDVDHQFVSTALLDQMWRLALPVGATRDH  253

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            P ANPFGP S  LE V   P+LV+   Q+VL DR ++YA +L    K V+ VVF+G+ HG
Sbjct  254  PAANPFGPDSVPLEDVAFQPLLVVDPDQDVLHDRTQDYAARLTAMGKLVELVVFRGQGHG  313

Query  905  FFTNDPFSDVSTQVLQQLQHFMI  973
            FF  DP  + S Q++  ++ F++
Sbjct  314  FFVFDPCGEASDQLIHVIRRFVL  336



>ref|XP_006429992.1| hypothetical protein CICLE_v10012167mg [Citrus clementina]
 gb|ESR43232.1| hypothetical protein CICLE_v10012167mg [Citrus clementina]
Length=255

 Score =   283 bits (723),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 177/252 (70%), Gaps = 24/252 (10%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPF-PVHDDASVHWKDSLFDRTHGLYLR  196
            MGSLP VVED  G+LQ+YSDG++FRSKD   N      +D++SV +KD  +D+ H L+LR
Sbjct  1    MGSLPCVVEDMGGVLQLYSDGTVFRSKDIKFNMQLIDQNDESSVFFKDCQYDKIHDLHLR  60

Query  197  IYKPRSSASAA----VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            +YKPRS  +++      LPI+ F HGGGFC GSR WPN H+CC RL A L ALVVA DYR
Sbjct  61   LYKPRSETTSSPLSKAKLPIVVFIHGGGFCAGSREWPNSHNCCFRLAAELNALVVALDYR  120

Query  365  LAPEHRLPAAMDDAFCAVKWVAAQA-----STDAWLKDGVDFNRAFVLGDSSGGNVAHHL  529
            LAPEHRLPAAM+DAF A+KW+ AQA     + DAW  + V+F+  FVLGDSSGGN+AHHL
Sbjct  121  LAPEHRLPAAMEDAFAAMKWLQAQALSENLNGDAWFGE-VEFDNVFVLGDSSGGNIAHHL  179

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            AV+LG GS E++PVRVRGYV++APFFGG  RTKSE  GP E  LNLE+LD          
Sbjct  180  AVQLGGGSSELAPVRVRGYVLLAPFFGGVARTKSEL-GPSEAMLNLELLD----------  228

Query  710  GTPDHPLANPFG  745
                HP    FG
Sbjct  229  --SSHPFLQEFG  238



>emb|CDM82063.1| unnamed protein product [Triticum aestivum]
Length=327

 Score =   285 bits (729),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 201/319 (63%), Gaps = 4/319 (1%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            + PHVVED  G++Q+ SDGS+ R  +  +    P  D   V WKD ++   HGL +R+Y+
Sbjct  5    TAPHVVEDLLGLVQILSDGSVVRGDESVLGPKEPFPDVPGVQWKDVVYHAAHGLRVRVYR  64

Query  206  PRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
            P S  +    LP++ +FHGGG+C+GS   P  HS CLR  + L A+V++  YRLAPEHRL
Sbjct  65   PTSVVAGGDKLPVLVYFHGGGYCLGSFAQPTFHSFCLRAASELPAVVLSVQYRLAPEHRL  124

Query  386  PAAMDDAFCAVKWVAAQAS----TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            PAA+DD    + W+  QA      D WL +   F + F+ G S+G N++HHL V++    
Sbjct  125  PAAIDDGAAFLSWLRGQAELGAGADPWLAESACFAQTFLSGVSAGANLSHHLIVQVASAR  184

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
             E+SPVR+ GYV+++ FF G  RT +EA+ P + FL LE+ D+ W +SLP G + DHP+A
Sbjct  185  LEVSPVRIVGYVLLSAFFTGAERTAAEADPPSDVFLPLELSDQLWHMSLPVGASRDHPVA  244

Query  734  NPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFT  913
            NPFGP SPSL  ++L P LV+    +VL+DR   YA +LK   K+V+ V  +G+QHGF  
Sbjct  245  NPFGPESPSLAPLELPPALVVAPLGDVLRDRSLGYAARLKDMGKDVELVEIEGQQHGFSV  304

Query  914  NDPFSDVSTQVLQQLQHFM  970
              PF   + ++++ L+ F+
Sbjct  305  RQPFGQAADELMRVLRRFV  323



>ref|XP_004955521.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=331

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/320 (47%), Positives = 203/320 (63%), Gaps = 8/320 (3%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P VVEDC G L+V SDG++ RS          V  D SV WKD+++D  HGL LRIY P 
Sbjct  7    PRVVEDCRGALRVLSDGTVVRSTPPIAGDTEGVRADPSVAWKDAVYDAAHGLGLRIYMPA  66

Query  212  SSASAA---VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
             +A+A      LP++ +FHGGGFC+GS  WP  H+ C RL AGL A++V+ DYRLAPEHR
Sbjct  67   VAAAAGGRDTKLPVVVYFHGGGFCIGSYAWPIFHAACSRLAAGLSAVLVSADYRLAPEHR  126

Query  383  LPAAMDDAFCAVKWV--AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSP  556
            LPAA+DDA   + W+  +  A  D WL    D  R  V G+S+GG +AHH+ VR   G+P
Sbjct  127  LPAAIDDAAAVLLWLRDSIAAGADPWLAAHADAGRVLVAGESAGGVLAHHMNVRFSSGAP  186

Query  557  EMSPVRVRGYVMMAPFF-GGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
             + PVR+RG+V + PFF GG   T SE   P   FLN ++  R+ RLSLP G T DHP  
Sbjct  187  -LHPVRLRGFVPLMPFFTGGGEPTPSELACPDSAFLNRDMSGRYVRLSLPAGATADHPFL  245

Query  734  NPFGP-ASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
            NPF P A+P L+ V + P LV+VGG ++L+DR   Y  ++++  K V+ VVF G+ H FF
Sbjct  246  NPFSPDAAPGLDRVDVGPTLVVVGGDDMLRDRNVEYVRRMEEMGKPVEAVVFPGQGHAFF  305

Query  911  TNDPFSDVSTQVLQQLQHFM  970
            +  P+S+   ++++ ++ FM
Sbjct  306  SLRPWSEPVEEMIRVVKRFM  325



>ref|XP_004955511.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=329

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/308 (47%), Positives = 202/308 (66%), Gaps = 14/308 (5%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHD-DASVHWKDSLFDRTHGLYLRIYKP  208
            PHVVEDC G+LQ+ SDG++ RS +    FP  + D D  V WKD  ++  H L +R+Y+P
Sbjct  10   PHVVEDCRGVLQLMSDGTVRRSAEP--AFPVEIPDGDCGVEWKDVTWEPEHDLNVRLYRP  67

Query  209  R-----SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            R       A+ A  LP++ +FHGGGFC+GS  WPN H+ CLRL A L A V++ DYRLAP
Sbjct  68   RRHLASGGANDARILPVVAYFHGGGFCIGSGRWPNFHAWCLRLAAELPAAVLSFDYRLAP  127

Query  374  EHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            EHR+PAA +D   A+ W+  +A+ D WL    DF R FV GDS+GGN+AHH+A   G   
Sbjct  128  EHRIPAAQEDGAKAMSWL--RATADPWLACAADFARVFVAGDSAGGNIAHHVAAAFGKTG  185

Query  554  PEMSP-VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPL  730
              +SP +R+RG V++AP   G  RT++E E PP  FL  E  D++ RL+LP   T +HP 
Sbjct  186  --LSPSIRIRGAVLLAPAMAGEARTRAELECPPGAFLTTETCDKYCRLALPGSATRNHPA  243

Query  731  ANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEVDYVVFQGKQHGF  907
             +P GP +P LEAV++ P+LV+ G ++VL+DR   YA ++ ++  K+V+YV   G +HGF
Sbjct  244  ISPAGPLAPGLEAVEMAPVLVVAGERDVLRDRNAEYARRMVEEWGKDVEYVEVAGVEHGF  303

Query  908  FTNDPFSD  931
            F  DP+S+
Sbjct  304  FQRDPWSE  311



>ref|NP_001058950.1| Os07g0162700 [Oryza sativa Japonica Group]
 dbj|BAF20864.1| Os07g0162700 [Oryza sativa Japonica Group]
Length=351

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/328 (47%), Positives = 207/328 (63%), Gaps = 19/328 (6%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDI---NFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            +VVED  G L+V SDG+I RS         FP    +  SV WK++++D+   L++R+YK
Sbjct  19   NVVEDLVGFLRVLSDGTILRSPGPVFCPSTFP---DEHPSVEWKEAVYDKPKNLHVRMYK  75

Query  206  PRSSASAAV-----SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLA  370
            P  ++          LP++ +FHGGGFC+GS TW N HS CLRL A   A+V++  YRLA
Sbjct  76   PSPASGGVGAGGGGKLPVLVYFHGGGFCLGSCTWANVHSFCLRLAADAGAVVLSAGYRLA  135

Query  371  PEHRLPAAMDDAFCAVKWVAAQASTDA------WLKDGVDFNRAFVLGDSSGGNVAHHLA  532
            PEHRLPAA+DDA   + W+  +A          WL +  DF R FV GDS+GG +AHHLA
Sbjct  136  PEHRLPAAVDDAAGFLHWLRERAVDGDGDGDGWWLAEAADFGRVFVTGDSAGGTIAHHLA  195

Query  533  VRLGVGSPEMSPVR--VRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPF  706
            VR G  +         +RGYV++ PFFGG  RT SEA  P E FLNL++ DRFWRLSLP 
Sbjct  196  VRAGSAAAAAPDDPVAIRGYVLLMPFFGGVSRTPSEAGCPAEVFLNLDLFDRFWRLSLPP  255

Query  707  GGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVF  886
            G T DHP+ANPFGP SP+++ V+L P+LV+ GG ++L+DR  +YA +L    K V+   F
Sbjct  256  GATRDHPMANPFGPDSPAMDGVELPPVLVVAGGLDMLRDRAVDYAERLSAMGKPVELAEF  315

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
             G+ HGFFT  P SD + +++  +  F+
Sbjct  316  AGEHHGFFTLGPGSDAAGELIAAVARFV  343



>dbj|BAC20766.1| putative cell death associated protein [Oryza sativa Japonica 
Group]
Length=348

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 153/328 (47%), Positives = 207/328 (63%), Gaps = 19/328 (6%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDI---NFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            +VVED  G L+V SDG+I RS         FP    +  SV WK++++D+   L++R+YK
Sbjct  16   NVVEDLVGFLRVLSDGTILRSPGPVFCPSTFP---DEHPSVEWKEAVYDKPKNLHVRMYK  72

Query  206  PRSSASAAV-----SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLA  370
            P  ++          LP++ +FHGGGFC+GS TW N HS CLRL A   A+V++  YRLA
Sbjct  73   PSPASGGVGAGGGGKLPVLVYFHGGGFCLGSCTWANVHSFCLRLAADAGAVVLSAGYRLA  132

Query  371  PEHRLPAAMDDAFCAVKWVAAQASTDA------WLKDGVDFNRAFVLGDSSGGNVAHHLA  532
            PEHRLPAA+DDA   + W+  +A          WL +  DF R FV GDS+GG +AHHLA
Sbjct  133  PEHRLPAAVDDAAGFLHWLRERAVDGDGDGDGWWLAEAADFGRVFVTGDSAGGTIAHHLA  192

Query  533  VRLGVGSPEMSPVR--VRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPF  706
            VR G  +         +RGYV++ PFFGG  RT SEA  P E FLNL++ DRFWRLSLP 
Sbjct  193  VRAGSAAAAAPDDPVAIRGYVLLMPFFGGVSRTPSEAGCPAEVFLNLDLFDRFWRLSLPP  252

Query  707  GGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVF  886
            G T DHP+ANPFGP SP+++ V+L P+LV+ GG ++L+DR  +YA +L    K V+   F
Sbjct  253  GATRDHPMANPFGPDSPAMDGVELPPVLVVAGGLDMLRDRAVDYAERLSAMGKPVELAEF  312

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
             G+ HGFFT  P SD + +++  +  F+
Sbjct  313  AGEHHGFFTLGPGSDAAGELIAAVARFV  340



>gb|EAZ02866.1| hypothetical protein OsI_24997 [Oryza sativa Indica Group]
Length=351

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 153/328 (47%), Positives = 207/328 (63%), Gaps = 19/328 (6%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDI---NFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            +VVED  G L+V SDG+I RS         FP    +  SV WK++++D+   L++R+YK
Sbjct  19   NVVEDLVGFLRVLSDGTILRSPGPVFCPSTFP---GEHPSVEWKEAVYDKPKNLHVRMYK  75

Query  206  PRSSASAAV-----SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLA  370
            P  ++          LP++ +FHGGGFC+GS TW N HS CLRL A   A+V++  YRLA
Sbjct  76   PSPASGGVGAGGGGKLPVLVYFHGGGFCLGSCTWANVHSFCLRLAADAGAVVLSAGYRLA  135

Query  371  PEHRLPAAMDDAFCAVKWVAAQASTDA------WLKDGVDFNRAFVLGDSSGGNVAHHLA  532
            PEHRLPAA+DDA   + W+  +A          WL +  DF R FV GDS+GG +AHHLA
Sbjct  136  PEHRLPAAVDDAAGFLHWLRERAVDGDGDGDGWWLAEAADFGRVFVTGDSAGGTIAHHLA  195

Query  533  VRLGVGSPEMSPVR--VRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPF  706
            VR G  +         +RGYV++ PFFGG  RT SEA  P E FLNL++ DRFWRLSLP 
Sbjct  196  VRAGSAAAAAPADPVAIRGYVLLMPFFGGVSRTPSEAGCPAEVFLNLDLFDRFWRLSLPP  255

Query  707  GGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVF  886
            G T DHP+ANPFGP SP+++ V+L P+LV+ GG ++L+DR  +YA +L    K V+   F
Sbjct  256  GATRDHPMANPFGPDSPAMDGVELPPVLVVAGGLDMLRDRAVDYAERLSAMGKPVELAEF  315

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
             G+ HGFFT  P SD + +++  +  F+
Sbjct  316  AGEHHGFFTLGPGSDAAGELIAAVARFV  343



>gb|EMT12641.1| Putative gibberellin receptor GID1L3 [Aegilops tauschii]
Length=365

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/323 (43%), Positives = 203/323 (63%), Gaps = 12/323 (4%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHD---DASVHWKDSLFDRTHGLYLRIYK  205
            HVVEDC G++Q+ SDG++ R     ++ P PVHD   D  V WKD ++D  H L LR+Y+
Sbjct  17   HVVEDCLGVVQLLSDGTVTRPTRSFLSDP-PVHDVRRDLPVQWKDVVYDEAHRLRLRMYR  75

Query  206  PRSSASAA----VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            P +S   A      LP++ +FHGGGFC+ S   P+ H+  LR+   L A+V++ DYRLAP
Sbjct  76   PTTSIGLAGGGEKKLPVLVYFHGGGFCIASFEHPSFHAVALRIAHDLPAIVLSADYRLAP  135

Query  374  EHRLPAAMDDAFCAVKWV----AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRL  541
            EHRLPAA  DA   + W+     A ++ DAWL +  DF R FV GDSSGGN++HH+AVR 
Sbjct  136  EHRLPAAHHDAETVLSWLHRHAVAGSAADAWLAESADFGRVFVWGDSSGGNISHHIAVRY  195

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
            G G  +++PVR+ G V++ P+FGG  R  SEA  P +  ++L + D+ WRL+LP G T D
Sbjct  196  GSGGLDINPVRIAGCVLLGPYFGGEERMASEACSPADVLMSLALFDQIWRLALPAGATRD  255

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HP A PFGP    L+ V   P+LV+    ++L+DR  +Y  +LK   K V+ V F G++H
Sbjct  256  HPAATPFGPERAPLDDVAFPPVLVLNAEHDLLRDRTADYVARLKAMGKPVELVEFDGQEH  315

Query  902  GFFTNDPFSDVSTQVLQQLQHFM  970
             FF  +P+   +  +++ ++ F+
Sbjct  316  AFFVYEPWGAAADGLIRVVRQFV  338



>ref|XP_006826392.1| hypothetical protein AMTR_s00004p00146770 [Amborella trichopoda]
 gb|ERM93629.1| hypothetical protein AMTR_s00004p00146770 [Amborella trichopoda]
Length=294

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/318 (45%), Positives = 200/318 (63%), Gaps = 30/318 (9%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P+ +E+C G+L+V+SDGS  R    +  F  P+ +D SV WKD  FD T  L LR+YKP 
Sbjct  6    PYEIENCRGLLRVFSDGSTIRISQPE-GFQIPIDEDGSVSWKDLQFDLTLDLNLRLYKPL  64

Query  212  SSASAAVS-LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
            SS+S   + LPI+F+FHGGGFC+GSRTWP  H+ CLRL   LQA+VV+PDYRLAPE+RLP
Sbjct  65   SSSSRENNKLPILFYFHGGGFCIGSRTWPVFHNTCLRLSRDLQAIVVSPDYRLAPENRLP  124

Query  389  AAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP  568
            AA+ DAF AV W+A+ A+ + +L +  DF R  +                          
Sbjct  125  AAISDAFSAVWWLASAAACEPFLSEIADFERGVLT-------------------------  159

Query  569  VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGP  748
              ++G+V++ P F G  RT+SE     + FLNLE+ DR+WRLSLP G   DHPL N FGP
Sbjct  160  --IKGFVLLNPAFAGVERTQSEITSDDD-FLNLELCDRYWRLSLPEGADRDHPLVNVFGP  216

Query  749  ASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFS  928
             +  + +V+  P+L++V G++ LKDR   Y  +LK+  K V+ VVF+GK+H FFT +P  
Sbjct  217  GAAEIGSVEWRPMLLVVAGRDPLKDREMEYGRRLKEMGKRVEVVVFEGKKHAFFTMEPEC  276

Query  929  DVSTQVLQQLQHFMISKV  982
            + S +V+  ++ FM + V
Sbjct  277  EASKEVMVSIREFMEANV  294



>dbj|BAK02070.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=346

 Score =   281 bits (718),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 141/329 (43%), Positives = 206/329 (63%), Gaps = 8/329 (2%)
 Frame = +2

Query  17   EMGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPF-PVHDDASVHWKDSLFDRTHGLYL  193
            E  + P V+ED  G+L++ SDGS+ R  DE + +P  P+ D   V WKD+L+    GL +
Sbjct  4    EDTAAPLVMEDLPGVLKLLSDGSVVRG-DEAVLWPKDPLPDVPGVQWKDALYHAPRGLSV  62

Query  194  RIYKPRSSASAA--VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            R+Y+P S    A    LP++ +FHGGG+C+GS   P+ H+ CLR  A L A+V++  YRL
Sbjct  63   RVYRPSSPVKTAGGPKLPVLVYFHGGGYCLGSFAQPHFHTYCLRAAAELPAVVLSVQYRL  122

Query  368  APEHRLPAAMDDAFCAVKWVAAQAS----TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAV  535
            APEHRLPAA+ D    + W+  QA      D WL +  DF R F+ G S+G N+AHH+ V
Sbjct  123  APEHRLPAAIQDGAAFLSWLRDQAELGVGADLWLAESADFGRTFISGASAGANLAHHVTV  182

Query  536  RLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGT  715
            +      ++ PVR+ GYV+++ FFGG  RT++EA+ P +  L +E  D FWR+SLP G +
Sbjct  183  QAASAQEDVHPVRLAGYVLISAFFGGAERTETEADPPADVSLTVEGSDMFWRMSLPVGAS  242

Query  716  PDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGK  895
             DHP+ NPFGP SPSL +V L P+LV+    +VL+DRV  YA  L++  K V+   F G+
Sbjct  243  RDHPVTNPFGPESPSLASVDLPPVLVVAPESDVLRDRVMGYAATLREMGKAVEVAEFAGE  302

Query  896  QHGFFTNDPFSDVSTQVLQQLQHFMISKV  982
            QHGF    PF + + ++++ L+ F+ +  
Sbjct  303  QHGFSVLRPFGEAANELMRVLKRFVYTST  331



>ref|XP_004955522.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=340

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/330 (44%), Positives = 205/330 (62%), Gaps = 18/330 (5%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHD-----DASVHWKDSLFDRTHGLYLR  196
            PHVVEDC G++Q+ SDG++ RS D  +   FP+       D  V WKD ++D  HGL LR
Sbjct  13   PHVVEDCLGLVQLLSDGTVRRSTDYSV---FPLVGGVPPPDLPVEWKDVVYDGAHGLRLR  69

Query  197  IYKPRSSASAA----VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            +Y+  ++ +        LP++ +FHGGGFCV S    N H+  LRL A L A+V++ DYR
Sbjct  70   MYRLSTAGAGGGVEEKKLPVLVYFHGGGFCVASFEVINFHAGALRLAAELPAVVLSADYR  129

Query  365  LAPEHRLPAAMDDAFCAVKWVAAQAS----TDAWLKDGVDFNRAFVLGDSSGGNVAHHLA  532
            LAPEHRLPAA+DDA     W+ +QA+     D WL +  DF R FV GDS+GGN+AHH++
Sbjct  130  LAPEHRLPAALDDAESVFSWLRSQAAGGGGADPWLVESADFRRVFVTGDSAGGNIAHHIS  189

Query  533  VRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
            VR G G   ++P+R+ G VM+ P+FGG     SEA  PP   + + + D+ WRL+LP G 
Sbjct  190  VRHGSGELPLTPLRLAGCVMLWPYFGGEELMPSEAASPPGEPMGMALFDQLWRLALPAGA  249

Query  713  TPDHPLANPFGPASPSLEAVKLD--PILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVF  886
            T DHP+ANP  P S     +  D  P+LV+   Q+VL DRV  Y  +L+   KEV+ VVF
Sbjct  250  TKDHPIANPLAPGSVPFGDLGGDFPPVLVLDPDQDVLHDRVGEYVARLRAAGKEVELVVF  309

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFMIS  976
            +G+ H FF  +P  + S ++++ ++ F+ S
Sbjct  310  EGQGHAFFVTEPCGEASDELIRVIRRFVHS  339



>tpg|DAA42599.1| TPA: hypothetical protein ZEAMMB73_208866 [Zea mays]
Length=342

 Score =   278 bits (710),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 201/328 (61%), Gaps = 15/328 (5%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPF---PVHDDASVHWKDSLFDRTHGLYLRIY  202
            PHVVEDC G +Q+ SDG++ RS D  +  P    P   D  V WKD +++ T GL LR+Y
Sbjct  12   PHVVEDCLGFVQLLSDGTVRRSTDYSMLRPIGRVPSDTDLPVQWKDVVYEDTRGLRLRMY  71

Query  203  KPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            +P  +A+    LP++ +FHGGGFC+ S    + H+  LRL A L ALV++ DYRLAPEHR
Sbjct  72   RPTGAAAGETKLPVLVYFHGGGFCLLSFEVASFHAGALRLAAELPALVLSADYRLAPEHR  131

Query  383  LPAAMDDAFCAVKWVAAQAS--------TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVR  538
            LPAA+DDA  A  W+ AQA+        +D WL +  DF R FV GDS+GGN++HH+AVR
Sbjct  132  LPAALDDAESAFAWLRAQAAPPSAAGAESDPWLAESADFARVFVAGDSAGGNISHHVAVR  191

Query  539  LGV--GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
                 G   ++P+R+ G VM+ P+FGG   T SEA  P +  +   + D+ WRL+LP G 
Sbjct  192  HASSGGGLSLAPLRLAGCVMLWPYFGGEEPTPSEAAFPADQPMGTALFDQMWRLALPAGA  251

Query  713  TPDHPLANPFGPASPSLE--AVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVF  886
            T DHP ANPF P S  L        P+LV+   Q+ L DRV +Y  +LK   K V+ VVF
Sbjct  252  TKDHPFANPFAPGSVPLRDLGAAFPPLLVVDPDQDPLHDRVVDYVARLKAAGKAVELVVF  311

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
             G+ HGFF  +P  + +  +++ ++ F+
Sbjct  312  AGQGHGFFAMEPCGEAADDLIRVIRRFV  339



>ref|NP_001042057.2| Os01g0153800 [Oryza sativa Japonica Group]
 dbj|BAF03971.2| Os01g0153800 [Oryza sativa Japonica Group]
Length=355

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/321 (45%), Positives = 200/321 (62%), Gaps = 8/321 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK--  205
            PHVVED  G++Q+ SDGS+ R+ D  +     + D   V WKD+++D THGL +R++K  
Sbjct  26   PHVVEDFFGVIQLLSDGSVVRADDAALLAMPELQDVPGVQWKDAVYDATHGLRVRVFKLA  85

Query  206  PRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
              ++      LP++ +FHGGG+C+G+      H+ CLR    L A+V++  YRLAPEHRL
Sbjct  86   AAAAGDDGGKLPVLVYFHGGGYCIGALDQSPFHTFCLRAADELPAVVLSVQYRLAPEHRL  145

Query  386  PAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG-----  550
            P A+DD      W+    S D WL +  +  R F+ G S+G N+AHH+AVR+  G     
Sbjct  146  PTAIDDGAAFFSWLRGAGSADPWLAESAELARTFISGVSAGANLAHHVAVRVASGRQPVV  205

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPE-PFLNLEILDRFWRLSLPFGGTPDHP  727
                  VRV GYV++  FFGG  RT +EA  P +   L +E+ D+FWRL+LP G T DHP
Sbjct  206  DDVDPVVRVAGYVLLDAFFGGVERTAAEANPPADVSLLTVEMADQFWRLALPAGATRDHP  265

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            +ANPFGP SPSLEAV L P LV+  G +VL DRV  YA +LK+  K V+ V F+G QHGF
Sbjct  266  VANPFGPESPSLEAVALPPALVVASGGDVLYDRVVGYAARLKEMGKAVELVEFEGAQHGF  325

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
                P+S  +++V+Q L+ F+
Sbjct  326  SVIQPWSPETSEVIQVLKRFV  346



>dbj|BAB44059.1| putative PrMC3 [Oryza sativa Japonica Group]
Length=361

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/321 (45%), Positives = 200/321 (62%), Gaps = 8/321 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK--  205
            PHVVED  G++Q+ SDGS+ R+ D  +     + D   V WKD+++D THGL +R++K  
Sbjct  32   PHVVEDFFGVIQLLSDGSVVRADDAALLAMPELQDVPGVQWKDAVYDATHGLRVRVFKLA  91

Query  206  PRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
              ++      LP++ +FHGGG+C+G+      H+ CLR    L A+V++  YRLAPEHRL
Sbjct  92   AAAAGDDGGKLPVLVYFHGGGYCIGALDQSPFHTFCLRAADELPAVVLSVQYRLAPEHRL  151

Query  386  PAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG-----  550
            P A+DD      W+    S D WL +  +  R F+ G S+G N+AHH+AVR+  G     
Sbjct  152  PTAIDDGAAFFSWLRGAGSADPWLAESAELARTFISGVSAGANLAHHVAVRVASGRQPVV  211

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPE-PFLNLEILDRFWRLSLPFGGTPDHP  727
                  VRV GYV++  FFGG  RT +EA  P +   L +E+ D+FWRL+LP G T DHP
Sbjct  212  DDVDPVVRVAGYVLLDAFFGGVERTAAEANPPADVSLLTVEMADQFWRLALPAGATRDHP  271

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            +ANPFGP SPSLEAV L P LV+  G +VL DRV  YA +LK+  K V+ V F+G QHGF
Sbjct  272  VANPFGPESPSLEAVALPPALVVASGGDVLYDRVVGYAARLKEMGKAVELVEFEGAQHGF  331

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
                P+S  +++V+Q L+ F+
Sbjct  332  SVIQPWSPETSEVIQVLKRFV  352



>ref|XP_002462164.1| hypothetical protein SORBIDRAFT_02g020810 [Sorghum bicolor]
 gb|EER98685.1| hypothetical protein SORBIDRAFT_02g020810 [Sorghum bicolor]
Length=339

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 203/324 (63%), Gaps = 9/324 (3%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKD-EDINFPFPVHDDASVHWKDSLFDRTHGLYLRIY  202
            + PHVV+DC GI+Q+ SDG++ RS D   +     V  +  V WKD ++D  H L LR+Y
Sbjct  13   TAPHVVDDCLGIVQLLSDGTVTRSADYSALPLQGEVPSNLPVQWKDVVYDAAHALRLRMY  72

Query  203  KPR----SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLA  370
            +P     ++ +A   LP++ +FHGGGFC+ S   P+ H+  LRL A L ALV++ DYRLA
Sbjct  73   RPTHGDTTTTTANDKLPVLVYFHGGGFCLCSFELPHFHAGALRLAAELPALVLSADYRLA  132

Query  371  PEHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            PEHRLPAA  DA   + W+ AQA  D WL D  D  R FV GDS+GGN+AHH+AVR G G
Sbjct  133  PEHRLPAAHRDAEAVLSWLRAQAEADPWLADSADLGRVFVCGDSAGGNIAHHVAVRYGRG  192

Query  551  SPEMSP---VRVRGYVMMAPFFGGTVRTKSEAEG-PPEPFLNLEILDRFWRLSLPFGGTP  718
               +     VR+ G V++ P+F    RT SE  G     F++ ++L++ WR++LP G T 
Sbjct  193  QLALDHNPVVRLAGCVLLWPYFAAEERTASETAGLDGHQFVSTKLLEQMWRMALPVGATR  252

Query  719  DHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQ  898
            DH  ANPFGP S  L+ V   P+LV+    +VL DR+++YA +L    K V+ VVF+GK 
Sbjct  253  DHTAANPFGPDSDPLDDVAFPPVLVVDPDLDVLHDRIQDYAARLTAMAKPVELVVFRGKD  312

Query  899  HGFFTNDPFSDVSTQVLQQLQHFM  970
            HGFFT DP  + S Q++  ++ F+
Sbjct  313  HGFFTFDPCGEASDQLIHVIRGFV  336



>ref|XP_004173935.1| PREDICTED: probable carboxylesterase 15-like, partial [Cucumis 
sativus]
Length=218

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 168/224 (75%), Gaps = 10/224 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLPH+VEDC G+LQ+YSDG++ RS   +I+FPFP+  D+SV ++D L+  +H L+LR+
Sbjct  1    MGSLPHIVEDCMGVLQLYSDGTVSRS--HNIHFPFPLTLDSSVLFRDVLYQPSHALHLRL  58

Query  200  YKP----RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            YKP     SS +    LPI+FFFHGGGFCVGSR+WPN H+CC+RL  GL ALV+APDYRL
Sbjct  59   YKPAPSTTSSPTTNKKLPILFFFHGGGFCVGSRSWPNSHNCCVRLALGLGALVIAPDYRL  118

Query  368  APEHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            APEHRLPAA++D   A++WV+     D W+++  D  R FV+GDSSGGN+AHHLAVR+G 
Sbjct  119  APEHRLPAAVEDGAKAIEWVSKAGKLDEWIEESGDLQRVFVMGDSSGGNIAHHLAVRIGT  178

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILD  679
               E     VRG+V+MAPFFGG  RTKSE EGP E F +LE LD
Sbjct  179  ---ENEKFGVRGFVLMAPFFGGVGRTKSE-EGPAEQFFDLEALD  218



>gb|EAY72585.1| hypothetical protein OsI_00451 [Oryza sativa Indica Group]
Length=442

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/323 (46%), Positives = 205/323 (63%), Gaps = 10/323 (3%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDI-NFPFP-VHDDASVHWKDSLFDRTHGLYLRIYK  205
            PHVVED  G++Q+ SDGS+ R+ D  +   P P + D   V WKD+++D THGL +R++K
Sbjct  11   PHVVEDFFGVIQLLSDGSVVRADDAALLAMPMPELQDVPGVQWKDAVYDATHGLRVRVFK  70

Query  206  PRSSASAAV--SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            P ++A+      LP++ +FHGGG+C+G+      H+ CLR    L A+V++  YRLAPEH
Sbjct  71   PAAAAAGDDGGKLPVLVYFHGGGYCIGALDQSPFHTFCLRAADELPAVVLSVQYRLAPEH  130

Query  380  RLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG---  550
            RLP A+DD      W+    S D WL +  +  R F+ G S+G N+AHH+AVR+  G   
Sbjct  131  RLPTAIDDGAAFFSWLRGAGSADPWLAESAELARTFISGVSAGANLAHHVAVRVASGRQP  190

Query  551  --SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPE-PFLNLEILDRFWRLSLPFGGTPD  721
                    VRV GYV++  FFGG  RT +EA  P +   L +E+ D+FWRL+LP G T D
Sbjct  191  VVDDVDPVVRVAGYVLLDAFFGGVERTAAEANPPADVSLLTVEMADQFWRLALPAGATRD  250

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HP+ANPFGP SPSLEAV L P LV+  G +VL DRV  YA +LK+  K V+ V F+G QH
Sbjct  251  HPVANPFGPESPSLEAVALPPALVVASGGDVLYDRVVGYAARLKEMGKAVELVEFEGAQH  310

Query  902  GFFTNDPFSDVSTQVLQQLQHFM  970
            GF    P+S  +++V+Q L+ F+
Sbjct  311  GFSVIQPWSPETSEVIQVLKRFV  333



>ref|XP_004955524.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=331

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/320 (46%), Positives = 203/320 (63%), Gaps = 8/320 (3%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P VVEDC G L+V SDG++ RS          V  D SV WKD+++D  HGL LRIY P 
Sbjct  7    PRVVEDCRGALRVLSDGTVVRSTPPIAGDTEGVRADPSVEWKDTVYDAAHGLGLRIYMPA  66

Query  212  SSASAA---VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            ++A+A    + LP++ +FHGGGFC+GS  WP  H+ C RL AGL A++V+ DYRLAPEHR
Sbjct  67   AAAAAGGRDMKLPVVVYFHGGGFCIGSYAWPIFHAACSRLAAGLSAVLVSADYRLAPEHR  126

Query  383  LPAAMDDAFCAVKWV--AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSP  556
            LPAA+DDA   + W+  +  A  D WL    D  R  V G+S+GG +AHH+ VR   G+P
Sbjct  127  LPAAIDDAAAVLLWLRDSIAAGADPWLAAHADAGRVLVAGESAGGVLAHHMNVRFSSGAP  186

Query  557  EMSPVRVRGYVMMAPFF-GGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
             + PVR+RG+V + PFF GG   T SE   P   FLN ++  R+ RLSLP G T DHP  
Sbjct  187  -LHPVRLRGFVPLMPFFTGGGEPTPSELACPDGAFLNRDMSGRYVRLSLPAGATADHPFL  245

Query  734  NPFGP-ASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
            NPF P A+P L+ V + P LV+V G ++L+DR   Y  ++++  K V+ V F G+ H FF
Sbjct  246  NPFSPDAAPGLDRVDVGPTLVVVAGDDMLRDRNVEYVRRMEEMGKPVEAVEFPGQGHAFF  305

Query  911  TNDPFSDVSTQVLQQLQHFM  970
            +  P+S+   ++++ ++ FM
Sbjct  306  SLRPWSEPVEEMIRVVKRFM  325



>ref|NP_001058949.1| Os07g0162600 [Oryza sativa Japonica Group]
 dbj|BAC15966.1| putative pepper esterase [Oryza sativa Japonica Group]
 dbj|BAD30765.1| putative pepper esterase [Oryza sativa Japonica Group]
 dbj|BAF20863.1| Os07g0162600 [Oryza sativa Japonica Group]
 dbj|BAG97366.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97663.1| unnamed protein product [Oryza sativa Japonica Group]
Length=335

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 148/322 (46%), Positives = 199/322 (62%), Gaps = 9/322 (3%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKD-EDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKP  208
            PHVVEDC GI+Q+ SDG++ RS D   I+    V  D  V WKD ++D   GL LR+Y P
Sbjct  11   PHVVEDCLGIVQLLSDGTVTRSGDYSSISLMRDVPIDLPVQWKDVVYDAGRGLRLRMYAP  70

Query  209  RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
             +       LP++ +FHGGGFC+ S   PN H+  LRL   L A+V++ DYRLAPEHRLP
Sbjct  71   ANHGGEEGKLPVLVYFHGGGFCIASFELPNFHAGALRLAGELPAVVLSADYRLAPEHRLP  130

Query  389  AAMDDAFCAVKWVAAQ--ASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEM  562
            AA +DA   + W+  Q  A+ D WL    DF R FV GDS GGN+AHHL V  G G   +
Sbjct  131  AAYEDAVAVLSWLRGQAAAAADPWLAASADFERVFVCGDSCGGNIAHHLTVGCGSGDIAL  190

Query  563  SPVRVRGYVMMAPFFGGTVRTKSEA-----EGPPEP-FLNLEILDRFWRLSLPFGGTPDH  724
               R+ G VM+ P+FGG  R  SEA     EG   P  + + + D+ WRL+LP G T DH
Sbjct  191  DAARLAGCVMLWPYFGGEERMPSEAPPPPPEGDASPSAMGITLFDQMWRLALPAGATRDH  250

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            P ANPFGP SP L+ V   P+L++    +VL+DRV +YA +L+   K V+ V F+G+ HG
Sbjct  251  PAANPFGPESPPLDGVAFPPVLIVDPELDVLRDRVADYAARLQAMGKRVELVKFEGQGHG  310

Query  905  FFTNDPFSDVSTQVLQQLQHFM  970
            FF  DP S+ S ++++ ++ F+
Sbjct  311  FFVLDPMSEASGELVRVVRRFV  332



>ref|XP_003561398.2| PREDICTED: probable carboxylesterase 15 [Brachypodium distachyon]
Length=335

 Score =   275 bits (703),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 147/327 (45%), Positives = 201/327 (61%), Gaps = 21/327 (6%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPV-HDDASVHWKDSLFDRTHGLYLRIYKP  208
            PHVVEDC G+LQV SDG++ R +      P P   DD  V WKD+++D   GL LR+YKP
Sbjct  7    PHVVEDCRGMLQVLSDGTVARFEPP----PIPAGDDDGRVEWKDAVYDAGRGLGLRMYKP  62

Query  209  RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
               A+A   LP++ +FHGGGFCVGS  WPN H+ CLRL A L A+V++ DYRLAPEHR P
Sbjct  63   ---AAAEKKLPVLVYFHGGGFCVGSYAWPNFHAGCLRLAAELPAVVLSFDYRLAPEHRFP  119

Query  389  AAMDDAFCAVKWV---AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPE  559
            AA DDA  A+ W+    A  +T+ WL D  D  R FV G+S+GGN+ HHLA+R G     
Sbjct  120  AAHDDAATALLWLRDQLASGTTNPWLADAADARRVFVSGESAGGNLTHHLALRFGSTPGL  179

Query  560  MSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANP  739
            + P+ + GYVM+ P F    RT+SE E P   FL  ++ D   RL LP G   DHPL NP
Sbjct  180  LDPINIAGYVMLMPGFLSERRTRSELESPATAFLTRDMCDTLSRLFLPAGADKDHPLINP  239

Query  740  FGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKL----------KQQNKEVDYVVFQ  889
             GP SPSL+ +   P+LV+   +++L+D+   YA +L          K++ + V+ VVF 
Sbjct  240  LGPESPSLDPLLDVPVLVVAAERDLLRDKNVEYAERLRALAAAGKGKKKEEENVELVVFP  299

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            G++H FF   P S+ + +V++ +   +
Sbjct  300  GEEHAFFGVKPESEAAGEVVRLIGRLV  326



>dbj|BAK06502.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=351

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 152/327 (46%), Positives = 206/327 (63%), Gaps = 13/327 (4%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVH--DDASVHWKDSLFDRTHGLYLRIYK  205
            PHVVEDC GI+Q+ SDG++ RS D   + P   H   D  V WKD ++D  +GL LR+Y+
Sbjct  19   PHVVEDCMGIVQLLSDGTVRRSLDYS-HLPMLRHVPSDLPVQWKDVVYDAGNGLRLRMYR  77

Query  206  PRSSASAAVS---LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            P ++  A      LP++ +FHGGGFC+ S  WPN H+  LRL   L ALV++ DYRLAPE
Sbjct  78   PTTAGPADKKHPKLPVLVYFHGGGFCIASFEWPNFHAGALRLAGELPALVLSADYRLAPE  137

Query  377  HRLPAAMDDAFCAVKWVAAQAS--TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            HRLPAA  DA   + W+  QA+  TDAWL +  DF R FV GDS+GGN+ HH+A RLG G
Sbjct  138  HRLPAAHQDAETVLSWLRDQAAAGTDAWLAECADFGRVFVCGDSAGGNMVHHVAARLGSG  197

Query  551  SPEMSP-VRVRGYVMMAPFFGGTVRTKSEAEG----PPEPFLNLEILDRFWRLSLPFGGT  715
            +  +   VRV G V++ P+FGG  RT +EAE     P   F      ++ WRL+LP G T
Sbjct  198  ALALRDRVRVVGCVILWPYFGGEERTAAEAEAEAMAPSSEFDPGRNFEQMWRLALPEGAT  257

Query  716  PDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGK  895
             DHP ANPFGP S  L+ V   P+LV   G++ ++DRV  Y  +L+   K V+  VF+G+
Sbjct  258  RDHPAANPFGPESAPLDGVPFPPVLVAKAGRDRMRDRVALYVARLRAMGKPVELAVFEGQ  317

Query  896  QHGFFTNDPFSDVSTQVLQQLQHFMIS  976
             HGFF  DPF D S ++++ ++ F+ +
Sbjct  318  GHGFFVFDPFGDASDELVRVVRQFVCT  344



>gb|EEE53894.1| hypothetical protein OsJ_00420 [Oryza sativa Japonica Group]
Length=389

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/321 (45%), Positives = 201/321 (63%), Gaps = 8/321 (2%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            PHVVED  G++Q+ SDGS+ R+ D  +     + D   V WKD+++D THGL +R++KP 
Sbjct  60   PHVVEDFFGVIQLLSDGSVVRADDAALLAMPELQDVPGVQWKDAVYDATHGLRVRVFKPA  119

Query  212  SSASAAV--SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
            ++A+      LP+  +FHGGG+C+G+      H+ CLR    L A+V++  YRLAPEHRL
Sbjct  120  AAAAGDDGGKLPVFVYFHGGGYCIGALDQSPFHTFCLRAADELSAVVLSVQYRLAPEHRL  179

Query  386  PAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG-----  550
            P A+DD      W+    + D WL +  +  R F+ G S+G N+AH +AVR+  G     
Sbjct  180  PTAIDDGAAFFSWLRGAGNADPWLAESAELARTFISGVSAGANLAHQVAVRVASGRQPVV  239

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPE-PFLNLEILDRFWRLSLPFGGTPDHP  727
                  VRV GYV++  FFGG  RT +EA  P +   L +E+ D+FWRL+LP G T DHP
Sbjct  240  DDVDPVVRVAGYVLLDAFFGGVERTAAEANPPADVSLLTVEMADQFWRLALPAGATRDHP  299

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            +ANPFGP SPSLEAV L P LV+  G +VL DRV  YA +LK+  K V+ V F+G QHGF
Sbjct  300  VANPFGPESPSLEAVALPPALVVASGGDVLYDRVVGYAARLKEMGKAVELVEFEGAQHGF  359

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
                P+S  +++V+Q L+ F+
Sbjct  360  SVIQPWSPETSEVIQVLKRFV  380



>gb|EAZ02865.1| hypothetical protein OsI_24996 [Oryza sativa Indica Group]
Length=336

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/323 (46%), Positives = 197/323 (61%), Gaps = 10/323 (3%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKD-EDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKP  208
            PHVVEDC GI+Q+ SDG++ RS D   I+    V  D  V WKD ++D   GL LR+Y P
Sbjct  11   PHVVEDCLGIVQLLSDGTVTRSGDYSSISLMRDVPIDLPVQWKDVVYDAGRGLRLRMYAP  70

Query  209  RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
             +       LP++ +FHGGGFC+ S   PN H+  LRL   L A+V++ DYRLAPEHRLP
Sbjct  71   ANHGGEEGKLPVLVYFHGGGFCIASFELPNFHAGALRLAGELPAVVLSADYRLAPEHRLP  130

Query  389  AAMDDAFCAVKWVAAQ---ASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPE  559
            AA +DA     W+  Q   A+ D WL    DF R FV GDS GGN+AHHL V  G G   
Sbjct  131  AAYEDAVAVFSWLRGQAAAAAADPWLAASADFERVFVCGDSCGGNIAHHLTVGCGSGDIA  190

Query  560  MSPVRVRGYVMMAPFFGGTVRTKSEA-----EGPPEP-FLNLEILDRFWRLSLPFGGTPD  721
            +   R+ G VM+ P+FGG  R  SEA     EG   P  + + + D+ WRL+LP G T D
Sbjct  191  LDAARLSGCVMLWPYFGGEERMPSEAPPPPPEGDASPSAMAITLFDQMWRLALPAGATRD  250

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HP ANPFGP SP L+ V   P+L++    +VL DRV +YA +L+   K V+ V F+G+ H
Sbjct  251  HPAANPFGPESPPLDGVAFPPVLIVDPELDVLSDRVADYAARLEAMGKRVELVKFEGQGH  310

Query  902  GFFTNDPFSDVSTQVLQQLQHFM  970
            GFF  DP S+ S ++++ ++ F+
Sbjct  311  GFFVLDPMSEASGELVRVVRRFV  333



>gb|KDO45120.1| hypothetical protein CISIN_1g0204061mg, partial [Citrus sinensis]
Length=224

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 164/217 (76%), Gaps = 7/217 (3%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            +V++C G+L VYSDGSI R      +F  PVHDD SV WKD +FD  H L LR+YKP  +
Sbjct  12   LVDECRGVLFVYSDGSIVRLPKP--SFSVPVHDDGSVVWKDVVFDPVHDLSLRLYKP--A  67

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
               +  LPI ++ HGGGFC+GSRTWPNC + C +L + LQA++++PDYRLAPE+RLPAA+
Sbjct  68   LPVSTKLPIFYYIHGGGFCIGSRTWPNCQNYCFKLASELQAVIISPDYRLAPENRLPAAI  127

Query  398  DDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP  568
            +D + AVKW+ AQA     D WL +  DF + F+ GDS+GGN+AH+LAVRL  GS E++P
Sbjct  128  EDGYMAVKWLQAQAVANEPDTWLTEVADFGKVFISGDSAGGNIAHNLAVRLKAGSLELAP  187

Query  569  VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILD  679
            VRV+GY+++APFFGGTVR KSEAEGP E FLNLE++D
Sbjct  188  VRVKGYILLAPFFGGTVRKKSEAEGPREAFLNLELID  224



>ref|XP_004955523.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=343

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 144/332 (43%), Positives = 204/332 (61%), Gaps = 21/332 (6%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHD-----DASVHWKDSLFDRTHGLYLRI  199
            HVVEDC G++Q+ SDG++ RS D  +   FP+       D  V WKD ++D  HGL LR+
Sbjct  14   HVVEDCLGLVQLLSDGTVRRSTDYSV---FPLVGGVPPPDLPVEWKDVVYDGAHGLRLRM  70

Query  200  YKPRSSASAA----VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            Y+  ++ +        LP++ +FHGGGFCV S    N H+  LRL A L A+V++ DYRL
Sbjct  71   YRLSTAGAGGGLEEKKLPVLVYFHGGGFCVASFEVINFHAGALRLAAELPAVVLSADYRL  130

Query  368  APEHRLPAAMDDAFCAVKWVAAQAST-------DAWLKDGVDFNRAFVLGDSSGGNVAHH  526
            APEHRLPAA+DDA     W+ +QA+        D WL +  DF R FV GDS+GGN+AHH
Sbjct  131  APEHRLPAALDDAESVFSWLRSQATAAASGAGADLWLAESADFRRVFVTGDSAGGNIAHH  190

Query  527  LAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPF  706
            ++VR G G   ++P+R+ G VM+ P+FGG   T SEA   P   + + + D+ WRL+LP 
Sbjct  191  ISVRHGSGELPLTPLRLAGCVMLWPYFGGEELTPSEAASQPGEPMGMALFDQLWRLALPA  250

Query  707  GGTPDHPLANPFGPASPSLEAVKLD--PILVMVGGQEVLKDRVENYAMKLKQQNKEVDYV  880
            G T DHP+ANP  P S     +  D  P+LV+   Q+VL DRV  Y  +L+   KEV+ V
Sbjct  251  GATKDHPIANPLAPGSVPFGDLGGDFPPVLVLDPDQDVLHDRVGEYVARLRAAGKEVELV  310

Query  881  VFQGKQHGFFTNDPFSDVSTQVLQQLQHFMIS  976
            VF+G+ H FF  +P  + S ++++ ++ F+ S
Sbjct  311  VFEGQGHAFFVTEPCGEASDELIRVIRRFVHS  342



>ref|XP_004955525.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=340

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 203/329 (62%), Gaps = 18/329 (5%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHD-----DASVHWKDSLFDRTHGLYLRI  199
            HVVEDC G++Q+ SDG++ RS D  +   FP+       D  V WKD ++D  HGL LR+
Sbjct  14   HVVEDCLGLVQLLSDGTVRRSTDYSV---FPLVGGVPPPDLPVEWKDVVYDGAHGLRLRM  70

Query  200  YKPRSSASAA----VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            Y+  ++ +        LP++ +FHGGGFCV S    N H+  LRL A L A+V++ DYRL
Sbjct  71   YRLSTAGAGGGVEEKKLPVLVYFHGGGFCVASFEVINFHAGALRLAAELPAVVLSADYRL  130

Query  368  APEHRLPAAMDDAFCAVKWVAAQAST----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAV  535
            APEHRLPAA+DDA     W+ +QA+     D WL +  DF R FV  DS+GGN+AHH++V
Sbjct  131  APEHRLPAALDDAESVFSWLRSQAAAGGGADPWLVESADFRRVFVTCDSAGGNIAHHISV  190

Query  536  RLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGT  715
            R G G   ++P+R+ G VM+ P+FGG   T SEA  PP   + + + D+ WRL+LP G T
Sbjct  191  RHGSGELPLTPLRLAGCVMLWPYFGGEELTPSEAASPPGEPMGMALFDQLWRLALPAGAT  250

Query  716  PDHPLANPFGPASPSLEAVKLD--PILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQ  889
             DHP+ANP    S     +  D  P+LV+   Q+VL DRV  Y  +L+   KEV+ VVF+
Sbjct  251  KDHPIANPLARGSVPFGDLGGDFPPVLVLDPDQDVLHDRVGEYVARLRAAGKEVELVVFE  310

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFMIS  976
            G+ H FF  +P  + S ++++ ++ F+ S
Sbjct  311  GQGHAFFVTEPCGEASDELIRVIRRFVHS  339



>gb|EAY72593.1| hypothetical protein OsI_00459 [Oryza sativa Indica Group]
Length=327

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 198/324 (61%), Gaps = 21/324 (6%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            PHVVED  G++++ SDGS+ R  DE +  P          WKD ++D THGL +R+Y PR
Sbjct  10   PHVVEDFYGVVKLLSDGSVVRG-DESVLIP---------SWKDVVYDATHGLRVRVYTPR  59

Query  212  SSASAAV-----SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            ++A+AA       LP++ +FHGGG+C+G+     CH  CLR    L A+V++  YRLAPE
Sbjct  60   TAAAAAAGDDGGKLPVLVYFHGGGYCIGALDQSICHGFCLRAAYELPAVVLSVQYRLAPE  119

Query  377  HRLPAAMDDAFCAVKWVAAQAS----TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            HRLPAA+DD    + W+  QA+     D WL +  DF R F+ G S+  N+AHH+  R+ 
Sbjct  120  HRLPAAIDDGAAFISWLRGQAALGAGADPWLAESADFARTFISGLSACANLAHHVTARVA  179

Query  545  VGS-PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPE-PFLNLEILDRFWRLSLPFGGTP  718
             G    + P R  GYV++ PF  G  RT +EA  P +   L +E+ D+ WR+SLP G T 
Sbjct  180  SGQLAAVDPARFAGYVLVDPFLAGVERTAAEANPPADVSTLTVEMADQMWRMSLPVGATR  239

Query  719  DHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQ  898
            DHP+ANPFGP SPSLEAV L   LV+  G +VL DRV +YA +LK+  K V+   F+G+Q
Sbjct  240  DHPVANPFGPESPSLEAVALPAALVVASGGDVLYDRVVDYAARLKEMGKAVELAEFEGEQ  299

Query  899  HGFFTNDPFSDVSTQVLQQLQHFM  970
            HGF    P S    + ++ L+ F+
Sbjct  300  HGFSAAKPSSPAIKEFIRVLKRFV  323



>ref|NP_001132851.1| hypothetical protein [Zea mays]
 gb|ACF81872.1| unknown [Zea mays]
 tpg|DAA59632.1| TPA: hypothetical protein ZEAMMB73_589142 [Zea mays]
Length=351

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/325 (45%), Positives = 200/325 (62%), Gaps = 15/325 (5%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFP--FPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            V ED  G L+V  DG++ RS  + +  P  FP     SV WK++++D+   L +R+Y+P 
Sbjct  19   VAEDLLGFLRVLRDGTVLRSPADPVFCPATFP-GSHPSVQWKEAVYDKPKNLRVRVYRPT  77

Query  212  SSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
            +       LP++  FHGGGFC+GS TW N H  CLRL A   A+V++  YRLAPEHRLPA
Sbjct  78   TPPGTKKKLPVLVHFHGGGFCLGSCTWANVHEFCLRLAAEAGAVVLSAGYRLAPEHRLPA  137

Query  392  AMDDAFCAVKWVAAQAS------TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            A DD    ++W+  Q++      +DAWL +  DF R  V GDS+G  +AHHLAVR G  +
Sbjct  138  AFDDGAGFMRWLRDQSAIGGAGASDAWLAEAADFGRVLVTGDSAGATIAHHLAVRAGSAA  197

Query  554  PEMSP------VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGT  715
             E  P      + VRGYV++ PFFGG  RT SEAE   E F NL+++DRFWRLSLP G T
Sbjct  198  AEPEPEPEPGLLTVRGYVLLMPFFGGVRRTASEAECAEEAFPNLDLVDRFWRLSLPAGAT  257

Query  716  PDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGK  895
             DHP +NPFGP SP L  V   P+LV+ GG ++++DR  +YA +L    K V+   F G 
Sbjct  258  RDHPASNPFGPDSPDLGPVDFRPVLVVAGGLDLIRDRTVDYAERLAAMGKPVELAEFAGM  317

Query  896  QHGFFTNDPFSDVSTQVLQQLQHFM  970
             HGF+ + P S  + +++Q +  F+
Sbjct  318  PHGFYLHQPGSQATGELIQTVARFV  342



>gb|KDO40223.1| hypothetical protein CISIN_1g026700mg [Citrus sinensis]
Length=235

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 170/232 (73%), Gaps = 8/232 (3%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLP VVE+C G+L++YSDGSI RS +  I+F  P  +D S+ +KD +F+    L LR+
Sbjct  1    MGSLPQVVEECFGLLKLYSDGSISRSPN--ISFDVPFINDNSILYKDLIFNENIDLRLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP S  +++  LPI+F+FHGGGFC GSRT+PN H+ C+RL + LQA V+ PDYRL PEH
Sbjct  59   YKPTSIVNSSTKLPIVFYFHGGGFCFGSRTFPNNHNICVRLASILQAAVIEPDYRLGPEH  118

Query  380  RLPAAMDDAFCAVKWVAAQA-----STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            RLPAA++DA CA+KW+  QA       D WL + VDF+R FVLG SSGGN+AHHLAVR G
Sbjct  119  RLPAALEDACCALKWLQGQAIMHANVMDTWLGE-VDFDRVFVLGYSSGGNLAHHLAVRFG  177

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSL  700
             GS E++PVRVRGYV+M+PFFGG  RT+SE E P +    LE+ DR  R+ L
Sbjct  178  PGSVELAPVRVRGYVLMSPFFGGCERTRSEEERPIDGIWTLEMYDRNLRVKL  229



>dbj|BAJ88995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   267 bits (682),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/317 (43%), Positives = 195/317 (62%), Gaps = 8/317 (3%)
 Frame = +2

Query  44   EDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSSAS  223
            ED  G++Q+ SDGS+ R  +  +    P  D   V WKD ++   HGL +R+Y+P S++S
Sbjct  1    EDLLGLVQLLSDGSVIRGDESVLRPREPFPDVPGVEWKDVVYHAAHGLRVRVYRPASASS  60

Query  224  AAV----SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
                    LP++ +FHGGG+C+ S   P  H+ CLR  A L  +V++  YRLAPEHRLPA
Sbjct  61   TIAGGGGKLPVLVYFHGGGYCLCSFAQPPFHAFCLRAAAELPTVVLSVQYRLAPEHRLPA  120

Query  392  AMDDAFCAVKWVAAQAS----TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPE  559
            A+ D    + W+  QA      D WL +  +F R  + G S+G N+AHHL V++      
Sbjct  121  AIHDGAAFLSWLRGQAELGAGADTWLAESANFARTIISGVSAGANMAHHLTVQVASARLP  180

Query  560  MSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANP  739
            +SPVRV GYV+++ FFGG  RT SEA+   +  L +E+ ++ W +SLP G T DHP+ANP
Sbjct  181  VSPVRVVGYVLLSAFFGGAERTASEADLTMDVSLPVEMCEQLWHMSLPVGATRDHPVANP  240

Query  740  FGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTND  919
            FGP SPSL  V+L P LV+    +VL+DRV  YA +LK   K+V+ V F+G+QHGF    
Sbjct  241  FGPESPSLAPVELPPALVVAPLGDVLRDRVLGYAARLKDMGKDVELVEFEGQQHGFSILQ  300

Query  920  PFSDVSTQVLQQLQHFM  970
            PF + + +++  L+ F+
Sbjct  301  PFGEAADELMGVLRRFV  317



>ref|XP_003568581.1| PREDICTED: probable carboxylesterase 15 [Brachypodium distachyon]
Length=341

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/327 (43%), Positives = 205/327 (63%), Gaps = 16/327 (5%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDA-SVHWKDSLFDRTHGLYLRIYKPR  211
            HVVED  G++Q+ SDGS+ R  DE + FP   + +   V WKD ++   HGL  R+Y+P 
Sbjct  12   HVVEDFFGVVQLRSDGSVIRG-DESVLFPPEQYPEVPGVEWKDVVYHAAHGLKARVYRPS  70

Query  212  SSASAAV---SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            S  +A      LP++ +FHGGG+C+GS   P+ H  CLR  A L A+V++  YRLAPEHR
Sbjct  71   SPVAAEKEEKKLPVLVYFHGGGYCLGSYAQPSFHVFCLRAAAELPAVVLSVQYRLAPEHR  130

Query  383  LPAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            LPAA+ D    + W+ AQA T   D WL D  DF R FV G S+G N+AHH+ V+    S
Sbjct  131  LPAAIHDGEGFLSWLRAQAETRNADPWLADSADFARTFVSGCSAGANLAHHVTVQAAASS  190

Query  554  PEMS----PVRVRGYVMMAPFFGGTVRTKSEAE-GPPEPFLNLEILDRFWRLSLPFGGTP  718
              +     P R+ G+V+++ FF G  RT +E +  P +  L  ++ D+ WR++LP G T 
Sbjct  191  GIIDSSPVPFRIAGFVLLSAFFSGVQRTPAEIDLSPADVSLTADMADQLWRMALPAGATR  250

Query  719  DHPLANPFGPASPS---LEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQ  889
            DHPLANPFGP + S   + AV+L P+LV+  G +VL+DRV  YA  +++  K+V+   F+
Sbjct  251  DHPLANPFGPETESSGFIAAVELPPVLVVAPGIDVLRDRVLGYAAAMRELGKDVELARFE  310

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            G+QHGF  + PFSD + ++++ L+ F+
Sbjct  311  GEQHGFSVSRPFSDAADEMMRLLRRFV  337



>ref|NP_001042062.1| Os01g0154900 [Oryza sativa Japonica Group]
 dbj|BAF03976.1| Os01g0154900 [Oryza sativa Japonica Group]
 gb|EAZ10596.1| hypothetical protein OsJ_00428 [Oryza sativa Japonica Group]
Length=314

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 190/310 (61%), Gaps = 21/310 (7%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            PHVVED  G++++ SDGS+ R  DE +  P          WKD ++D THGL +R+Y  R
Sbjct  10   PHVVEDFYGVVKLLSDGSVVRG-DESVLIP---------SWKDVVYDATHGLRVRVYTSR  59

Query  212  SSASAAV-----SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            ++A+AA       LP++ +FHGGG+C+G+     CH  CLR    L A+V++  YRLAPE
Sbjct  60   TAAAAAAGDDGGKLPVLVYFHGGGYCIGALDQSICHGFCLRAAYELPAVVLSVQYRLAPE  119

Query  377  HRLPAAMDDAFCAVKWVAAQAS----TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            HRLPAA+DD    + W+  QA+     D WL +  DF R F+ G S+G N+AHH+  R+ 
Sbjct  120  HRLPAAIDDGAAFISWLRGQAALGAGADPWLAESADFARTFISGLSAGANLAHHVTARVA  179

Query  545  VGS-PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPE-PFLNLEILDRFWRLSLPFGGTP  718
             G    + P R  GYV++ PF  G  RT +EA  P +   L +E+ D+ WR+SLP G T 
Sbjct  180  SGQLAAVDPARFAGYVLVDPFLAGVERTAAEANPPADVSTLTVEMADQMWRMSLPVGATR  239

Query  719  DHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQ  898
            DHP+ANPFGP SPSLEAV L   LV+  G +VL DRV +YA +LK+  K V+   F+G+Q
Sbjct  240  DHPVANPFGPESPSLEAVALPAALVVASGGDVLYDRVVDYAARLKEMGKAVELAEFEGEQ  299

Query  899  HGFFTNDPFS  928
             GF    P S
Sbjct  300  LGFSAAKPSS  309



>emb|CDM81993.1| unnamed protein product [Triticum aestivum]
Length=331

 Score =   265 bits (676),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 134/327 (41%), Positives = 201/327 (61%), Gaps = 15/327 (5%)
 Frame = +2

Query  17   EMGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPF-PVHDDASVHWKDSLFDRTHGLYL  193
            E  + P V+ED   +L++ SDGS+ R  DE + +P  P+ D   V WKD+++    GL +
Sbjct  4    EDTAAPQVMEDLPSVLKLLSDGSVVRG-DEAVLWPKDPLPDVPGVQWKDAMYHAPRGLSV  62

Query  194  RIYKPRSSASAA--VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            R+Y+P  S + A    LP++ +FHGGG+C+GS   P+ H+ CLR  A L A+V++  YRL
Sbjct  63   RVYRPSPSVTTAGGPKLPVLVYFHGGGYCIGSFAQPHFHTYCLRAAAELPAVVLSVQYRL  122

Query  368  APEHRLPAAMDDAFCAVKWVAAQAS----TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAV  535
            APEHR PAA++D    + W+  QA      D WL +  DF R F+ G S+G N+AHH+ V
Sbjct  123  APEHRHPAAIEDGAAFLSWLCGQAELGVGADPWLAETADFGRTFISGASAGTNLAHHVTV  182

Query  536  RLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGT  715
            ++     ++ PV + GYV+++ FFGG  RT +EA+ P +  L +E  D FWR+SLP G  
Sbjct  183  QVASAQQDVHPVHIAGYVLISAFFGGAKRTATEADPPADVSLTVEGSDMFWRMSLPVGTN  242

Query  716  PDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGK  895
             DHP+ANPFGP SPSL +       V+    +VL+DRV  YA +L++  K V+   F G+
Sbjct  243  RDHPVANPFGPESPSLAS-------VVAPESDVLRDRVMGYAARLREMGKAVEVAEFAGE  295

Query  896  QHGFFTNDPFSDVSTQVLQQLQHFMIS  976
            QHGF    PF + + ++++ L+ F+ +
Sbjct  296  QHGFSVLRPFGEAANELMRVLKRFVYT  322



>ref|XP_003561404.1| PREDICTED: probable carboxylesterase 15 [Brachypodium distachyon]
Length=345

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/331 (43%), Positives = 206/331 (62%), Gaps = 27/331 (8%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFP------VHDDASVHWKDSLFDRTHGLYL  193
            P+VVEDC G+LQ+ SDG++ RS       PFP      + +D  V WKD+++D   GL L
Sbjct  11   PYVVEDCRGVLQLLSDGTVVRSA----ALPFPAGNDDGLDNDGRVEWKDAVYDAGRGLGL  66

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            R+YKP   A+A   LP++ +FHGGGFC+GS  WPN H+ CLRL A L A+V++ DYRLAP
Sbjct  67   RMYKP---AAAEKKLPVLVYFHGGGFCIGSYAWPNFHAGCLRLAASLPAVVLSFDYRLAP  123

Query  374  EHRLPAAMDDAFCAVKWVAAQASTDA---WLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHR+PAA +DA  A+ W+ +Q ++D    WL D  D  R FV G+S+GGN+AHHLA+R G
Sbjct  124  EHRIPAAHEDAAAALLWLRSQLASDTSNPWLADAADPRRVFVSGESAGGNLAHHLALRFG  183

Query  545  VGSPEMSPV-RVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
                 + PV  + GY+++ P F     T+SE + P   FL  ++ DR+ RLS P G   D
Sbjct  184  ASG--LDPVAHIAGYILLMPAFMSEQPTRSELDSPATAFLTRDMCDRYGRLSFPAGANRD  241

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQ--------QNKEVDY  877
            HPL NP GP SPSL+ +    +LV+    ++L+D+   YA +LK         + + V+ 
Sbjct  242  HPLLNPLGPESPSLDPLLDVAMLVVAAEGDLLRDKNVEYAERLKALAAEKGKGKEENVEL  301

Query  878  VVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            VVFQG++H FF   P S+ + ++++ +  F+
Sbjct  302  VVFQGEEHAFFGVKPMSEAAGELVRVIGRFV  332



>ref|XP_004968253.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=326

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/320 (43%), Positives = 196/320 (61%), Gaps = 8/320 (3%)
 Frame = +2

Query  23   GSLPHVVEDCSGILQVYSDGSIFRSKDEDI---NFPFPVHDDASVHWKDSLFDRTHGLYL  193
            G+ P VVED  G++Q+ SDGS+ R  +  I     PFP  D  SV WKD+++D   GL +
Sbjct  4    GTAPRVVEDFFGVIQLLSDGSVVRGDESTIMPAGGPFP--DVPSVQWKDAVYDAARGLKV  61

Query  194  RIYKPRSSASAAV-SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLA  370
            R+YKP   A+ A   LP++ +FHGGG+CVG+   P  HS C R  A L A+V++  YRLA
Sbjct  62   RVYKPSPPAAGAEGKLPVLVYFHGGGYCVGAYDQPMFHSFCQRFAAELPAVVLSVQYRLA  121

Query  371  PEHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            PEHRLPAA++DA     W+  +   + WL +  D +R FV G S+G N+AHH+ V++  G
Sbjct  122  PEHRLPAAIEDAATFFSWL--RDGAEPWLAESADLSRTFVSGVSAGANLAHHVVVQIASG  179

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPL  730
               + PVR+ GY++ + FFG    T +E++ P    L +E+ D+ WR++LP G T DHPL
Sbjct  180  QIVLGPVRLAGYILFSAFFGSDEHTATESDPPAGVSLTVEMSDQLWRMALPVGVTRDHPL  239

Query  731  ANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
            ANPF P S  LE + L P LV+  G++VL   V  YA +LK+  K V+   F G+ HGF 
Sbjct  240  ANPFAPGSARLEPLTLPPALVVAPGRDVLCGHVLRYAARLKEMGKAVELAEFVGEPHGFS  299

Query  911  TNDPFSDVSTQVLQQLQHFM  970
               P S+ + +++  L+ F+
Sbjct  300  VIRPRSEATEELMGVLKRFV  319



>ref|XP_003557563.2| PREDICTED: probable carboxylesterase 15 [Brachypodium distachyon]
Length=365

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 156/339 (46%), Positives = 206/339 (61%), Gaps = 30/339 (9%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFP--FPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            VVE+  G+L+V SDG+I RS D     P  FP  +  SV WK++++D+   L +RIYKP 
Sbjct  17   VVENLFGLLRVLSDGTIVRSPDPPAFCPKTFP-SEHPSVQWKEAVYDKARNLRVRIYKPT  75

Query  212  SSASA---AVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
             +A A      LP++ +FHGGGFC+G  TW N HS CLRL AG  ALV++  YRLAPEH 
Sbjct  76   MAAHAEKQKQKLPVLVYFHGGGFCLGCCTWANTHSFCLRLAAGAGALVLSACYRLAPEHP  135

Query  383  LPAAMDDAFCAVKWVAAQA----------STDAW-LKDGVDFNRAFVLGDSSGGNVAHHL  529
            LPAA+ DA   + W++AQ           + D W L +  DF R FV GDS+GG +AHHL
Sbjct  136  LPAALYDAAALLTWLSAQQLHSSAAAGDDNADTWSLAEVADFGRVFVTGDSAGGTLAHHL  195

Query  530  AVRLGVGSPEMSPVR------VRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWR  691
            AV  G G      VR      V+GYV++ PFFGG  R  SE E      +N + LDRFWR
Sbjct  196  AVSSGPGGKAALVVRDDVTVNVKGYVLLMPFFGGERRLPSE-EAESTRLMNRDTLDRFWR  254

Query  692  LSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEV  871
            L+LP G T DHPLANPFGP SP LE V L P+LV+  GQ++L+DRV +Y  +LK   K V
Sbjct  255  LALPAGATRDHPLANPFGPDSPGLEPVALPPVLVVAAGQDMLRDRVVDYGERLKAMGKPV  314

Query  872  DYVVFQ------GKQHGFFTNDPFSDVSTQVLQQLQHFM  970
               +F+      G+ H FF  +P+   + ++L+ L+ F+
Sbjct  315  KLSIFRKTEFVVGQGHAFFVYEPWGKAADELLRVLRQFV  353



>gb|ABK26127.1| unknown [Picea sitchensis]
Length=351

 Score =   263 bits (671),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 138/333 (41%), Positives = 210/333 (63%), Gaps = 10/333 (3%)
 Frame = +2

Query  32    PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
             P  V + SG+L++Y DGSIFR +D  +     +  +  V  KD + +   GL++R+Y P 
Sbjct  15    PEEVVNVSGVLKLYRDGSIFRLEDPQMFVKASLEGEDGVASKDVVLNEKLGLWVRLYLPS  74

Query  212   S---SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
             S     +    LP+I +FHGGGFC+ S   P+ H+  L+L A + A+V++  YRLAPEHR
Sbjct  75    SHLQQQTEKRRLPLIVYFHGGGFCLASPALPDYHNFTLKLAASVGAIVISVAYRLAPEHR  134

Query  383   LPAAMDDAFCAVKWVAAQA------STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
             LPAA DD   A++WV++ A        D WL    DF+R ++LGDS+GGN+A+H+ ++ G
Sbjct  135   LPAAYDDCIKALQWVSSHAVDGGDFERDLWLDFQADFSRVYLLGDSAGGNIANHVLLQCG  194

Query  545   VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
              G    SP+RVRG + + P+FG   RT+SE+E PP+ +L+L++ D  WRLSLP G   DH
Sbjct  195   -GVEAWSPMRVRGAIFVQPYFGSVQRTRSESECPPDAWLSLQLSDAGWRLSLPVGSDRDH  253

Query  725   PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
             P +NP+ P +P LE   L P+LV +GG+++L+DR  +Y   LKQ  K V+ VVF+ ++H 
Sbjct  254   PFSNPWSPEAPKLEEAPLPPLLVAIGGRDMLRDRGHDYCESLKQCGKSVEVVVFEEEEHA  313

Query  905   FFTNDPFSDVSTQVLQQLQHFMISKV*NDEIYI  1003
             F+   P  D S ++++++ HF+ S +    I+I
Sbjct  314   FYALKPHCDSSERLMEKISHFISSSLSEAVIHI  346



>gb|KDO70741.1| hypothetical protein CISIN_1g0202681mg, partial [Citrus sinensis]
Length=226

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 166/229 (72%), Gaps = 12/229 (5%)
 Frame = +2

Query  20   MGSL-PHVVEDC-SGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYL  193
            MGSL P V+ED   G++Q+ SDG++ RS + D ++P    +D SV  KD  +D  H L+L
Sbjct  1    MGSLDPQVIEDLGKGVIQLLSDGTVLRSNNIDFDYPLD-KNDGSVLIKDCQYDEKHQLHL  59

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            R+YK  S  +++  LPI+ F HGGGFCVGSR WP+ H+CC+RL  GL ALVVA DYRLAP
Sbjct  60   RMYKTPSIITSSRKLPIVVFIHGGGFCVGSRAWPSSHNCCMRLATGLNALVVALDYRLAP  119

Query  374  EHRLPAAMDDAFCAVKWVAAQAST-----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVR  538
            EHRLPAAM+DAF A+KW+  QA +     D W  D V+F+R FVLGDSSGGN+AHHLAVR
Sbjct  120  EHRLPAAMEDAFSAMKWLQDQALSEKVVDDEWFHD-VEFDRVFVLGDSSGGNIAHHLAVR  178

Query  539  LGVGS--PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILD  679
            LG G    E++PVRVRGYV++APFFGG  RTKSEA GP E  L L ILD
Sbjct  179  LGGGGGFEELAPVRVRGYVLLAPFFGGVARTKSEA-GPSEEHLTLAILD  226



>ref|XP_003565280.2| PREDICTED: probable carboxylesterase 15 [Brachypodium distachyon]
Length=335

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 138/322 (43%), Positives = 196/322 (61%), Gaps = 19/322 (6%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFP---FPVHDDASVHWKDSLFDRTHGLYLRIY  202
            PHVVED  G++Q+ SDGS+ R  +  ++ P   FP  D   V WKD  +   HGL  R+Y
Sbjct  18   PHVVEDLLGVVQLLSDGSVIRGDESVLSPPEQQFP--DVPGVEWKDVAYHAAHGLKARVY  75

Query  203  KPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            +P    +    LP++ +FHGGG+C+GS   P  H+ CLR  A L ALV++  YRLAPEHR
Sbjct  76   RPSEKKT---KLPVLVYFHGGGYCIGSYAQPPFHAFCLRAAAELPALVLSVQYRLAPEHR  132

Query  383  LPAAMDDAFCAVKWVAAQAST-----DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            LPAA+ D    + W+ AQA T     D WL +  DF R FV G S+G N+AHH+ V+   
Sbjct  133  LPAAVHDGADFLSWLRAQAETGGAAEDTWLAESADFARTFVSGVSAGANLAHHVTVQNAA  192

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSE-AEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             S   + +R+ G V+++ FFGG  RT +E A  P +  L +++ D+ WRL+LP G T DH
Sbjct  193  TSASPARLRIAGLVLLSAFFGGVRRTPAETALSPADVSLTVDVADQLWRLALPAGATRDH  252

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            PLA+P  P     EAV+L P+LV+  G++VL+DRV  YA +L +  K V+ V F  +QHG
Sbjct  253  PLASPEIP-----EAVELPPVLVVAPGRDVLRDRVLGYAARLGEMGKAVEVVRFDDEQHG  307

Query  905  FFTNDPFSDVSTQVLQQLQHFM  970
            F    PF   + ++++ L+ F+
Sbjct  308  FSVLRPFGVAADELMRVLRRFL  329



>ref|XP_008655646.1| PREDICTED: probable carboxylesterase 15 [Zea mays]
 gb|AFW80074.1| hypothetical protein ZEAMMB73_806887 [Zea mays]
Length=340

 Score =   257 bits (657),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 140/334 (42%), Positives = 209/334 (63%), Gaps = 22/334 (7%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVH--DDASVHWKDSLFDRTHGLYLRIYK  205
            P VVED  G++Q+ SDG++ RS D  +  P   H  D   V W+D ++D  HGL LR+Y+
Sbjct  7    PRVVEDYRGVIQLLSDGTVVRS-DPAVLRPSGEHFPDVPGVQWEDVVYDAAHGLSLRVYR  65

Query  206  PRSSASAAV----------SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAP  355
            P ++ + A            LP++ +FH GGFC+G+ + PN H+  LRL + L A+V++ 
Sbjct  66   PAAATATAGDAAREEEKKKKLPVLMYFHSGGFCLGTFSQPNFHAGSLRLASELPAVVISA  125

Query  356  DYRLAPEHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAV  535
            DYRL PEHRLPAA+DDA  A+ W+  Q     WL +  DF R FV G+SSG N++HH+AV
Sbjct  126  DYRLGPEHRLPAAIDDAAAALSWLREQ--RHPWLAESADFTRVFVAGESSGANMSHHVAV  183

Query  536  RLGVGSPEMS----PVRVRGYVMMAPFFGGTVRTKSEAEGPP--EPFLNLEILDRFWRLS  697
            R G    +++    P+RV GY+++ PFFGG VRT +E   PP   PF   E+ D+ WRLS
Sbjct  184  RHGSSGGQLALALAPLRVAGYLLLTPFFGGAVRTAAEEASPPPGAPF-TPEMADKMWRLS  242

Query  698  LPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDY  877
            LP G T DHP  NPFGP S +L  V    +LV+  G++ L +RV  YA +L++  K V+ 
Sbjct  243  LPAGATMDHPATNPFGPDSRALGPVAFPRVLVVSAGRDFLHERVLRYAARLREMGKPVEV  302

Query  878  VVFQGKQHGFFTNDPFSDVSTQVLQQLQHFMISK  979
             V +G++H FF+  P+S+ + ++++ ++ F+ ++
Sbjct  303  YVLEGQEHAFFSRQPWSEGTDELIRVVRRFVYTE  336



>ref|XP_002455178.1| hypothetical protein SORBIDRAFT_03g005590 [Sorghum bicolor]
 gb|EES00298.1| hypothetical protein SORBIDRAFT_03g005590 [Sorghum bicolor]
Length=442

 Score =   260 bits (665),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 136/318 (43%), Positives = 196/318 (62%), Gaps = 8/318 (3%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPF-PVHDDASVHWKDSLFDRTHGLYLRIY  202
            + PHVVED  G++++  DGS+ R  DE +  P  P  D   V WKD  +D   GL +R+Y
Sbjct  5    ATPHVVEDFFGVVRLLGDGSVVRG-DESVLMPAGPFPDIPGVEWKDVAYDTARGLKVRVY  63

Query  203  KPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
              RSS+ A   LP++ +FHGGG+C+G+   P  HSCC R  A L A+V++  YRLAPEHR
Sbjct  64   --RSSSVARGRLPVLVYFHGGGYCIGAYDKPMFHSCCQRFAAELPAVVLSVQYRLAPEHR  121

Query  383  LPAAMDDAFCAVKWVAAQAS--TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSP  556
            LPAA+DD      W+  QA+  T+ WL++  DF + FV G S+G N+AHH+ V +  G  
Sbjct  122  LPAAIDDGATFFSWLRRQAAAGTEPWLEESADFAQTFVSGVSAGANLAHHVVVHIASGKL  181

Query  557  EMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLAN  736
             + P R+ GYV+++ FFG   RT +E+E P    L     D+ WRL LP G T DHPLAN
Sbjct  182  AVHPARIAGYVLLSAFFGSAERTAAESESPANVSLT-AAFDQIWRLVLPAGATRDHPLAN  240

Query  737  PFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTN  916
            PF   SP +E + L P LV+V G + L+D +  YA +L++  K V+ V F G++HGF   
Sbjct  241  PFARDSPGMEPLPLPPALVVVPGLDTLRDHMRRYAARLEEMGKAVELVEFAGERHGFSVR  300

Query  917  DPFSDVSTQVLQQLQHFM  970
              +S+ + ++++ L+ F+
Sbjct  301  -AWSEANEELVRILKRFV  317



>gb|ACF82397.1| unknown [Zea mays]
 gb|AFW80073.1| gibberellin receptor GID1L2 [Zea mays]
Length=331

 Score =   256 bits (655),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 137/329 (42%), Positives = 197/329 (60%), Gaps = 13/329 (4%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            + PHVVED  G +Q+ SDG++ R  +  +  P P  D   V WKD+++D   GL +R+Y+
Sbjct  5    TAPHVVEDFFGAIQLLSDGTVVRGDEAALLPPKPFPDVPGVQWKDAVYDAARGLKVRVYR  64

Query  206  PRSSASAAVSLPIIFFFHGGGFCVGSR-TWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            P + A  +  LP++  FHGGG+CVGS            RL A L ALV++  YRLAPEHR
Sbjct  65   PTADAGDS-KLPVLVHFHGGGYCVGSYDELGGADYLRRRLAADLPALVLSVQYRLAPEHR  123

Query  383  LPAAMDDAFCAVKWV----------AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLA  532
            LPAA++D    + W+           A A  + WL +  DF R F+ G S+G N+AHHLA
Sbjct  124  LPAAIEDGATFLAWLRGQAALAGAGGAGAGVEQWLAESADFARTFLSGVSAGANLAHHLA  183

Query  533  VRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
            VR G G  +++P R+ G V+++ F GG  RT +E+  P    L + + D+ WR++LP G 
Sbjct  184  VRAGSGQVDLAPARLAGLVLLSLFLGGVERTATESAPPDGVSLTVAMSDQLWRMALPVGA  243

Query  713  TPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQG  892
            + DHPLANPFGP SP LE V L P+LV   G +VL+DRV  YA +L++  K+V+   F G
Sbjct  244  SMDHPLANPFGPGSPGLEPVALPPVLVEAPGVDVLRDRVLLYAARLREMGKDVELAEFPG  303

Query  893  KQHGFFTNDPFSDVSTQVLQQLQHFMISK  979
            +QHGF     +   + +++Q L+ F+  K
Sbjct  304  EQHGFSVLR-WGQANEELMQILKRFLHRK  331



>ref|XP_002461497.1| hypothetical protein SORBIDRAFT_02g003580 [Sorghum bicolor]
 gb|EER98018.1| hypothetical protein SORBIDRAFT_02g003580 [Sorghum bicolor]
Length=337

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 142/323 (44%), Positives = 194/323 (60%), Gaps = 19/323 (6%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDEDINFP---FPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            HVVEDC G +Q+ SDG++ RS D  +  P    P   D  V WKD ++D  HGL LR+Y+
Sbjct  16   HVVEDCLGFVQLLSDGTVRRSTDYSMLRPTGRVPSDSDLPVQWKDVVYDDAHGLRLRMYR  75

Query  206  PRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
            P ++ +    LP++ +FHGGGFC+ S    + H+  LRL A L ALV++ DYRLAPEHRL
Sbjct  76   PTNAGATKKKLPVLVYFHGGGFCLLSFEMTSFHAAALRLAAELPALVLSADYRLAPEHRL  135

Query  386  PAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMS  565
            PAA+DDA     W+ AQA  D WL    DF R FV G S+GGN++HH+AVRL        
Sbjct  136  PAALDDAESVFSWLRAQAMADPWLAGSADFARVFVTGHSAGGNISHHVAVRLA-------  188

Query  566  PVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFG  745
                 G VM+ P+FGG   T SEA  P +  +   + D+ WRL+LP G T DHP ANPF 
Sbjct  189  -----GCVMLWPYFGGEEPTPSEAACPADQVMGPALFDQMWRLALPAGATKDHPFANPFA  243

Query  746  PASPSLE--AVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVF--QGKQHGFFT  913
            P S  L        P+LV+   Q+ L DRV +Y  +LK   K+V+ VVF  QG+ HGFF 
Sbjct  244  PGSVQLGDLGAAFPPVLVVDPDQDPLHDRVVDYVARLKAAGKDVELVVFAGQGQGHGFFA  303

Query  914  NDPFSDVSTQVLQQLQHFMISKV  982
             +P  + + +++Q ++ F+  ++
Sbjct  304  TEPCGEAADELIQVIRRFVHGRL  326



>ref|XP_010239851.1| PREDICTED: probable carboxylesterase 15 [Brachypodium distachyon]
Length=351

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/337 (43%), Positives = 207/337 (61%), Gaps = 24/337 (7%)
 Frame = +2

Query  11   EREMGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHD--DASVHWKDSLFDRTHG  184
            E E  + PHVVEDC G+LQV SDG++ RS       P+ V D  D  V W+D+ +  + G
Sbjct  12   EVEATAPPHVVEDCRGVLQVLSDGTVVRSSAS----PYAVEDRDDGRVEWRDAAYGGSRG  67

Query  185  LYLRIYKP---RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAP  355
            L +R+Y+P   R        L ++ +FHGGGFC+GSR WP+ H+CCLRL    +A+V++ 
Sbjct  68   LGVRMYRPKPPRERQGKKPLLRVLAYFHGGGFCIGSRAWPSVHACCLRLADEARAVVLSF  127

Query  356  DYRLAPEHRLPAAMDDAFCAVKW----VAAQASTD------AWLKD-GVDFNRAFVLGDS  502
            DYRLAPEHRLPAA +DA  A+ W    +A   + D      +WL D G D  R FV G+S
Sbjct  128  DYRLAPEHRLPAAHEDAADALLWLRDRLALTPNNDDDDGVGSWLADSGADPGRLFVSGES  187

Query  503  SGGNVAHHLAVRLGVGSPEMSP-VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILD  679
            +GGN+AHH+A R G     + P V+V GYV++ P F     T+SE E P    L+ ++ +
Sbjct  188  AGGNMAHHMAARFGDSG--LGPVVKVAGYVLIMPAFTSEAPTESELESPATAALSRDVAE  245

Query  680  RFWRLSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ  859
            R+ RL+LP G   DHPL NP GP SP L A     +LV+VGG+++LKD    YA +++  
Sbjct  246  RYNRLALPAGANKDHPLMNPLGPDSPGL-ARVGGRVLVVVGGEDMLKDNQLRYAEEMRAA  304

Query  860  NKEVDYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
              +V+  V  G+QHGFF++ P+S+ S +V++ +  FM
Sbjct  305  GNDVELFVLPGEQHGFFSSKPWSEASGEVVRAIGRFM  341



>dbj|BAJ94602.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95248.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/332 (43%), Positives = 201/332 (61%), Gaps = 24/332 (7%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHD--DASVHWKDSLFDRTHGLYLRIYK  205
            PHVVEDC G+LQV SDG+  RS       P+ V D  D  V W+D+++   HGL +R+Y+
Sbjct  28   PHVVEDCRGVLQVLSDGTTVRSA----AAPYAVEDRDDGRVEWRDAVYHPAHGLGVRMYR  83

Query  206  P-RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            P R        LP++ +FHGGGFC+GSR WP+ H+CCLR    L A+V++ DYRLAPEHR
Sbjct  84   PPRREREGKGPLPVLAYFHGGGFCIGSRAWPSVHACCLRFAHELPAVVLSFDYRLAPEHR  143

Query  383  LPAAMDDAFCAVKWV---------------AAQASTDAWLK-DGVDFNRAFVLGDSSGGN  514
            LPAA +DA  A+ W+                +     AWL   G D  R FV GDS+G N
Sbjct  144  LPAAHEDAATALAWLRDRLTGMTPGLADGSGSDEDVRAWLAGSGADPGRLFVSGDSAGAN  203

Query  515  VAHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRL  694
            +AHH+A R G     + PVR+ G+V++ P F     T+SE       FL+ ++ +R+ RL
Sbjct  204  IAHHMAARFGAAGAGLGPVRIAGHVLVMPAFTSEAPTQSELSSRGNAFLSRDVAERYSRL  263

Query  695  SLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVD  874
            +LP G   D+PL NP GP SP L  V    +LV+VGG+++LKD    YA ++K    +V+
Sbjct  264  ALPAGANKDYPLMNPLGPDSPGLVVVGGR-VLVVVGGEDMLKDNQVRYAERMKAVGNDVE  322

Query  875  YVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
             VVF GK+HGFF+ DP+S+   +V++ ++ FM
Sbjct  323  LVVFDGKEHGFFSRDPWSETGGEVVRVVRRFM  354



>gb|ABK25952.1| unknown [Picea sitchensis]
Length=338

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/321 (40%), Positives = 194/321 (60%), Gaps = 10/321 (3%)
 Frame = +2

Query  41   VEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRS--  214
            VE+  G+L+VY DG+IFR ++  +     +  +  V  KD + + T GL++R+Y P S  
Sbjct  6    VENMRGLLKVYRDGTIFRLENPRMFVQPSLQGEGGVASKDVVLNETLGLWVRLYLPSSYL  65

Query  215  -SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
               +    LP+I +FHGGGFC+ S   P+ H+  L+L   + A+VV+  YRLAPEHRLPA
Sbjct  66   QQQTEKRRLPLIVYFHGGGFCLFSPAVPDLHNFTLKLTQSVGAIVVSVAYRLAPEHRLPA  125

Query  392  AMDDAFCAVKWVAAQA------STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            A DD   A++WV++ A        D WL    DF++ ++LGDS+GGN+AHH  VR G G 
Sbjct  126  AYDDCITALQWVSSHAVDGGDFERDPWLHSHADFSQVYLLGDSAGGNIAHHGVVRSG-GV  184

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
               SP+++RG + + P FG   RT+SE+E PP+ FL L+  D  WR+SLP G   DHP  
Sbjct  185  EAWSPMKIRGAIFVQPGFGAEKRTRSESECPPDAFLTLQHSDACWRISLPVGSNRDHPFC  244

Query  734  NPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFT  913
            NP+   +P LE V L P+LV +GG+++L+D    Y   LKQ  K V+ +V + + H F+ 
Sbjct  245  NPWSDGAPKLEDVTLPPLLVAIGGRDMLRDSNYVYCESLKQCGKSVEVMVLEEEGHAFYA  304

Query  914  NDPFSDVSTQVLQQLQHFMIS  976
              P    S ++++++  F+ S
Sbjct  305  LKPHCQSSERLMERISRFISS  325



>gb|ABK25184.1| unknown [Picea sitchensis]
Length=338

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/321 (40%), Positives = 196/321 (61%), Gaps = 10/321 (3%)
 Frame = +2

Query  41   VEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRS--  214
            VE+ SG+L+VY DG+IFR +D  +     +  +  V  KD + +   GL++R+Y P S  
Sbjct  6    VENMSGVLKVYRDGTIFRVEDPRMFVKASLQGEGDVASKDIVLNEKLGLWVRLYLPSSHL  65

Query  215  -SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
               +    LP+I +FHGGGFC+ S   P+ H+  L+L A + A+VV+  YRLAPEHRLPA
Sbjct  66   QQQTEKRRLPLIVYFHGGGFCLASPALPDFHNFTLKLAASVGAIVVSVAYRLAPEHRLPA  125

Query  392  AMDDAFCAVKWVAAQA------STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            A DD   A++WV++ A        D WL    DF++ ++LGDS+G N+AHH     G G 
Sbjct  126  AYDDGITALQWVSSHAVHGGDYEHDPWLDSHADFSQVYLLGDSAGANIAHHAVAECG-GV  184

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
               SP+RVRG + + P+FG   RT+SE+E PP+ F  L + D  WR+SLP G   DHP +
Sbjct  185  EAWSPMRVRGAIFVQPYFGAEKRTRSESECPPDAFFTLPLSDACWRVSLPVGSNRDHPFS  244

Query  734  NPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFT  913
            NP+   +P LE V L P+LV +GG+++L+DR  +Y   LKQ  K ++ +V + ++H F+ 
Sbjct  245  NPWSDGAPKLEEVPLPPLLVAIGGRDMLRDRGLDYCESLKQCGKSLEVMVLEEEEHAFYA  304

Query  914  NDPFSDVSTQVLQQLQHFMIS  976
              P    S ++++++  F+ S
Sbjct  305  LKPHCQSSERLMERISRFISS  325



>emb|CDM86907.1| unnamed protein product [Triticum aestivum]
Length=335

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/320 (41%), Positives = 198/320 (62%), Gaps = 19/320 (6%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPV---HDDASVHWKDSLFDRTHGLYLR  196
            ++P+VVEDC G++++ SDG++ RS       PFP    +DD  V WKD+++D  + L +R
Sbjct  26   AIPYVVEDCLGVMKLLSDGTVIRSAPP----PFPAGADYDDGRVEWKDAVYDAQYNLGVR  81

Query  197  IYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            IY+PR    A   LP++ +FHGGGF  GS +WP  H+ CLRL   L A+V++ DYRLAPE
Sbjct  82   IYRPRL-GEANTKLPVLVYFHGGGFVFGSYSWPKNHAGCLRLACELPAVVLSFDYRLAPE  140

Query  377  HRLPAAMDDAFCAVKWVAAQAST--DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            H LPAA++D+  A++W+A + S+  D WL +       F+ G SSG  +AHHL +R    
Sbjct  141  HPLPAAVEDSATALRWLATRISSRSDPWLAEDACI---FLGGQSSGATLAHHLLLR----  193

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPL  730
                  V++ G +++ P F     T+SE + P   FL+ ++ D+++RL +P G   D PL
Sbjct  194  --PHPMVKIAGCILLMPPFLSETATQSELDTPDTAFLSCKMSDKYFRLMMPVGANKDDPL  251

Query  731  ANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
             NPFGPASPSLE   +  +LV+    ++++D+   YA +LK   K+V+ VVF G++H FF
Sbjct  252  VNPFGPASPSLETADVGRMLVVAAECDMVRDKDVEYADRLKAMGKDVELVVFAGQEHAFF  311

Query  911  TNDPFSDVSTQVLQQLQHFM  970
               PFS  + Q+L  ++ F+
Sbjct  312  ATKPFSPAADQLLTVIKRFL  331



>ref|XP_002455176.1| hypothetical protein SORBIDRAFT_03g005570 [Sorghum bicolor]
 gb|EES00296.1| hypothetical protein SORBIDRAFT_03g005570 [Sorghum bicolor]
Length=340

 Score =   252 bits (643),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 136/331 (41%), Positives = 200/331 (60%), Gaps = 20/331 (6%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPF-PVHDDASVHWKDSLFDRTHGLYLRIYKP  208
            PHVVED  G +Q+ SDG++ R  DE +  P  P  D   V WKD+++D   GL +R+Y+P
Sbjct  7    PHVVEDFFGAVQLLSDGTVVRG-DEALLMPAEPFPDVPGVEWKDAVYDTARGLKVRLYRP  65

Query  209  RSS----ASAAVSLPIIFFFHGGGFCVGS-RTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
             ++      + + LP++  FHGGG+C+GS            RL A L ALV++  YRLAP
Sbjct  66   AAADAGDGGSNIKLPVLVHFHGGGYCIGSYNQLGGGDHLRRRLAADLPALVLSVQYRLAP  125

Query  374  EHRLPAAMDDAFCAVKWVAAQASTDA------------WLKDGVDFNRAFVLGDSSGGNV  517
            EHRLPAA++D    + W+  QAS  A            WL +  DF R F+ G S+G N+
Sbjct  126  EHRLPAAIEDGATFLSWLRGQASLAAAGGVGAGAEAEPWLAESADFARTFLSGVSAGANL  185

Query  518  AHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLS  697
             HHLAVR G G  +++PVR+ G+V+++ F GG  RT +E++ P    L + + D+ WR++
Sbjct  186  THHLAVRAGSGQVDLAPVRLAGHVLLSLFLGGVQRTATESDPPDGVSLTVAMSDQLWRMA  245

Query  698  LPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDY  877
            LP G + DHPLANPFGP SP LE V L P+LV     +VL+DRV  YA +L++  K+V+ 
Sbjct  246  LPVGASLDHPLANPFGPDSPGLENVALPPVLVEAPEVDVLRDRVLLYAARLREMGKDVEL  305

Query  878  VVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
              F+G+QHGF     +   + ++++ L+ F+
Sbjct  306  AEFEGEQHGFSVRR-WGQANEELIRILKRFV  335



>gb|ABK26852.1| unknown [Picea sitchensis]
Length=327

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/319 (42%), Positives = 195/319 (61%), Gaps = 10/319 (3%)
 Frame = +2

Query  41   VEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRS--  214
            V +  GIL+VY DG+IFR +D  +     +  +  V  KD + +   GL++R+Y P S  
Sbjct  4    VVNVGGILKVYRDGTIFRVEDPRMFVKASLQGEGDVASKDVVLNEKLGLWVRLYLPSSHL  63

Query  215  -SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
               +    LP+I +FHGGGFCV S   P+ H+  L+L A + A+VV+  YRLAPEHRLPA
Sbjct  64   QQQTEKRRLPLIVYFHGGGFCVASPALPDFHNFTLKLAATVGAIVVSVAYRLAPEHRLPA  123

Query  392  AMDDAFCAVKWVAAQAST------DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            A DD   A++WV + A        D WL+   DF+  +++GDS+GGN+AHH+    G G 
Sbjct  124  AYDDCISALQWVNSHAGDGGDFKHDPWLESYADFSAVYLMGDSAGGNIAHHVVALRG-GV  182

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
               +P++++G +++ PFFG   RT SE+E P +  LNLE+ D  WRLSLP G   DHP +
Sbjct  183  EAWNPIKLKGSILVEPFFGAEQRTLSESECPCDAVLNLELSDACWRLSLPVGSDRDHPFS  242

Query  734  NPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFT  913
             P  PA+P LE + L P+LV +GG+++L+DR   Y   LKQ  K V+ VVF  ++HGF+ 
Sbjct  243  YPCSPAAPKLEKISLPPLLVAIGGRDMLRDRDHEYCELLKQHGKSVEVVVFGEEEHGFYV  302

Query  914  NDPFSDVSTQVLQQLQHFM  970
              P S    +++Q++  F+
Sbjct  303  VRPQSQSCERLIQEISRFI  321



>ref|NP_001148081.1| gibberellin receptor GID1L2 [Zea mays]
 gb|ACG29669.1| gibberellin receptor GID1L2 [Zea mays]
Length=331

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/329 (41%), Positives = 196/329 (60%), Gaps = 13/329 (4%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYK  205
            + PHVVED  G +Q+ SDG++ R  +  +  P P  D   V WKD+++D   GL +R+Y+
Sbjct  5    TAPHVVEDFFGAIQLLSDGTVVRGDEAALLPPKPFPDVPGVQWKDAVYDAARGLKVRVYR  64

Query  206  PRSSASAAVSLPIIFFFHGGGFCVGSR-TWPNCHSCCLRLCAGLQALVVAPDYRLAPEHR  382
            P + A  +  LP++  FHGGG+CVGS            RL A L ALV++  YRLAPEHR
Sbjct  65   PTADAGDS-KLPVLVHFHGGGYCVGSYDELGGADYLRRRLAADLPALVLSVQYRLAPEHR  123

Query  383  LPAAMDDAFCAVKWV----------AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLA  532
            LPAA++D    + W+           A A  + WL +  DF R F+ G S+G N+AHHLA
Sbjct  124  LPAAIEDGATFLAWLRGQAALAGAGGAGAGVEQWLAESADFARTFLSGVSAGANLAHHLA  183

Query  533  VRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
            VR G G  +++P R+ G V+++ F GG  RT +E+  P    L + + D+ WR++LP G 
Sbjct  184  VRAGSGQVDLAPARLAGLVLLSLFLGGVERTATESAPPDGVSLTVAMSDQLWRMALPVGA  243

Query  713  TPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQG  892
            + DHPLANPFGP S  LE V L P+LV   G +VL+DRV  YA +L++  K+V+   F G
Sbjct  244  SMDHPLANPFGPGSLGLEPVALPPVLVEAPGVDVLRDRVLLYAARLREMGKDVELAEFPG  303

Query  893  KQHGFFTNDPFSDVSTQVLQQLQHFMISK  979
            +QHGF     +   + ++++ L+ F+  K
Sbjct  304  EQHGFSVLR-WGQANEELIRILKQFLHRK  331



>ref|XP_008652040.1| PREDICTED: probable carboxylesterase 15 [Zea mays]
 tpg|DAA59633.1| TPA: hypothetical protein ZEAMMB73_843435 [Zea mays]
Length=378

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/351 (41%), Positives = 205/351 (58%), Gaps = 31/351 (9%)
 Frame = +2

Query  38    VVEDCSGILQVYSDGSIFRSKDEDINFP---FPVHDDASVHWKDSLFDRTHGLYLRIYKP  208
             VVED  G+++V  DG++ RS    +  P   FP  +   V WK++++D+ + L +R+YKP
Sbjct  29    VVEDVLGLVRVLGDGTVVRSAVGPVFSPATSFP-ENHPCVEWKEAVYDKPNNLLVRMYKP  87

Query  209   RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
              S  +A    P++  FHGGGFC+GS TW N H+ CLRL A   A+V++  YRLAPEHRLP
Sbjct  88    -SPPAAGGKAPVLVHFHGGGFCIGSCTWANVHAFCLRLAADTGAVVLSAGYRLAPEHRLP  146

Query  389   AAMDDAFCAVKWVAAQASTDAWLKDGVDF----------NRAFVLGDSSGGNVAHHLAVR  538
              A+DD    ++W+  Q+S+        D            R FV GDS+G  +AHHLAVR
Sbjct  147   VAVDDGAGFMRWLRGQSSSADAADADADAWAWLADAADLGRVFVTGDSAGATIAHHLAVR  206

Query  539   LGVG-------------SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPE---PFLNLE  670
              GV              +P      VRGYV++ PFFGG  RT SE  G P      L+L+
Sbjct  207   AGVAAAGAGEAGDGERKTPGQQVTTVRGYVLLLPFFGGVERTPSEKAGCPAGAGALLSLD  266

Query  671   ILDRFWRLSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKL  850
             +LDRFWR+SLP G T DHP+ANPFGP SP L +V   P+LV+V G ++L+DR  +YA +L
Sbjct  267   VLDRFWRVSLPVGATRDHPVANPFGPDSPELGSVDFPPVLVVVAGLDLLRDRAVDYAERL  326

Query  851   KQQNKEVDYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFMISKV*NDEIYI  1003
                 K V+   F    HGF+ ++P S+ + ++++ +  F+ S V   E+ +
Sbjct  327   AAAGKPVELAEFAAAAHGFYLHEPGSEATGELIRAVGRFVDSCVSASEVLL  377



>ref|XP_008673695.1| PREDICTED: probable carboxylesterase 15 [Zea mays]
 tpg|DAA53411.1| TPA: hypothetical protein ZEAMMB73_465748 [Zea mays]
Length=339

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 137/326 (42%), Positives = 197/326 (60%), Gaps = 14/326 (4%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            PHVVED  G++Q++SDGSI R  +  I    P  D   V WKD++++ T GL +R+YKP 
Sbjct  8    PHVVEDFLGVIQIFSDGSIVRGDESTIRPSGPCSDVPGVQWKDAVYEATRGLKVRVYKPP  67

Query  212  SSASAAV--SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
             +        LP++ +FHGGG+C G+   P  HSCC R  A L A+V++  YRLAPEHRL
Sbjct  68   PTPGGGNQGKLPVLVYFHGGGYCGGAYDHPLLHSCCQRFAAELPAVVLSVQYRLAPEHRL  127

Query  386  PAAMDDAFCAVKWVAAQASTDA----------WLKDGVDFNRAFVLGDSSGGNVAHHLAV  535
            PAA++D      W+ +QA              WL +  DF+R FV G S+G N+AHH+ V
Sbjct  128  PAAVEDGAAFFSWLRSQAQAQPAAPGAAAADPWLAESADFSRTFVSGGSAGANLAHHIVV  187

Query  536  RLGVGSPEM-SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
            R+  G   + + VRV GYV+ + FFG   R  +E++ P   +L +E +D+ WR++LP G 
Sbjct  188  RIASGQIALGAAVRVAGYVLFSAFFGSVERVATESDPPAGVYLTVETIDQLWRMALPVGA  247

Query  713  TPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQG  892
            T DHPLANPFGP SPSLE + L P LV+   ++VL   V  YA +L++  K V+   F G
Sbjct  248  TRDHPLANPFGPGSPSLEPLPLPPALVVAPERDVLHGHVRRYAARLREMGKPVELAEFAG  307

Query  893  KQHGFFTNDPFSDVSTQVLQQLQHFM  970
            + H FF   P+S+   ++++ L+ F+
Sbjct  308  EGHAFFVG-PWSEARDELMRILKRFV  332



>ref|XP_004963490.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=337

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 194/339 (57%), Gaps = 22/339 (6%)
 Frame = +2

Query  2    KERERE---MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHD---DASVHWKDS  163
            ++R R+     + P+VVEDC G+LQV SDG++ R        PFP  D   D  V W+D+
Sbjct  4    RDRARQPSLATAAPYVVEDCLGLLQVLSDGTVLRFSPP----PFPAGDACDDGRVEWQDA  59

Query  164  LFDRTHGLYLRIYKPRSSASAAVS----------LPIIFFFHGGGFCVGSRTWPNCHSCC  313
            ++D  + L +R+Y+PR     +            LP++ +F GGGFC GS ++P  H+ C
Sbjct  60   VYDADNNLGVRMYRPRRRLCVSADKAAAEHKKKKLPVVVYFAGGGFCFGSYSYPKNHALC  119

Query  314  LRLCAGLQALVVAPDYRLAPEHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVL  493
            LRL   L A+V + ++RLAPEHRLPAA +DA  A+ W+  Q   + WL    D  R FV 
Sbjct  120  LRLATELPAVVCSINHRLAPEHRLPAAFEDAMAALLWLPDQIFHNPWLAGRADPRRVFVS  179

Query  494  GDSSGGNVAHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEI  673
            G SSG  VAH +AVRLG     + P+++ GY+++ P+F     T SE   P    L+ E 
Sbjct  180  GTSSGACVAHQMAVRLGTAG--LHPLKITGYILLMPYFLSEEPTMSELSTPETALLSRER  237

Query  674  LDRFWRLSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLK  853
             DR+ RL++P G   DHPL NPFGP SPSL +  +  +LV+    ++++D+   YA ++K
Sbjct  238  SDRYVRLAMPAGWNKDHPLLNPFGPYSPSLASADVGRVLVVAAECDLVRDKNLEYAERMK  297

Query  854  QQNKEVDYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
               K+V   +F G+ H F    P S  + +V++ ++ F+
Sbjct  298  ALGKDVRLALFPGQGHAFCAIKPLSPATDEVIRLIKRFI  336



>gb|EEE66608.1| hypothetical protein OsJ_23182 [Oryza sativa Japonica Group]
Length=312

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/320 (40%), Positives = 191/320 (60%), Gaps = 20/320 (6%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P+VVEDC G +Q+ SDG++ RS +   +   P   DA+V WKD  +D  H L  R+Y+PR
Sbjct  7    PYVVEDCRGAVQLMSDGTVRRSAEPAFHVDLPDDADAAVEWKDVTYDAEHDLNARLYRPR  66

Query  212  S-SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
            +  A+     P++ +FHGGGFC+GS               G  A +       +P     
Sbjct  67   NLGAANDARFPVVAYFHGGGFCIGS---------------GRLAQLPRLGASASPRSSRR  111

Query  389  AAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSP  568
             A++D   A+ WV   A+ D WL D  DF+R FV GDS+GGN+ HH+AVR G     + P
Sbjct  112  RAVEDGATAMAWVRDSAARDPWLADAADFSRVFVAGDSAGGNITHHMAVRFGKAG--LGP  169

Query  569  -VRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFG  745
             VR+RG+V++ P   G  RT++E E  P  FL  E+ DR+ RL LP G T D+P+ NP G
Sbjct  170  QVRLRGHVLLMPAMAGETRTRAELECRPGAFLTAEMSDRYARLILPGGATRDYPVLNPAG  229

Query  746  PASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ-NKEVDYVVFQGKQHGFFTNDP  922
            P +P LEAV + P LV+    ++L+DR E+YA +++++  KEV +V F G+QHGFF  DP
Sbjct  230  PEAPGLEAVAMAPSLVVAAEHDILRDRNEHYARRMREEWGKEVAFVEFAGEQHGFFEVDP  289

Query  923  FSDVSTQVLQQLQHFMISKV  982
            +S+ + ++++ ++ F++  +
Sbjct  290  WSERADELVRLIRSFVVEHM  309



>gb|ABK26900.1| unknown [Picea sitchensis]
Length=337

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 186/321 (58%), Gaps = 12/321 (4%)
 Frame = +2

Query  41   VEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRS--  214
            VE+ SG+++VY DG+I R     +        +  V  K  + + T GL++R+Y P S  
Sbjct  6    VENVSGLIKVYRDGTIVRHPPTFVKASL--QGEGGVASKGVVLNETLGLWVRLYLPSSHL  63

Query  215  -SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPA  391
               +    L +I +FHGGGFC+ S   P+ H+  L+L   + A+VV+  YRL PEHRLPA
Sbjct  64   PQQTEKRRLRLIVYFHGGGFCLFSPAEPDIHNFTLKLTESVGAIVVSVAYRLTPEHRLPA  123

Query  392  AMDDAFCAVKWVAAQA------STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGS  553
            A DD   A++WV++ A        D WL    DF++ ++LGDS+G N AHH  VR G G 
Sbjct  124  AYDDCITALQWVSSHAVDGGDFERDPWLHSHADFSQVYILGDSAGANNAHHGVVRSG-GV  182

Query  554  PEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLA  733
               SP+++RG + + P F    RT+SE+E PP+ FL L+  D  WR+SLP G   DHP  
Sbjct  183  EAWSPLKIRGAIFVQPAFSAEKRTRSESECPPDAFLTLQEGDACWRISLPVGSNRDHPFC  242

Query  734  NPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFT  913
            NP+   +P++E V L P+LV +GG+++L+D    Y   LKQ  K V+ +V + + H F+ 
Sbjct  243  NPWSDGAPNMEEVTLPPLLVAIGGRDMLRDSNHVYCESLKQCGKSVEVMVLEEEGHAFYA  302

Query  914  NDPFSDVSTQVLQQLQHFMIS  976
              P    S ++++++  F+ S
Sbjct  303  LKPHCQSSERLMERISRFISS  323



>ref|XP_003575791.1| PREDICTED: probable carboxylesterase 15 [Brachypodium distachyon]
Length=343

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 130/320 (41%), Positives = 191/320 (60%), Gaps = 17/320 (5%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPV---HDDASVHWKDSLFDRTHGLYLRIY  202
            P+VVEDC G++++ SDG++ RS       PFP    +DD  V WKD+++D  H L +R+Y
Sbjct  32   PYVVEDCLGVMKLLSDGTVLRSTPP----PFPAGADYDDGRVEWKDAVYDTRHNLGVRMY  87

Query  203  KPRSSA-SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            +P ++       LP++ +FHGGGF  GS +WP  H+ CLRL A L A+V++ DYRLAPEH
Sbjct  88   RPHNNKPDNKQQLPVLVYFHGGGFVFGSYSWPKNHAGCLRLAAELPAIVLSFDYRLAPEH  147

Query  380  RLPAAMDDAFCAVKWVAAQAST---DAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            RLPAAMDDA  A+ WVAA+ S+   D WL    +  + F+ G SSG  +AHHL +     
Sbjct  148  RLPAAMDDAASALHWVAARISSGSADPWLP--AETTQIFLGGQSSGATLAHHLLLLDKKK  205

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPL  730
                      GY+++ P F     T+SE + P   FL+    DR++RL +P G   DHPL
Sbjct  206  IKIKI----AGYILLMPPFLSEKVTQSELDAPDAAFLSRAASDRYFRLMMPAGADKDHPL  261

Query  731  ANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
             NPFG  SPSL+   +  +LV+    ++++D+   YA +L+   K+V+  VF G++H FF
Sbjct  262  VNPFGAGSPSLDTAHVGRMLVVAAECDMVRDKDVEYAERLRAMGKDVELAVFAGQEHAFF  321

Query  911  TNDPFSDVSTQVLQQLQHFM  970
               PFS  +  +L  ++ F+
Sbjct  322  ATRPFSPAADDLLALIKRFL  341



>ref|XP_003573773.1| PREDICTED: probable carboxylesterase 15 [Brachypodium distachyon]
Length=350

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 131/333 (39%), Positives = 195/333 (59%), Gaps = 31/333 (9%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            P+VVEDC G+LQ+ SDG++ R        PFP  DD  V WK+ ++D   GL +R+YKP 
Sbjct  13   PYVVEDCPGLLQLLSDGTVVRFGPP----PFPTVDDGRVEWKNDVYDTDRGLGVRMYKPA  68

Query  212  SSASAA-------VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLA  370
            ++ + +         LP++  FHGGGFCVGS  WP+ H+ C+RL A L A+V++ DYRLA
Sbjct  69   AAGAGSEEHTTSKKKLPVVVHFHGGGFCVGSYAWPSFHAGCVRLAAELPAVVLSFDYRLA  128

Query  371  PEHRLPAAMDDAFCAVKWVAAQASTDA--WLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            PEHR+PAA +DA  A+ W+  Q +++   WL D  D  R FV G+++GGN+AHHLA+   
Sbjct  129  PEHRVPAAYEDAAAALLWLRCQLASNVNPWLADAADARRVFVSGEATGGNLAHHLALT--  186

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
              +P +    + G +++ P F     T+SE + P   FL  E+ D   RL LP G   DH
Sbjct  187  --APGLD---IAGLILVTPAFLSEQPTRSELDTPATAFLTRELCDALCRLFLPAGADKDH  241

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYA-----------MKLKQQNKEV  871
            PL NP GP SPSLE +    +LV+    ++L+D+   +A              ++   +V
Sbjct  242  PLINPLGPESPSLEPLLDVAVLVVAAEGDLLRDKTVEFAERLRALAAAAGKGKEEDYVQV  301

Query  872  DYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            + VVFQG++HGFF   P S  + ++++ +  F+
Sbjct  302  ELVVFQGEEHGFFGLKPASAAAGELVRLIARFV  334



>ref|XP_002461496.1| hypothetical protein SORBIDRAFT_02g003570 [Sorghum bicolor]
 gb|EER98017.1| hypothetical protein SORBIDRAFT_02g003570 [Sorghum bicolor]
Length=368

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 137/348 (39%), Positives = 195/348 (56%), Gaps = 47/348 (14%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDA--SVHWKDSLFDRTHGLYLRIYK  205
            PH+VEDC G++Q+ SDG++ R+    +     +HD+A  +V WKD +++    L LR+Y 
Sbjct  18   PHIVEDCLGLVQLLSDGTVKRAPATLV-----LHDNAPAAVRWKDVVYNEARNLSLRMYV  72

Query  206  PRSSASAAV------SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            P ++ +          LP++ +FHGGGF +GS   P  H+ CLRL A L A+V++ DYRL
Sbjct  73   PSAAGAGDGGGAETKKLPVLVYFHGGGFIIGSFASPEFHAVCLRLAAELPAVVLSADYRL  132

Query  368  APEHRLPAAMDDAFCAVKWVAAQ-------ASTDAWLKDGVDFNRAFVLGDSSGGNVAHH  526
            APEHRLPAA++DA   + W+A Q       A  D WL D  D +R FV GDS+G N+AHH
Sbjct  133  APEHRLPAAVEDADALLSWLADQQRHAAAGAGADPWLADAADLSRVFVSGDSAGANIAHH  192

Query  527  LAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEP-FLNLEILDRFWRLSLP  703
             A  +  G      + + G V++ P+FGG  RT SEA  P +  FL L + D+ WRL+LP
Sbjct  193  AAAGVASG----RRLGLAGCVLLWPYFGGERRTASEAACPGDGVFLTLPLYDQMWRLALP  248

Query  704  FGGTPDHPLANPF--------GPASPSLEAVKLDPILVMVGGQEVLKDRVENY-------  838
             G T DH  ANPF        G  SP  E   L P+LV VG  ++L DRV  Y       
Sbjct  249  AGATRDHQAANPFAGPEATGGGSGSPGAE---LPPLLVAVGDGDMLVDRVREYVAWARAR  305

Query  839  ----AMKLKQQNKEVDYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
                A   K  ++ VD V F G  HGF   +P  + + ++++ ++ F+
Sbjct  306  VQAAATGNKNNDRRVDLVEFPGAGHGFAIFEPDGEAAGELVRVVRRFV  353



>emb|CDY55764.1| BnaA03g55400D [Brassica napus]
Length=234

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 161/227 (71%), Gaps = 14/227 (6%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDI---NFPFPVHDDASVHWKDSLFDRTHGLY  190
            +G  P V EDC G+LQ+ SDG++ RSK  D+     P   H  ++V +KDS++ + + L+
Sbjct  4    LGEQPQVAEDCMGLLQLLSDGTVVRSKSIDLITQQIPLANHK-SNVLFKDSIYHKPNNLH  62

Query  191  LRIYKPRSSA--SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            LR+YKP S++  SA   LP++ FFHGGGFC GSRTWP+ H+ CL L + L A VVAPDYR
Sbjct  63   LRLYKPASASNRSATALLPVVVFFHGGGFCFGSRTWPHFHNFCLTLASSLHAFVVAPDYR  122

Query  365  LAPEHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            LAPEHRLPAA +DA  A+ W+  QA +       VDF+R +VLGDSSGGN+AHHLA R G
Sbjct  123  LAPEHRLPAAFEDAEAALTWLRDQAVS-------VDFDRVYVLGDSSGGNIAHHLAFRFG  175

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRF  685
             GS E+SPVRVRGYV++ PFFGG  RTKSE +GP E  L+L++LD  
Sbjct  176  SGSTELSPVRVRGYVLLGPFFGGVERTKSE-DGPSEALLSLDLLDNI  221



>ref|XP_002455177.1| hypothetical protein SORBIDRAFT_03g005580 [Sorghum bicolor]
 gb|EES00297.1| hypothetical protein SORBIDRAFT_03g005580 [Sorghum bicolor]
Length=347

 Score =   226 bits (576),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 134/334 (40%), Positives = 199/334 (60%), Gaps = 22/334 (7%)
 Frame = +2

Query  26   SLPHVV-EDCSGILQVYSDGSIFRSKDEDINFP---FPVHDDASVHWKDSLFDRTHGLYL  193
            + PHVV ED  GI+Q+ SDGS+ R+ +  +  P   FP  D   VHW+D ++D    L +
Sbjct  7    TAPHVVVEDLLGIVQLLSDGSVVRADESVVTPPGAAFP--DVPGVHWRDVVYDPARRLKV  64

Query  194  RIYKPRSSA------SAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAP  355
            R+Y+   +        +   LP++ +FHGGG+C+G+   P  H+ C  + A + A+V++ 
Sbjct  65   RLYRTSPAEAPAAAPKSGRRLPVLVYFHGGGYCIGAYDQPGFHAFCRHVAAEVPAVVLSV  124

Query  356  DYRLAPEHRLPAAMDDAFCAVKWV---------AAQASTDAWLKDGVDFNRAFVLGDSSG  508
             YRLAPEHRLPAA+DDA     W+         AA A+ D WL +  DF+R FV G S+G
Sbjct  125  QYRLAPEHRLPAAIDDAATFFFWLRAQAAPAPAAAAAAADPWLAESADFSRTFVSGVSAG  184

Query  509  GNVAHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFW  688
             N+AHH+ V++  G      VRV GY + +PFFG   R  SE+  P    + +++LD  W
Sbjct  185  SNLAHHVVVQIASGQIVPGAVRVAGYFLFSPFFGSDERVASESHPPAGVSVTVQMLDVAW  244

Query  689  RLSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKE  868
            R++LP G T DHPLANPFGP SPSL+ + L P+L+   G++VL D V  YA +LK+  K 
Sbjct  245  RMALPLGATRDHPLANPFGPDSPSLQPLPLPPVLLEAPGRDVLYDHVLRYAARLKEMGKA  304

Query  869  VDYVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            V+ V F  ++HGF     +S+ + +++  L+ F+
Sbjct  305  VELVEFAEERHGFSVGQ-WSEATEELMHILKQFI  337



>ref|XP_011085931.1| PREDICTED: probable carboxylesterase 15 isoform X1 [Sesamum indicum]
 ref|XP_011085939.1| PREDICTED: probable carboxylesterase 15 isoform X2 [Sesamum indicum]
Length=335

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/318 (40%), Positives = 176/318 (55%), Gaps = 12/318 (4%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS-------KDEDINFPFPVHDDASVHWKDSLFDRTHGLYLR  196
            V+++ SG L+V+ DGS+ R+       K      P   H    V   D + D+  GL LR
Sbjct  7    VIDEVSGWLRVFDDGSVDRTWTGPPQVKFMSALVPPHHHFIDGVAIADVVGDQDSGLKLR  66

Query  197  IYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            IY P         LP++  FHGGGFC+    W   +S   RL    +A+VV+   RLAPE
Sbjct  67   IYLPEKQEDDPEKLPVLLHFHGGGFCISQADWFMYYSVYTRLARTARAVVVSVFLRLAPE  126

Query  377  HRLPAAMDDAFCAVKW---VAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            HRLPAA DD F A+ W   VA       WL D  DFNR F++GDSSGGN+ H +A R   
Sbjct  127  HRLPAACDDGFAALLWLRSVAGGQKQQPWLHDHADFNRVFLIGDSSGGNIVHQVASR--A  184

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            G   + P+RV G + + P F  + R+KSE E P  PFL L+++D+F RL+LP G T DHP
Sbjct  185  GRENLEPLRVAGAIPIHPGFCRSQRSKSEMEQPETPFLTLDMVDKFLRLALPVGATKDHP  244

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            +  P G A+P++E +KL P L  V  Q+++KD    +   +K+  KEV+  + +G  H F
Sbjct  245  ITCPMGEAAPAIEKLKLPPYLYCVAEQDLIKDTEMEFYEAMKRGGKEVELAMSEGVGHSF  304

Query  908  FTNDPFSDVSTQVLQQLQ  961
            + N    D+  +  Q+ Q
Sbjct  305  YLNKIAVDMDPKTAQETQ  322



>ref|XP_007010790.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY19600.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=335

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 177/316 (56%), Gaps = 12/316 (4%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPF-----PVHDD--ASVHWKDSLFDRTHGLYLR  196
            +V++ SG L+ Y DGS+ R+        F     P H+D    V  +D   D   GL +R
Sbjct  7    LVDEVSGWLRAYDDGSVDRTWTGPPEVKFMAEAVPPHEDFIEGVATRDVTIDSNSGLRVR  66

Query  197  IYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            IY P    +A   LPI+  FHGGGFC+    W   +    RL   + A+ V+   RLAPE
Sbjct  67   IYLPEQVLTAKTKLPILLHFHGGGFCISQADWYMYYHIYARLARSVPAICVSVYLRLAPE  126

Query  377  HRLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            ++LPAA DD +  + W+ + A   S + WL D  DFNR F++GDSSGGN+ H +AVR   
Sbjct  127  NKLPAACDDGYATLLWLKSLAKGESHEPWLNDHADFNRVFLIGDSSGGNIVHQVAVR--A  184

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            G+ ++SP+R+ G + + P F    R+KSE E P  PFL L+++D+F  L+LP G T DHP
Sbjct  185  GNLDLSPLRLAGGIPIHPGFVRAERSKSELEQPESPFLTLDMVDKFLALALPIGSTKDHP  244

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            +  P GPA+P++E + L P L  V  ++++KD    Y   ++  NKEV+ ++  G  H F
Sbjct  245  ITCPMGPAAPAMEGLNLPPFLFCVAEKDLIKDTEMEYYEAMRNANKEVELLISPGMGHSF  304

Query  908  FTNDPFSDVSTQVLQQ  955
            + N    D+      Q
Sbjct  305  YLNKIAVDMDPNYAAQ  320



>ref|XP_004307205.1| PREDICTED: probable carboxylesterase 6-like [Fragaria vesca subsp. 
vesca]
Length=348

 Score =   223 bits (569),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 129/340 (38%), Positives = 191/340 (56%), Gaps = 30/340 (9%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRS--KDEDINF---PFPVHDD--ASVHWKDSLFDRTHGLYL  193
             +V++ SG L+VY DGS+ R+     ++ F   P P HD     V  KD L D+T GL +
Sbjct  8    QLVQEVSGWLRVYDDGSVDRTWTGPPEVKFMVEPVPPHDKFIDGVATKDVLVDQTSGLRV  67

Query  194  RIYKPRSS-----------ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQA  340
            RIY P              +S    LPII  FHGGGFCV    W   +    +L     A
Sbjct  68   RIYLPEQQQEPEEDDDNKVSSEQQKLPIILHFHGGGFCVSQADWYMYYHIYTKLSRSANA  127

Query  341  LVVAPDYRLAPEHRLPAAMDDAFCAVKW---VAAQASTDAWLKDGVDFNRAFVLGDSSGG  511
            +VV+   RL+PEHRLPAA+DD F A+ W   VA     + WL    DFNR F++GDSSGG
Sbjct  128  IVVSVYQRLSPEHRLPAAIDDGFSALLWLRSVALAEQKEPWLLTYADFNRVFLIGDSSGG  187

Query  512  NVAHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWR  691
            N+ HH+A R   GS ++SP+R+ G + + P F  + R+KSE E P  PFL  +++D+F  
Sbjct  188  NIVHHVAAR--AGSEDLSPLRLAGGIPIHPGFVRSERSKSELEQPQSPFLTRDMVDKFLG  245

Query  692  LSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEV  871
            L+LP G T DHP+  P G  +P+LE +KL P L+ +  ++++ D    Y   +K+  ++V
Sbjct  246  LALPEGSTKDHPITCPMGSGAPALEGLKLPPFLLCIAEKDLIIDTEMEYYEAMKKAKQDV  305

Query  872  DYVVFQGKQHGFFTN------DPFSDVSTQ-VLQQLQHFM  970
            + ++ +G  H F+ N      DP +   T+ +++ ++ FM
Sbjct  306  EILMNKGMMHSFYLNKIAVDMDPETAAETERLIEGIKGFM  345



>ref|XP_007148812.1| hypothetical protein PHAVU_005G016400g [Phaseolus vulgaris]
 gb|ESW20806.1| hypothetical protein PHAVU_005G016400g [Phaseolus vulgaris]
Length=336

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 178/317 (56%), Gaps = 13/317 (4%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPF---PVHDDASVHWKDSLFDRT-----HGLYL  193
            +V++ SG L++Y DGS+ R+      F F   PV          ++ D T     H L +
Sbjct  7    LVDEVSGWLKIYDDGSVDRTWTGPPQFKFLSDPVLPHQQFIDGVAVRDTTISLGDHNLRV  66

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            R+Y P   + +   LPII  FHGGGFC+    W   +    R+    QA+VV+P  R AP
Sbjct  67   RLYLPEVKSESKKKLPIILHFHGGGFCISEPDWFMYYHFYGRVALAAQAIVVSPFLRRAP  126

Query  374  EHRLPAAMDDAFCAVKW---VAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAA+DDAF  + W   VA   S + WL+   DFNR F++GDSSGGNV H +A R  
Sbjct  127  EHRLPAAIDDAFDTLLWLQAVAQSGSQEPWLEQHGDFNRVFLIGDSSGGNVVHEVASR--  184

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             GS E+ PVRV G + + P +  + R++SE E P  PFL L++LD+F  L+LP G T DH
Sbjct  185  AGSVELRPVRVAGAIPVHPGYVRSERSRSELEMPQSPFLTLDMLDKFLELALPVGATKDH  244

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            P+  P G A+P LE +KL  +L+ V   ++++D    Y   LK++NK+V+     G  H 
Sbjct  245  PITCPMGEAAPPLEGLKLPAVLLCVAEMDLIRDTEMEYYEALKKRNKDVEVYFSNGMTHS  304

Query  905  FFTNDPFSDVSTQVLQQ  955
            F+ N    D+   V  Q
Sbjct  305  FYLNKVGVDMDPNVRAQ  321



>gb|KDP40570.1| hypothetical protein JCGZ_24569 [Jatropha curcas]
Length=336

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/321 (39%), Positives = 185/321 (58%), Gaps = 19/321 (6%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS-----KDEDINFPFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            +VE+ SG L+VY DGS+ R+     + + +  P P H+     V  +D   +   GL +R
Sbjct  7    IVEEVSGWLRVYDDGSVDRTWTGPPQVKFMAEPVPAHEQFIDGVAVRDVTVNSNSGLRVR  66

Query  197  IYKPRSS-ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            IY P ++  S    LPII  FHGGGFC+    W   +    RL    +A+ V+   RLAP
Sbjct  67   IYLPETNLESNDNKLPIILHFHGGGFCISQADWYMYYHIYTRLARSAKAICVSVFLRLAP  126

Query  374  EHRLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAA+DD F A+ W+++ A   S ++WL +  +FNR F++GDSSGGNV H +A R  
Sbjct  127  EHRLPAAIDDGFSALLWLSSLANGKSQESWLNNHGNFNRVFLIGDSSGGNVVHEVAAR--  184

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             G  ++SP+R+ G + + P F  + R+KSE E P  PFL L+++D+F  L+LP G   DH
Sbjct  185  AGHMDLSPLRLAGAIPIHPGFVRSERSKSELEQPESPFLTLDMVDKFLGLALPIGCNKDH  244

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            P+  P G A+P L+ +KL P L+ V   ++++D    Y   +K+  K+V+ ++  G  H 
Sbjct  245  PITCPMGAAAPKLDGLKLPPFLLCVAEMDLIRDTEMEYYEAMKKAKKDVELLINPGMGHS  304

Query  905  FFTN------DPFSDVSTQVL  949
            F+ N      DP +   T VL
Sbjct  305  FYLNKIAVDMDPLTATQTSVL  325



>ref|XP_004984954.1| PREDICTED: probable carboxylesterase 17-like [Setaria italica]
Length=371

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 129/343 (38%), Positives = 181/343 (53%), Gaps = 38/343 (11%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHW-------------KDSLFDRT  178
            VVE+  G+++VY DG + R          P   D    W             +D++ DR 
Sbjct  38   VVEEIHGLIRVYKDGHVER---------LPAIPDVPCTWGATAPGAPGGVVARDAVVDRA  88

Query  179  HGLYLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPD  358
             G++ R+Y P ++A+    LP++ +FHGGGFCVGS  W   H    +L A     V++ D
Sbjct  89   TGVWARLYAPMAAATTGARLPVVVYFHGGGFCVGSAAWSCYHEFLAQLAARAGCAVMSVD  148

Query  359  YRLAPEHRLPAAMDDAFCAVKWVAAQASTD----------AWLKDGVDFNRAFVLGDSSG  508
            YRLAPEHRLPAA DD   AV+W+  QA+            +W +    F+R F++GDS+G
Sbjct  149  YRLAPEHRLPAAFDDGLAAVRWLRHQAAVAATRAAAPDELSWWRARCGFDRVFLMGDSAG  208

Query  509  GNVAHHLAVRLGVGS-PEMSPVRVRGYVMMAPFFGGTVRTKSEAE--GPPEPFLNLEILD  679
             NVA H+A RLG G    + PV VRG V++ PFFGG  RT SE     PP   L L   D
Sbjct  209  ANVAFHVAARLGQGHLGALHPVTVRGAVIVQPFFGGEARTASEKTMAQPPGSALTLPTSD  268

Query  680  RFWRLSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ  859
             +WRL+LP G   DHP  NP   A+P LE + L P+LV V  Q++L+DR       +++ 
Sbjct  269  CYWRLALPAGAGRDHPWCNPLSRAAPRLETLPLPPVLVCVSEQDILRDRNLELCRAMRKA  328

Query  860  NKEVDYVVFQGKQHGF--FTNDPFSDVSTQ-VLQQLQHFMISK  979
             K V+   + G  H F    N   S   TQ +L  ++ F+ ++
Sbjct  329  GKSVEQATYGGVGHAFQVLHNCHLSQPRTQEMLAHIKAFVCAR  371



>ref|XP_010067679.1| PREDICTED: probable carboxylesterase 15 [Eucalyptus grandis]
Length=337

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/322 (38%), Positives = 183/322 (57%), Gaps = 12/322 (4%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS-----KDEDINFPFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            +V++  G L+VY DGS+ R+     + + +  P   H++    V  +D + DR  G  +R
Sbjct  7    MVDEVPGWLRVYEDGSVDRTWTGPPEAKFMAEPVAPHEEFIDGVAVRDVVTDRKSGRRVR  66

Query  197  IYKPRSSASA-AVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            IY P     A +  LP+I  FHGGGFC+    W   ++   +L A  +A+ V+   RLAP
Sbjct  67   IYLPEDIPEADSAKLPVILHFHGGGFCISQADWFMYYNTYTKLAASARAICVSAYLRLAP  126

Query  374  EHRLPAAMDDAFCAVKW---VAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            E+RLPAAM+DA+ A++W   VA   S + WL+D  DF+R F++GDSSGGNV H +A R G
Sbjct  127  ENRLPAAMEDAYAALEWLISVARGESREPWLEDHADFSRVFLIGDSSGGNVVHEVARRAG  186

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
                ++ PVR+ G + + P F    R++SE E P  PFLN  ++D+F  L LP G T DH
Sbjct  187  EAE-DLGPVRLAGAIPIHPGFVRAERSRSELEHPETPFLNRAMVDKFLSLGLPEGATRDH  245

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            PL  P G A+P+LE ++L P+L  V  ++++ D    +   +K  NKEV+ +V +G  H 
Sbjct  246  PLTCPMGRAAPALEGLRLPPVLFCVAEKDLVLDTEMEFYKAMKAANKEVELLVSRGMTHS  305

Query  905  FFTNDPFSDVSTQVLQQLQHFM  970
            F+ N    D      ++    M
Sbjct  306  FYLNKMAIDTDPATAEETDRLM  327



>ref|XP_006385976.1| hypothetical protein POPTR_0003s19190g [Populus trichocarpa]
 gb|ERP63773.1| hypothetical protein POPTR_0003s19190g [Populus trichocarpa]
Length=339

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 125/325 (38%), Positives = 181/325 (56%), Gaps = 16/325 (5%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS--KDEDINF---PFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            +VE+ SG L+ + DGS+ R+     ++ F   P P H++    V  +D   D   GL +R
Sbjct  7    LVEEVSGWLRTFDDGSVDRTWTGPPEVTFMAEPVPPHEEFKEGVAVRDVTIDEKSGLRVR  66

Query  197  IYKPRSS---ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            IY P+           LPII  FHGGGFC+    W   +    RL     A+VV+   RL
Sbjct  67   IYLPQHEPHYTDNHNKLPIIVHFHGGGFCISQADWYMYYYMYSRLARSASAIVVSVYLRL  126

Query  368  APEHRLPAAMDDAFCAVKWVAA----QASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAV  535
            APEHRLPAA+DD F A+ W+ +      S + WL +  DFNR F++GDSSGGN+ HH+A 
Sbjct  127  APEHRLPAAIDDGFSALMWLRSLGQGHDSYEPWLNNYGDFNRVFLIGDSSGGNLVHHVAA  186

Query  536  RLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGT  715
            R   G  ++SPVR+ G + + P F  +VR+KSE E P  PFL L+++DRF +L+LP G T
Sbjct  187  R--AGHVDLSPVRLAGGIPVHPGFIRSVRSKSEMEQPESPFLTLDMVDRFLKLALPKGCT  244

Query  716  PDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGK  895
             DHP   P G A+P L+ + L P L+ V   ++++D    Y   +++ NK+V+ ++  G 
Sbjct  245  KDHPFTCPVGHAAPPLDGLNLPPFLLCVAETDLIRDTEMEYYEAMRKANKDVELLINPGV  304

Query  896  QHGFFTNDPFSDVSTQVLQQLQHFM  970
             H F+ N    D+      Q    M
Sbjct  305  GHSFYLNKIAVDMDPHTAAQTTGLM  329



>ref|XP_004955508.1| PREDICTED: probable carboxylesterase 15-like [Setaria italica]
Length=350

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 138/343 (40%), Positives = 200/343 (58%), Gaps = 26/343 (8%)
 Frame = +2

Query  26   SLPHVVEDCSGILQVYSDGSIFRSKDEDINFPF-------------PVHDDASVHWKDSL  166
            S PHVVED  G++Q+ SDG++ RS D   ++P                 DD+ V WKD  
Sbjct  7    SEPHVVEDIRGLVQLMSDGTVRRSADP-ASYPVVDADPDGGGGSGSDGDDDSGVEWKDVT  65

Query  167  FDRTHGLYLRIYKPRS-SASAAVSLPIIFFFHGGGFCVG-----SRTWPNCHSCCLRLCA  328
            + R H L  R+Y+PR   A+    +PI+ +FHGGG   G     S  WP  H+ CLRL A
Sbjct  66   WQREHDLNARLYRPRHLGAANDAQIPIVAYFHGGGAGGGFFCLGSGRWPGPHAWCLRLAA  125

Query  329  GLQALVVAPDYRLAPEHRLPAAMDDAFCAVKWVAAQASTDAWLKDGVDFNRAFVLGDSSG  508
             L A+V++ DYRLAPEHRLP A +D   A+ W+ A A+ D W  D  DF R FV G S+G
Sbjct  126  ELPAVVLSFDYRLAPEHRLPTAQEDGAEAMAWLRAHAAHDPWFADDADFARVFVAGASAG  185

Query  509  GNVAHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPP---EPFLNLEILD  679
            GN+AHH+A   G  +    PVR+RG V++ P   G  RT++EA  PP      L  +++D
Sbjct  186  GNIAHHVATEFG-KTGLGPPVRIRGTVLLTPAMAGEARTRAEAAPPPAANSSLLTADMVD  244

Query  680  RFWRLSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQ  859
            R+ RL LP G T DHP  N  GP +P LE   + P+LV+   ++VL+DR   YA ++K++
Sbjct  245  RYARLFLPPGATRDHPAINLAGPEAPPLEVAAMAPVLVVAAERDVLRDRHAQYARRMKEE  304

Query  860  -NKEVDYVVFQGKQHGFF-TNDPFSDVSTQVLQQLQHFMISKV  982
              KEV+Y    G  HGF   +DP++  + ++++ ++ F+++ +
Sbjct  305  WGKEVEYAELAGVGHGFSEADDPWTRPADELVRLVRRFVVAHM  347



>ref|XP_008673693.1| PREDICTED: probable carboxylesterase 15 [Zea mays]
Length=337

 Score =   218 bits (555),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 136/324 (42%), Positives = 198/324 (61%), Gaps = 12/324 (4%)
 Frame = +2

Query  32   PHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPR  211
            PHVVED  G++Q++SDGSI R  +  I    P  D   V WKD++++ T GL +R+YKP 
Sbjct  8    PHVVEDFLGVIQIFSDGSIVRGDESTIMPAGPCPDVPGVQWKDAVYEATRGLKVRVYKPP  67

Query  212  SSASAAV--SLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRL  385
             +        LP++ +F+GGG+C G+   P  HSCC R  A L A+V++  YRLAPEHRL
Sbjct  68   PTPGGGNQGKLPVLVYFYGGGYCGGAYDHPLFHSCCQRFAAELPAVVLSVQYRLAPEHRL  127

Query  386  PAAMDDAFCAVKWV--------AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRL  541
            PAA++D      W+        AA  + D WL +  DF+R FV G S+G N+AHH+ VR+
Sbjct  128  PAAVEDGAAFFSWLRAQAQAQPAAPGAADPWLAESADFSRTFVSGGSAGANLAHHIVVRI  187

Query  542  GVGSPEM-SPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTP  718
              G   + + VRV GYV+ + FFG   R  +E++ P   +L +E +D+ WR++LP G   
Sbjct  188  ASGQIALGAAVRVAGYVLFSAFFGSVERVATESDPPAGVYLTVETIDQLWRMALPVGAIR  247

Query  719  DHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQ  898
            DHPLANPFGP SPSLE + L P LV+   ++VL   V  YA +L++  K V+   F G+ 
Sbjct  248  DHPLANPFGPGSPSLEPLPLPPALVVAPERDVLHGHVWRYAARLREMGKPVELAEFAGEG  307

Query  899  HGFFTNDPFSDVSTQVLQQLQHFM  970
            HG F+  P+S+   ++++ L+ F+
Sbjct  308  HG-FSVGPWSEARDELMRILKRFV  330



>ref|XP_008231719.1| PREDICTED: probable carboxylesterase 15 [Prunus mume]
Length=338

 Score =   218 bits (554),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 121/322 (38%), Positives = 183/322 (57%), Gaps = 20/322 (6%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS--KDEDINF---PFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            +VE+ SG L+V+ DGS+ R+     ++ F   P   H++    V  KD + D   GL +R
Sbjct  8    LVEEVSGWLRVFDDGSVDRTWTGPPEVKFMVEPVAPHNEFIDGVATKDVIVDEPSGLRVR  67

Query  197  IYKP--RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLA  370
            IY P  +        LPII  FHGGGFC+    W   +    +L     A+VV+   RLA
Sbjct  68   IYLPEQKPEGHEDTKLPIILHFHGGGFCISQADWYMYYHIYTKLARATNAIVVSVYQRLA  127

Query  371  PEHRLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRL  541
            PEHRLPAA+DD + A+ W+   A     + WL    DF+  F++GDSSGGN+ HH+A R 
Sbjct  128  PEHRLPAAIDDGYTALLWLRKLARGEQNEPWLLSYADFSSVFLIGDSSGGNIVHHVAAR-  186

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
              G+ ++SP+R+ G + + P F    R+KSE E P  PFL L+++D+F  L++P G T D
Sbjct  187  -AGTVDLSPLRLAGGIPIHPGFVRAERSKSELEQPESPFLTLDMVDKFLGLAIPVGSTKD  245

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HP+  P GP +P L+ +KL P L+ +  ++++ D    Y   +K+ NK+V+ ++ +G  H
Sbjct  246  HPVTCPMGPGAPRLDGLKLPPFLLCIASKDLIIDTEMEYFEAMKKANKDVELLINKGMTH  305

Query  902  GFFTN------DPFSDVSTQVL  949
             F+ N      DP +   T+VL
Sbjct  306  SFYLNKIAVDMDPETASETEVL  327



>ref|XP_003527517.1| PREDICTED: probable carboxylesterase 15-like [Glycine max]
Length=338

 Score =   218 bits (554),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 127/332 (38%), Positives = 184/332 (55%), Gaps = 24/332 (7%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPF-----PVHDDASVHWKDSLFDR----THG--  184
            +V++ SG L++Y DGS+ R+      F F     P H+     + D +  R    THG  
Sbjct  7    LVDEVSGWLKIYDDGSVDRTWSGPDQFKFMAEPAPPHE----QFIDGVAIRDVAVTHGGG  62

Query  185  ---LYLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAP  355
                ++R+Y P      +  LPI+  FHGGGFC+    W   +    R     +++VV+P
Sbjct  63   QSGHHVRLYLPEIKPEDSQKLPIVLHFHGGGFCISEPDWFMYYQVYTRFARSTRSIVVSP  122

Query  356  DYRLAPEHRLPAAMDDAFCAVKW---VAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHH  526
              R APEHRLPAA+DD F  + W   VA   S + WL+   DFNR F++GDSSGGN  H 
Sbjct  123  FLRRAPEHRLPAAIDDGFDTLLWLQTVARSGSLEPWLEQHGDFNRVFLIGDSSGGNSVHE  182

Query  527  LAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPF  706
            +A R   GS ++SPVRV G + + P F  + R++SE E P  PFL L++LD+F  L+LP 
Sbjct  183  VAAR--AGSADLSPVRVAGAIPVHPGFVRSNRSRSEMEMPQTPFLTLDMLDKFLALALPV  240

Query  707  GGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVF  886
            G T DHP   P G A+P LE +KL P+L+ V   ++++D    Y   +K+ NK+V+  V 
Sbjct  241  GATKDHPFTCPMGEAAPPLEGLKLPPVLLCVAEMDLVRDTEMEYYEAMKKANKDVELYVS  300

Query  887  QGKQHGFFTNDPFSDVSTQVLQQLQHFMISKV  982
            +G  H F+ N    D+   V  Q    +IS++
Sbjct  301  KGMTHSFYLNKIAVDMDPNVSAQTDA-LISRI  331



>ref|XP_002297728.1| hsr203J family protein [Populus trichocarpa]
 gb|EEE82533.1| hsr203J family protein [Populus trichocarpa]
Length=340

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 181/321 (56%), Gaps = 17/321 (5%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS--KDEDINF---PFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            +VE+ SG L+++ DG + R+      + F   P P H++    V  +D   D   GL +R
Sbjct  7    IVEEVSGWLRIFDDGWVDRTWIGPPQVKFMAEPVPPHEEFIEGVAIRDVTIDENSGLSVR  66

Query  197  IYKPRSS----ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            IY P+         +  LP+I  FHGGGFC+    W   +    RL     A+VV+   R
Sbjct  67   IYLPQHEPDHYTDNSDKLPLIVHFHGGGFCISQADWYMYYYIYSRLARSAPAIVVSVYLR  126

Query  365  LAPEHRLPAAMDDAFCAVKWVAA----QASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLA  532
            LAPEHRLPAA+DD F A+ W+ A    Q S + WL +  DFNR F++GDSSGGN+ HH+A
Sbjct  127  LAPEHRLPAAIDDGFSALMWLRALAQGQESYEPWLNNHGDFNRVFLIGDSSGGNLVHHVA  186

Query  533  VRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
             R   G  ++SP+R+ G + + P F  + R+KSE E P  PFL L+++DRF +L+LP G 
Sbjct  187  AR--AGQVDLSPMRLAGGIPVHPGFVRSERSKSEMEQPESPFLTLDMVDRFLKLALPKGC  244

Query  713  TPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQG  892
            T DHP   P G A+P L+++ L P L+ V   ++++D    Y   +K+ NK+V+ ++  G
Sbjct  245  TKDHPFTCPMGHAAPPLDSLNLPPFLLCVAEADLIRDTEMEYYEAMKKANKDVELLINPG  304

Query  893  KQHGFFTNDPFSDVSTQVLQQ  955
              H F+ N    D+      Q
Sbjct  305  VGHSFYLNKIAVDMDPHTAAQ  325



>ref|XP_007218270.1| hypothetical protein PRUPE_ppa008273mg [Prunus persica]
 gb|EMJ19469.1| hypothetical protein PRUPE_ppa008273mg [Prunus persica]
Length=338

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/330 (37%), Positives = 188/330 (57%), Gaps = 21/330 (6%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS--KDEDINF---PFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            +VE+ SG L+V++DGS+ R+     ++ F   P   H +    V  +D + D   GL +R
Sbjct  8    LVEEVSGWLRVFNDGSVDRTWTGPPEVKFMSEPVAPHKEFVNGVATEDVIVDEPSGLRVR  67

Query  197  IYKPRSSASAA--VSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLA  370
            IY P           LPII  FHGGGFC+    W   +    +L     A+VV+   RLA
Sbjct  68   IYLPEQKQEGHDDNKLPIILHFHGGGFCISQADWYMYYHIYTKLARATNAIVVSVYQRLA  127

Query  371  PEHRLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRL  541
            PEHRLPAA+DD + A+ W+   A     + WL    DF+R F++GDSSGGN+ HH+A R 
Sbjct  128  PEHRLPAAIDDGYTALLWLRKLARGEQKEPWLLSYADFSRVFLIGDSSGGNIVHHVAAR-  186

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
              G+ ++SP+R+ G + + P F    R+KSE E P  PFL L+++D+F  L++P G T D
Sbjct  187  -AGTVDLSPLRLAGGIPIHPGFVRAERSKSELEQPESPFLTLDMVDKFLGLAIPVGSTKD  245

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HP+  P GP +P L+ +KL P L+ +  ++++ D    Y   +K+ NK+V+ ++ +G  H
Sbjct  246  HPVTCPMGPGAPLLDGLKLPPFLLCIASKDLIIDTEMEYFEAMKKANKDVELLINKGMTH  305

Query  902  GFFTN------DPFSDVSTQVL-QQLQHFM  970
             F+ N      DP +   T++L  +++ F+
Sbjct  306  SFYLNKIALDMDPETASETEILITRIKEFI  335



>ref|XP_010106123.1| putative carboxylesterase 6 [Morus notabilis]
 gb|EXC07783.1| putative carboxylesterase 6 [Morus notabilis]
Length=334

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 182/315 (58%), Gaps = 11/315 (3%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS--KDEDINF---PFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            +V++ SG L+VY DGS+ R+     ++ F   P P HDD    V  +D + DR  GL +R
Sbjct  7    LVDEVSGWLRVYDDGSVDRTWTGPPEVKFMAEPVPPHDDFIEGVAVRDVVADRKSGLRVR  66

Query  197  IYKP-RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            IY P ++      + PII  FHGGGFC+    W   +    RL    +A++V+   R AP
Sbjct  67   IYLPEKNPGEEKTNFPIILHFHGGGFCISEADWFMYYYIYARLARAARAVIVSAYLRRAP  126

Query  374  EHRLPAAMDDAFCAVKWVAAQASTDAWLKDG-VDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            EHRLPAA DD + A+ W+ + A +      G VDFNR F++GDSSGGN+ H +A R   G
Sbjct  127  EHRLPAAADDGYSALLWLRSLAKSGESSDLGDVDFNRVFLIGDSSGGNLVHEVAAR--AG  184

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPL  730
              ++SPVRV G + + P F  + R+KSE E P  PFL L+++D+F  LSLP G T DHP 
Sbjct  185  KEDISPVRVAGAIPIHPGFVRSERSKSEKEQPQSPFLTLDMVDKFLSLSLPVGCTKDHPF  244

Query  731  ANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
              P G A+P LE ++L P+L+ +  ++++KD    Y   +++  K+V+ ++  G  H F+
Sbjct  245  TCPMGAAAPPLEELRLPPMLLCIAEKDLIKDTEMEYYEAMRKAEKDVELLISHGMTHSFY  304

Query  911  TNDPFSDVSTQVLQQ  955
             N    D+ T    Q
Sbjct  305  LNKIAVDMDTNTAAQ  319



>ref|XP_009592309.1| PREDICTED: probable carboxylesterase 15 [Nicotiana tomentosiformis]
Length=336

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 125/332 (38%), Positives = 184/332 (55%), Gaps = 19/332 (6%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRS--KDEDINF---PFPVHDDA--SVHWKDSLFDRTHGLYL  193
             V+E+ SG L+V+ DGS+ R+     ++ F   PFP HDD    V  KD + D   G  L
Sbjct  6    QVIEEVSGWLRVFEDGSVDRTWTGPPEVKFMAEPFPPHDDYIDGVAVKDVVADENSGSRL  65

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            RIY P    ++   LP+I  FHGGGFC+    W   ++   RL     A++V+    LAP
Sbjct  66   RIYLPERKDNSVNKLPVILHFHGGGFCISQADWFMYYTVYTRLARVANAIIVSVFLPLAP  125

Query  374  EHRLPAAMDDAFCAVKWV---AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLP+A D  F A+ W+   + Q   + WL D  DFNR F++GDSSGGN+ H +AVR  
Sbjct  126  EHRLPSACDAGFSALLWLRDLSLQQGHEPWLNDYADFNRVFLIGDSSGGNIVHQVAVR--  183

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             G   +SP+R+ G + + P F  + R+KSE E    PFL L+++D+F  L+LP G   DH
Sbjct  184  AGEENLSPMRLAGAIPIHPGFVRSYRSKSELEQEQTPFLTLDMVDKFLGLALPVGSNKDH  243

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVD-YVVFQGKQH  901
            P+  P G A+P++E + L P L  V  ++++KD    +   +K+  K+V+ ++   G  H
Sbjct  244  PITCPMGDAAPAVEELNLPPYLYCVAEKDLIKDTEMEFYEAMKKGKKDVELFINSNGVGH  303

Query  902  GFFTN------DPFSDVSTQVLQQLQHFMISK  979
             F+ N      DP +   T+ L +     ISK
Sbjct  304  SFYLNKISVEMDPVTGSETEKLFEAVAEFISK  335



>ref|XP_011034694.1| PREDICTED: probable carboxylesterase 15 [Populus euphratica]
Length=340

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 182/321 (57%), Gaps = 17/321 (5%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKD--EDINF---PFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            +VE+ SG L+++ DG + R+     ++ F   P   H++    V  +D   D   GL +R
Sbjct  7    IVEEVSGWLRIFDDGWVDRTWTGPPEVKFMAEPVLPHEEFIDGVAIRDVTIDENSGLSVR  66

Query  197  IYKPRSS----ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYR  364
            IY P+         +  LP+I  FHGGGFC+    W   +    RL     A+VV+   R
Sbjct  67   IYLPQHEPDHYTDNSDKLPLIVHFHGGGFCISQADWYMYYYIYSRLARSAPAIVVSVYLR  126

Query  365  LAPEHRLPAAMDDAFCAVKWVAA----QASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLA  532
            LAPEHRLPAA+DD F A+ W+ A    Q S ++WL +  DFNR F++GDSSGGN+ HH+A
Sbjct  127  LAPEHRLPAAIDDGFSALMWLRALAQGQKSYESWLNNHGDFNRVFLIGDSSGGNLVHHVA  186

Query  533  VRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGG  712
             R   G  ++SP+R+ G + + P F  + R+KSE E P  PFL L+++DRF +L+LP G 
Sbjct  187  AR--AGQLDLSPMRLAGGIPVHPGFVRSERSKSEMEQPESPFLTLDMVDRFLKLALPKGC  244

Query  713  TPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQG  892
            T DHP   P G A+P L+++ L P L+ V   ++++D    Y   +K+ NK+V+ ++  G
Sbjct  245  TKDHPFTCPMGQAAPPLDSLNLPPFLLCVAEADLIRDTEMEYYEAMKKANKDVELLINPG  304

Query  893  KQHGFFTNDPFSDVSTQVLQQ  955
              H F+ N    D+      Q
Sbjct  305  VGHSFYLNKIAVDMDPHTAAQ  325



>ref|XP_002304812.2| hsr203J family protein [Populus trichocarpa]
 gb|EEE79791.2| hsr203J family protein [Populus trichocarpa]
Length=339

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/325 (38%), Positives = 180/325 (55%), Gaps = 16/325 (5%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS--KDEDINF---PFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            +VE+ SG L+ + DGS+ R+     ++ F   P P H++    V  +D   D   GL +R
Sbjct  7    LVEEVSGWLRTFDDGSVDRTWTGPPEVTFMAEPVPPHEEFKEGVVVRDVTIDEKSGLRVR  66

Query  197  IYKPRSSASAAVS---LPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
            IY P+       S   LPII  FHGGGFC+    W   +    RL     A+VV+   RL
Sbjct  67   IYLPQHEPHYTDSHNKLPIIVHFHGGGFCISQADWYMYYYMYYRLARSASAIVVSVYLRL  126

Query  368  APEHRLPAAMDDAFCAVKWVAA----QASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAV  535
            APEHRLPAA+DD F A+ W+ +      S + W  +  DFN  F++GDSSGGN+ HH+A 
Sbjct  127  APEHRLPAAIDDGFSALMWLRSLGQGHDSYEPWFNNYGDFNMVFLIGDSSGGNLVHHVAA  186

Query  536  RLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGT  715
            R   G  ++SPVR+ G + + P F  +VR+KSE E P  PFL L+++DRF +L+LP G T
Sbjct  187  R--AGHVDLSPVRLAGGIPVHPGFVRSVRSKSEMEQPESPFLTLDMVDRFLKLALPKGCT  244

Query  716  PDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGK  895
             DHP   P G  +P L+++ L P L+ V   ++++D    Y   +++ NK+V+ ++  G 
Sbjct  245  KDHPFTCPVGHEAPPLDSLNLPPFLLCVAETDLIRDTEMEYYEAMRKANKDVELLINPGV  304

Query  896  QHGFFTNDPFSDVSTQVLQQLQHFM  970
             H F+ N    D+      Q    M
Sbjct  305  GHSFYLNKIAVDMDPHTAAQTTGLM  329



>gb|KFK25051.1| hypothetical protein AALP_AA8G060400 [Arabis alpina]
Length=232

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 163/233 (70%), Gaps = 13/233 (6%)
 Frame = +2

Query  20   MGSLP---HVVEDCSGILQVYSDGSIFRSKDED-INFPFPVHDDASVHWKDSLFDRTHGL  187
            MGSL     V+EDC G+LQ+ S+G++ RS+  D I    P+++  +V +KDS++ + + L
Sbjct  1    MGSLGEQLQVMEDCMGLLQLLSNGTVLRSQTIDLITQQIPLNNHKTVLFKDSIYHKPNNL  60

Query  188  YLRIYKPRSSAS---AAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPD  358
            +LR+YKP S+++    A  LP++ FFHGGGFC GSR+WP  H+ C  L + L ALVVAPD
Sbjct  61   HLRLYKPISTSNLTDTATRLPVVVFFHGGGFCFGSRSWPLFHNFCHNLASSLHALVVAPD  120

Query  359  YRLAPEHRLPAAMDDAFCAVKWV---AAQASTDAWLKD--GVDFNRAFVLGDSSGGNVAH  523
            YRLAPEHRLPAA +D+   + W+   A     D W +   GVDF R FVLGDSSGGN+AH
Sbjct  121  YRLAPEHRLPAAFEDSEAVLTWLRDEAVSGGVDHWFESGPGVDFERVFVLGDSSGGNIAH  180

Query  524  HLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDR  682
             LAVR G GS ++ PV+VRGYV++ PFFGG  RT+SE +GP E  +NL++LD+
Sbjct  181  QLAVRFGSGSIDLKPVKVRGYVLLGPFFGGEERTESE-DGPSEASINLDLLDK  232



>gb|AAF62404.1|AF212184_1 cell death associated protein [Nicotiana tabacum]
Length=335

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/331 (37%), Positives = 184/331 (56%), Gaps = 18/331 (5%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRS--KDEDINF---PFPVHD--DASVHWKDSLFDRTHGLYL  193
             V+E+ SG L+V+ DGS+ R+     ++ F   P P HD     V  KD + D   G  L
Sbjct  6    QVIEEVSGWLRVFEDGSVDRTWTGPPEVKFMAEPVPPHDYFIDGVAVKDVVADEKSGSRL  65

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            RIY P  + ++A  LP+I  FHGGGFCV    W   ++   RL    +A++V+    LAP
Sbjct  66   RIYLPERNDNSANKLPVILHFHGGGFCVSHADWFMYYTVYTRLARAAKAIIVSVFLPLAP  125

Query  374  EHRLPAAMDDAFCAVKWV---AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAA D  F A+ W+   + Q   + WL D  DFNR F++GDSSGGN+ H +AV+  
Sbjct  126  EHRLPAACDAGFAALLWLRDLSRQQGHEPWLNDYADFNRVFLIGDSSGGNIVHQVAVK--  183

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             G   +SP+R+ G + + P F  + R+KSE E    PFL L+++D+F  L+LP G   DH
Sbjct  184  AGEENLSPMRLAGAIPIHPGFVRSYRSKSELEQEQTPFLTLDMVDKFLGLALPVGSNKDH  243

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
             +  P G A+P++E +KL P L  V  ++++KD    +   +K+  K+V+  +  G  H 
Sbjct  244  QITCPMGEAAPAVEELKLPPYLYCVAEKDLIKDTEMEFYEAMKKGEKDVELFINNGVGHS  303

Query  905  FFTN------DPFSDVSTQVLQQLQHFMISK  979
            F+ N      DP +   T+ L +     I+K
Sbjct  304  FYLNKIAVRMDPVTGSETEKLCEAVAEFINK  334



>ref|XP_008346678.1| PREDICTED: probable carboxylesterase 15 [Malus domestica]
Length=336

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/319 (37%), Positives = 182/319 (57%), Gaps = 18/319 (6%)
 Frame = +2

Query  41   VEDCSGILQVYSDGSIFR--SKDEDINF---PFPVHDD--ASVHWKDSLFDRTHGLYLRI  199
            VE+ SG L+V+ DGS+ R  +   ++ F   P   HD+    V  KD + D++ G  +RI
Sbjct  9    VEEVSGWLRVFDDGSVDRRWTGPPEVQFMVEPVEAHDEFIDGVSTKDVVADKSSGXRVRI  68

Query  200  YKP-RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            Y P R   +    LPII  FHGGGFC+    W   +    +L      +V++   RLAPE
Sbjct  69   YLPERKPENNDTKLPIILHFHGGGFCISQADWYMYYQIYTKLSRSTNXIVISVYQRLAPE  128

Query  377  HRLPAAMDDAFCAVKWV--AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVG  550
            HRLPAA++D + A+ W+   AQ   +  L    D+NR F++GDSSGGN+ HH+A +   G
Sbjct  129  HRLPAAIEDGYSALLWLRSLAQGEQNEPLLSHADYNRVFLIGDSSGGNIVHHVAAQ--SG  186

Query  551  SPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPL  730
            + ++SP+R+ G + + P F    R+KS+ E P  PFL L+++D+F  L+LP G T DHP+
Sbjct  187  TADLSPLRLAGXIPIHPGFVRAERSKSQLEQPQSPFLTLDMVDKFLGLALPVGSTKDHPI  246

Query  731  ANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFF  910
              P GP +  L  +KL P L+ +  ++++ D    Y   +K+ NK+V+ ++ +G  H F+
Sbjct  247  TCPIGPEAQPLGNLKLPPFLLCIASRDLIIDTQMEYFEAMKKANKDVELLINEGVTHSFY  306

Query  911  TN------DPFSDVSTQVL  949
             N      DP +D  T+ L
Sbjct  307  LNKIAVDTDPETDAETERL  325



>dbj|BAE16319.1| hsr203J [Solanum tuberosum]
Length=335

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 181/326 (56%), Gaps = 18/326 (6%)
 Frame = +2

Query  50   CSGILQVYSDGSIFRS--KDEDINF---PFPVHDD--ASVHWKDSLFDRTHGLYLRIYKP  208
             SG L V+ DGS+ R+     ++ F   P P HDD    V  KD +     G   R+Y P
Sbjct  11   VSGWLTVFDDGSVDRTWTGPPEVKFMAEPVPPHDDFIDGVAVKDVVAGENSGSRFRVYLP  70

Query  209  RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLP  388
              + S+   LP+I  FHGGGFC+    W   ++ C RL     A++V+    LAPEHRLP
Sbjct  71   ERNDSSVDKLPVILHFHGGGFCISQADWYMYYAVCTRLARVANAIIVSVFLPLAPEHRLP  130

Query  389  AAMDDAFCAVKW---VAAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPE  559
            AA D +F  + W   V+ +   + WL +  DFNR F++GDSSGGN+ H +A R   G  +
Sbjct  131  AACDASFAGLLWLRDVSRKQDHEPWLNEYADFNRVFLIGDSSGGNIVHQVAAR--AGEED  188

Query  560  MSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANP  739
            +SP+R+ G + + P F  + R+KSE E    PFL L+++D+F  L+LP G T DHP+  P
Sbjct  189  LSPMRLAGAIPIHPGFMRSQRSKSELEQEQTPFLTLDMVDKFMELALPIGSTKDHPITCP  248

Query  740  FGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTN-  916
             G A+P++E +KL P L  V  ++++KD    +   LK+  K+V+ ++  G  H F+ N 
Sbjct  249  MGDAAPAVEELKLPPYLYCVAEKDLIKDTEMEFYEALKKGEKDVELLINNGVGHSFYLNK  308

Query  917  -----DPFSDVSTQVLQQLQHFMISK  979
                 DP +  +T+ L +     I+K
Sbjct  309  IAVDMDPVTGSATEKLFEAIAEFINK  334



>ref|XP_008231718.1| PREDICTED: probable carboxylesterase 15 [Prunus mume]
Length=333

 Score =   213 bits (542),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/321 (36%), Positives = 180/321 (56%), Gaps = 14/321 (4%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS-----KDEDINFPFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            VV + SG L+V+ DG++ R+     + E +  P P HDD    V  +D   ++   L LR
Sbjct  7    VVNEVSGWLRVFDDGTVDRTWTGPPQVEFMTEPVPPHDDFIDGVATRDVFVNKN--LRLR  64

Query  197  IYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            IY P ++      LPII   HGGGFC+    W   +    RL    +A+ V+   RLAPE
Sbjct  65   IYLPETNPEDESKLPIILHLHGGGFCISQADWYMYYHMYTRLARSAKAICVSVYLRLAPE  124

Query  377  HRLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            HRLPA ++D F A+ W+ + A   S + WL +  DFNR F++GDSSGGN+ H +A R   
Sbjct  125  HRLPAPVNDGFSALLWLRSLAKGESYEPWLINHGDFNRVFLIGDSSGGNLVHEVAAR--A  182

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            G  ++SP+R+ G + + P F   VR++SE E P  P L ++++D+F  L+LP G T DHP
Sbjct  183  GKADLSPLRLAGGIPIHPGFVRAVRSRSELEQPESPMLTIDMVDKFLSLALPVGSTKDHP  242

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            +  P G  +P L+++KL P L+ +  ++++ D    Y   +K+  KEV+ ++  G  H F
Sbjct  243  ITCPMGYGAPDLDSLKLPPFLLCIAERDMIIDTEMEYYEAMKKARKEVELLISPGMSHSF  302

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
            + N    D+  Q   Q +  +
Sbjct  303  YLNKIAVDMDPQTAAQTEGLI  323



>ref|XP_006472129.1| PREDICTED: probable carboxylesterase 15-like [Citrus sinensis]
Length=189

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 136/188 (72%), Gaps = 9/188 (5%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRI  199
            MGSLP VVE+C G+L++YSDGSI RS +  I+F  P  +D S+ +KD +F+    L LR+
Sbjct  1    MGSLPQVVEECFGLLKLYSDGSISRSPN--ISFDVPFINDNSILYKDLIFNENIDLRLRL  58

Query  200  YKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEH  379
            YKP S  +++  LPI+F+FHGGGFC GSRT+PN H+ C+RL + LQA V+ PDYRL PEH
Sbjct  59   YKPTSIVNSSTKLPIVFYFHGGGFCFGSRTFPNNHNICVRLASILQAAVIEPDYRLGPEH  118

Query  380  RLPAAMDDAFCAVKWVAAQA-----STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            RLPAA++DA CA+KW+  QA       D WL + VDF+R FVLG SSGGN+AHHLAVR  
Sbjct  119  RLPAALEDACCALKWLQGQAIMHANVMDTWLGE-VDFDRVFVLGYSSGGNLAHHLAVRFN  177

Query  545  VGSPEMSP  568
              S  +SP
Sbjct  178  CFS-TLSP  184



>ref|XP_004499770.1| PREDICTED: probable carboxylesterase 15-like [Cicer arietinum]
Length=338

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 121/321 (38%), Positives = 183/321 (57%), Gaps = 15/321 (5%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKD--EDINF---PFPVHDD--ASVHWKDSLFDRTH-GLY-  190
            VV++ SG  ++Y+DGS+ RS     ++NF   P   H     +V  +D     TH GL  
Sbjct  7    VVDEVSGWFRIYNDGSVERSWTGPPEVNFMLEPVSPHTQFIEAVATRDITTTTTHDGLIH  66

Query  191  -LRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRL  367
              RIY P  +      LPI+  FHGGGFC+    W   +    R     +++ V+P  R 
Sbjct  67   RARIYLPEKTPKDNHKLPILIHFHGGGFCISEPDWFMYYHVYTRFVRSTRSICVSPFLRR  126

Query  368  APEHRLPAAMDDAFCAVKWVAAQAS---TDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVR  538
            APEHRLPAA+DD F  ++W+ + A    +D WL++  DF+R F++GDSSGGN+ H +A R
Sbjct  127  APEHRLPAAIDDGFTTLQWLQSVARGDVSDPWLEEHGDFSRVFLIGDSSGGNLVHEVAAR  186

Query  539  LGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTP  718
              VGS ++SP+ + G + + P F  + R+KSE E P  PFL L+++D+F R++LP G   
Sbjct  187  --VGSIDLSPIWLAGAIPIHPGFVRSYRSKSELEMPQSPFLTLDMMDKFLRMALPIGSNK  244

Query  719  DHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQ  898
            DHP+  P G A+P L+ +KL P L+ V  +++L D    +   +K+ NK+VD  V +G  
Sbjct  245  DHPITCPMGEAAPPLDGLKLPPFLLCVAEKDLLNDTQMEFYEAMKKANKDVDLFVSKGMT  304

Query  899  HGFFTNDPFSDVSTQVLQQLQ  961
            H F+ N    D+   V  ++ 
Sbjct  305  HSFYLNKMAVDLDHNVNAEMN  325



>ref|XP_009788938.1| PREDICTED: probable carboxylesterase 15 [Nicotiana sylvestris]
 emb|CAA54393.1| HSR203J [Nicotiana tabacum]
Length=335

 Score =   212 bits (540),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 183/331 (55%), Gaps = 18/331 (5%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKD--EDINF---PFPVHD--DASVHWKDSLFDRTHGLYL  193
             V+E+ SG L+V+ DGS+ R+     ++ F   P P HD     V  KD + D   G  L
Sbjct  6    QVIEEVSGWLRVFEDGSVDRTWTGPPEVKFMAEPVPPHDYFIDGVAVKDVVADEKSGSRL  65

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            RIY P  + ++A  LP+I  F GGGFCV    W   ++   RL    +A++V+    LAP
Sbjct  66   RIYLPERNDNSASKLPVILHFQGGGFCVSHADWFMYYTVYTRLARAAKAIIVSVFLPLAP  125

Query  374  EHRLPAAMDDAFCAVKWV---AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAA D  F A+ W+   + Q   + WL D  DFNR F++GDSSGGN+ H +AV+  
Sbjct  126  EHRLPAACDAGFAALLWLRDLSRQQGHEPWLNDYADFNRVFLIGDSSGGNIVHQVAVK--  183

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             G   +SP+R+ G + + P F  + R+KSE E    PFL L+++D+F  L+LP G   DH
Sbjct  184  AGEENLSPMRLAGAIPIHPGFVRSYRSKSELEQEQTPFLTLDMVDKFLGLALPVGSNKDH  243

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
             +  P G A+P++E +KL P L  V  ++++KD    +   +K+  K+V+  +  G  H 
Sbjct  244  QITCPMGEAAPAVEELKLPPYLYCVAEKDLIKDTEMEFYEAMKKGEKDVELFINNGVGHS  303

Query  905  FFTN------DPFSDVSTQVLQQLQHFMISK  979
            F+ N      DP +   T+ L +     I+K
Sbjct  304  FYLNKIAVRMDPVTGSETEKLYEAVAEFINK  334



>ref|XP_009770110.1| PREDICTED: probable carboxylesterase 17 [Nicotiana sylvestris]
Length=335

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 178/327 (54%), Gaps = 12/327 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRS-----KDEDINFPFPVHDD--ASVHWKDSLFDRT  178
            M     V+E+ SG L V+ DGS+ R+     +D+ +    P HDD    V  KD + D  
Sbjct  1    MAHEKQVIEEVSGWLTVFEDGSVDRTLTGPPEDKFMAEAVPPHDDFIDGVAVKDVVADEN  60

Query  179  HGLYLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPD  358
             G  LRIY P    ++   LP+I  FHGGGFC+    W   ++   RL     A++V+  
Sbjct  61   SGSRLRIYLPERKDNSVNKLPVILHFHGGGFCISQADWFMYYTVYTRLARVANAIIVSVF  120

Query  359  YRLAPEHRLPAAMDDAFCAVKWV---AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHL  529
              LAPEHRLPAA D  F A+ W+   + Q   + WL +  DFNR F++GD+SGGN+ H +
Sbjct  121  LPLAPEHRLPAACDAGFAALLWLRELSRQQGHEPWLNNYADFNRVFLIGDASGGNIVHQV  180

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            AVR   G   +SP+R+ G + +   F  + R+KSE E    PFL L+++D+F  L+LP G
Sbjct  181  AVR--AGEENLSPLRLAGAIPIHTGFVRSYRSKSELEQEQTPFLTLDMVDKFLGLALPVG  238

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQ  889
               DHP+  P G A+P++E +KL P L  V  ++++KD    +   +++  K+++  +  
Sbjct  239  SNKDHPITCPMGEAAPAVEELKLPPYLYCVAEKDLMKDTEMEFYEAMEKGEKDIELFINN  298

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            G  H F+ N    ++      + + F+
Sbjct  299  GVGHSFYLNKTAVEIDLVTASETEKFL  325



>ref|XP_007218280.1| hypothetical protein PRUPE_ppa008373mg [Prunus persica]
 gb|EMJ19479.1| hypothetical protein PRUPE_ppa008373mg [Prunus persica]
Length=335

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/331 (35%), Positives = 182/331 (55%), Gaps = 13/331 (4%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKD--EDINF---PFPVHDD--ASVHWKDSLFDRT  178
            M S   ++ + SG L+V+ DGS  R+     ++ F   P   H++    V  +D + D+ 
Sbjct  1    MISQKKLLHEVSGWLKVFEDGSTDRTWTGPSEVKFMVEPVQPHEEFINGVATRDVVVDKD  60

Query  179  HGLYLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPD  358
             GL LRIY P       + LPII  FHGGGFC+    W   +     L    +A+ V+  
Sbjct  61   SGLQLRIYLPEIKPRDEIKLPIILHFHGGGFCISRADWYMYYHMYTNLARSAKAIFVSVY  120

Query  359  YRLAPEHRLPAAMDDAFCAVKWVAAQASTDA---WLKDGVDFNRAFVLGDSSGGNVAHHL  529
             RLAPEHRLPAA+DD + A+ W+ + A  D    WL D  DFNR  +LGDS+GGN+ H L
Sbjct  121  LRLAPEHRLPAAIDDGWAALLWLQSLAQGDLYEPWLVDHADFNRVILLGDSTGGNIVHEL  180

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            A R   G  +++ +R+ G +++ P F  + R++SE E P  P L L+++D+F  L+LP G
Sbjct  181  AAR--AGKVDLNHMRLTGGILIHPGFVRSTRSRSELEQPESPMLTLDMVDKFLSLALPMG  238

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQ  889
             + DHP+  P G  +P L+ +KL P L+ +   +++ D    Y   +K+  K+V+ ++  
Sbjct  239  SSKDHPITCPMGSGAPDLDTLKLPPFLLCIAEMDMIVDTEIEYYEAMKKAEKDVELLISP  298

Query  890  GKQHGFFTNDPFSDVSTQVLQQLQHFMISKV  982
            G  H F+ N    ++  Q   Q +  +IS++
Sbjct  299  GVAHSFYLNKIAIEMDPQTASQTE-ILISRI  328



>emb|CBI39096.3| unnamed protein product [Vitis vinifera]
Length=155

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = +2

Query  515  VAHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRL  694
            +AH +AV++G G  E+ P+RVRG+V+MAPFFGGTVRT+SE EGP +   NLE+ DRFWRL
Sbjct  1    MAHQVAVQMGAGLLELEPIRVRGFVLMAPFFGGTVRTRSE-EGPSDTMFNLELFDRFWRL  59

Query  695  SLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVD  874
            S+P GGT DHPL NPFGP SPSLE +KL+PILV+VGG E+LKDR E YA +LK+  K ++
Sbjct  60   SIPEGGTADHPLVNPFGPCSPSLEPLKLNPILVVVGGNELLKDRAEQYAKRLKEMGKGIE  119

Query  875  YVVFQGKQHGFFTNDPFSDVSTQVLQQLQHFM  970
            YV F+G+ HGFFTNDP+SD +T VL  ++ F+
Sbjct  120  YVEFKGEGHGFFTNDPYSDAATAVLPVIKRFI  151



>ref|XP_007218321.1| hypothetical protein PRUPE_ppa008412mg [Prunus persica]
 gb|EMJ19520.1| hypothetical protein PRUPE_ppa008412mg [Prunus persica]
Length=333

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/321 (36%), Positives = 180/321 (56%), Gaps = 14/321 (4%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS-----KDEDINFPFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            VV + SG L+V+ DGS+ R+     + + +  P P HD+    V  +D   ++   L LR
Sbjct  7    VVNEVSGWLRVFDDGSVDRTWTGPPQVQFMTEPVPPHDEFIDGVATRDVFVNKN--LRLR  64

Query  197  IYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPE  376
            IY P ++      LPII   HGGGFC+    W   +    RL    +A+ V+   RLAPE
Sbjct  65   IYLPETNPEDETKLPIILHLHGGGFCISQADWYMYYHMYTRLARSAKAICVSVYLRLAPE  124

Query  377  HRLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGV  547
            HRLPA ++D F A+ W+ + A   S + WL +  DFNR F++GDSSGGN+ H +A R   
Sbjct  125  HRLPAPVNDGFSALLWLRSLAQGESYEPWLINHGDFNRVFLIGDSSGGNLVHEVAAR--A  182

Query  548  GSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHP  727
            G  ++SP+R+ G + + P F   VR++SE E P  P L ++++D+F  L+LP G T DHP
Sbjct  183  GKADLSPLRLAGGIPIHPGFVRAVRSRSELEQPESPMLTIDMVDKFLSLALPVGSTKDHP  242

Query  728  LANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGF  907
            +  P G  +P L+++KL P L+ +  ++++ D    Y   +K+  KEV+ ++  G  H F
Sbjct  243  ITCPMGYGAPDLDSLKLPPFLLCIAERDMIIDTEMEYYEAMKKAKKEVELLISPGMSHSF  302

Query  908  FTNDPFSDVSTQVLQQLQHFM  970
            + N    D+  Q   Q +  +
Sbjct  303  YLNKIAVDMDPQTAAQTEGLI  323



>ref|XP_006432380.1| hypothetical protein CICLE_v10001722mg [Citrus clementina]
 gb|ESR45620.1| hypothetical protein CICLE_v10001722mg [Citrus clementina]
Length=344

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/324 (38%), Positives = 173/324 (53%), Gaps = 20/324 (6%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS-----KDEDINFPFPVHDDA--SVHWKDSLFDRTHGLYLR  196
            +V++ SG L+VYSDGS+ R+     + + ++ P P H D   SV   D   ++  GL +R
Sbjct  8    IVDEVSGWLRVYSDGSVDRTWTGPPQVKFLSEPVPPHSDLIDSVATHDVTINKESGLRVR  67

Query  197  IYKPRS-------SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAP  355
            IY P                LPII  FHGGGFCV    W   +    +L   + A+ V+ 
Sbjct  68   IYSPEEIKKLNGDDCKNKKKLPIILHFHGGGFCVSQADWYMYYHVYTKLAKSVPAICVSV  127

Query  356  DYRLAPEHRLPAAMDDAFCAVKWV----AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAH  523
              R APEHRLPAA DD F A+ W+     AQA  + WL + VDF R F++GDSSGGNV H
Sbjct  128  YLRRAPEHRLPAAFDDGFEALLWLRSLSLAQARENNWLTEHVDFQRVFLIGDSSGGNVVH  187

Query  524  HLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLP  703
             +A R   G  ++SP+RV G + + P F    R+KSE E P  P L L+++D+F   +LP
Sbjct  188  EVAAR--AGQADVSPLRVAGAIPIHPGFLRQERSKSELENPQSPLLTLDMVDKFLSFALP  245

Query  704  FGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVV  883
                  HP   P GPA P ++ +KL P L+ V G +++KD    Y   +K+  K+V+ +V
Sbjct  246  LNSDKGHPYTCPMGPAGPPIDGLKLPPFLLCVAGNDLIKDTEMEYYEAMKKAGKDVELLV  305

Query  884  FQGKQHGFFTNDPFSDVSTQVLQQ  955
              G  H F+ +    D+      Q
Sbjct  306  SPGMGHSFYLDKIAVDMDPNTAAQ  329



>ref|XP_004307204.1| PREDICTED: probable carboxylesterase 17-like [Fragaria vesca 
subsp. vesca]
Length=337

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/323 (36%), Positives = 182/323 (56%), Gaps = 14/323 (4%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS-----KDEDINFPFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            +V++ SG L++Y+DGS+ R+     + + +  P P HD+    V  KD + D   GL +R
Sbjct  7    LVDEVSGWLRLYNDGSVDRTWTGPPQVKFMAEPVPPHDEFINGVATKDVMVDEMSGLRVR  66

Query  197  IY--KPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLA  370
            IY  + +   +    LP+I  FHGGGFC+    W   +     L     A+ V+   RLA
Sbjct  67   IYVQERKPEDNDETKLPVILHFHGGGFCISQADWFMYYHMYASLALAANAICVSVYLRLA  126

Query  371  PEHRLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRL  541
            PEHRLPA ++D   A+ W+ + A   S ++WL D  DF+R F++GDSSGGN+ H +A R 
Sbjct  127  PEHRLPAPINDGCSALLWLRSLARAESYESWLSDDADFSRVFLIGDSSGGNIVHEVAAR-  185

Query  542  GVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPD  721
              G  ++SP+++ G + + P F   VR++SE E P  PFL L+++D+F  LSLP G T D
Sbjct  186  -AGRLDLSPLKLAGAIPIHPGFVRAVRSRSELEQPESPFLTLDMVDKFLSLSLPVGSTKD  244

Query  722  HPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQH  901
            HP+  P G  +P L+ +KL P L+ V  ++++ D    Y   +K+  K+V+ ++  G  H
Sbjct  245  HPITCPMGSTAPDLDTLKLPPFLLCVAEKDMIVDTEMEYFEAMKKAKKDVELLISPGMSH  304

Query  902  GFFTNDPFSDVSTQVLQQLQHFM  970
             F+ N    D+  Q   Q +  +
Sbjct  305  SFYLNKIAIDMDPQTGAQTESLI  327



>ref|XP_008245519.1| PREDICTED: probable carboxylesterase 15 [Prunus mume]
Length=335

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/326 (36%), Positives = 179/326 (55%), Gaps = 18/326 (6%)
 Frame = +2

Query  20   MGSLPHVVEDCSGILQVYSDGSIFRSKD--EDINF---PFPVHDD--ASVHWKDSLFDRT  178
            M S   ++ + SG L+V+ DGS  R+     ++ F   P   H++    V  +D + D+ 
Sbjct  1    MISQKKLLHEVSGWLKVFEDGSTDRTWTGPSEVQFMVEPVQPHEEFINGVATRDVVVDKD  60

Query  179  HGLYLRIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPD  358
             GL LRIY P         LPII  FHGGGFC+    W   +     L    +A+ V+  
Sbjct  61   SGLQLRIYLPEIKPRDETKLPIILHFHGGGFCISRADWYMYYHMYTNLARSAKAIFVSVY  120

Query  359  YRLAPEHRLPAAMDDAFCAVKWVAAQASTDA---WLKDGVDFNRAFVLGDSSGGNVAHHL  529
             RLAPEHRLPAA+DD + A+ W+ + A  D+   WL D  DFNR  +LGDS+GGN+ H L
Sbjct  121  LRLAPEHRLPAAIDDGWSALFWLQSLAQGDSYEPWLVDHADFNRVILLGDSTGGNIVHEL  180

Query  530  AVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFG  709
            A R   G  +++ +R+ G +++ P F  + R++SE + P  P L L+++D+F  L+LP G
Sbjct  181  AAR--AGKVDLNHIRLTGGILIHPGFVRSTRSRSELDQPESPMLTLDMVDKFLSLALPVG  238

Query  710  GTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQ  889
             T DHP+  P G  +P L+ +KL P L+ V   +++ D    Y   +K+  K+V+ ++  
Sbjct  239  STKDHPITCPMGSGAPDLDTLKLPPFLLCVAEMDMIVDTEIEYYEAMKKAEKDVELLISP  298

Query  890  GKQHGFFTN------DPFSDVSTQVL  949
            G  H F+ N      DP +   T++L
Sbjct  299  GVAHSFYLNKIAIEMDPHTASQTEIL  324



>dbj|BAC15624.1| hsr203J [Nicotiana tabacum]
Length=335

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 114/322 (35%), Positives = 178/322 (55%), Gaps = 12/322 (4%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRS-----KDEDINFPFPVHDD--ASVHWKDSLFDRTHGLYL  193
             V+E+ SG L V+ DGS+ R+     +D+ +    P HDD    V  KD + D   G  L
Sbjct  6    QVIEEVSGWLTVFEDGSVDRTLTGPPEDKFMAEAVPPHDDFIDGVADKDVVADENSGSRL  65

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            RIY P  + ++   LP+I  FHGGGFC+    W   ++   RL     A++V+    LAP
Sbjct  66   RIYLPERNDNSVNKLPVILHFHGGGFCISQADWFMYYTVYTRLARVANAIIVSVFLPLAP  125

Query  374  EHRLPAAMDDAFCAVKWV---AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAA D  F A+ W+   + Q   + WL +  DFNR F++GD+SGGN+ H +AVR  
Sbjct  126  EHRLPAACDAGFAALLWLRELSRQQGHEPWLNNYADFNRVFLIGDASGGNIVHQVAVR--  183

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             G   +SP+R+ G + +   F  + R+KSE E    PFL L+++D+F  L+LP G   DH
Sbjct  184  AGEENLSPLRLAGAIPIHTGFVRSYRSKSELEQEQTPFLTLDMVDKFLGLALPVGSNKDH  243

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            P+  P G A+P++E +KL P L  V  ++++KD    +   +++  K+++  +  G  H 
Sbjct  244  PITCPMGEAAPAVEELKLPPYLNCVAEKDLMKDTEMEFYEAMEKGEKDIELFINNGVGHS  303

Query  905  FFTNDPFSDVSTQVLQQLQHFM  970
            F+ N    ++      + + F+
Sbjct  304  FYLNKTAVEIDPVTASETEKFL  325



>ref|XP_009798409.1| PREDICTED: probable carboxylesterase 15 [Nicotiana sylvestris]
Length=368

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 121/323 (37%), Positives = 181/323 (56%), Gaps = 18/323 (6%)
 Frame = +2

Query  35   HVVEDCSGILQVYSDGSIFRSKDE--DINF---PFPVHDD--ASVHWKDSLFDRTHGLYL  193
             V+E+ SG L+V+ DGS+ R+     ++ F   P P HDD    V  KD + D   G  L
Sbjct  6    QVIEEVSGWLRVFEDGSVDRTWTGPLEVKFMAEPVPPHDDFIDGVAVKDVVADEKSGSRL  65

Query  194  RIYKPRSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAP  373
            RIY P  + ++   LP+IF FHGGGFC+    W   ++   RL     A++V+    LAP
Sbjct  66   RIYLPERNDNSVNKLPVIFHFHGGGFCISQADWFMYYTVYTRLVRVANAIIVSVFIPLAP  125

Query  374  EHRLPAAMDDAFCAVKWV---AAQASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLG  544
            EHRLPAA D  F A+ W+   + +   + WL D  DFNR F++GDSSGGN+ H +AV+  
Sbjct  126  EHRLPAACDAGFDALLWLRDLSRKQGHEPWLNDHADFNRVFLIGDSSGGNIVHQVAVK--  183

Query  545  VGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDH  724
             G   +SP+R+ G + + P F  + R+KSE E    PFLNL+++D F  L+LP G   DH
Sbjct  184  SGEVNLSPMRLAGALPIHPGFVRSYRSKSELEQEQTPFLNLDMVDEFLGLALPVGSNKDH  243

Query  725  PLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHG  904
            P+  P G A+P+++ + L P L  V  ++++KD    +   +K+  K+V+  +  G  H 
Sbjct  244  PITCPMGDAAPAVKELNLPPYLYCVAEKDLIKDTEMEFYEAMKKGEKDVELFINNGVGHS  303

Query  905  FFTN------DPFSDVSTQVLQQ  955
            F+ N      DP +   T+ L +
Sbjct  304  FYLNKIAVKMDPVTGSETEKLLE  326



>gb|AAD04946.2| PrMC3 [Pinus radiata]
Length=319

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 115/312 (37%), Positives = 172/312 (55%), Gaps = 5/312 (2%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRSKDEDINFPFPVHDDASVHWKDSLFDRTHGLYLRIYKPRSS  217
            ++ED  G +QVY DG + R  D  +    P         KD + D   G+  R++ P + 
Sbjct  7    LLEDVPGFIQVYEDGFVARF-DHRLTPASPQVASDGARSKDVVIDPVKGISARLFLP-AE  64

Query  218  ASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAPDYRLAPEHRLPAAM  397
               A  LP++F+FHGGGFC+G+  W   H     L A  +ALV++ DYRLAPEHRLPAA 
Sbjct  65   LPLAQKLPLLFYFHGGGFCIGTTAWEGYHLFLSLLAATTRALVISVDYRLAPEHRLPAAY  124

Query  398  DDAFCAVKWVAA-QASTDAWLKDGVDFNRAFVLGDSSGGNVAHHLAVRLGVGSPEMSPVR  574
            DD F AV+WVA+     + WL    D+ R F+ G+S+GGN+AH +  R      ++ P++
Sbjct  125  DDCFDAVEWVASGGGKAEPWLDAHADYGRCFLAGESAGGNIAHVVGSR--TADQDLGPLK  182

Query  575  VRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLSLPFGGTPDHPLANPFGPAS  754
            +RG +++ P+FG   R + E     +    LE+ D FWRL+LP G   D+P  NP GP S
Sbjct  183  IRGLIVIHPYFGSEERIECEKVAAGDDAAALELNDLFWRLALPPGSDRDYPTCNPRGPRS  242

Query  755  PSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDYVVFQGKQHGFFTNDPFSDV  934
              L  V L P+LV V G ++LK R   Y   L+   KE + +  +G+ H +    P S+ 
Sbjct  243  ADLRKVPLPPVLVTVAGLDLLKTRGLLYYELLQSCGKEAELMEAEGEIHAYHVFHPRSEA  302

Query  935  STQVLQQLQHFM  970
            +  + +++  F+
Sbjct  303  TRLLQERMSQFI  314



>ref|XP_006494564.1| PREDICTED: probable carboxylesterase 15-like [Citrus sinensis]
 gb|KDO42208.1| hypothetical protein CISIN_1g019097mg [Citrus sinensis]
Length=346

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/338 (37%), Positives = 179/338 (53%), Gaps = 29/338 (9%)
 Frame = +2

Query  38   VVEDCSGILQVYSDGSIFRS-----KDEDINFPFPVHDD--ASVHWKDSLFDRTHGLYLR  196
            +V++ SG L+VYSDGS+ R+     + + ++ P P H D   SV   D   ++  GL +R
Sbjct  8    IVDEVSGWLRVYSDGSVDRTWTGPPEVKFLSEPVPPHSDFIDSVATHDVTINKESGLRVR  67

Query  197  IYKPRS-------SASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQALVVAP  355
            IY P                LPII  FHGGGFCV    W   +    +L   + A+ V+ 
Sbjct  68   IYSPEEIKKLNGDDCKNKKKLPIILHFHGGGFCVSQADWYMYYHVYTKLAKSVPAICVSV  127

Query  356  DYRLAPEHRLPAAMDDAFCAVKWV------AAQASTDAWLKDGVDFNRAFVLGDSSGGNV  517
              R APEHRLPAA DD F A+ W+       AQA  + WL + VDF R F++GDSSGGNV
Sbjct  128  YLRRAPEHRLPAAFDDGFEALLWLRSLSLAQAQARENNWLTEHVDFQRVFLIGDSSGGNV  187

Query  518  AHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWRLS  697
             H +A R   G  ++SP+RV G + + P F    R+KSE E P  P L L+++D+F   +
Sbjct  188  VHEVAAR--AGDADLSPLRVAGAIPIHPGFLRQERSKSELENPQSPLLTLDMVDKFLSFA  245

Query  698  LPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEVDY  877
            LP      HP   P GPA+  ++ +KL P L+ V G +++KD    Y   +K+  K+V+ 
Sbjct  246  LPLNSDKGHPYTCPMGPAASPIDGLKLPPFLLCVAGNDLIKDTEMEYYEAMKKAGKDVEL  305

Query  878  VVFQGKQHGFFTN------DPFSDVST-QVLQQLQHFM  970
            +V  G  H F+ +      DP +   T  + Q +  FM
Sbjct  306  LVNPGMGHSFYLDKIAVDMDPNTAAQTCSLFQGIAEFM  343



>ref|XP_002525545.1| catalytic, putative [Ricinus communis]
 gb|EEF36804.1| catalytic, putative [Ricinus communis]
Length=337

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/334 (36%), Positives = 185/334 (55%), Gaps = 26/334 (8%)
 Frame = +2

Query  8    REREMGSLPHVVEDCSGILQVYSDGSIFRS-----KDEDINFPFPVHDD--ASVHWKDSL  166
            RER++      V++ SG L++Y DGS+ R+     + + ++ P P HD+    V  KD  
Sbjct  3    RERKL------VDEVSGWLRLYDDGSVDRTWTGPPQVKFMSEPVPAHDNFIDGVAVKDLT  56

Query  167  FDRTHGLYLRIYKP--RSSASAAVSLPIIFFFHGGGFCVGSRTWPNCHSCCLRLCAGLQA  340
             D   GL +RIY P  ++       LPII  FHGGGFC+    W   ++   RL     A
Sbjct  57   IDSESGLRVRIYLPENKNQKQNYNKLPIIIHFHGGGFCISQADWYMYYNIYTRLARSANA  116

Query  341  LVVAPDYRLAPEHRLPAAMDDAFCAVKWVAAQA---STDAWLKDGVDFNRAFVLGDSSGG  511
            + V+   RLAPEHRLPAA+DD F  + W+ + A   S + W+ D  DF R F++GDSSG 
Sbjct  117  ICVSVYLRLAPEHRLPAAVDDGFSTLLWLRSLAKGESYEPWVNDYGDFTRVFLIGDSSGA  176

Query  512  NVAHHLAVRLGVGSPEMSPVRVRGYVMMAPFFGGTVRTKSEAEGPPEPFLNLEILDRFWR  691
            N+ H ++ R   G  +++PV + G + + P F  + R+KSE E P  PFL L+++D+F  
Sbjct  177  NLVHEVSSR--AGRVDLTPVILAGGIPIHPGFVRSERSKSELEQPESPFLTLDMVDKFLG  234

Query  692  LSLPFGGTPDHPLANPFGPASPSLEAVKLDPILVMVGGQEVLKDRVENYAMKLKQQNKEV  871
             +LP G T DHP+  P G  +P LE + L P L+ V  +++++D    Y  ++K+ NK+V
Sbjct  235  FALPVGCTKDHPITCPMGSGAPPLEGLNLPPFLLCVAEKDLIRDTEMEYYEEMKKANKDV  294

Query  872  DYVVFQGKQHGFFTN------DPFSDVSTQVLQQ  955
            + ++  G  H F+ N      DP +   T  L +
Sbjct  295  ELLINLGMGHSFYLNKIALDMDPLTAAETNNLIE  328



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3500367830012