BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c39683_g1_i1 len=242 path=[220:0-241]

Length=242
                                                                      Score     E

ref|XP_008657613.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    2e-21   
ref|XP_010667127.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  95.1    1e-20   
gb|EEE63476.1|  hypothetical protein OsJ_18290                        94.0    3e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010694608.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  90.5    9e-20   
gb|ABN05718.1|  FAR1; Zinc finger, SWIM-type                          91.7    3e-19   Medicago truncatula
ref|XP_002467387.1|  hypothetical protein SORBIDRAFT_01g026910        90.1    6e-19   Sorghum bicolor [broomcorn]
ref|XP_009775261.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  90.5    7e-19   
ref|XP_002444099.1|  hypothetical protein SORBIDRAFT_07g007695        87.4    7e-19   Sorghum bicolor [broomcorn]
ref|XP_010666566.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  90.1    1e-18   
gb|EYU43726.1|  hypothetical protein MIMGU_mgv1a0034692mg             87.4    1e-18   
ref|XP_009631560.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  89.7    1e-18   
ref|XP_010670287.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  87.4    1e-18   
ref|XP_003545054.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  89.4    2e-18   
ref|XP_009631561.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  89.0    2e-18   
ref|XP_007142582.1|  hypothetical protein PHAVU_008G293000g           88.6    3e-18   
ref|XP_010677175.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  87.8    3e-18   
ref|XP_010668319.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  87.8    4e-18   
ref|XP_008679530.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  86.3    5e-18   
gb|KDP24914.1|  hypothetical protein JCGZ_24292                       87.8    6e-18   
ref|XP_010678062.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  84.7    9e-18   
ref|XP_008242120.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  87.4    9e-18   
ref|XP_007203789.1|  hypothetical protein PRUPE_ppa001606mg           87.0    1e-17   
gb|EYU36991.1|  hypothetical protein MIMGU_mgv1a0188031mg             86.7    1e-17   
gb|EEE69818.1|  hypothetical protein OsJ_29559                        86.7    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063309.1|  Os09g0446400                                     86.3    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004967151.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  86.3    1e-17   
gb|AAV31356.1|  hypothetical protein                                  87.0    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010266300.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  86.7    2e-17   
gb|EEC74573.1|  hypothetical protein OsI_10136                        86.7    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010682235.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  83.6    2e-17   
gb|EEE63447.1|  hypothetical protein OsJ_18260                        86.3    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010678296.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  84.0    2e-17   
gb|AAS79743.1|  putative Mutator-like transposase                     86.7    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456061.1|  hypothetical protein SORBIDRAFT_03g029670        85.9    2e-17   Sorghum bicolor [broomcorn]
ref|XP_010675531.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  85.9    2e-17   
ref|XP_010238888.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  86.3    3e-17   
ref|XP_010692636.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  83.6    3e-17   
gb|EAY74255.1|  hypothetical protein OsI_02146                        83.2    3e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_002444124.1|  hypothetical protein SORBIDRAFT_07g008830        83.2    3e-17   Sorghum bicolor [broomcorn]
ref|XP_010266298.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  85.5    4e-17   
ref|XP_002446625.1|  hypothetical protein SORBIDRAFT_06g019085        83.2    4e-17   Sorghum bicolor [broomcorn]
ref|XP_010678162.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  83.6    5e-17   
ref|XP_002443950.1|  hypothetical protein SORBIDRAFT_07g004960        83.6    5e-17   Sorghum bicolor [broomcorn]
ref|XP_002444085.1|  hypothetical protein SORBIDRAFT_07g007480        82.0    6e-17   Sorghum bicolor [broomcorn]
gb|KHN32934.1|  Protein FAR1-RELATED SEQUENCE 5                       84.7    7e-17   
ref|XP_002453665.1|  hypothetical protein SORBIDRAFT_04g010080        84.3    7e-17   Sorghum bicolor [broomcorn]
ref|XP_003517928.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  84.7    7e-17   
gb|KHN46858.1|  Protein FAR1-RELATED SEQUENCE 5                       84.7    8e-17   
ref|XP_006384877.1|  hypothetical protein POPTR_0004s21880g           84.7    8e-17   
ref|XP_010649323.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  84.3    9e-17   
ref|XP_011040842.1|  PREDICTED: LOW QUALITY PROTEIN: protein FAR1...  84.3    9e-17   
ref|XP_010238967.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  84.0    1e-16   
ref|XP_008654819.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  84.0    1e-16   
gb|KDP47038.1|  hypothetical protein JCGZ_10765                       84.3    1e-16   
ref|XP_010649324.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  84.3    1e-16   
ref|XP_010649325.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  84.0    1e-16   
ref|XP_008357827.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  84.0    1e-16   
emb|CAN71534.1|  hypothetical protein VITISV_018182                   84.0    1e-16   Vitis vinifera
ref|XP_008357828.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  84.0    2e-16   
ref|XP_006486554.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  84.0    2e-16   
dbj|BAD19318.1|  putative far-red impaired response protein           84.0    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011088828.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       83.6    2e-16   
ref|XP_010229979.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  83.2    2e-16   
ref|XP_007043118.1|  FAR1-related sequence 5                          83.2    2e-16   
ref|XP_006422378.1|  hypothetical protein CICLE_v10027888mg           83.2    2e-16   
ref|XP_009359644.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  83.2    2e-16   
dbj|BAD10392.1|  putative far-red impaired response protein           83.2    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009359643.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  83.2    2e-16   
gb|KGN43377.1|  hypothetical protein Csa_7G029420                     83.2    2e-16   
ref|XP_008451177.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       83.2    3e-16   
ref|XP_010695510.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  83.2    3e-16   
ref|XP_004289021.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  82.8    3e-16   
ref|XP_004144566.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  82.8    3e-16   
ref|XP_010259175.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  82.8    4e-16   
ref|XP_010259163.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  82.8    4e-16   
ref|XP_010259189.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  82.4    4e-16   
ref|XP_010259180.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  82.4    4e-16   
ref|NP_001049063.1|  Os03g0164400                                     82.0    5e-16   Oryza sativa Japonica Group [Japonica rice]
gb|AAX92763.1|  transposon protein, putative, unclassified            82.8    5e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003618131.1|  FAR1-related protein                             82.4    5e-16   
gb|AAX94831.1|  transposon protein, putative, unclassified            82.4    6e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010233373.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  79.7    6e-16   
ref|XP_006655317.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  82.0    6e-16   
gb|AAM15785.1|AC104428_6  Putative far-red impaired response protein  81.6    6e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011030709.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  82.0    7e-16   
ref|XP_009360548.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  81.6    8e-16   
ref|XP_011004404.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  81.6    9e-16   
gb|KFK30428.1|  hypothetical protein AALP_AA7G259900                  81.6    9e-16   
ref|XP_006377868.1|  hypothetical protein POPTR_0011s14880g           81.6    1e-15   
ref|XP_010270590.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  81.3    1e-15   
ref|XP_008368438.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  81.3    1e-15   
ref|XP_008669590.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  80.5    1e-15   
gb|ABF94141.1|  transposon protein, putative, unclassified, expre...  80.9    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002450570.1|  hypothetical protein SORBIDRAFT_05g007130        81.3    1e-15   Sorghum bicolor [broomcorn]
ref|XP_007032686.1|  FAR1-related sequence 5                          81.3    1e-15   
ref|XP_004309932.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  80.1    1e-15   
gb|KDP36732.1|  hypothetical protein JCGZ_08023                       80.9    1e-15   
ref|XP_004966891.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  79.7    1e-15   
ref|XP_006411599.1|  hypothetical protein EUTSA_v10024456mg           80.9    2e-15   
ref|XP_006281824.1|  hypothetical protein CARUB_v10028009mg           80.9    2e-15   
ref|XP_004491651.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  80.9    2e-15   
emb|CBI22289.3|  unnamed protein product                              80.9    2e-15   
gb|EEC84007.1|  hypothetical protein OsI_30215                        80.5    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_010661125.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  80.9    2e-15   
emb|CAN68961.1|  hypothetical protein VITISV_019276                   80.9    2e-15   Vitis vinifera
dbj|BAB33151.1|  hypothetical protein                                 80.5    2e-15   Carthamus tinctorius
ref|XP_006364336.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  80.5    2e-15   
ref|XP_006285782.1|  hypothetical protein CARUB_v10007256mg           80.5    2e-15   
ref|XP_006477730.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  79.7    3e-15   
ref|XP_002460267.1|  hypothetical protein SORBIDRAFT_02g025670        79.7    3e-15   Sorghum bicolor [broomcorn]
gb|AAL58182.1|AC027037_4  putative far-red impaired response protein  79.7    3e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232993.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  76.6    3e-15   
ref|XP_004980265.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  79.0    4e-15   
ref|XP_008233036.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-like  79.0    4e-15   
ref|XP_010028878.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5 i...  79.7    4e-15   
ref|XP_011000845.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  79.7    5e-15   
ref|XP_010468694.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  79.3    5e-15   
ref|XP_010028879.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5 i...  79.3    5e-15   
ref|XP_010927109.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  79.7    6e-15   
ref|XP_010927108.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  79.7    6e-15   
ref|XP_010927107.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  79.7    6e-15   
ref|XP_009612458.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       79.3    6e-15   
ref|XP_002466896.1|  hypothetical protein SORBIDRAFT_01g016055        78.2    6e-15   Sorghum bicolor [broomcorn]
ref|XP_009387977.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  79.3    6e-15   
ref|XP_009387976.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  79.3    7e-15   
ref|XP_004963627.1|  PREDICTED: uncharacterized protein LOC101779982  79.3    7e-15   
ref|XP_009758605.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       79.0    8e-15   
ref|XP_010227160.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  78.6    8e-15   
ref|XP_002459592.1|  hypothetical protein SORBIDRAFT_02g007217        78.6    8e-15   Sorghum bicolor [broomcorn]
ref|XP_006406281.1|  hypothetical protein EUTSA_v10021958mg           78.6    9e-15   
ref|XP_003538916.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  79.0    9e-15   
ref|XP_006406280.1|  hypothetical protein EUTSA_v10022007mg           78.6    9e-15   
ref|XP_010513339.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  76.6    9e-15   
ref|NP_001047685.1|  Os02g0668200                                     78.6    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010239257.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  78.2    1e-14   
gb|EEE57540.1|  hypothetical protein OsJ_07864                        78.6    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002460471.1|  hypothetical protein SORBIDRAFT_02g028930        77.8    1e-14   Sorghum bicolor [broomcorn]
ref|XP_010693322.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  77.4    1e-14   
ref|XP_008680369.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  77.4    1e-14   
ref|XP_004290092.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  78.2    1e-14   
ref|XP_006435469.1|  hypothetical protein CICLE_v10000383mg           78.2    1e-14   
ref|XP_007200955.1|  hypothetical protein PRUPE_ppa001597mg           78.2    1e-14   
ref|XP_008653692.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  77.8    1e-14   
ref|XP_008235836.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       78.2    1e-14   
ref|XP_004305530.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  77.8    1e-14   
ref|XP_002283202.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       78.2    1e-14   Vitis vinifera
ref|XP_007216795.1|  hypothetical protein PRUPE_ppa023614mg           77.8    2e-14   
ref|XP_004986319.1|  PREDICTED: uncharacterized protein LOC101759074  77.8    2e-14   
ref|XP_010690587.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       77.8    2e-14   
ref|XP_006383797.1|  hypothetical protein POPTR_0005s27900g           77.4    2e-14   
ref|XP_010274043.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  77.4    2e-14   
ref|XP_009412131.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  77.4    2e-14   
ref|XP_008787331.1|  PREDICTED: LOW QUALITY PROTEIN: protein FAR-...  77.8    3e-14   
ref|XP_006480513.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  77.4    3e-14   
ref|XP_004974618.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  76.6    3e-14   
gb|EPS62805.1|  hypothetical protein M569_11983                       77.0    3e-14   
ref|XP_010233328.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  74.7    3e-14   
ref|XP_010251622.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3       77.0    3e-14   
ref|XP_011041139.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  77.0    3e-14   
ref|XP_009358905.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       77.0    3e-14   
ref|XP_010436910.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  77.0    4e-14   
ref|XP_010555162.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       77.0    4e-14   
ref|XP_002313567.1|  far-red impaired responsive family protein       76.6    4e-14   Populus trichocarpa [western balsam poplar]
ref|XP_009391891.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-l...  76.6    4e-14   
ref|XP_010436909.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  76.6    4e-14   
ref|XP_008237898.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  76.6    5e-14   
ref|XP_007208906.1|  hypothetical protein PRUPE_ppa026999mg           76.6    5e-14   
ref|XP_009123004.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.2    5e-14   
gb|EYU41087.1|  hypothetical protein MIMGU_mgv1a020432mg              76.3    5e-14   
ref|XP_002466791.1|  hypothetical protein SORBIDRAFT_01g014270        76.3    6e-14   Sorghum bicolor [broomcorn]
ref|XP_008382516.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       76.3    6e-14   
ref|XP_006487498.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  75.1    6e-14   
ref|XP_004231108.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       76.3    6e-14   
ref|XP_002466969.1|  hypothetical protein SORBIDRAFT_01g017605        73.6    6e-14   Sorghum bicolor [broomcorn]
ref|XP_009123544.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  74.7    7e-14   
ref|XP_002443160.1|  hypothetical protein SORBIDRAFT_08g013410        75.1    7e-14   Sorghum bicolor [broomcorn]
ref|XP_009416765.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.6    7e-14   
ref|XP_010240740.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  75.5    7e-14   
ref|XP_010231426.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  75.1    7e-14   
ref|XP_010685516.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3       76.3    8e-14   
ref|XP_009372650.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  75.9    8e-14   
ref|XP_006645669.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  75.9    8e-14   
ref|XP_008373334.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  75.9    8e-14   
ref|XP_006649180.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-like  75.9    9e-14   
ref|XP_010942431.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-like  75.9    1e-13   
ref|XP_010941614.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  75.9    1e-13   
ref|XP_007212371.1|  hypothetical protein PRUPE_ppa014831mg           75.5    1e-13   
ref|XP_010693927.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  75.1    1e-13   
gb|AAF66982.1|  transposase                                           75.5    1e-13   Zea mays [maize]
ref|NP_195531.1|  protein FAR1-related sequence 5                     75.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116658.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  75.5    1e-13   
ref|XP_006472948.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  75.5    1e-13   
ref|XP_006472950.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  75.1    1e-13   
ref|XP_010236653.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.9    1e-13   
ref|XP_009116657.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  75.5    1e-13   
ref|XP_008646465.1|  PREDICTED: uncharacterized protein LOC103627938  75.5    1e-13   
ref|XP_006484349.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  75.1    1e-13   
ref|XP_008219733.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  75.1    2e-13   
ref|XP_004301609.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  75.1    2e-13   
ref|NP_001052447.2|  Os04g0316800                                     75.5    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KDO47575.1|  hypothetical protein CISIN_1g005927mg                 75.1    2e-13   
ref|XP_006485311.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  73.2    2e-13   
ref|XP_007219530.1|  hypothetical protein PRUPE_ppa022622mg           74.7    2e-13   
gb|KDO47577.1|  hypothetical protein CISIN_1g005927mg                 74.3    2e-13   
ref|XP_009103778.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.9    2e-13   
dbj|BAG93645.1|  unnamed protein product                              74.7    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007208744.1|  hypothetical protein PRUPE_ppa015375mg           74.3    2e-13   
ref|XP_008811123.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  75.1    2e-13   
gb|KHN46338.1|  Protein FAR1-RELATED SEQUENCE 3                       74.7    2e-13   
gb|EAZ40658.1|  hypothetical protein OsJ_25129                        74.7    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KDO47576.1|  hypothetical protein CISIN_1g005927mg                 74.3    3e-13   
ref|XP_006384878.1|  hypothetical protein POPTR_0004s21890g           74.3    3e-13   
ref|XP_009117177.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  72.0    3e-13   
gb|KDP42904.1|  hypothetical protein JCGZ_23846                       74.7    3e-13   
ref|XP_004958302.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  74.3    3e-13   
ref|XP_006605632.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  74.7    3e-13   
ref|NP_001060272.1|  Os07g0615900                                     74.3    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004231427.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.2    3e-13   
ref|XP_004305654.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.6    3e-13   
ref|XP_006605633.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  74.3    3e-13   
ref|XP_007146047.1|  hypothetical protein PHAVU_006G008300g           74.3    3e-13   
ref|XP_010497176.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  74.3    3e-13   
ref|XP_010063175.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  74.3    3e-13   
ref|XP_006293662.1|  hypothetical protein CARUB_v10022618mg           74.3    3e-13   
ref|XP_006385722.1|  hypothetical protein POPTR_0003s10970g           74.3    3e-13   
dbj|BAD29488.1|  putative far-red impaired response protein           73.9    3e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40514.2|  OSJNBa0050F15.2                                      73.9    3e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EEE62203.1|  hypothetical protein OsJ_16990                        74.3    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010233182.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.6    4e-13   
ref|XP_006657954.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.9    4e-13   
ref|XP_007018641.1|  Far1-related sequence 5 isoform 1                73.9    4e-13   
ref|XP_010446320.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       73.9    4e-13   
ref|XP_010236728.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.9    4e-13   
ref|XP_008381561.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.6    5e-13   
ref|XP_010063176.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  73.6    5e-13   
ref|XP_010245238.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.6    5e-13   
ref|XP_006385723.1|  hypothetical protein POPTR_0003s10970g           73.9    5e-13   
gb|KFK32424.1|  hypothetical protein AALP_AA6G240100                  73.6    5e-13   
ref|XP_009405914.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.9    5e-13   
ref|XP_011033962.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  73.6    5e-13   
ref|XP_008227250.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  73.2    5e-13   
ref|XP_004292735.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  73.6    5e-13   
ref|XP_004297991.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  72.0    6e-13   
ref|XP_007199084.1|  hypothetical protein PRUPE_ppa019160mg           73.2    6e-13   
ref|XP_011033967.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  73.6    6e-13   
ref|XP_008792840.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  73.2    6e-13   
ref|XP_003619906.1|  FAR-RED IMPAIRED RESPONSE                        73.2    6e-13   
ref|XP_008792843.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  73.2    7e-13   
emb|CAE02528.2|  OSJNBb0003A12.15                                     72.8    7e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008237973.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  73.2    7e-13   
ref|XP_003606229.1|  FAR1-related protein                             72.4    8e-13   
ref|XP_010668418.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.1    8e-13   
ref|XP_007043119.1|  Far1-related sequence 9                          72.8    8e-13   
ref|XP_008237974.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  73.2    8e-13   
ref|XP_010685218.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  72.4    8e-13   
ref|XP_010227128.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  72.4    8e-13   
ref|XP_007211309.1|  hypothetical protein PRUPE_ppa001395mg           73.2    8e-13   
ref|XP_008227249.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.8    8e-13   
ref|XP_008792844.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.8    9e-13   
ref|XP_007133534.1|  hypothetical protein PHAVU_011G187200g           73.2    9e-13   
ref|XP_010028880.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9       72.4    9e-13   
ref|XP_007220598.1|  hypothetical protein PRUPE_ppa001310mg           72.8    1e-12   
ref|XP_011040838.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9       72.4    1e-12   
ref|XP_008231884.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  72.8    1e-12   
ref|XP_010941828.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  72.4    1e-12   
ref|XP_010912765.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  72.8    1e-12   
gb|KCW55701.1|  hypothetical protein EUGRSUZ_I01548                   72.0    1e-12   
ref|XP_004307013.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  72.8    1e-12   
ref|NP_565636.1|  FAR1-related sequence 3                             72.8    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|KCW55700.1|  hypothetical protein EUGRSUZ_I01548                   72.0    1e-12   
ref|XP_010932381.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.4    1e-12   
ref|XP_002273512.2|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  72.4    1e-12   Vitis vinifera
ref|XP_010930350.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  72.4    1e-12   
ref|XP_006408658.1|  hypothetical protein EUTSA_v10001905mg           72.4    1e-12   
ref|XP_004238635.2|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  72.4    1e-12   
ref|XP_010669221.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.7    1e-12   
gb|ABD33026.2|  Cyclin-like F-box; FAR1; Zinc finger, SWIM-type       72.8    1e-12   Medicago truncatula
ref|XP_009409125.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.4    1e-12   
ref|NP_001031428.1|  FAR1-related sequence 3                          72.4    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008809356.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.4    1e-12   
ref|XP_008246383.1|  PREDICTED: uncharacterized protein LOC103344568  71.6    1e-12   
dbj|BAJ06701.1|  unnamed protein product                              72.0    1e-12   
dbj|BAJ06700.1|  unnamed protein product                              72.0    1e-12   
ref|XP_002439945.1|  hypothetical protein SORBIDRAFT_09g023170        72.4    1e-12   
ref|XP_004295765.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  72.0    1e-12   
ref|XP_009409124.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.4    1e-12   
ref|XP_008809355.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.4    1e-12   
ref|XP_009409120.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.4    1e-12   
gb|KHN25102.1|  Protein FAR1-RELATED SEQUENCE 5                       71.2    1e-12   
ref|XP_008373411.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  72.4    2e-12   
ref|XP_010923743.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.4    2e-12   
ref|XP_010923745.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.4    2e-12   
ref|XP_007016659.1|  FAR1-related sequence 3 isoform 1                72.4    2e-12   
ref|XP_007016664.1|  FAR1-related sequence 3 isoform 6                72.4    2e-12   
ref|XP_008809351.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.4    2e-12   
ref|XP_011090244.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  72.4    2e-12   
ref|XP_007208966.1|  hypothetical protein PRUPE_ppb019935mg           72.0    2e-12   
ref|XP_007010682.1|  Far1-related sequence 3 isoform 1                72.4    2e-12   
ref|XP_010932383.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.0    2e-12   
ref|XP_010027018.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  72.0    2e-12   
ref|XP_003518461.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  72.0    2e-12   
ref|XP_010456530.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  72.0    2e-12   
ref|XP_010677952.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.3    2e-12   
ref|XP_010924140.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.0    2e-12   
ref|XP_004511157.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  72.0    2e-12   
ref|XP_010924139.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  72.0    2e-12   
gb|EAZ14299.1|  hypothetical protein OsJ_04225                        70.5    2e-12   
gb|AAT01399.1|  putative far-red impaired response protein            72.0    2e-12   
ref|XP_010239118.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.9    2e-12   
ref|XP_010666753.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.2    2e-12   
ref|XP_004297885.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  71.6    2e-12   
ref|XP_006591712.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.6    2e-12   
ref|XP_003601116.1|  Far-red impaired response protein                69.7    2e-12   
ref|XP_004292126.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.2    2e-12   
gb|EYU35993.1|  hypothetical protein MIMGU_mgv1a001288mg              72.0    2e-12   
ref|XP_006342191.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.6    2e-12   
gb|EPS63307.1|  hypothetical protein M569_11475                       71.6    2e-12   
ref|XP_010473100.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3       72.0    2e-12   
ref|XP_009365699.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  72.0    2e-12   
ref|XP_010417857.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  72.0    2e-12   
ref|XP_010445346.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.6    2e-12   
emb|CAN78577.1|  hypothetical protein VITISV_020585                   72.0    2e-12   
gb|EMT19245.1|  Putative disease resistance protein RGA4              72.0    3e-12   
ref|XP_004501995.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  71.6    3e-12   
ref|XP_004501994.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  71.6    3e-12   
ref|XP_009133360.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       71.6    3e-12   
ref|XP_010647371.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.5    3e-12   
ref|XP_010421147.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.7    3e-12   
emb|CAH67732.1|  H0522A01.3                                           71.6    3e-12   
ref|XP_009609281.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3 i...  71.6    3e-12   
ref|XP_010056981.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.6    3e-12   
dbj|BAJ06702.1|  unnamed protein product                              71.2    3e-12   
ref|XP_007041047.1|  FRS transcription factor family isoform 2        71.2    3e-12   
ref|XP_008451084.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3       71.2    3e-12   
ref|XP_010645549.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9 i...  70.9    3e-12   
ref|XP_006647047.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.2    3e-12   
ref|XP_010925259.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.2    3e-12   
ref|XP_010665058.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.5    3e-12   
ref|XP_009362868.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  71.2    3e-12   
ref|XP_007041046.1|  FRS transcription factor family isoform 1        71.2    3e-12   
ref|XP_008777505.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  71.2    3e-12   
ref|XP_010235320.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.2    3e-12   
ref|XP_010645554.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9 i...  70.9    3e-12   
ref|XP_008777503.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  71.2    4e-12   
ref|XP_006590087.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.2    4e-12   
emb|CAN77889.1|  hypothetical protein VITISV_003778                   71.2    4e-12   
ref|XP_010681849.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.2    4e-12   
ref|XP_010914936.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.9    4e-12   
ref|XP_010028196.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  71.2    4e-12   
ref|NP_001146631.1|  FAR1 transcription factor                        70.9    4e-12   
ref|XP_010028203.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  71.2    4e-12   
ref|XP_008241738.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.9    4e-12   
ref|XP_010665808.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.9    4e-12   
ref|XP_007041048.1|  FRS transcription factor family isoform 3        70.9    4e-12   
gb|KCW65131.1|  hypothetical protein EUGRSUZ_G02634                   70.9    4e-12   
ref|XP_007214218.1|  hypothetical protein PRUPE_ppa023217mg           70.9    4e-12   
gb|ABA95414.1|  transposon protein, putative, unclassified            70.9    4e-12   
ref|XP_010660450.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.7    5e-12   
ref|XP_004486559.1|  PREDICTED: uncharacterized protein LOC101503771  71.2    5e-12   
gb|EEE52553.1|  hypothetical protein OsJ_34801                        70.9    5e-12   
ref|XP_008809265.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.9    5e-12   
ref|XP_010923773.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.9    5e-12   
ref|XP_004306439.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  70.9    5e-12   
ref|XP_009381611.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  70.9    5e-12   
ref|XP_010067068.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  70.9    5e-12   
emb|CBI37713.3|  unnamed protein product                              70.5    5e-12   
ref|XP_008376001.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.9    5e-12   
ref|XP_006432553.1|  hypothetical protein CICLE_v10000255mg           70.9    5e-12   
ref|XP_002447845.1|  hypothetical protein SORBIDRAFT_06g016820        70.5    6e-12   
ref|XP_004982579.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.9    6e-12   
ref|XP_010675536.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.1    6e-12   
ref|XP_009381610.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  70.5    6e-12   
ref|XP_010067070.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  70.9    6e-12   
ref|XP_008375417.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  70.9    6e-12   
ref|XP_010666429.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  67.8    6e-12   
ref|XP_004987222.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.7    6e-12   
gb|KDP20361.1|  hypothetical protein JCGZ_06470                       70.9    6e-12   
ref|XP_008232022.1|  PREDICTED: uncharacterized protein LOC103331192  70.5    6e-12   
ref|XP_009407252.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.5    6e-12   
ref|XP_007202195.1|  hypothetical protein PRUPE_ppa018832mg           70.5    6e-12   
ref|XP_010657399.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.1    6e-12   
gb|EYU26870.1|  hypothetical protein MIMGU_mgv1a025010mg              70.5    7e-12   
ref|XP_008356763.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.9    7e-12   
ref|XP_006452274.1|  hypothetical protein CICLE_v100102261mg          70.1    7e-12   
ref|XP_008390324.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.7    7e-12   
gb|KHN38124.1|  Protein FAR1-RELATED SEQUENCE 3                       70.5    7e-12   
gb|KDP24963.1|  hypothetical protein JCGZ_24409                       70.5    7e-12   
gb|ABF95759.1|  transposon protein, putative, unclassified            70.1    7e-12   
ref|XP_010650778.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.7    7e-12   
ref|XP_006365056.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  70.5    7e-12   
ref|XP_010254493.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  70.5    7e-12   
ref|XP_008785341.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.1    7e-12   
ref|XP_006585693.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  70.5    7e-12   
ref|XP_010651609.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3 i...  70.5    8e-12   
ref|XP_002270441.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3 i...  70.5    8e-12   
ref|XP_010495230.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.7    8e-12   
gb|EEC72703.1|  hypothetical protein OsI_06289                        70.1    8e-12   
ref|XP_011080506.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3       70.5    8e-12   
ref|XP_010322461.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3 i...  70.1    8e-12   
ref|XP_003530369.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  70.5    8e-12   
ref|XP_010277380.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 12-...  70.5    8e-12   
ref|XP_006603498.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.7    8e-12   
emb|CAN70262.1|  hypothetical protein VITISV_002225                   70.5    8e-12   
ref|XP_008338042.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.1    8e-12   
ref|NP_001046234.1|  Os02g0202800                                     70.1    8e-12   
ref|XP_002446233.1|  hypothetical protein SORBIDRAFT_06g007340        68.9    8e-12   
ref|XP_010277381.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 12-...  70.1    8e-12   
ref|XP_007217773.1|  hypothetical protein PRUPE_ppa015745mg           69.7    8e-12   
ref|XP_010914593.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.1    9e-12   
ref|XP_010254494.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  70.1    9e-12   
ref|XP_006365057.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  70.1    9e-12   
ref|XP_004144079.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  70.1    9e-12   
ref|XP_008365955.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.1    9e-12   
gb|EYU42903.1|  hypothetical protein MIMGU_mgv1a001358mg              70.1    9e-12   
ref|XP_002457925.1|  hypothetical protein SORBIDRAFT_03g022130        69.7    1e-11   
ref|XP_002457501.1|  hypothetical protein SORBIDRAFT_03g008390        69.7    1e-11   
ref|XP_007201166.1|  hypothetical protein PRUPE_ppa003787mg           69.7    1e-11   
ref|XP_009339769.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.7    1e-11   
gb|KCW84403.1|  hypothetical protein EUGRSUZ_B01259                   69.7    1e-11   
ref|XP_006651873.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.1    1e-11   
gb|KCW72771.1|  hypothetical protein EUGRSUZ_E01219                   69.7    1e-11   
ref|XP_010653426.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.7    1e-11   
ref|XP_010239274.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  70.1    1e-11   
ref|XP_006441931.1|  hypothetical protein CICLE_v10023561mg           70.1    1e-11   
gb|EYU42902.1|  hypothetical protein MIMGU_mgv1a001358mg              69.7    1e-11   
ref|XP_008784344.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.7    1e-11   
emb|CAN68134.1|  hypothetical protein VITISV_035651                   69.7    1e-11   
gb|KCW54873.1|  hypothetical protein EUGRSUZ_I00824                   69.7    1e-11   
ref|XP_008353320.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.7    1e-11   
dbj|BAG95729.1|  unnamed protein product                              69.3    1e-11   
ref|XP_010322460.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3 i...  69.7    1e-11   
ref|XP_010227402.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.6    1e-11   
ref|XP_010694902.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  67.0    1e-11   
ref|XP_008784343.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.7    1e-11   
ref|XP_009609280.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3 i...  69.7    1e-11   
ref|XP_008235837.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9       69.3    1e-11   
ref|XP_006481373.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 2-l...  69.7    1e-11   
ref|XP_006361134.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  69.7    1e-11   
ref|XP_006481372.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 2-l...  69.7    1e-11   
ref|XP_009609279.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3 i...  69.7    1e-11   
ref|XP_010937296.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.3    1e-11   
ref|XP_010267255.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-l...  69.7    1e-11   
ref|XP_010937294.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.7    1e-11   
ref|XP_002272915.3|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  69.7    1e-11   
ref|XP_008792111.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.3    1e-11   
ref|XP_010937297.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.3    1e-11   
dbj|BAC24942.1|  putative far-red impaired response protein           69.7    1e-11   
ref|XP_010674487.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.3    1e-11   
ref|XP_007016661.1|  Far1-related sequence 3 isoform 3                69.7    1e-11   
ref|XP_008792107.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.3    1e-11   
ref|XP_008670949.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.7    1e-11   
ref|XP_010694900.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  67.0    1e-11   
emb|CAN62918.1|  hypothetical protein VITISV_029735                   69.3    1e-11   
ref|XP_004293778.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  69.7    1e-11   
ref|XP_008670948.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.7    1e-11   
ref|XP_010937295.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.3    1e-11   
ref|XP_010507064.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.3    1e-11   
ref|XP_007016665.1|  Far1-related sequence 3 isoform 7                69.3    1e-11   
ref|XP_008228816.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.2    1e-11   
ref|XP_010656916.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.9    1e-11   
ref|XP_010245235.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.7    1e-11   
ref|XP_010245233.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.7    1e-11   
ref|XP_006481374.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 2-l...  69.3    2e-11   
emb|CAN65848.1|  hypothetical protein VITISV_039640                   69.3    2e-11   
ref|XP_010045140.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  69.3    2e-11   
emb|CAD40691.3|  OSJNBa0083D01.8                                      69.7    2e-11   
ref|XP_010668432.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.3    2e-11   
ref|XP_010045142.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  69.3    2e-11   
ref|XP_007142585.1|  hypothetical protein PHAVU_008G293200g           68.9    2e-11   
ref|XP_004289552.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 8-like  67.8    2e-11   
ref|XP_004298353.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.9    2e-11   
ref|XP_010234002.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  68.2    2e-11   
ref|XP_008782887.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.3    2e-11   
ref|XP_010658797.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.9    2e-11   
ref|XP_008782870.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.3    2e-11   
ref|XP_003592163.1|  Cysteine-rich receptor-like protein kinase       69.7    2e-11   
ref|XP_010673996.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  69.3    2e-11   
ref|XP_010513318.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  69.3    2e-11   
ref|XP_002278883.2|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  69.3    2e-11   
ref|XP_010689813.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.6    2e-11   
ref|XP_010644068.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.9    2e-11   
ref|XP_008244105.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  67.4    2e-11   
gb|ABA98678.1|  transposon protein, putative, unclassified            68.9    2e-11   
ref|XP_010690588.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9       68.6    2e-11   
ref|XP_006384742.1|  hypothetical protein POPTR_0004s20710g           68.9    2e-11   
ref|XP_002456110.1|  hypothetical protein SORBIDRAFT_03g030640        68.9    2e-11   
ref|XP_010267252.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  69.3    2e-11   
ref|XP_004967127.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.9    2e-11   
ref|XP_009398192.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.9    2e-11   
ref|XP_010267250.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  68.9    2e-11   
gb|KDO38178.1|  hypothetical protein CISIN_1g046720mg                 68.2    2e-11   
ref|XP_004977727.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.9    2e-11   
ref|XP_008338195.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  67.0    2e-11   
ref|XP_010267254.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  68.9    2e-11   
gb|EEE68621.1|  hypothetical protein OsJ_27177                        68.9    2e-11   
emb|CAN63412.1|  hypothetical protein VITISV_011051                   68.9    2e-11   
ref|XP_009391987.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  68.6    2e-11   
ref|XP_006493665.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  68.9    2e-11   
ref|XP_006493664.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  68.9    2e-11   
ref|XP_010668149.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  65.9    2e-11   



>ref|XP_008657613.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=644

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            ID    K   +P FY+ + VDE  +L  +FWADP  R NF+ FGD +SFD+TY TN Y +
Sbjct  112  IDNLASKNELNPTFYYDYVVDEKGRLVHVFWADPTCRKNFSHFGDLLSFDSTYNTNHYNM  171

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +F PFTG++HHK  V F A
Sbjct  172  IFTPFTGINHHKSCVLFGA  190



>ref|XP_010667127.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=732

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            +D +  KK     F F ++VD+   LCR FWADP  R N+ +FGD +SFD T+ TNRY +
Sbjct  229  VDNFKMKKLLWSAFLFDYEVDQEGCLCRAFWADPICRKNYALFGDMLSFDTTFQTNRYNM  288

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +F PFTGVDHHK+ V+F A
Sbjct  289  IFGPFTGVDHHKRCVSFGA  307



>gb|EEE63476.1| hypothetical protein OsJ_18290 [Oryza sativa Japonica Group]
Length=664

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            +D+ + K  A+P FYF + VD+  +L  +FWAD   R N+  FGD +SFD+TY TN Y +
Sbjct  209  VDQLSRKSLANPGFYFDYVVDDKGRLIHVFWADAICRKNYAHFGDLVSFDSTYSTNEYGM  268

Query  184  VFVPFTGVDHHKKSVTFAA  240
            VF PFTGV+HHK SV F A
Sbjct  269  VFTPFTGVNHHKSSVLFGA  287



>ref|XP_010694608.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score = 90.5 bits (223),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  25   KNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTG  204
            K  +P FY+A++VDE  +L   FWAD   R NF +FGD +SFD TY TN+Y L+F PFTG
Sbjct  2    KARNPSFYYAYEVDEERRLKHAFWADGICRKNFALFGDAISFDTTYRTNKYSLIFAPFTG  61

Query  205  VDHHKKSVTFAA  240
            ++HH++++TF A
Sbjct  62   LNHHRQAITFGA  73



>gb|ABN05718.1| FAR1; Zinc finger, SWIM-type [Medicago truncatula]
Length=800

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            ID +  K+  +P F++ ++ D   +L  +FWAD   R N+++FGD +SFD TY TN+Y +
Sbjct  278  IDNFRRKREINPSFFYDYEADNEGKLKHVFWADGICRKNYSLFGDVVSFDTTYRTNKYFM  337

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +F PFTG++HH++S+TF A
Sbjct  338  IFAPFTGINHHRQSITFGA  356



>ref|XP_002467387.1| hypothetical protein SORBIDRAFT_01g026910 [Sorghum bicolor]
 gb|EER94385.1| hypothetical protein SORBIDRAFT_01g026910 [Sorghum bicolor]
Length=558

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +1

Query  22   KKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFT  201
            KK  +P F++  +V+E  +L R+FWAD  +R N+NIFGD +S DATY TN+Y + FVPFT
Sbjct  185  KKEVNPAFFYEFEVNEEGRLVRVFWADALSRKNYNIFGDVISVDATYTTNQYNMKFVPFT  244

Query  202  GVDHHKKSVTFAA  240
            GV+HH +SV   A
Sbjct  245  GVNHHLQSVFLGA  257



>ref|XP_009775261.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nicotiana sylvestris]
Length=788

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +K   +P F++A   DE   +  IFWADP+AR NF+ FGDT++FD TY +NRY+
Sbjct  248  LLDYLKQKHLENPSFFYAVQGDEDHCMSNIFWADPKARTNFSYFGDTVTFDTTYRSNRYR  307

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  308  LPFAPFTGVNHHGQPVLFG  326



>ref|XP_002444099.1| hypothetical protein SORBIDRAFT_07g007695 [Sorghum bicolor]
 gb|EES13594.1| hypothetical protein SORBIDRAFT_07g007695 [Sorghum bicolor]
Length=243

 Score = 87.4 bits (215),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK  +P F++  +V+E  +L R+FWAD  +R N+N+FGD +  DATY TN+Y +
Sbjct  120  VAQLERKKEVNPAFFYEFEVNEEGRLVRVFWADALSRKNYNVFGDVILVDATYTTNQYNM  179

Query  184  VFVPFTGVDHHKKSVTFAA  240
             FVPFTGV+HH +SV   A
Sbjct  180  KFVPFTGVNHHLQSVFLGA  198



>ref|XP_010666566.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=891

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            +D +  KK     F++  +VD+   L + FWADP  R N+ +FGD +SFD TY TNRY +
Sbjct  362  VDNFKMKKLLWGAFFYDFEVDDEQCLTKAFWADPICRKNYALFGDMVSFDTTYETNRYNM  421

Query  184  VFVPFTGVDHHKKSVTFAA  240
            VF PFTGVDHHK+ +TF A
Sbjct  422  VFGPFTGVDHHKRCITFGA  440



>gb|EYU43726.1| hypothetical protein MIMGU_mgv1a0034692mg, partial [Erythranthe 
guttata]
Length=324

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +K++ +P F++A   DE      +FWADP++R ++N FGDT++FD TY +NRY+
Sbjct  177  LLDYLKQKQSENPSFFYAIQGDEDQYTGNVFWADPKSRSDYNHFGDTVTFDTTYRSNRYR  236

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L FVPFTG++HH + V F 
Sbjct  237  LPFVPFTGLNHHGQPVLFG  255



>ref|XP_009631560.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nicotiana 
tomentosiformis]
Length=784

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +K   +P F++A   DE   +  IFWADP+AR NF  FGDT++FD TY +NRY+
Sbjct  244  LLDYLKQKHLENPSFFYAVQGDEDHCMSNIFWADPEARSNFIYFGDTVTFDTTYRSNRYR  303

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  304  LPFAPFTGVNHHGQPVLFG  322



>ref|XP_010670287.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            +D +  KK     F++  +VD+   L + FWADP  R N+ +FGD +SFD TY TNRY +
Sbjct  235  MDNFKMKKLLWGAFFYDFEVDDEQCLTKAFWADPICRKNYALFGDMVSFDTTYETNRYNM  294

Query  184  VFVPFTGVDHHKKSVTFAA  240
            VF PFTGVDHHK+ +TF A
Sbjct  295  VFGPFTGVDHHKRCITFGA  313



>ref|XP_003545054.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Glycine max]
Length=777

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+D   +    +P+F++A   DE   +  +FWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  235  VLDYLRQMHAENPNFFYAVQGDEDQSITNVFWADPKARMNYTFFGDTVTFDTTYRSNRYR  294

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  295  LPFAPFTGVNHHGQPVLFG  313



>ref|XP_009631561.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nicotiana 
tomentosiformis]
Length=722

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +K   +P F++A   DE   +  IFWADP+AR NF  FGDT++FD TY +NRY+
Sbjct  244  LLDYLKQKHLENPSFFYAVQGDEDHCMSNIFWADPEARSNFIYFGDTVTFDTTYRSNRYR  303

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  304  LPFAPFTGVNHHGQPVLFG  322



>ref|XP_007142582.1| hypothetical protein PHAVU_008G293000g [Phaseolus vulgaris]
 gb|ESW14576.1| hypothetical protein PHAVU_008G293000g [Phaseolus vulgaris]
Length=783

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+D   +  + +P+F++A   DE   +  +FWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  241  VLDYLRQMHSENPNFFYAVQGDEDQSVNNVFWADPKARMNYTFFGDTVTFDTTYRSNRYR  300

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  301  LPFAPFTGVNHHGQPVLFG  319



>ref|XP_010677175.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=525

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  43   FYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHHKK  222
            F++  +VD+   L + FWADP  R N+ +FGD +SFD TY TNRY +VF PFTGVDHHK+
Sbjct  9    FFYDFEVDDEQCLTKAFWADPICRKNYALFGDMVSFDTTYETNRYNMVFGPFTGVDHHKR  68

Query  223  SVTFAA  240
             +TF A
Sbjct  69   CITFGA  74



>ref|XP_010668319.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=599

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            +D +  KK     F++  +VD+   L + FWADP  R N+ +FGD +SFD TY TNRY +
Sbjct  235  VDNFKMKKLLWGAFFYDFEVDDEQCLTKAFWADPICRKNYALFGDMVSFDTTYETNRYHM  294

Query  184  VFVPFTGVDHHKKSVTFAA  240
            VF PFTGVDHHK+ +TF A
Sbjct  295  VFGPFTGVDHHKRCITFGA  313



>ref|XP_008679530.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
 ref|XP_008679531.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=384

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK A+  F++   VDE  +L  +FWAD  +R N++ FGD +SFDATY TN+Y +
Sbjct  171  VAQMERKKEANSAFFYDLVVDEHGKLVSMFWADATSRKNYSHFGDLVSFDATYSTNQYNM  230

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +F PFTGV+HH KSV F A
Sbjct  231  IFAPFTGVNHHMKSVFFGA  249



>gb|KDP24914.1| hypothetical protein JCGZ_24292 [Jatropha curcas]
Length=808

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D    K + +P F++A   DE   +  IFWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  268  LLDYLRNKHSENPAFFYAVQGDEDQCMSNIFWADPKARTNYTYFGDTVTFDTTYRSNRYR  327

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  328  LPFAPFTGVNHHGQPVLFG  346



>ref|XP_010678062.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=338

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            I   + +K  +  F+F +  +  + L R+FWAD   R N+  FGD +SFDATYGTN Y L
Sbjct  161  ISTLSRQKEMNSGFFFDYVANAKEGLHRVFWADALCRRNYFAFGDVVSFDATYGTNMYNL  220

Query  184  VFVPFTGVDHHKKSVTFAA  240
            VF PFTG+DHHK+ V F A
Sbjct  221  VFCPFTGIDHHKRFVIFGA  239



>ref|XP_008242120.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=778

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +K+   P F+FA   DE   +  +FWADP+AR ++  FGDT++FD TY +NRY+
Sbjct  236  LLDYLKDKQAKDPAFFFAVQGDEDQCMSNVFWADPKARTDYTYFGDTVTFDTTYRSNRYR  295

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  296  LPFAPFTGVNHHGQPVLFG  314



>ref|XP_007203789.1| hypothetical protein PRUPE_ppa001606mg [Prunus persica]
 gb|EMJ04988.1| hypothetical protein PRUPE_ppa001606mg [Prunus persica]
Length=794

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +K+   P F+FA   DE   +  +FWADP+AR ++  FGDT++FD TY +NRY+
Sbjct  252  LLDYLKDKQAKDPAFFFAVQGDEDQCMSNVFWADPKARTDYTYFGDTVTFDTTYRSNRYR  311

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  312  LPFAPFTGVNHHGQPVLFG  330



>gb|EYU36991.1| hypothetical protein MIMGU_mgv1a0188031mg, partial [Erythranthe 
guttata]
Length=610

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +K++ +P F++A   DE      +FWADP++R ++N FGDT++FD TY +NRY+
Sbjct  93   LLDYLKQKQSENPSFFYAIQGDEDQYTGNVFWADPKSRSDYNHFGDTVTFDTTYRSNRYR  152

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L FVPFTG++HH + V F 
Sbjct  153  LPFVPFTGLNHHGQPVLFG  171



>gb|EEE69818.1| hypothetical protein OsJ_29559 [Oryza sativa Japonica Group]
Length=562

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK  +P F++   VDE  +L R+FWAD   R N+++FGD +S D+TY TN+Y +
Sbjct  223  VAQLERKKEVNPAFFYDFMVDEQGRLVRVFWADALCRKNYSVFGDVVSVDSTYTTNQYNM  282

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +FVPFTGV+HH +SV   A
Sbjct  283  IFVPFTGVNHHLQSVFLGA  301



>ref|NP_001063309.1| Os09g0446400 [Oryza sativa Japonica Group]
 dbj|BAF25223.1| Os09g0446400 [Oryza sativa Japonica Group]
Length=561

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK  +P F++   VDE  +L R+FWAD   R N+++FGD +S D+TY TN+Y +
Sbjct  222  VAQLERKKEVNPAFFYDFMVDEQGRLVRVFWADALCRKNYSVFGDVVSVDSTYTTNQYNM  281

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +FVPFTGV+HH +SV   A
Sbjct  282  IFVPFTGVNHHLQSVFLGA  300



>ref|XP_004967151.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=546

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK  +P F++   VDE  +L R+FWAD   R N+++FGD +S D+TY TN+Y +
Sbjct  209  VAQLERKKEVNPAFFYDFMVDEQGRLVRVFWADALCRKNYSVFGDVVSVDSTYTTNQYNM  268

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +FVPFTGV+HH +SV   A
Sbjct  269  IFVPFTGVNHHLQSVFLGA  287



>gb|AAV31356.1| hypothetical protein [Oryza sativa Japonica Group]
Length=896

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK  +P F++   VD+  +L R+FWAD   R N+++FGD +S D+TY TN+Y +
Sbjct  282  VGQLERKKEVNPAFFYEFMVDKQGRLVRVFWADAICRKNYSVFGDVLSVDSTYSTNQYNM  341

Query  184  VFVPFTGVDHHKKSVTFAA  240
             FVPFTGV+HH +SV   A
Sbjct  342  KFVPFTGVNHHLQSVFLGA  360



>ref|XP_010266300.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
Length=775

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            + D        +P F++A   DE   +  IFWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  235  LJDYLKHMHAXNPSFFYAVQGDEDQCMSNIFWADPKARXNYTYFGDTVTFDTTYRSNRYR  294

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTG++HH + V F 
Sbjct  295  LPFAPFTGINHHGQPVLFG  313



>gb|EEC74573.1| hypothetical protein OsI_10136 [Oryza sativa Indica Group]
Length=1025

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK  +P F++   VD+  +L R+FWAD   R N+++FGD +S D+TY TN+Y +
Sbjct  831  VGQLERKKEVNPAFFYEFMVDKQGRLVRVFWADAICRKNYSVFGDVLSVDSTYSTNQYNM  890

Query  184  VFVPFTGVDHHKKSVTFAA  240
             FVPFTGV+HH +SV   A
Sbjct  891  KFVPFTGVNHHLQSVFLGA  909



>ref|XP_010682235.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=289

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +1

Query  4    IDKYTEKKNASPD-FYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++ + EK  +S   F+F + VDE   L R+FWAD  +R N+++FGD +SFD T+ TN+Y 
Sbjct  202  VNNFKEKATSSGGGFFFDYCVDENRHLTRVFWADAISRKNYSLFGDMVSFDTTFDTNKYC  261

Query  181  LVFVPFTGVDHHKKSVTFA  237
            +V  PFTGVDHH K VTF 
Sbjct  262  MVLAPFTGVDHHGKCVTFG  280



>gb|EEE63447.1| hypothetical protein OsJ_18260 [Oryza sativa Japonica Group]
Length=748

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK  +P F++   VD+  +L R+FWAD   R N+++FGD +S D+TY TN+Y +
Sbjct  282  VGQLERKKEVNPAFFYEFMVDKQGRLVRVFWADAICRKNYSVFGDVLSVDSTYSTNQYNM  341

Query  184  VFVPFTGVDHHKKSVTFAA  240
             FVPFTGV+HH +SV   A
Sbjct  342  KFVPFTGVNHHLQSVFLGA  360



>ref|XP_010678296.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=331

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            +D +  KK     F++  ++D+   L + FWADP  R N+ +FGD +SFD TY TNRY +
Sbjct  63   VDNFKMKKLLWGAFFYDFEIDDEQCLTKAFWADPICRKNYALFGDMVSFDTTYETNRYNM  122

Query  184  VFVPFTGVDHHKKSVTFAA  240
            VF PFTGVDH K+ +TF A
Sbjct  123  VFGPFTGVDHLKRCITFGA  141



>gb|AAS79743.1| putative Mutator-like transposase [Oryza sativa Japonica Group]
Length=1510

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK  +P F++   VD+  +L R+FWAD   R N+++FGD +S D+TY TN+Y +
Sbjct  891  VGQLERKKEVNPAFFYEFMVDKQGRLVRVFWADAICRKNYSVFGDVLSVDSTYSTNQYNM  950

Query  184  VFVPFTGVDHHKKSVTFAA  240
             FVPFTGV+HH +SV   A
Sbjct  951  KFVPFTGVNHHLQSVFLGA  969



>ref|XP_002456061.1| hypothetical protein SORBIDRAFT_03g029670 [Sorghum bicolor]
 gb|EES01181.1| hypothetical protein SORBIDRAFT_03g029670 [Sorghum bicolor]
Length=549

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +1

Query  19   EKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPF  198
            +++N  PDFYF + VD+  +L  +FW D Q+R ++  FGD + FD+TY  NRYK+ FVPF
Sbjct  60   KRRNTDPDFYFDYKVDDDSRLMSLFWCDTQSRMDYQSFGDVVVFDSTYRMNRYKMPFVPF  119

Query  199  TGVDHHKKSVTFA  237
             G++HH+ +  F 
Sbjct  120  VGLNHHRNTTVFG  132



>ref|XP_010675531.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=617

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDE-LDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            I+ +  K+  +P FYFA+++++   QL  +FWAD  +R N+ ++ D +SFD TY TNRYK
Sbjct  243  IENFKRKQKINPSFYFAYEINKSTRQLKHVFWADGISRKNYALYDDVVSFDTTYDTNRYK  302

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            ++F PFTG+D+H+  +TF A
Sbjct  303  MIFAPFTGLDNHRLCITFGA  322



>ref|XP_010238888.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=914

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            ID   +++  +P F+F + +D+ ++L  +FWAD   R N+ +FG+ +SFD+TY TN+Y +
Sbjct  290  IDNLRKRQEINPGFFFEYVLDDKNRLTHVFWADACCRKNYALFGEMVSFDSTYNTNQYSM  349

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +F PFTG++HH  SV + A
Sbjct  350  IFCPFTGINHHMASVFYGA  368



>ref|XP_010692636.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=334

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            I   + +K  +  F+F +  +  + L R+FWAD   R N+  FGD +SFDATYGTN Y L
Sbjct  56   ISTLSRQKEMNSGFFFDYVANAKEGLHRVFWADALCRTNYFAFGDVVSFDATYGTNMYNL  115

Query  184  VFVPFTGVDHHKKSVTFAA  240
            VF PFT +DHHK+SV F A
Sbjct  116  VFCPFTRIDHHKRSVIFGA  134



>gb|EAY74255.1| hypothetical protein OsI_02146 [Oryza sativa Indica Group]
Length=294

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  22   KKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFT  201
            ++   PDF+F  + DE   L R+FWAD Q+R ++  FGD + FD+TY TNRYKL F+PF 
Sbjct  185  REERDPDFFFRFEADEDRHLKRLFWADSQSRLDYEAFGDVVVFDSTYRTNRYKLPFIPFV  244

Query  202  GVDHHKKSVTFA  237
            G++ H+ +V F 
Sbjct  245  GLNQHRSTVVFG  256



>ref|XP_002444124.1| hypothetical protein SORBIDRAFT_07g008830 [Sorghum bicolor]
 gb|EES13619.1| hypothetical protein SORBIDRAFT_07g008830 [Sorghum bicolor]
Length=331

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK  +  F++  +V+E  +L R+FWAD  +R N+++FGD +S DATY TN+Y +
Sbjct  21   VAQLERKKEVNSAFFYEFEVNEEGRLVRVFWADALSRKNYHVFGDVISVDATYTTNQYNM  80

Query  184  VFVPFTGVDHHKKSVTFAA  240
             FVPFTGV HH +SV   A
Sbjct  81   KFVPFTGVSHHLQSVFLGA  99



>ref|XP_010266298.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
Length=775

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            + D        +P F++A   DE   +  IFWADP+AR N+  FGDT++FD T+ +NRY+
Sbjct  235  LJDYLKHMHAXNPSFFYAVQGDEDQCMSNIFWADPKARXNYTYFGDTVTFDTTFRSNRYR  294

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  295  LPFAPFTGVNHHGQPVLFG  313



>ref|XP_002446625.1| hypothetical protein SORBIDRAFT_06g019085 [Sorghum bicolor]
 gb|EES10953.1| hypothetical protein SORBIDRAFT_06g019085 [Sorghum bicolor]
Length=343

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +1

Query  19   EKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPF  198
            +++N  PDFYF + VD+   L  +FW D Q+R ++  FGD + FD+TY  NRYK+ FVPF
Sbjct  84   KRRNTDPDFYFDYKVDDDSPLMSLFWCDTQSRMDYQSFGDVVVFDSTYRMNRYKMPFVPF  143

Query  199  TGVDHHKKSVTFA  237
             G++HH+ +  F 
Sbjct  144  VGLNHHRNTTVFG  156



>ref|XP_010678162.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=386

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +1

Query  4    IDKYTEKKNASPD-FYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++ + EK  +S   F+F + VDE   L R+FWAD  +R N+++FGD +SFD T+ TN+Y 
Sbjct  181  VNNFKEKATSSGGGFFFDYCVDENRHLTRVFWADAISRKNYSLFGDMVSFDTTFDTNKYC  240

Query  181  LVFVPFTGVDHHKKSVTFA  237
            +V  PFTGVDHH K VTF 
Sbjct  241  MVLAPFTGVDHHGKCVTFG  259



>ref|XP_002443950.1| hypothetical protein SORBIDRAFT_07g004960 [Sorghum bicolor]
 gb|EES13445.1| hypothetical protein SORBIDRAFT_07g004960 [Sorghum bicolor]
Length=414

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            +++   KK  +P F++   VD+  +L R+FWAD   R N ++FGD +S D+TY TN+Y +
Sbjct  180  VEQLERKKEVNPAFFYEFMVDKQGRLVRVFWADAICRKNCSVFGDILSVDSTYTTNQYNM  239

Query  184  VFVPFTGVDHHKKSVTFAA  240
             FVPFTGV+HH +SV   A
Sbjct  240  KFVPFTGVNHHLQSVFLGA  258



>ref|XP_002444085.1| hypothetical protein SORBIDRAFT_07g007480 [Sorghum bicolor]
 gb|EES13580.1| hypothetical protein SORBIDRAFT_07g007480 [Sorghum bicolor]
Length=248

 Score = 82.0 bits (201),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + ++  KK A+P F++   VD+  +L R+FWAD   R N ++FGD +  D+TY TN+Y +
Sbjct  138  VHQHERKKEANPAFFYEFMVDKEGRLVRVFWADATCRKNCSVFGDVLLVDSTYTTNQYDM  197

Query  184  VFVPFTGVDHHKKSVTFAA  240
             FVPFTGV+HH +SV   A
Sbjct  198  KFVPFTGVNHHLQSVFLGA  216



>gb|KHN32934.1| Protein FAR1-RELATED SEQUENCE 5 [Glycine soja]
Length=774

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+D   +    +P+F++A   DE   +  +FWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  235  VLDYLRQMHAENPNFFYAVQGDEDQSITNVFWADPKARMNYTFFGDTVTFDTTYRSNRYR  294

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F  FTGV+HH + V F 
Sbjct  295  LPFAFFTGVNHHGQPVLFG  313



>ref|XP_002453665.1| hypothetical protein SORBIDRAFT_04g010080 [Sorghum bicolor]
 gb|EES06641.1| hypothetical protein SORBIDRAFT_04g010080 [Sorghum bicolor]
Length=591

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +1

Query  19   EKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPF  198
            +++N  PDFYF + VD+  +L  +FW D Q+R ++  FGD + FD+TY  NRYK+ FVPF
Sbjct  82   KRRNTDPDFYFDYKVDDDSRLMSLFWCDTQSRMDYQSFGDVVVFDSTYRMNRYKMPFVPF  141

Query  199  TGVDHHKKSVTFA  237
             G++HH+ +  F 
Sbjct  142  VGLNHHRNTTVFG  154



>ref|XP_003517928.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Glycine max]
Length=776

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+D   +    +P+F++A   DE   +  +FWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  235  VLDYLRQMHAENPNFFYAVQGDEDQSITNVFWADPKARMNYTFFGDTVTFDTTYRSNRYR  294

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F  FTGV+HH + V F 
Sbjct  295  LPFAFFTGVNHHGQPVLFG  313



>gb|KHN46858.1| Protein FAR1-RELATED SEQUENCE 5 [Glycine soja]
Length=777

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+D   +    +P+F++A   DE   +  +FWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  235  VLDYLRQMHAENPNFFYAVQGDEDQSITNVFWADPKARMNYTFFGDTVTFDTTYRSNRYR  294

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F  FTGV+HH + V F 
Sbjct  295  LPFAFFTGVNHHGQPVLFG  313



>ref|XP_006384877.1| hypothetical protein POPTR_0004s21880g [Populus trichocarpa]
 gb|ERP62674.1| hypothetical protein POPTR_0004s21880g [Populus trichocarpa]
Length=789

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   + ++ +PDF++A   D+      + WADP+AR N++ FGDT++FD TY +NRY+
Sbjct  247  LLDYLRQMQSENPDFFYALQGDDGQFTGNVLWADPRARANYSYFGDTVTFDTTYRSNRYR  306

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  307  LPFAPFTGVNHHGQPVLFG  325



>ref|XP_010649323.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Vitis 
vinifera]
Length=786

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D     +  +P F +A   DE   +  IFWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  246  LLDYLRNMQAENPAFVYAVQGDEDQCMSNIFWADPKARMNYTYFGDTVTFDTTYRSNRYR  305

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  306  LPFAPFTGVNHHGQPVLFG  324



>ref|XP_011040842.1| PREDICTED: LOW QUALITY PROTEIN: protein FAR1-RELATED SEQUENCE 
5-like [Populus euphratica]
Length=789

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   + ++ +PDF++A   D+      + WADP+AR N++ FGDT++FD TY +NRY+
Sbjct  247  LLDYLRQMQSENPDFFYALQGDDGQFTGNVLWADPRARANYSYFGDTVTFDTTYRSNRYR  306

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  307  LPFAPFTGVNHHGQPVLFG  325



>ref|XP_010238967.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=607

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            ID   +++  +P F+F + +D+ + L  +FWAD   R N+ +FG+ +SFD+TY TN+Y +
Sbjct  186  IDNLRKRQEINPGFFFEYVLDDKNWLTHVFWADACCRKNYALFGEMVSFDSTYSTNQYSM  245

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +F PFTG++HH  SV + A
Sbjct  246  IFCPFTGINHHMASVFYGA  264



>ref|XP_008654819.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=589

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK A+  F++   VDE  +L  IFWAD  +R N++ FGD +SFDATY TN+Y +
Sbjct  287  VAQMERKKEANSAFFYDLVVDEHGKLVSIFWADATSRKNYSHFGDLVSFDATYSTNQYNM  346

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +F PFTGV+HH +SV F A
Sbjct  347  IFAPFTGVNHHMQSVFFGA  365



>gb|KDP47038.1| hypothetical protein JCGZ_10765 [Jatropha curcas]
Length=786

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +  N +P+F++A   DE      +FWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  242  LLDYLRQMHNENPNFFYAVQGDEEQYTGNVFWADPKARTNYTYFGDTVTFDTTYRSNRYR  301

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH   V F  
Sbjct  302  LPFAPFTGVNHHGHPVLFGC  321



>ref|XP_010649324.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Vitis 
vinifera]
Length=780

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D     +  +P F +A   DE   +  IFWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  240  LLDYLRNMQAENPAFVYAVQGDEDQCMSNIFWADPKARMNYTYFGDTVTFDTTYRSNRYR  299

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  300  LPFAPFTGVNHHGQPVLFG  318



>ref|XP_010649325.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Vitis 
vinifera]
Length=751

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D     +  +P F +A   DE   +  IFWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  246  LLDYLRNMQAENPAFVYAVQGDEDQCMSNIFWADPKARMNYTYFGDTVTFDTTYRSNRYR  305

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  306  LPFAPFTGVNHHGQPVLFG  324



>ref|XP_008357827.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Malus 
domestica]
Length=746

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +++   P F+FA   DE   +   FW DP+AR+++  FGDT++FD TY +NRY+
Sbjct  253  LLDYLKDRQAKDPAFFFAVQGDEDQCMGNFFWVDPKARNDYTYFGDTVTFDTTYRSNRYR  312

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  313  LPFAPFTGVNHHGQPVFFG  331



>emb|CAN71534.1| hypothetical protein VITISV_018182 [Vitis vinifera]
Length=737

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D     +  +P F +A   DE   +  IFWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  246  LLDYLRNMQAENPAFVYAVQGDEDQCMSNIFWADPKARMNYTYFGDTVTFDTTYRSNRYR  305

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  306  LPFAPFTGVNHHGQPVLFG  324



>ref|XP_008357828.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Malus 
domestica]
Length=792

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +++   P F+FA   DE   +   FW DP+AR+++  FGDT++FD TY +NRY+
Sbjct  253  LLDYLKDRQAKDPAFFFAVQGDEDQCMGNFFWVDPKARNDYTYFGDTVTFDTTYRSNRYR  312

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  313  LPFAPFTGVNHHGQPVFFG  331



>ref|XP_006486554.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Citrus sinensis]
Length=786

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   + +  +P+F++A   DE      +FWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  244  LLDYLKQMQAENPNFFYAVQGDEDQSTGNVFWADPKARTNYTYFGDTVTFDTTYRSNRYR  303

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + V F  
Sbjct  304  LPFAPFTGVNHHGQPVLFGC  323



>dbj|BAD19318.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
Length=880

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI  +  ++    +F+F ++ DE  +L R+FW+DPQ+R +++ FGD + FD+TY  NRY 
Sbjct  238  VIKYFQWRQKHDMEFFFEYETDEAGRLKRLFWSDPQSRIDYDAFGDVVVFDSTYRVNRYN  297

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F+PF GV+HH  ++ F 
Sbjct  298  LPFIPFVGVNHHGSTIIFG  316



>ref|XP_011088828.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Sesamum indicum]
 ref|XP_011088829.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Sesamum indicum]
 ref|XP_011088830.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Sesamum indicum]
Length=786

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +K+  +P F++A   DE      +FWADP+AR +++ FGDT++FD TY +NRY+
Sbjct  244  LLDYLKQKQAENPSFFYAVQGDEDQYTGNVFWADPKARTDYSYFGDTVTFDTTYRSNRYR  303

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L FVPFTG++HH + V F  
Sbjct  304  LPFVPFTGLNHHGQPVLFGC  323



>ref|XP_010229979.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=722

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            ID   +++  +P F+F + +D+ + L  +FWAD   R N+ +FG+ +SFD+TY TN+Y +
Sbjct  290  IDNLRKRQEINPGFFFEYVLDDKNWLTHVFWADACCRKNYALFGEMVSFDSTYSTNQYGM  349

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +F PFTG++HH  SV + A
Sbjct  350  IFCPFTGINHHMASVFYGA  368



>ref|XP_007043118.1| FAR1-related sequence 5 [Theobroma cacao]
 gb|EOX98949.1| FAR1-related sequence 5 [Theobroma cacao]
Length=791

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQ--LCRIFWADPQARHNFNIFGDTMSFDATYGTNR  174
            ++D   + +  +P+F++A   DE DQ  +  +FWADP++R N+  FGDT++FD TY +NR
Sbjct  253  LLDYLRQMQAENPNFFYAVQGDE-DQALMSNVFWADPKSRMNYTYFGDTVTFDTTYRSNR  311

Query  175  YKLVFVPFTGVDHHKKSVTFA  237
            Y+L F PFTGV+HH + V F 
Sbjct  312  YRLPFAPFTGVNHHGQPVLFG  332



>ref|XP_006422378.1| hypothetical protein CICLE_v10027888mg [Citrus clementina]
 gb|ESR35618.1| hypothetical protein CICLE_v10027888mg [Citrus clementina]
Length=736

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   + +  +P+F++A   DE      +FWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  244  LLDYLKQMQAENPNFFYAVQGDEDQSTGNVFWADPKARINYTYFGDTVTFDTTYRSNRYR  303

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + V F  
Sbjct  304  LPFAPFTGVNHHGQPVLFGC  323



>ref|XP_009359644.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Pyrus 
x bretschneideri]
Length=746

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +++   P F+FA   DE   +   FW DP+AR+++  FGDT++FD TY +NRY+
Sbjct  253  LLDYLKDRQAKDPAFFFAVQGDEDQCVGNFFWVDPKARNDYTYFGDTVTFDTTYRSNRYR  312

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  313  LPFAPFTGVNHHGQPVFFG  331



>dbj|BAD10392.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
 dbj|BAD09065.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
Length=690

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI     ++    +F++ ++ DE  +L R+FWADPQ+R +++ FGD + FD+TY  N+Y 
Sbjct  172  VIKYMQARQKDDMEFFYEYETDEAGRLKRLFWADPQSRIDYDAFGDVVVFDSTYRVNKYN  231

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F+PF GV+HH  ++ FA
Sbjct  232  LPFIPFVGVNHHGSTIIFA  250



>ref|XP_009359643.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Pyrus 
x bretschneideri]
Length=792

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +++   P F+FA   DE   +   FW DP+AR+++  FGDT++FD TY +NRY+
Sbjct  253  LLDYLKDRQAKDPAFFFAVQGDEDQCVGNFFWVDPKARNDYTYFGDTVTFDTTYRSNRYR  312

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  313  LPFAPFTGVNHHGQPVFFG  331



>gb|KGN43377.1| hypothetical protein Csa_7G029420 [Cucumis sativus]
Length=826

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +  + +P+F++A   +E   +  +FWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  247  LLDYLRQMHSENPNFFYAVQGEEDQCVGNVFWADPKARMNYTYFGDTVTFDTTYRSNRYR  306

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  307  LPFAPFTGVNHHGQPVLFG  325



>ref|XP_008451177.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Cucumis melo]
 ref|XP_008451178.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Cucumis melo]
 ref|XP_008451179.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Cucumis melo]
 ref|XP_008451181.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Cucumis melo]
Length=790

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +  + +P+F++A   +E   +  +FWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  247  LLDYLRQMHSENPNFFYAVQGEEDQSVGNVFWADPKARMNYTYFGDTVTFDTTYRSNRYR  306

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + V F  
Sbjct  307  LPFAPFTGVNHHGQPVLFGC  326



>ref|XP_010695510.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=834

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            +D +  KK     F++  +VD+   L + FWADP  R N+ +FGD +S D TY TNRY +
Sbjct  331  VDNFKMKKLLWGAFFYDFEVDDEQCLTKAFWADPICRKNYALFGDMVSVDTTYETNRYNM  390

Query  184  VFVPFTGVDHHKKSVTFA  237
            VF PFTGVDH ++ +TF 
Sbjct  391  VFGPFTGVDHRRRCITFG  408



>ref|XP_004289021.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=781

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +1

Query  19   EKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPF  198
            +++   P F++A   D+   +  IFWADP+AR ++  FGDT++FD TY +NRY+L F PF
Sbjct  249  DRQVKDPAFFYAVQGDQEQCMSNIFWADPKARSDYTYFGDTVTFDTTYRSNRYRLPFAPF  308

Query  199  TGVDHHKKSVTFA  237
            TGV+HH + V F 
Sbjct  309  TGVNHHGQPVLFG  321



>ref|XP_004144566.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Cucumis sativus]
 ref|XP_004162884.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Cucumis sativus]
Length=790

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +  + +P+F++A   +E   +  +FWADP+AR N+  FGDT++FD TY +NRY+
Sbjct  247  LLDYLRQMHSENPNFFYAVQGEEDQCVGNVFWADPKARMNYTYFGDTVTFDTTYRSNRYR  306

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  307  LPFAPFTGVNHHGQPVLFG  325



>ref|XP_010259175.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
Length=819

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  37   PDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHH  216
            P F++A  VDE D+L  +FW D ++R  +N F D ++FD TY  N+YK+ F PFTGV+HH
Sbjct  270  PAFFYAIQVDEEDRLSSVFWVDTRSRIAYNCFSDVVAFDTTYQVNQYKMPFAPFTGVNHH  329

Query  217  KKSVTFA  237
            K+SV F 
Sbjct  330  KQSVLFG  336



>ref|XP_010259163.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010259169.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
Length=826

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  37   PDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHH  216
            P F++A  VDE D+L  +FW D ++R  +N F D ++FD TY  N+YK+ F PFTGV+HH
Sbjct  277  PAFFYAIQVDEEDRLSSVFWVDTRSRIAYNCFSDVVAFDTTYQVNQYKMPFAPFTGVNHH  336

Query  217  KKSVTFA  237
            K+SV F 
Sbjct  337  KQSVLFG  343



>ref|XP_010259189.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X4 [Nelumbo 
nucifera]
Length=794

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  37   PDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHH  216
            P F++A  VDE D+L  +FW D ++R  +N F D ++FD TY  N+YK+ F PFTGV+HH
Sbjct  277  PAFFYAIQVDEEDRLSSVFWVDTRSRIAYNCFSDVVAFDTTYQVNQYKMPFAPFTGVNHH  336

Query  217  KKSVTFA  237
            K+SV F 
Sbjct  337  KQSVLFG  343



>ref|XP_010259180.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Nelumbo 
nucifera]
 ref|XP_010259184.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Nelumbo 
nucifera]
Length=807

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  37   PDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHH  216
            P F++A  VDE D+L  +FW D ++R  +N F D ++FD TY  N+YK+ F PFTGV+HH
Sbjct  258  PAFFYAIQVDEEDRLSSVFWVDTRSRIAYNCFSDVVAFDTTYQVNQYKMPFAPFTGVNHH  317

Query  217  KKSVTFA  237
            K+SV F 
Sbjct  318  KQSVLFG  324



>ref|NP_001049063.1| Os03g0164400 [Oryza sativa Japonica Group]
 dbj|BAF10977.1| Os03g0164400, partial [Oryza sativa Japonica Group]
Length=627

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI     ++    DFY+ ++ DE   L R+FWADPQ+R +++ FGD + FD+TY  N+Y 
Sbjct  191  VIKYMQARQKDDMDFYYEYETDEAGCLKRLFWADPQSRIDYDAFGDVVVFDSTYRVNKYN  250

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F+PF GV+HH  +V F 
Sbjct  251  LPFIPFVGVNHHGSTVIFG  269



>gb|AAX92763.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
 gb|ABA91508.1| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1185

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/77 (43%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +1

Query  10   KYTEKKNASP-DFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLV  186
            KY + +     +FY+ +++D+   L R+FW+DPQ+R +++ FGD + FD+TY  N+Y L 
Sbjct  760  KYMQARQKDDMEFYYDYEIDQAGCLKRLFWSDPQSRIDYDAFGDVVVFDSTYRVNKYNLP  819

Query  187  FVPFTGVDHHKKSVTFA  237
            F+PF GV+HH  +V FA
Sbjct  820  FIPFVGVNHHGSTVIFA  836



>ref|XP_003618131.1| FAR1-related protein [Medicago truncatula]
Length=786

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFA--HDVDELDQ-LCRIFWADPQARHNFNIFGDTMSFDATYGTN  171
            V+D   +    +P+F+FA   D+D+ D  +  +FWADP+AR N+  FGDT++FD TY +N
Sbjct  241  VLDYLRQMHAQNPNFFFAVQGDLDDEDHPITNVFWADPKARLNYTFFGDTVTFDTTYRSN  300

Query  172  RYKLVFVPFTGVDHHKKSVTFAA  240
            RY+L F PFTGV+HH + V F  
Sbjct  301  RYRLPFAPFTGVNHHGQPVLFGC  323



>gb|AAX94831.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1023

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 31/66 (47%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  40   DFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHHK  219
            +FY+ +++D+   L R+FW+DPQ+R +++ FGD + FD+TY  N+Y L F+PF GV+HH 
Sbjct  771  EFYYDYEIDQAGCLKRLFWSDPQSRIDYDAFGDVVVFDSTYRVNKYNLPFIPFVGVNHHG  830

Query  220  KSVTFA  237
             +V FA
Sbjct  831  STVIFA  836



>ref|XP_010233373.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=325

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI     ++   P+F+F + VD    L  +FWAD Q+R ++ +FGD + FD+TY TN+Y 
Sbjct  192  VICHMMARQERDPNFFFKNLVDGEGHLKGLFWADSQSRLDYEVFGDVVVFDSTYRTNKYN  251

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L+FVPF G++HH+ +V F 
Sbjct  252  LLFVPFVGLNHHRSTVVFG  270



>ref|XP_006655317.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Oryza brachyantha]
 ref|XP_006658608.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Oryza brachyantha]
Length=729

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK  +P F++   VD+  +L R+FWAD   R N ++FGD +S D+TY TN+Y +
Sbjct  269  VGQLERKKEVNPAFFYEFMVDKQGRLVRVFWADAICRKNCSVFGDVISVDSTYTTNQYNM  328

Query  184  VFVPFTGVDHHKKSVTFAA  240
             FVPFTGV+HH +SV   A
Sbjct  329  KFVPFTGVNHHLQSVFLGA  347



>gb|AAM15785.1|AC104428_6 Putative far-red impaired response protein [Oryza sativa Japonica 
Group]
Length=611

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI     ++    DFY+ ++ DE   L R+FWADPQ+R +++ FGD + FD+TY  N+Y 
Sbjct  197  VIKYMQARQKDDMDFYYEYETDEAGCLKRLFWADPQSRIDYDAFGDVVVFDSTYRVNKYN  256

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F+PF GV+HH  +V F 
Sbjct  257  LPFIPFVGVNHHGSTVIFG  275



>ref|XP_011030709.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Populus euphratica]
Length=807

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D    K+  +  F++A   DE   +  IFWAD +AR N+  FGDT++FD TY +NRY+
Sbjct  267  LLDYLRNKQAENSAFFYAVQGDEDQCMSNIFWADAKARANYTYFGDTVTFDTTYRSNRYR  326

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  327  LPFAPFTGVNHHGQPVLFG  345



>ref|XP_009360548.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Pyrus x bretschneideri]
 ref|XP_009360549.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Pyrus x bretschneideri]
 ref|XP_009360550.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Pyrus x bretschneideri]
Length=712

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  31   ASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVD  210
            + P FY+A  VDE ++L  +FW D ++R  +N F D ++FD TY  N+YK+ F PFTGV+
Sbjct  266  SDPAFYYAIQVDEEERLSSVFWVDTRSRIAYNCFSDVVAFDTTYQVNQYKMPFAPFTGVN  325

Query  211  HHKKSVTFA  237
            HHK SV F 
Sbjct  326  HHKHSVLFG  334



>ref|XP_011004404.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Populus euphratica]
Length=807

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D    K+  +  F++A   DE   +  IFWAD +AR N+  FGDT++FD TY +NRY+
Sbjct  267  LLDYLRNKQAENSAFFYAVQGDEDQCMSNIFWADAKARANYTYFGDTVTFDTTYRSNRYR  326

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  327  LPFAPFTGVNHHGQPVLFG  345



>gb|KFK30428.1| hypothetical protein AALP_AA7G259900 [Arabis alpina]
Length=733

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +1

Query  13   YTEKKNA-SPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVF  189
            Y  + NA +P+FY+A    E   +  +FWADP+AR +F  FGDT++FD TY +NRY+L F
Sbjct  246  YLRQMNADNPNFYYAVQGSEDHSVGNVFWADPKARADFTYFGDTVTFDTTYRSNRYRLPF  305

Query  190  VPFTGVDHHKKSVTFAA  240
             PFTGV+HH + + F  
Sbjct  306  APFTGVNHHGQPILFGC  322



>ref|XP_006377868.1| hypothetical protein POPTR_0011s14880g [Populus trichocarpa]
 gb|ERP55665.1| hypothetical protein POPTR_0011s14880g [Populus trichocarpa]
Length=807

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D    K+  +  F++A   DE   +  IFWAD +AR N+  FGDT++FD TY +NRY+
Sbjct  267  LLDYLRNKQAENSAFFYAVQGDEDQCMSNIFWADAKARANYTYFGDTVTFDTTYRSNRYR  326

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  327  LPFAPFTGVNHHGQPVLFG  345



>ref|XP_010270590.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
Length=783

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+D     +  +P F++A   DEL     IFWAD  +R N++ FGDT++FD TY TNRY+
Sbjct  249  VLDYLKRMQAENPSFFYAIQGDELST-GNIFWADASSRMNYSYFGDTVTFDTTYRTNRYR  307

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTG++HH + V F 
Sbjct  308  VPFAPFTGLNHHGQPVLFG  326



>ref|XP_008368438.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
 ref|XP_008368439.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=712

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  31   ASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVD  210
            + P FY+A  VDE ++L  +FW D ++R  +N F D ++FD TY  N+YK+ F PFTGV+
Sbjct  266  SDPAFYYAIQVDEEERLSSVFWVDTRSRIAYNCFSDVVAFDTTYQVNQYKMPFAPFTGVN  325

Query  211  HHKKSVTFA  237
            HHK SV F 
Sbjct  326  HHKHSVLFG  334



>ref|XP_008669590.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
 ref|XP_008670829.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
 ref|XP_008662561.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=499

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK A+  F++   VDE  +L  IFWAD  +R N++ FGD +S DATY TN+Y +
Sbjct  308  VAQLERKKEANIAFFYDFVVDEQGKLVYIFWADATSRKNYSHFGDLVSVDATYSTNQYNM  367

Query  184  VFVPFTGVDHHKKSVTFAA  240
             FVPFTGV+HH +SV F A
Sbjct  368  KFVPFTGVNHHMQSVFFGA  386



>gb|ABF94141.1| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAG88664.1| unnamed protein product [Oryza sativa Japonica Group]
Length=552

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI     ++    DFY+ ++ DE   L R+FWADPQ+R +++ FGD + FD+TY  N+Y 
Sbjct  180  VIKYMQARQKDDMDFYYEYETDEAGCLKRLFWADPQSRIDYDAFGDVVVFDSTYRVNKYN  239

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F+PF GV+HH  +V F  
Sbjct  240  LPFIPFVGVNHHGSTVIFGC  259



>ref|XP_002450570.1| hypothetical protein SORBIDRAFT_05g007130 [Sorghum bicolor]
 gb|EES09558.1| hypothetical protein SORBIDRAFT_05g007130 [Sorghum bicolor]
Length=698

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI   TE K   PDF+F +  D    L  + W D Q R ++  FGD + FD+TY TNRY 
Sbjct  193  VISYLTECKRRDPDFFFQYKTDREGHLKGLIWCDCQCRLDYRAFGDVVVFDSTYKTNRYN  252

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L  VPF GV+HH  +V FA
Sbjct  253  LPLVPFVGVNHHGSTVLFA  271



>ref|XP_007032686.1| FAR1-related sequence 5 [Theobroma cacao]
 gb|EOY03612.1| FAR1-related sequence 5 [Theobroma cacao]
Length=791

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  37   PDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHH  216
            P FY+A  VDE D+L  +FW D ++R  +N F D +SFD TY  N+YK+ F PF GV+HH
Sbjct  259  PAFYYAIQVDEEDRLSSVFWVDTRSRIAYNCFSDVVSFDTTYQVNQYKMPFAPFIGVNHH  318

Query  217  KKSVTFA  237
            ++SV F 
Sbjct  319  RQSVLFG  325



>ref|XP_004309932.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=454

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ +  +K   P FYF  D DE +++ R FWADP ++  +  F D + FD TY TN+Y+
Sbjct  34   LLEYFESEKEKKPSFYFEVDRDEENRMTRCFWADPTSKKAYFFFNDVVVFDTTYNTNKYR  93

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            ++F P TGV+HH +++ F  
Sbjct  94   MIFAPITGVNHHGQTIVFGC  113



>gb|KDP36732.1| hypothetical protein JCGZ_08023 [Jatropha curcas]
Length=763

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V D   E + A P F++A   D  +    IFWAD  +R N+  FGDT++FD TY TNRY+
Sbjct  242  VFDYLKEMQTADPGFFYAVQGDFENSSGNIFWADASSRRNYTFFGDTVTFDTTYRTNRYR  301

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTG +HH + V F 
Sbjct  302  VPFAPFTGWNHHGQPVLFG  320



>ref|XP_004966891.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=415

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++   + +   P+F+F   VD   +L  +FW+D Q++ ++ +FGD + FD+TY  NRY 
Sbjct  198  VLNHMRQMQEKDPEFFFTFSVDAQGRLKNLFWSDAQSQIDYGVFGDVVVFDSTYRVNRYN  257

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L FVPF GV+HH+ +V F 
Sbjct  258  LPFVPFIGVNHHRSTVVFG  276



>ref|XP_006411599.1| hypothetical protein EUTSA_v10024456mg [Eutrema salsugineum]
 gb|ESQ53052.1| hypothetical protein EUTSA_v10024456mg [Eutrema salsugineum]
Length=789

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +    +P+FY+A    E   +  +FWADP+AR +F  FGDT++FD TY +NRY+
Sbjct  247  LLDYLRQMSADNPNFYYAVQGSEDQSVGNVFWADPKARMDFAYFGDTVTFDTTYRSNRYR  306

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + + F  
Sbjct  307  LPFAPFTGVNHHGQPILFGC  326



>ref|XP_006281824.1| hypothetical protein CARUB_v10028009mg [Capsella rubella]
 gb|EOA14722.1| hypothetical protein CARUB_v10028009mg [Capsella rubella]
Length=809

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++ + +KK  +  F+++  +DE D +  IFWAD ++  +FN FGD + FD TY TN Y 
Sbjct  264  VLEYFQKKKEDNSSFFYSMQLDEDDMITNIFWADDRSISDFNRFGDVVCFDTTYKTNEYD  323

Query  181  LVFVPFTGVDHHKKSVTFAA  240
              F PF GV+HHK+++ F A
Sbjct  324  RPFAPFVGVNHHKQTIVFGA  343



>ref|XP_004491651.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Cicer arietinum]
Length=776

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 7/84 (8%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFA----HDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGT  168
            V+D   +    +P+F++A    HD D++  L   FWADP+AR N+  FGDT++FD TY +
Sbjct  233  VLDYLRQMHAQNPNFFYAVQGDHDHDDITNL---FWADPKARLNYTFFGDTVTFDTTYRS  289

Query  169  NRYKLVFVPFTGVDHHKKSVTFAA  240
            NRY+L F PFTGV+HH + V F  
Sbjct  290  NRYRLPFAPFTGVNHHGQPVLFGC  313



>emb|CBI22289.3| unnamed protein product [Vitis vinifera]
Length=855

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  31   ASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVD  210
            + P F++A  VDE D+L  +FW D ++R  +N F D ++FD TY  N+YK+ F PFTG++
Sbjct  302  SDPAFFYAIQVDEEDRLSSVFWVDTRSRIAYNCFSDVVAFDTTYQVNQYKMPFAPFTGLN  361

Query  211  HHKKSVTFA  237
            HHK+SV F 
Sbjct  362  HHKQSVLFG  370



>gb|EEC84007.1| hypothetical protein OsI_30215 [Oryza sativa Indica Group]
Length=617

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI     ++    +F++ ++ DE  +L R+FWADPQ+R +++ FGD + FD+TY  N+Y 
Sbjct  107  VIKYMQARQKDDMEFFYEYETDEAGRLKRLFWADPQSRIDYDAFGDVVVFDSTYRVNKYN  166

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F+PF GV++H  +V FA
Sbjct  167  LPFIPFVGVNNHGSTVIFA  185



>ref|XP_010661125.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Vitis vinifera]
Length=808

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  31   ASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVD  210
            + P F++A  VDE D+L  +FW D ++R  +N F D ++FD TY  N+YK+ F PFTG++
Sbjct  255  SDPAFFYAIQVDEEDRLSSVFWVDTRSRIAYNCFSDVVAFDTTYQVNQYKMPFAPFTGLN  314

Query  211  HHKKSVTFA  237
            HHK+SV F 
Sbjct  315  HHKQSVLFG  323



>emb|CAN68961.1| hypothetical protein VITISV_019276 [Vitis vinifera]
Length=808

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  31   ASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVD  210
            + P F++A  VDE D+L  +FW D ++R  +N F D ++FD TY  N+YK+ F PFTG++
Sbjct  255  SDPAFFYAIQVDEEDRLSSVFWVDTRSRIAYNCFSDVVAFDTTYQVNQYKMPFAPFTGLN  314

Query  211  HHKKSVTFA  237
            HHK+SV F 
Sbjct  315  HHKQSVLFG  323



>dbj|BAB33151.1| hypothetical protein [Carthamus tinctorius]
Length=699

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +I+    ++  SP F+F    +E  +L  IFWAD  AR N+  FGD +SFDATY T ++ 
Sbjct  228  LINTMVNRQKISPQFFFEFKCNE-KELLAIFWADEVARMNYREFGDAISFDATYRTQKHA  286

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            ++FVPF  VD+HKKSV   A
Sbjct  287  MIFVPFVAVDNHKKSVVVGA  306



>ref|XP_006364336.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Solanum tuberosum]
Length=781

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +    +P F++A   DE      +FWAD +AR N+N FGDT++FD TY +NRY+
Sbjct  239  LLDYLKQMNIQNPGFFYAVQGDEGQCTGNVFWADSKARANYNYFGDTVTFDTTYRSNRYR  298

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + V F  
Sbjct  299  LPFAPFTGVNHHGQPVLFGC  318



>ref|XP_006285782.1| hypothetical protein CARUB_v10007256mg [Capsella rubella]
 gb|EOA18680.1| hypothetical protein CARUB_v10007256mg [Capsella rubella]
Length=793

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +1

Query  13   YTEKKNA-SPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVF  189
            Y  + NA +P+F++A    E   +  +FWADP+AR +F+ FGDT++FD TY +NRY+L F
Sbjct  254  YLRQMNADNPNFFYAVQGAEDQSVGNVFWADPKARLDFSFFGDTVTFDTTYRSNRYRLPF  313

Query  190  VPFTGVDHHKKSVTFAA  240
             PFTGV+HH + + F  
Sbjct  314  APFTGVNHHGQPILFGC  330



>ref|XP_006477730.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Citrus sinensis]
Length=497

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ +T+ +  +P+F++A D+DE  +L  IFW D  +R ++ IFGD +SFD TY TN+Y+
Sbjct  211  MLNHFTQMQEQNPNFFYAVDLDEEQRLKNIFWVDATSREDYKIFGDVVSFDTTYNTNKYR  270

Query  181  LVFVPFTGVDHHKKSV  228
            ++F  F GV+ H +S+
Sbjct  271  MLFALFIGVNDHFQSI  286



>ref|XP_002460267.1| hypothetical protein SORBIDRAFT_02g025670 [Sorghum bicolor]
 gb|EER96788.1| hypothetical protein SORBIDRAFT_02g025670 [Sorghum bicolor]
Length=610

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+    +++N  PDFYF + VD+  +L  +FW D Q+R ++  FGD + FD+TY  NRYK
Sbjct  83   VLGLLLKRRNTDPDFYFDYKVDDDSRLMSLFWCDTQSRMDYQSFGDVVVFDSTYRMNRYK  142

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            + F PF G++HH+ +  F  
Sbjct  143  MPFDPFVGLNHHRNTTVFGC  162



>gb|AAL58182.1|AC027037_4 putative far-red impaired response protein [Oryza sativa Japonica 
Group]
Length=721

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++    ++   PDF+F + +DE  +L  +FWAD Q++ ++  F D + FD+TY  NRY 
Sbjct  197  VVNHLMAQQEQDPDFFFRYSIDEKGRLRNLFWADSQSQLDYEAFSDVVIFDSTYRVNRYN  256

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L FVPF G +HH+ +V F 
Sbjct  257  LPFVPFVGANHHRSTVIFG  275



>ref|XP_010232993.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=185

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI     ++   P+F+F + VD    L  +FWAD Q+R ++ +FGD + FD+TY TN+Y 
Sbjct  45   VICHMMARRERDPNFFFKYLVDGEGHLKGLFWADSQSRLDYEVFGDVVVFDSTYRTNKYN  104

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L FVPF G++HH  ++ F  
Sbjct  105  LPFVPFVGLNHHHSTIVFGC  124



>ref|XP_004980265.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=511

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++   + +   P+F+F   VD   +L  +FW+D Q++ ++ +FGD + FD+TY  NRY 
Sbjct  266  VLNHMRQMQEKDPEFFFTFSVDAQGRLKNLFWSDAQSQIDYGVFGDVVVFDSTYRVNRYN  325

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L FVPF GV+HH+ +V F 
Sbjct  326  LPFVPFIGVNHHRSTVVFG  344



>ref|XP_008233036.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like [Prunus mume]
Length=477

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ +T  +  +P+F++A D+DE  +L  +FW D + R ++  FGD +SFD TY TN+YK
Sbjct  170  MLELFTRMQEENPNFFYAMDLDEEQRLVNVFWVDAKGRADYKFFGDVISFDTTYITNKYK  229

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            + F PF GV++H +S     
Sbjct  230  MPFAPFIGVNNHSQSTLLGC  249



>ref|XP_010028878.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55696.1| hypothetical protein EUGRSUZ_I01547 [Eucalyptus grandis]
Length=793

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +    + +F++A   DE   +C + WAD ++R N+  FGDT++FD TY +NRY+
Sbjct  251  LLDYLKQMHAENANFFYAVQNDEDQSMCNVVWADSRSRMNYTYFGDTVTFDTTYRSNRYR  310

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + + F 
Sbjct  311  LPFAPFTGVNHHGQPILFG  329



>ref|XP_011000845.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Populus euphratica]
Length=786

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +  N +P+F++A    +      +FW+DP+AR N++ FGDT++FD TY +NRY+
Sbjct  244  LLDYLRQMHNENPNFFYALQGGDDQFTGNVFWSDPRARANYSYFGDTVTFDTTYRSNRYR  303

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F P TGV+HH + V F 
Sbjct  304  LPFAPLTGVNHHGQPVLFG  322



>ref|XP_010468694.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=693

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++ + +KK  +  F+++  +DE D +  IFWAD ++  ++N+FGD + FD TY TN Y 
Sbjct  200  VLEYFQKKKEDNSSFFYSMQLDEDDMITNIFWADDRSISDYNLFGDVVCFDTTYKTNEYD  259

Query  181  LVFVPFTGVDHHKKSVTFAA  240
              F PF GV+HHK++V F A
Sbjct  260  RPFAPFVGVNHHKQTVVFGA  279



>ref|XP_010028879.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X2 [Eucalyptus 
grandis]
 gb|KCW55697.1| hypothetical protein EUGRSUZ_I01547 [Eucalyptus grandis]
Length=747

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +    + +F++A   DE   +C + WAD ++R N+  FGDT++FD TY +NRY+
Sbjct  251  LLDYLKQMHAENANFFYAVQNDEDQSMCNVVWADSRSRMNYTYFGDTVTFDTTYRSNRYR  310

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + + F 
Sbjct  311  LPFAPFTGVNHHGQPILFG  329



>ref|XP_010927109.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like isoform X3 [Elaeis 
guineensis]
Length=1184

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  10   KYTEK-KNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLV  186
            +Y +K K  +P FY+A  VDE DQL  +FWAD ++  +++ FGD + FD TY  N Y   
Sbjct  571  EYLQKMKGDNPSFYYAIQVDEYDQLTNVFWADAKSMIDYHYFGDVVCFDTTYKANNYGRP  630

Query  187  FVPFTGVDHHKKSVTFAA  240
            F  F G++HHK+SV F A
Sbjct  631  FSLFIGINHHKQSVIFGA  648



>ref|XP_010927108.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like isoform X2 [Elaeis 
guineensis]
Length=1191

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  10   KYTEK-KNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLV  186
            +Y +K K  +P FY+A  VDE DQL  +FWAD ++  +++ FGD + FD TY  N Y   
Sbjct  571  EYLQKMKGDNPSFYYAIQVDEYDQLTNVFWADAKSMIDYHYFGDVVCFDTTYKANNYGRP  630

Query  187  FVPFTGVDHHKKSVTFAA  240
            F  F G++HHK+SV F A
Sbjct  631  FSLFIGINHHKQSVIFGA  648



>ref|XP_010927107.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like isoform X1 [Elaeis 
guineensis]
Length=1200

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  10   KYTEK-KNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLV  186
            +Y +K K  +P FY+A  VDE DQL  +FWAD ++  +++ FGD + FD TY  N Y   
Sbjct  571  EYLQKMKGDNPSFYYAIQVDEYDQLTNVFWADAKSMIDYHYFGDVVCFDTTYKANNYGRP  630

Query  187  FVPFTGVDHHKKSVTFAA  240
            F  F G++HHK+SV F A
Sbjct  631  FSLFIGINHHKQSVIFGA  648



>ref|XP_009612458.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Nicotiana tomentosiformis]
Length=774

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +  + +P F++A   DE      +FWAD +AR N++ FGDT++FD TY +NRY+
Sbjct  232  LLDYLKQMHSQNPGFFYAVQGDEDQCTGNVFWADSKARSNYSYFGDTVTFDTTYRSNRYR  291

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + V F  
Sbjct  292  LPFAPFTGVNHHGQPVLFGC  311



>ref|XP_002466896.1| hypothetical protein SORBIDRAFT_01g016055 [Sorghum bicolor]
 gb|EER93894.1| hypothetical protein SORBIDRAFT_01g016055 [Sorghum bicolor]
Length=437

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI   TE K   PDF+F +  D    L  + W D Q R ++  FGD + F++TY TNRY 
Sbjct  195  VISYLTECKRRDPDFFFQYKTDREGHLKGLIWCDCQCRLDYRAFGDVVVFESTYKTNRYN  254

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L  VPF GV+HH  +V FA
Sbjct  255  LPLVPFVGVNHHGSTVLFA  273



>ref|XP_009387977.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1220

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ +   K  +P FY+A  VDE DQ+  +FWAD ++  +++ FGD + FD +Y  N Y 
Sbjct  597  LLEYFQRMKGDNPSFYYAIQVDEYDQMTNVFWADAKSMIDYHYFGDVVCFDTSYKVNDYG  656

Query  181  LVFVPFTGVDHHKKSVTFAA  240
              F  F GV+HHK++V FAA
Sbjct  657  RPFALFIGVNHHKQTVIFAA  676



>ref|XP_009387976.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1228

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ +   K  +P FY+A  VDE DQ+  +FWAD ++  +++ FGD + FD +Y  N Y 
Sbjct  597  LLEYFQRMKGDNPSFYYAIQVDEYDQMTNVFWADAKSMIDYHYFGDVVCFDTSYKVNDYG  656

Query  181  LVFVPFTGVDHHKKSVTFAA  240
              F  F GV+HHK++V FAA
Sbjct  657  RPFALFIGVNHHKQTVIFAA  676



>ref|XP_004963627.1| PREDICTED: uncharacterized protein LOC101779982 [Setaria italica]
Length=1006

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++   + +   P+F+F   VD   +L  +FW+D Q++ ++ +FGD + FD+TY  NRY 
Sbjct  198  VLNHMRQMQEKDPEFFFTFSVDAQGRLKNLFWSDAQSQIDYGVFGDVVVFDSTYRVNRYN  257

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L FVPF GV+HH+ +V F 
Sbjct  258  LPFVPFIGVNHHRSTVVFG  276



>ref|XP_009758605.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Nicotiana sylvestris]
Length=774

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +  + +P F++A   DE      +FWAD +AR N++ FGDT++FD TY +NRY+
Sbjct  232  LLDYLKQMHSQNPGFFYAVQGDEDQCTGNVFWADSKARANYSYFGDTVTFDTTYRSNRYR  291

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + V F  
Sbjct  292  LPFAPFTGVNHHGQPVLFGC  311



>ref|XP_010227160.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=612

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   K  A+P F++   V E  +L  +FW D   R N+  FG   SFD+TY TN+Y +
Sbjct  178  VSQLARKHEANPSFFYDFVVSEEGKLMYVFWVDATTRKNYKHFGYVASFDSTYTTNQYDM  237

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +F PFTGV+HH +SV F A
Sbjct  238  IFAPFTGVNHHLQSVFFGA  256



>ref|XP_002459592.1| hypothetical protein SORBIDRAFT_02g007217 [Sorghum bicolor]
 gb|EER96113.1| hypothetical protein SORBIDRAFT_02g007217 [Sorghum bicolor]
Length=670

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI   TE +   PDF+F + VD    L  +FW D Q   ++  FGD + FD+TY TNRY 
Sbjct  191  VISYLTELQRRDPDFFFEYMVDGEGHLKGLFWCDSQCLLDYEAFGDVVVFDSTYKTNRYN  250

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L  VPF GV+HH+ +V F 
Sbjct  251  LPLVPFVGVNHHRSTVIFG  269



>ref|XP_006406281.1| hypothetical protein EUTSA_v10021958mg, partial [Eutrema salsugineum]
 gb|ESQ47734.1| hypothetical protein EUTSA_v10021958mg, partial [Eutrema salsugineum]
Length=573

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++ +  KK  +  F+++  +DE D +  IFWAD ++  ++N+FGD + FD TY TN Y 
Sbjct  160  VLEYFQRKKEDNSSFFYSMQLDEDDMITNIFWADDRSISDYNLFGDVVCFDTTYKTNEYD  219

Query  181  LVFVPFTGVDHHKKSVTFAA  240
              F PF GV+HHK++V F A
Sbjct  220  RPFAPFIGVNHHKQTVVFGA  239



>ref|XP_003538916.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Glycine max]
Length=790

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 51/81 (63%), Gaps = 2/81 (2%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDV--DELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNR  174
            ++D    K+  +P F++A  +  DE   +  IFW D +AR N+  FGDT++FD  Y +NR
Sbjct  249  LLDYLKSKQAENPSFFYAVQLQGDEDHCMSNIFWVDSKARTNYTYFGDTVTFDTAYRSNR  308

Query  175  YKLVFVPFTGVDHHKKSVTFA  237
            Y+L F PFTGV+HH + V F 
Sbjct  309  YRLPFAPFTGVNHHGQPVLFG  329



>ref|XP_006406280.1| hypothetical protein EUTSA_v10022007mg, partial [Eutrema salsugineum]
 gb|ESQ47733.1| hypothetical protein EUTSA_v10022007mg, partial [Eutrema salsugineum]
Length=685

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++ +  KK  +  F+++  +DE D +  IFWAD ++  ++N+FGD + FD TY TN Y 
Sbjct  156  VLEYFQRKKEDNSSFFYSMQLDEDDMITNIFWADDRSISDYNLFGDVVCFDTTYKTNEYD  215

Query  181  LVFVPFTGVDHHKKSVTFAA  240
              F PF GV+HHK++V F A
Sbjct  216  RPFAPFIGVNHHKQTVVFGA  235



>ref|XP_010513339.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=345

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++ + +KK  +  F+++  +DE D +  I WAD ++  ++N+FGD + FD TY TN Y 
Sbjct  258  VLEYFQKKKEDNSSFFYSIQLDEDDMITNILWADDRSISDYNLFGDVVCFDTTYKTNEYD  317

Query  181  LVFVPFTGVDHHKKSVTFAA  240
              F PF GV+HHK++V F A
Sbjct  318  RPFAPFVGVNHHKQTVVFGA  337



>ref|NP_001047685.1| Os02g0668200 [Oryza sativa Japonica Group]
 dbj|BAF09599.1| Os02g0668200 [Oryza sativa Japonica Group]
Length=766

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   K   +  F++  DVDE  +L  +FWAD  +R N++ FGD +SFD+TY TN+Y +
Sbjct  269  VAQLCRKNEVNSSFFYDFDVDEHGRLKYVFWADATSRKNYSHFGDIVSFDSTYTTNQYDM  328

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +F PFTGV+HH +SV + A
Sbjct  329  IFAPFTGVNHHLQSVFYGA  347



>ref|XP_010239257.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=627

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VID + +++   P FY+A  VDE D++  IFW+D   R  + ++GD +SFD TY TN Y 
Sbjct  62   VIDYFRKRQMQDPRFYYAFKVDEEDKVQNIFWSDGNCRRFYGLYGDCISFDTTYKTNMYN  121

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PF G+  H  +  FA
Sbjct  122  LPFAPFVGITGHAHNCLFA  140



>gb|EEE57540.1| hypothetical protein OsJ_07864 [Oryza sativa Japonica Group]
Length=805

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   K   +  F++  DVDE  +L  +FWAD  +R N++ FGD +SFD+TY TN+Y +
Sbjct  269  VAQLCRKNEVNSSFFYDFDVDEHGRLKYVFWADATSRKNYSHFGDIVSFDSTYTTNQYDM  328

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +F PFTGV+HH +SV + A
Sbjct  329  IFAPFTGVNHHLQSVFYGA  347



>ref|XP_002460471.1| hypothetical protein SORBIDRAFT_02g028930 [Sorghum bicolor]
 gb|EER96992.1| hypothetical protein SORBIDRAFT_02g028930 [Sorghum bicolor]
Length=499

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI   TE K   PDF+F +  D    L  + W D Q R ++  FGD + FD+TY TNRY 
Sbjct  193  VISYLTECKCRDPDFFFQYKTDGEGHLKGLLWCDCQCRFDYAAFGDVVVFDSTYKTNRYN  252

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L  VPF GV+HH  +V FA
Sbjct  253  LPLVPFVGVNHHGSTVLFA  271



>ref|XP_010693322.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +1

Query  19   EKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPF  198
            E  ++   F+F + VDE   L R+FW D  +R N+ +FGD +SFD T+ TNRY +V  PF
Sbjct  214  EATSSGGGFFFDYCVDENRHLTRVFWTDAISRKNYYLFGDMVSFDTTFDTNRYCMVLAPF  273

Query  199  TGVDHHKKSVTF  234
            T VDHH K VTF
Sbjct  274  TRVDHHGKCVTF  285



>ref|XP_008680369.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=460

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK A+  F++   VDE  +L  IFWA+  +R N+++FGD +SFD+TY TN Y +
Sbjct  271  VAQLERKKEANSAFFYDFVVDEEGKLLYIFWANATSRKNYSLFGDIVSFDSTYSTNHYNM  330

Query  184  VFVPFTGVDHHKKSV  228
             F PFTGV+HH +S+
Sbjct  331  KFTPFTGVNHHMQSI  345



>ref|XP_004290092.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=791

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   + +  + +F++A   DE   +  + WADP+A+ N+N FGDT++FD TY +NRY+
Sbjct  250  LLDYLRQMQADNQNFFYAVQGDEDQAMGNVIWADPKAKMNYNYFGDTVTFDTTYRSNRYR  309

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F P TG++HH + V F 
Sbjct  310  LPFAPITGINHHGQPVLFG  328



>ref|XP_006435469.1| hypothetical protein CICLE_v10000383mg [Citrus clementina]
 ref|XP_006473867.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Citrus sinensis]
 gb|ESR48709.1| hypothetical protein CICLE_v10000383mg [Citrus clementina]
 gb|KDO85263.1| hypothetical protein CISIN_1g004450mg [Citrus sinensis]
Length=753

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VID   + +   P F+ A   D  +    IFWAD  +R N++ FGDT++FD TY  NRY+
Sbjct  232  VIDNLKQMQAEDPSFFCAFQGDFENTTGNIFWADANSRMNYSYFGDTVTFDTTYRMNRYR  291

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTG++HH + V F 
Sbjct  292  IPFAPFTGLNHHGQPVLFG  310



>ref|XP_007200955.1| hypothetical protein PRUPE_ppa001597mg [Prunus persica]
 gb|EMJ02154.1| hypothetical protein PRUPE_ppa001597mg [Prunus persica]
Length=795

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   + +  + +F++A   DE      + WADP+AR N++ FGDT++FD TY +NRY+
Sbjct  255  LLDYLRQMQADNQNFFYAVQGDEDQSTGNVIWADPKARMNYSYFGDTVTFDTTYRSNRYR  314

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + V F  
Sbjct  315  LPFAPFTGVNHHGQPVLFGC  334



>ref|XP_008653692.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=517

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK  +  F++   VD   +L  +FWAD  +R N++ FGD +SFDATY TN+Y +
Sbjct  241  VAQLERKKEVNSAFFYDFVVDAQGKLVYVFWADATSRKNYSHFGDLVSFDATYSTNQYNM  300

Query  184  VFVPFTGVDHHKKSVTFAA  240
             F PFTGV+HH +SV F A
Sbjct  301  KFTPFTGVNHHMQSVFFGA  319



>ref|XP_008235836.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Prunus mume]
Length=795

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   + +  + +F++A   DE      + WADP+AR N++ FGDT++FD TY +NRY+
Sbjct  255  LLDYLRQMQADNQNFFYAVQGDEDQSTGNVIWADPKARMNYSYFGDTVTFDTTYRSNRYR  314

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + V F  
Sbjct  315  LPFAPFTGVNHHGQPVLFGC  334



>ref|XP_004305530.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=644

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  7    DKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLV  186
            + +  ++   PDF+F    DE  +L R FW D  A+  ++ FGD + FD TY TNRYK++
Sbjct  151  EHFKAEQEKDPDFFFEFHTDEEQRLVRCFWVDSTAKRAYSHFGDVVVFDTTYNTNRYKMI  210

Query  187  FVPFTGVDHHKKSVTFAA  240
            F PF GV+HH ++  F  
Sbjct  211  FAPFVGVNHHGQTTVFGC  228



>ref|XP_002283202.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Vitis vinifera]
 ref|XP_010645572.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Vitis vinifera]
 ref|XP_010645577.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Vitis vinifera]
Length=783

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +    +P F +A   D+      +FWADP++R N+  FGDT++FD TY +NRY+
Sbjct  241  LLDYLRQMHAENPSFVYAVQGDDDQSPSNVFWADPKSRMNYTYFGDTVTFDTTYRSNRYR  300

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + V F  
Sbjct  301  LPFAPFTGVNHHGQPVLFGC  320



>ref|XP_007216795.1| hypothetical protein PRUPE_ppa023614mg [Prunus persica]
 gb|EMJ17994.1| hypothetical protein PRUPE_ppa023614mg [Prunus persica]
Length=685

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +1

Query  31   ASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVD  210
            + P FY+A  VDE ++L  +FW D ++R  +N F D ++FD TY  N+YK+ F  FTGV+
Sbjct  239  SDPAFYYAIQVDEEERLSSVFWVDTRSRIAYNCFSDVVAFDTTYQVNQYKMPFATFTGVN  298

Query  211  HHKKSVTFA  237
            HHK SV F 
Sbjct  299  HHKHSVLFG  307



>ref|XP_004986319.1| PREDICTED: uncharacterized protein LOC101759074 [Setaria italica]
Length=1036

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++   + +   P+F+F   VD   +L  +FW+D Q++ ++ +FGD + FD+TY  NRY 
Sbjct  228  VLNHMRQMQEKDPEFFFTFSVDAQGRLKNLFWSDAQSQIDYGVFGDVVVFDSTYRVNRYN  287

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L FVPF GV+HH+ +V F  
Sbjct  288  LPFVPFIGVNHHRSTVVFGC  307



>ref|XP_010690587.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Beta vulgaris subsp. 
vulgaris]
Length=778

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   + +  S +FYFA    E      +FWAD +AR N++ +GDT++FD T+ +NRY+
Sbjct  237  LVDYLKQMRIESSEFYFAVQGGECCSTGNVFWADGRARMNYSYYGDTVTFDTTFRSNRYR  296

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH + V F 
Sbjct  297  LPFAPFTGVNHHGQPVLFG  315



>ref|XP_006383797.1| hypothetical protein POPTR_0005s27900g, partial [Populus trichocarpa]
 gb|ERP61594.1| hypothetical protein POPTR_0005s27900g, partial [Populus trichocarpa]
Length=708

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V D   + +   P F++A   D  +    +FWAD  AR N++ FGDT++FD TY TNRY+
Sbjct  187  VFDYLKQMQAEDPGFFYAVQGDFENSTGNVFWADANARMNYSFFGDTITFDTTYRTNRYR  246

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTG +HH + + F 
Sbjct  247  VPFAPFTGWNHHGQPLLFG  265



>ref|XP_010274043.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Nelumbo 
nucifera]
Length=681

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ +T  +  + +F++A D+D+  +L  +FW DP+ RH++  FGD +SFD TY  NRY+
Sbjct  225  MLEYFTCMQEENTNFFYAIDLDDEQRLRNVFWVDPKGRHDYTYFGDIVSFDTTYIKNRYR  284

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + FVPF G +HH +   F 
Sbjct  285  MPFVPFIGANHHFQPTFFG  303



>ref|XP_009412131.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412133.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
Length=775

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D    K++  P F++A  +DE +++   FWAD ++ +++  FGD++ FD TY T+R+ 
Sbjct  296  LLDILKNKQSEDPSFFYAVQIDEKERMTNFFWADARSINDYAYFGDSVLFDTTYRTSRFD  355

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            + F PF GV+HHK+ V F A
Sbjct  356  IPFAPFIGVNHHKQIVIFGA  375



>ref|XP_008787331.1| PREDICTED: LOW QUALITY PROTEIN: protein FAR-RED IMPAIRED RESPONSE 
1-like [Phoenix dactylifera]
Length=1205

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +1

Query  10   KYTEK-KNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLV  186
            +Y +K K+ +P F++A  VDE DQL  IFWAD Q+  +++ FGD + FD  Y TN Y   
Sbjct  574  EYLQKMKSXNPSFFYAIQVDEEDQLTNIFWADAQSMMDYHYFGDVVCFDTAYRTNDYDRP  633

Query  187  FVPFTGVDHHKKSVTFAA  240
            F  F GV+HHK+   F A
Sbjct  634  FALFFGVNHHKQITIFGA  651



>ref|XP_006480513.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Citrus sinensis]
Length=787

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +1

Query  4    IDKYTEKKNASPD-FYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            I KY E K A  D F+F+ D+DE D+L  +FWAD ++R  +  FGD ++FD TY TN+Y 
Sbjct  194  ILKYFETKQAECDGFFFSIDLDEQDRLKNVFWADRRSRAAYKYFGDVVTFDTTYLTNKYD  253

Query  181  LVFVPFTGVDHHKKSV  228
            + F  F GV+HH +S+
Sbjct  254  MPFALFVGVNHHGQSI  269



>ref|XP_004974618.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=550

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +    K  +P F++   VDE  +L  +F A+   R N+++FGD +S D+TY TN+Y +
Sbjct  137  VAQLERNKEVNPTFFYDFMVDEQGRLVHVFSANALCRKNYSVFGDVVSVDSTYTTNQYNM  196

Query  184  VFVPFTGVDHHKKSVTFAA  240
            +FVPFTGV+HH +SV+  A
Sbjct  197  IFVPFTGVNHHLQSVSLGA  215



>gb|EPS62805.1| hypothetical protein M569_11983, partial [Genlisea aurea]
Length=715

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLC--RIFWADPQARHNFNIFGDTMSFDATYGTNR  174
            ++D   +K+  +P F++  DV   ++ C   +FWAD +AR ++N FGDT++FD TY +NR
Sbjct  247  LLDYLKQKQAQNPSFFY--DVQWKEEQCTGNLFWADLKARADYNHFGDTVTFDTTYRSNR  304

Query  175  YKLVFVPFTGVDHHKKSVTFA  237
            Y+L F PFTG++HH + V F 
Sbjct  305  YRLPFAPFTGLNHHGQPVLFG  325



>ref|XP_010233328.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=308

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI     ++   P+F+F + VD    L  +FWAD Q+R ++ +FG+ + FD+TY TN+Y 
Sbjct  52   VICHMMARQERDPNFFFNYLVDGEGHLKGLFWADSQSRLDYEVFGNVVVFDSTYRTNKYN  111

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L FVPF G++HH  +V F  
Sbjct  112  LPFVPFVGLNHHHSTVVFGC  131



>ref|XP_010251622.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3 [Nelumbo nucifera]
 ref|XP_010251623.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3 [Nelumbo nucifera]
Length=887

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D +   +  +P FY+A  +DE +++  +FWAD ++R  ++ FGD ++FD  Y  N+Y+
Sbjct  231  LLDYFKRMQAENPGFYYAIQLDEENRMTNVFWADSRSRAAYSHFGDAVTFDTMYRPNQYR  290

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTGV+HH + V F 
Sbjct  291  VPFAPFTGVNHHGQMVLFG  309



>ref|XP_011041139.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Populus euphratica]
Length=763

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V D   + +   P F++A   D  +    +FWAD  AR N++ FGDT++FD TY TNRY+
Sbjct  242  VFDYLKQMQAEDPGFFYAVQGDFENSTGNVFWADANARMNYSFFGDTITFDTTYRTNRYR  301

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTG +HH + + F 
Sbjct  302  VPFAPFTGWNHHGQPLLFG  320



>ref|XP_009358905.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Pyrus x bretschneideri]
 ref|XP_009358906.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Pyrus x bretschneideri]
 ref|XP_009358907.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Pyrus x bretschneideri]
Length=795

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   + +  + +F++A   D+   +  + WADP+AR N++ FGDT++FD TY +NRY+
Sbjct  254  LLDYLRQMQADNHNFFYAVQGDDDQSMGNVIWADPKARMNYSYFGDTVTFDTTYRSNRYR  313

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + V F  
Sbjct  314  LPFAPFTGVNHHGQPVLFGC  333



>ref|XP_010436910.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Camelina 
sativa]
Length=717

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 4/80 (5%)
 Frame = +1

Query  13   YTEKKNA-SPDFYFA---HDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            Y  + NA +P+F++A      +E   +  +FWADP+AR +F  FGDT++FD TY +NRY+
Sbjct  220  YLRQMNADNPNFFYAVQGGTTEEDQSVGNVFWADPKARTDFAFFGDTVTFDTTYRSNRYR  279

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + + F  
Sbjct  280  LPFAPFTGVNHHGQPILFGC  299



>ref|XP_010555162.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Tarenaya hassleriana]
Length=794

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +1

Query  13   YTEKKNA-SPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVF  189
            Y  + NA +  F++A    E   +  +FWADP+AR +F  FGDT++FD TY +NRY+L F
Sbjct  257  YLRQMNAENSSFFYAVQGSEDQSVGNVFWADPKARKDFTHFGDTVTFDTTYRSNRYRLPF  316

Query  190  VPFTGVDHHKKSVTFAA  240
             PFTGV+HH + V F  
Sbjct  317  APFTGVNHHGQPVLFGC  333



>ref|XP_002313567.1| far-red impaired responsive family protein [Populus trichocarpa]
 gb|EEE87522.1| far-red impaired responsive family protein [Populus trichocarpa]
Length=751

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +    +P+F++A    +      +FW+DP+AR N++ FGDT++FD TY +NRY+
Sbjct  242  LLDYLRQMHTENPNFFYALQGGDDQFTGNVFWSDPRARANYSYFGDTVTFDTTYRSNRYR  301

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F P TGV+HH + V F 
Sbjct  302  LPFAPLTGVNHHGQPVLFG  320



>ref|XP_009391891.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391892.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=817

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            + D +   K+ +  F++A DVDE  ++  + WAD ++R  +  FGD ++ D TY TN+Y 
Sbjct  214  IFDYFIRMKSKNSSFFYAMDVDEESRIKNVLWADARSRAAYEEFGDVVTIDTTYLTNKYD  273

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + FVPF GV+HH +S+ F 
Sbjct  274  MPFVPFVGVNHHGQSILFG  292



>ref|XP_010436909.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Camelina 
sativa]
Length=754

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 4/80 (5%)
 Frame = +1

Query  13   YTEKKNA-SPDFYFA---HDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            Y  + NA +P+F++A      +E   +  +FWADP+AR +F  FGDT++FD TY +NRY+
Sbjct  257  YLRQMNADNPNFFYAVQGGTTEEDQSVGNVFWADPKARTDFAFFGDTVTFDTTYRSNRYR  316

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + + F  
Sbjct  317  LPFAPFTGVNHHGQPILFGC  336



>ref|XP_008237898.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=764

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V D     +   P F+FA   D  +    IFWAD  +R N++ FGDT++FD TY TNRY+
Sbjct  242  VFDYLKRMQAEDPGFFFAVQGDFENLTGNIFWADSNSRMNYDYFGDTVTFDTTYRTNRYR  301

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTG +HH + V F 
Sbjct  302  VPFAPFTGWNHHGQPVLFG  320



>ref|XP_007208906.1| hypothetical protein PRUPE_ppa026999mg [Prunus persica]
 gb|EMJ10105.1| hypothetical protein PRUPE_ppa026999mg [Prunus persica]
Length=763

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V D     +   P F+FA   D  +    IFWAD  +R N++ FGDT++FD TY TNRY+
Sbjct  242  VFDYLKRMQAEDPGFFFAVQGDFENLTGNIFWADSNSRMNYDYFGDTVTFDTTYRTNRYR  301

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTG +HH + V F 
Sbjct  302  VPFAPFTGWNHHGQPVLFG  320



>ref|XP_009123004.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brassica rapa]
Length=198

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++ + +KK  +   +++  +DE D +  IFWA  Q+  ++N+FGD + FD  Y TN Y+
Sbjct  12   VLEYFQKKKEDNASLFYSMQLDEDDMITNIFWAYDQSISDYNLFGDVVCFDTIYKTNEYE  71

Query  181  LVFVPFTGVDHHKKSVTFA  237
              F PF GV+HHK+S+ F 
Sbjct  72   KPFAPFVGVNHHKQSIVFG  90



>gb|EYU41087.1| hypothetical protein MIMGU_mgv1a020432mg [Erythranthe guttata]
Length=609

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  13   YTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFV  192
            + E ++ +P F ++  +D+ +++   FWA+ ++R  +  FGD ++FDATY TN Y + FV
Sbjct  188  FMECQSKNPGFVYSIQLDDNNRMGNFFWANTRSRLAYQYFGDVVTFDATYLTNHYSMPFV  247

Query  193  PFTGVDHHKKSVTFA  237
            PFTGV+HH +SV F 
Sbjct  248  PFTGVNHHHQSVMFG  262



>ref|XP_002466791.1| hypothetical protein SORBIDRAFT_01g014270 [Sorghum bicolor]
 gb|EER93789.1| hypothetical protein SORBIDRAFT_01g014270 [Sorghum bicolor]
Length=708

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI     ++   P+F+F   VD  + L  +FW D Q++ ++  FGD + FD+TY TNRY 
Sbjct  195  VIRHLKARQEKDPEFFFKFFVDGDNHLQGLFWCDSQSQLDYEAFGDVVVFDSTYKTNRYN  254

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L FVPF G++HH+ +V F 
Sbjct  255  LPFVPFVGLNHHRSTVIFG  273



>ref|XP_008382516.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Malus domestica]
 ref|XP_008382517.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Malus domestica]
Length=794

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   + +  + +F++A   D+   +  + WADP+AR N++ FGDT++FD TY +NRY+
Sbjct  251  LLDYLRQMQADNQNFFYAVRGDDDKSMGNVIWADPKARINYSYFGDTVTFDTTYRSNRYR  310

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + V F  
Sbjct  311  LPFAPFTGVNHHGQPVLFGC  330



>ref|XP_006487498.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Citrus sinensis]
Length=372

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  43   FYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHHKK  222
            FYF+  VD+  +L  IFWA+P+ R  +  FGD ++FD TY TN+Y + F PF GV+HH  
Sbjct  208  FYFSMQVDDEGRLKNIFWAEPRNREAYKEFGDVVTFDTTYLTNKYDMPFAPFVGVNHHGH  267

Query  223  SVTFA  237
            S+ F 
Sbjct  268  SILFG  272



>ref|XP_004231108.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Solanum lycopersicum]
Length=781

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D   +    +  F++A   DE      +FWAD +AR N+N FGDT++FD TY +NRY+
Sbjct  239  LLDYLKQMNIQNAGFFYAVQGDEDQCSGNVFWADSKARANYNYFGDTITFDTTYRSNRYR  298

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + V F  
Sbjct  299  LPFAPFTGVNHHGQPVLFGC  318



>ref|XP_002466969.1| hypothetical protein SORBIDRAFT_01g017605 [Sorghum bicolor]
 gb|EER93967.1| hypothetical protein SORBIDRAFT_01g017605 [Sorghum bicolor]
Length=265

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            VI   TE K   PDF+F +  D    L  + W D Q R ++  FGD + FD+TY TNRY 
Sbjct  193  VISYLTECKRRDPDFFFQYKTDREGHLKGLIWCDCQCRLDYRAFGDVVVFDSTYKTNRYN  252

Query  181  LVFVPFTGVDHH  216
            L  VPF GV+HH
Sbjct  253  LPLVPFVGVNHH  264



>ref|XP_009123544.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brassica rapa]
Length=355

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++ + +KK  +   +++  +D  D +  IFW D ++  +FN+FGD + FD TY TN Y 
Sbjct  12   VLEYFQKKKEENSSIFYSMQLDVDDMITNIFWVDDRSISDFNLFGDVICFDTTYKTNEYD  71

Query  181  LVFVPFTGVDHHKKSVTFAA  240
              F PF GV+HHK++V F A
Sbjct  72   RPFAPFVGVNHHKQTVVFGA  91



>ref|XP_002443160.1| hypothetical protein SORBIDRAFT_08g013410 [Sorghum bicolor]
 gb|EES16998.1| hypothetical protein SORBIDRAFT_08g013410 [Sorghum bicolor]
Length=397

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  61   VDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHHKKSVTFAA  240
            VD+  +L R+FWAD   R N+++FGD ++ DATY TN+Y + FVPFTGV+HH +SV   A
Sbjct  2    VDKQGRLVRVFWADAVCRKNYSVFGDVIAVDATYTTNQYNMKFVPFTGVNHHLQSVFLGA  61



>ref|XP_009416765.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
Length=295

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  10   KYTEK-KNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLV  186
            +Y +K K  +P F++A  VDE +QL  +FWADP++  +++ FGD + FD  Y  N Y   
Sbjct  159  EYLQKMKGDNPSFFYAIQVDEAEQLTNVFWADPKSIMDYHYFGDIICFDTAYQINDYGRP  218

Query  187  FVPFTGVDHHKKSVTFAA  240
             V FTGV+HHK+ + F +
Sbjct  219  LVLFTGVNHHKQIIIFGS  236



>ref|XP_010240740.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=460

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +1

Query  22   KKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFT  201
            +++  PDF+F +  DE+ +L  +FW D Q+R ++  FGD + FD+TY  NRY + F+PF 
Sbjct  323  RRDNDPDFFFEYQADEMGRLRSMFWCDSQSRQDYQDFGDVVVFDSTYKMNRYGMPFIPFV  382

Query  202  GVDHHKKSVTFA  237
            G+++H K   F 
Sbjct  383  GLNNHCKITVFG  394



>ref|XP_010231426.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=405

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  40   DFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHHK  219
            +F+F +  D+   L  IFWAD Q++ ++  FGD + FD+TY  NRY L FVPF GVDHH+
Sbjct  209  EFFFKYSTDDEGHLRNIFWADSQSQIDYEAFGDLVVFDSTYRVNRYNLPFVPFIGVDHHR  268

Query  220  KSVTFA  237
             ++ F 
Sbjct  269  STIVFG  274



>ref|XP_010685516.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3 [Beta vulgaris subsp. 
vulgaris]
Length=881

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D + + +  +P F++A  +DE +++   FWAD ++R  F+ FGD ++ D +Y  N+YK
Sbjct  231  MLDYFKKMQAENPGFFYAIQLDEDNRMANAFWADARSRTAFSHFGDVVTLDTSYKVNQYK  290

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTGV+HH +++ F 
Sbjct  291  VQFAPFTGVNHHGQTILFG  309



>ref|XP_009372650.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Pyrus x bretschneideri]
Length=764

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V D     +   PDF+ A   D  +    IFWAD  +R N++ FGDT++FD TY TNRY+
Sbjct  243  VFDYLKRMQVEDPDFFCAVQGDFENSTGNIFWADANSRMNYDYFGDTVTFDTTYRTNRYR  302

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTG +HH + V F 
Sbjct  303  VPFAPFTGWNHHGQPVLFG  321



>ref|XP_006645669.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Oryza brachyantha]
Length=704

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +1

Query  13   YTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFV  192
            + +KK   P+F++A D+DE   +  IFW D + R ++  FGD ++FD TY TN Y +   
Sbjct  187  FQKKKEKDPEFFYAIDLDENGAVKNIFWVDGRGRRSYQEFGDVVTFDTTYQTNIYSMPLA  246

Query  193  PFTGVDHHKKSVTFA  237
            PF GV HH+ +++F 
Sbjct  247  PFLGVSHHRHTISFG  261



>ref|XP_008373334.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=766

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V D     +   PDF+ A   D  +    IFWAD  +R N++ FGDT++FD TY TNRY+
Sbjct  245  VFDYLKRMQVEDPDFFCAVQGDFENSTGNIFWADANSRMNYDYFGDTVTFDTTYRTNRYR  304

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTG +HH + V F 
Sbjct  305  VPFAPFTGWNHHGQPVLFG  323



>ref|XP_006649180.1| PREDICTED: protein FAR1-RELATED SEQUENCE 7-like [Oryza brachyantha]
Length=772

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +1

Query  13   YTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFV  192
            + +KK   P+F++A D+DE   +  IFW D + R ++  FGD ++FD TY TN Y +   
Sbjct  255  FQKKKEKDPEFFYAIDLDENGAVKNIFWVDGRGRRSYQEFGDVVTFDTTYQTNIYSMPLA  314

Query  193  PFTGVDHHKKSVTFA  237
            PF GV HH+ +++F 
Sbjct  315  PFLGVSHHRHTISFG  329



>ref|XP_010942431.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like [Elaeis guineensis]
 ref|XP_010942439.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like [Elaeis guineensis]
 ref|XP_010942448.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like [Elaeis guineensis]
 ref|XP_010942458.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like [Elaeis guineensis]
Length=1201

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +1

Query  10   KYTEK-KNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLV  186
            +Y +K K+ +P F++A  VDE DQL  IFW D ++  +++ FGD + FD  Y TN Y   
Sbjct  576  EYLQKMKSENPSFFYAIQVDERDQLTNIFWVDAKSMVDYHYFGDVVCFDTAYKTNDYDRP  635

Query  187  FVPFTGVDHHKKSVTFAA  240
            F  F GV+HHK+ + F A
Sbjct  636  FTLFLGVNHHKQIIVFGA  653



>ref|XP_010941614.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3-like [Elaeis guineensis]
 ref|XP_010941615.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3-like [Elaeis guineensis]
Length=1193

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  10   KYTEK-KNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLV  186
            +Y +K K  +P FY+A  VDE DQ+  +FWAD ++  +++ FGD + FD +Y  N Y   
Sbjct  564  EYLQKMKGDNPSFYYAIQVDEYDQMTNVFWADAKSMIDYHYFGDVVCFDTSYRANDYGRP  623

Query  187  FVPFTGVDHHKKSVTFAA  240
            F  F G++HHK++V F A
Sbjct  624  FALFIGMNHHKQTVIFGA  641



>ref|XP_007212371.1| hypothetical protein PRUPE_ppa014831mg [Prunus persica]
 ref|XP_007221097.1| hypothetical protein PRUPE_ppa017176mg [Prunus persica]
 gb|EMJ13570.1| hypothetical protein PRUPE_ppa014831mg [Prunus persica]
 gb|EMJ22296.1| hypothetical protein PRUPE_ppa017176mg [Prunus persica]
Length=665

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+  + +K+  +P F++A   DE  +    FW D ++R  +N FGD ++FD TY TN+Y 
Sbjct  190  VLTYFRKKQAENPQFFYAIQCDENGRAANFFWVDARSRMAYNYFGDVVTFDTTYRTNKYD  249

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            + F PFTGV+HH +S+ F  
Sbjct  250  MPFAPFTGVNHHLQSIQFGC  269



>ref|XP_010693927.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=562

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            +D    KK     F+   +VD+   L   FW D   R N+ +FGD +S D TY TNRY +
Sbjct  63   VDNLKMKKLLWGAFFCDFEVDDEQCLTEAFWKDSICRKNYALFGDMVSSDTTYETNRYNM  122

Query  184  VFVPFTGVDHHKKSVTFA  237
            VF PFTGVDHHK+ +TF 
Sbjct  123  VFGPFTGVDHHKRCITFG  140



>gb|AAF66982.1| transposase [Zea mays]
Length=709

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            + +   KK A+  F++   VDE  +L  I WAD   R ++  FGD +S DATY TN+Y +
Sbjct  199  VAQMERKKEANSAFFYDFAVDEHGKLVYICWADATCRKSYTHFGDLVSVDATYSTNQYNM  258

Query  184  VFVPFTGVDHHKKSVTFAA  240
             F PFTGV+HH + V F A
Sbjct  259  RFAPFTGVNHHMQRVFFGA  277



>ref|NP_195531.1| protein FAR1-related sequence 5 [Arabidopsis thaliana]
 sp|Q9SZL8.1|FRS5_ARATH RecName: Full=Protein FAR1-RELATED SEQUENCE 5 [Arabidopsis thaliana]
 emb|CAB37558.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80483.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM97122.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86890.1| protein FAR1-related sequence 5 [Arabidopsis thaliana]
Length=788

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +1

Query  13   YTEKKNA-SPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVF  189
            Y  + NA +P+F+++    E   +  +FWADP+A  +F  FGDT++FD TY +NRY+L F
Sbjct  256  YLRQMNADNPNFFYSVQGSEDQSVGNVFWADPKAIMDFTHFGDTVTFDTTYRSNRYRLPF  315

Query  190  VPFTGVDHHKKSVTFAA  240
             PFTGV+HH + + F  
Sbjct  316  APFTGVNHHGQPILFGC  332



>ref|XP_009116658.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Brassica 
rapa]
Length=867

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++ + +KK  +  F+++  +D+ D +  IFW D ++  ++N+FGD + FD TY TN Y 
Sbjct  259  VLEYFQKKKEDNSSFFYSMQLDKDDMITNIFWVDDRSISDYNLFGDVVCFDTTYKTNEYD  318

Query  181  LVFVPFTGVDHHKKSVTFAA  240
              F PF GV+HHK++V F A
Sbjct  319  RPFAPFVGVNHHKQTVVFGA  338



>ref|XP_006472948.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1 
[Citrus sinensis]
 ref|XP_006472949.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X2 
[Citrus sinensis]
Length=688

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = +1

Query  4    IDKYTEKKNAS-PDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            I +Y  K  A    F+F+ D+DE  QL  +FWADP++R  +N FGD + FD TY TN+Y 
Sbjct  211  IQRYFLKMQAKYEGFFFSMDLDEEGQLKNVFWADPKSRAAYNDFGDIIYFDTTYLTNKYD  270

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L FV F GV+HH +S+    
Sbjct  271  LPFVLFIGVNHHGQSILLGC  290



>ref|XP_006472950.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X3 
[Citrus sinensis]
Length=641

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = +1

Query  4    IDKYTEKKNAS-PDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            I +Y  K  A    F+F+ D+DE  QL  +FWADP++R  +N FGD + FD TY TN+Y 
Sbjct  211  IQRYFLKMQAKYEGFFFSMDLDEEGQLKNVFWADPKSRAAYNDFGDIIYFDTTYLTNKYD  270

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L FV F GV+HH +S+    
Sbjct  271  LPFVLFIGVNHHGQSILLGC  290



>ref|XP_010236653.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=355

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +1

Query  40   DFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHHK  219
            +F+F +  D+   L  IFWAD Q++ ++  FGD + FD+TY  NRY L FVPF GVDHH+
Sbjct  54   EFFFKYSTDDEGHLQNIFWADSQSQIDYEAFGDLVVFDSTYRVNRYNLPFVPFIGVDHHR  113

Query  220  KSVTFAA  240
             ++ F  
Sbjct  114  STIVFGV  120



>ref|XP_009116657.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Brassica 
rapa]
Length=897

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++ + +KK  +  F+++  +D+ D +  IFW D ++  ++N+FGD + FD TY TN Y 
Sbjct  259  VLEYFQKKKEDNSSFFYSMQLDKDDMITNIFWVDDRSISDYNLFGDVVCFDTTYKTNEYD  318

Query  181  LVFVPFTGVDHHKKSVTFAA  240
              F PF GV+HHK++V F A
Sbjct  319  RPFAPFVGVNHHKQTVVFGA  338



>ref|XP_008646465.1| PREDICTED: uncharacterized protein LOC103627938 [Zea mays]
Length=1308

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  4    IDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKL  183
            ID    K   +P FY+ + VDE  +L  +FWADP  R NF+ FGD +SFD+TY TN Y +
Sbjct  310  IDNLASKNELNPTFYYDYVVDEKGRLVHVFWADPTCRKNFSHFGDLLSFDSTYNTNHYNM  369

Query  184  VFVPFT  201
            +F PFT
Sbjct  370  IFTPFT  375



>ref|XP_006484349.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Citrus sinensis]
Length=754

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  43   FYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHHKK  222
            FYF+  VD+  +L  IFWA+P+ R  +  FGD ++FD TY TN+Y + F PF GV+HH  
Sbjct  208  FYFSMQVDDEGRLKNIFWAEPRNREAYKEFGDVVTFDTTYLTNKYDMPFAPFVGVNHHGH  267

Query  223  SVTFA  237
            S+ F 
Sbjct  268  SILFG  272



>ref|XP_008219733.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=742

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+  + +K+  +P F++A   DE  +    FW D ++R  ++ FGD ++FD TY TN+Y 
Sbjct  185  VLTYFRKKQAENPQFFYAIQCDENGRASNFFWVDARSRLAYHYFGDVVAFDTTYRTNKYD  244

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTGV+HH +S+ F 
Sbjct  245  MPFAPFTGVNHHLQSIQFG  263



>ref|XP_004301609.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=765

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V D     ++  P F+ A   D  +    IFWAD  +R N++ FGDT++FD TY TNRY+
Sbjct  244  VFDYLKRMQDEDPGFFCAVQGDFENSTGNIFWADSNSRMNYSYFGDTVTFDTTYRTNRYR  303

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTG +HH + V F 
Sbjct  304  VPFAPFTGWNHHGQPVLFG  322



>ref|NP_001052447.2| Os04g0316800 [Oryza sativa Japonica Group]
 dbj|BAF14361.2| Os04g0316800 [Oryza sativa Japonica Group]
Length=1316

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+   T K+    +F+F +  DE  +L  +FWAD ++R ++  FG  + FD+TY  N+Y 
Sbjct  791  VLKYLTRKQEEDAEFFFKYTTDEEGRLRNVFWADAESRLDYAAFGGVVIFDSTYRVNKYN  850

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F+PF GV+HH+ +  F 
Sbjct  851  LPFIPFIGVNHHRSTTIFG  869



>gb|KDO47575.1| hypothetical protein CISIN_1g005927mg [Citrus sinensis]
Length=669

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ +  KK   P F++A  V++L+Q    FW D +++ +++ FGD +SFDAT+  N+Y 
Sbjct  191  LLNYFRRKKCEDPSFFYAVQVNQLNQATNFFWRDGRSKLDYDCFGDVVSFDATFRLNKYN  250

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L+  PF GV+HH K++ F 
Sbjct  251  LICAPFVGVNHHWKNMLFG  269



>ref|XP_006485311.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Citrus 
sinensis]
Length=345

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ +  KK   P F++A  V++L+Q    FW D +++ +++ FGD +SFD T+  N+Y 
Sbjct  191  LLNYFRRKKCEDPSFFYAVQVNQLNQATNFFWRDGRSKLDYDCFGDVVSFDTTFRLNKYN  250

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L+  PF GV+HH K++ F 
Sbjct  251  LICAPFVGVNHHWKNMLFG  269



>ref|XP_007219530.1| hypothetical protein PRUPE_ppa022622mg [Prunus persica]
 gb|EMJ20729.1| hypothetical protein PRUPE_ppa022622mg [Prunus persica]
Length=613

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +I+ +  K+   P F++   VD+ +++   FW D ++R +++ FGD + FD TY TNRY 
Sbjct  155  LINLFKRKQAEDPMFFYTVQVDQENRMTNFFWRDGRSRIDYDCFGDVVVFDTTYRTNRYN  214

Query  181  LVFVPFTGVDHHKKSVTFA  237
            ++  PF GV+HH K+V F 
Sbjct  215  MICAPFVGVNHHWKNVLFG  233



>gb|KDO47577.1| hypothetical protein CISIN_1g005927mg [Citrus sinensis]
Length=573

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ +  KK   P F++A  V++L+Q    FW D +++ +++ FGD +SFDAT+  N+Y 
Sbjct  95   LLNYFRRKKCEDPSFFYAVQVNQLNQATNFFWRDGRSKLDYDCFGDVVSFDATFRLNKYN  154

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L+  PF GV+HH K++ F 
Sbjct  155  LICAPFVGVNHHWKNMLFG  173



>ref|XP_009103778.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brassica rapa]
Length=429

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++ + +KK  +  F+++  +D  D +  IFWAD ++  ++N+FGD + FD TY  N Y 
Sbjct  9    VLEYFQKKKEENSSFFYSMQLDVDDMITNIFWADDRSISDYNLFGDVVCFDTTYKNNDYD  68

Query  181  LVFVPFTGVDHHKKSVTFAA  240
              F PF GV+HHK++V F A
Sbjct  69   RPFAPFVGVNHHKQTVVFGA  88



>dbj|BAG93645.1| unnamed protein product [Oryza sativa Japonica Group]
Length=742

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  34   SPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDH  213
            +P F++   +DE D+L   FWADP++R +FN FGD +  D TY  N Y      F GV+H
Sbjct  310  NPAFFYTMQIDEDDKLTNFFWADPKSREDFNYFGDVLCLDTTYKINGYGRPLSLFLGVNH  369

Query  214  HKKSVTFAA  240
            HK+++ F A
Sbjct  370  HKQTIVFGA  378



>ref|XP_007208744.1| hypothetical protein PRUPE_ppa015375mg, partial [Prunus persica]
 gb|EMJ09943.1| hypothetical protein PRUPE_ppa015375mg, partial [Prunus persica]
Length=600

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +I+ +  K+   P F++   VD+ +++   FW D ++R +++ FGD + FD TY TNRY 
Sbjct  155  LINLFKRKQAEDPMFFYTVQVDQENRMTNFFWRDGRSRIDYDCFGDVVVFDTTYRTNRYN  214

Query  181  LVFVPFTGVDHHKKSVTFA  237
            ++  PF GV+HH K+V F 
Sbjct  215  MICAPFVGVNHHWKNVLFG  233



>ref|XP_008811123.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Phoenix 
dactylifera]
Length=1201

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +1

Query  10   KYTEK-KNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLV  186
            +Y +K K  +P FY+A  VDE DQ+  +FWAD ++  +++ FGD + FD TY  N     
Sbjct  572  EYLQKMKGDNPSFYYAIQVDEYDQMTNVFWADAKSMIDYHYFGDVVCFDTTYKANNSGRP  631

Query  187  FVPFTGVDHHKKSVTFAA  240
            F  F GV+HHK++V F A
Sbjct  632  FSLFIGVNHHKQTVIFGA  649



>gb|KHN46338.1| Protein FAR1-RELATED SEQUENCE 3 [Glycine soja]
Length=883

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ + + +  +P F++A  +DE +++  +FWAD ++R  ++ +GDT+  D TY  N+Y+
Sbjct  228  LLEYFKKMQAENPGFFYAIQLDEENRMSNVFWADARSRTAYSYYGDTVHLDTTYKVNQYR  287

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTGV+HH + V F 
Sbjct  288  VPFAPFTGVNHHGQMVLFG  306



>gb|EAZ40658.1| hypothetical protein OsJ_25129 [Oryza sativa Japonica Group]
Length=784

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  34   SPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDH  213
            +P F++   +DE D+L   FWADP++R +FN FGD +  D TY  N Y      F GV+H
Sbjct  366  NPAFFYTMQIDEDDKLTNFFWADPKSREDFNYFGDVLCLDTTYKINGYGRPLSLFLGVNH  425

Query  214  HKKSVTFAA  240
            HK+++ F A
Sbjct  426  HKQTIVFGA  434



>gb|KDO47576.1| hypothetical protein CISIN_1g005927mg [Citrus sinensis]
Length=587

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ +  KK   P F++A  V++L+Q    FW D +++ +++ FGD +SFDAT+  N+Y 
Sbjct  95   LLNYFRRKKCEDPSFFYAVQVNQLNQATNFFWRDGRSKLDYDCFGDVVSFDATFRLNKYN  154

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L+  PF GV+HH K++ F 
Sbjct  155  LICAPFVGVNHHWKNMLFG  173



>ref|XP_006384878.1| hypothetical protein POPTR_0004s21890g [Populus trichocarpa]
 gb|ERP62675.1| hypothetical protein POPTR_0004s21890g [Populus trichocarpa]
Length=594

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAH--DVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNR  174
            V+D     ++ +P F++A   D D       IFWAD  AR N+N FGDT+ FD +Y T+R
Sbjct  59   VLDYLKRMQSENPAFFYATQPDTDHSPGGATIFWADATARMNYNYFGDTLVFDTSYRTHR  118

Query  175  YKLVFVPFTGVDHHKKSVTFA  237
            Y++ F  FTG++HH + V F 
Sbjct  119  YRVPFASFTGINHHGQPVLFG  139



>ref|XP_009117177.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brassica rapa]
Length=295

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++ + +KK  +  F+++  +DE D +  I WAD ++  ++N+F D + FD TY TN + 
Sbjct  191  VLEYFQKKKEDNASFFYSMQLDEDDMITNILWADNRSISDYNLFRDVICFDTTYKTNEFD  250

Query  181  LVFVPFTGVDHHKKSVTFAA  240
              F PF GV+HHK+++ F A
Sbjct  251  KPFAPFVGVNHHKQTILFGA  270



>gb|KDP42904.1| hypothetical protein JCGZ_23846 [Jatropha curcas]
Length=880

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ + + +  +P F++A  +DE +++  +FWAD ++R  +N FGD ++ D  Y  N+Y+
Sbjct  227  LLEYFKKMQAENPGFFYAIQLDEDNRMANVFWADARSRTAYNHFGDAVTLDTNYRVNQYR  286

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTGV+HH +++ F 
Sbjct  287  VPFAPFTGVNHHGQTILFG  305



>ref|XP_004958302.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=705

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  34   SPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDH  213
            +P F++   +DE D+L   FWADP++R +FN FGD +  D TY  N Y      F GV+H
Sbjct  291  NPSFFYTTQIDEDDRLTNFFWADPKSRDDFNYFGDVLCLDTTYKINGYGRPLALFLGVNH  350

Query  214  HKKSVTFAA  240
            HK+++ F A
Sbjct  351  HKQTIIFGA  359



>ref|XP_006605632.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3-like isoform X1 [Glycine 
max]
Length=880

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ + + +  +P F++A  +DE +++  +FWAD ++R  ++ +GDT+  D TY  N+Y+
Sbjct  228  LLEYFKKMQAENPGFFYAIQLDEENRMSNVFWADARSRTAYSYYGDTVHLDTTYKVNQYR  287

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTGV+HH + V F 
Sbjct  288  VPFAPFTGVNHHGQMVLFG  306



>ref|NP_001060272.1| Os07g0615900 [Oryza sativa Japonica Group]
 dbj|BAF22186.1| Os07g0615900 [Oryza sativa Japonica Group]
 dbj|BAG89908.1| unnamed protein product [Oryza sativa Japonica Group]
Length=732

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  34   SPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDH  213
            +P F++   +DE D+L   FWADP++R +FN FGD +  D TY  N Y      F GV+H
Sbjct  310  NPAFFYTMQIDEDDKLTNFFWADPKSREDFNYFGDVLCLDTTYKINGYGRPLSLFLGVNH  369

Query  214  HKKSVTFAA  240
            HK+++ F A
Sbjct  370  HKQTIVFGA  378



>ref|XP_004231427.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Solanum lycopersicum]
Length=400

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +1

Query  10   KYTEKKNA-SPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLV  186
            KY +K+ + SP F++A  +D    L   FW D ++R  +  FGD + FD TY TN+YK+ 
Sbjct  224  KYFQKRQSDSPGFFYAIQMDVEGHLANCFWVDARSRIAYKNFGDVVLFDPTYLTNKYKMP  283

Query  187  FVPFTGVDHHKKSVTFA  237
            FVPFTGV++H +S+ F 
Sbjct  284  FVPFTGVNNHHQSILFG  300



>ref|XP_004305654.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=226

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V++ + +K+  +P F++A   DE  +    FW D ++R  +  FGD ++FD TY TN+Y 
Sbjct  35   VLNYFRKKQAENPQFFYAIQCDEDGRATNFFWVDSRSRTAYQYFGDVVTFDTTYRTNKYD  94

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            + F PFTG++HH +S+ F  
Sbjct  95   MPFAPFTGLNHHFQSIQFGC  114



>ref|XP_006605633.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3-like isoform X2 [Glycine 
max]
Length=879

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ + + +  +P F++A  +DE +++  +FWAD ++R  ++ +GDT+  D TY  N+Y+
Sbjct  228  LLEYFKKMQAENPGFFYAIQLDEENRMSNVFWADARSRTAYSYYGDTVHLDTTYKVNQYR  287

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTGV+HH + V F 
Sbjct  288  VPFAPFTGVNHHGQMVLFG  306



>ref|XP_007146047.1| hypothetical protein PHAVU_006G008300g [Phaseolus vulgaris]
 gb|ESW18041.1| hypothetical protein PHAVU_006G008300g [Phaseolus vulgaris]
Length=885

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ + + +  +P F++A  +DE +++  +FWAD ++R  ++ +GDT+  D TY  N+Y+
Sbjct  233  LLEYFKKMQAENPGFFYAIQLDEDNRMSNVFWADARSRTAYSCYGDTVHLDTTYKVNQYR  292

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTGV+HH + V F 
Sbjct  293  VPFAPFTGVNHHGQMVLFG  311



>ref|XP_010497176.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like, partial [Camelina 
sativa]
Length=647

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 53/80 (66%), Gaps = 4/80 (5%)
 Frame = +1

Query  13   YTEKKNA-SPDFYFAHD---VDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            Y  + NA +P+F++A      ++   +  +FWADP+AR +F  FGDT++FD TY +NRY+
Sbjct  106  YLRQMNADNPNFFYALQGGTTEDDHSVGNVFWADPKARTDFAYFGDTVTFDTTYRSNRYR  165

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + + F  
Sbjct  166  LPFAPFTGVNHHGQPILFGC  185



>ref|XP_010063175.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Eucalyptus 
grandis]
Length=758

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+D   +++ A P F+ A   D  +    IFWAD  +R N+  FGDT++FD +Y  NRY+
Sbjct  238  VLDYLKQRQAADPGFFCAVQGDFDNLAGNIFWADANSRKNYAYFGDTVNFDTSYRMNRYR  297

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTG +HH + V F 
Sbjct  298  VPFAPFTGWNHHGQPVLFG  316



>ref|XP_006293662.1| hypothetical protein CARUB_v10022618mg [Capsella rubella]
 gb|EOA26560.1| hypothetical protein CARUB_v10022618mg [Capsella rubella]
Length=866

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ +   +  +P F++A  +DE +Q+  +FWAD ++R  ++ FGDT++ D  Y  N+++
Sbjct  219  LLEYFKRMQAENPGFFYAIQLDEDNQMTNVFWADSRSRFAYSHFGDTVTLDTRYRCNQFR  278

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTGV+HH +++ F 
Sbjct  279  VPFAPFTGVNHHGQTIIFG  297



>ref|XP_006385722.1| hypothetical protein POPTR_0003s10970g [Populus trichocarpa]
 gb|ERP63519.1| hypothetical protein POPTR_0003s10970g [Populus trichocarpa]
Length=913

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D +   ++ +P+F++A D++E  QL  +FW D + R ++  FGD + FD TY  N YK
Sbjct  280  MLDHFMHMQDENPNFFYAIDLNEEQQLRNVFWVDAKGRLDYGNFGDVIFFDTTYLKNEYK  339

Query  181  LVFVPFTGVDHH  216
            L F PF GV+HH
Sbjct  340  LPFAPFIGVNHH  351



>dbj|BAD29488.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
 dbj|BAD29601.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
Length=688

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+   T K+    +F+F +  DE  +L  +FWAD ++R ++  FG  + FD+TY  N+Y 
Sbjct  195  VLKYLTRKQEEDAEFFFKYTTDEEGRLRNVFWADAESRLDYAAFGGVVIFDSTYRVNKYN  254

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F+PF GV+HH+ +  F 
Sbjct  255  LPFIPFIGVNHHRSTTIFG  273



>emb|CAD40514.2| OSJNBa0050F15.2 [Oryza sativa Japonica Group]
Length=688

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+   T K+    +F+F +  DE  +L  +FWAD ++R ++  FG  + FD+TY  N+Y 
Sbjct  195  VLKYLTRKQEEDAEFFFKYTTDEEGRLRNVFWADAESRLDYAAFGGVVIFDSTYRVNKYN  254

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F+PF GV+HH+ +  F 
Sbjct  255  LPFIPFIGVNHHRSTTIFG  273



>gb|EEE62203.1| hypothetical protein OsJ_16990 [Oryza sativa Japonica Group]
Length=1281

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +1

Query  19   EKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPF  198
            ++++  P F++ + VD+  +L  +FW D Q+R ++  FGD + FD+T   N+Y + F+PF
Sbjct  221  KRRDKDPGFFYEYQVDDEGRLKNLFWCDAQSRMDYQSFGDVVVFDSTQRMNKYNMPFIPF  280

Query  199  TGVDHHKKSVTFA  237
             G++HH+++  FA
Sbjct  281  VGLNHHRQTTIFA  293



>ref|XP_010233182.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=483

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  40   DFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHHK  219
            +F+F +  D+   L  IFWAD Q++ ++  FGD + FD+TY  NRY L FVPF GV+HH+
Sbjct  209  EFFFKYSTDDEGHLRNIFWADSQSQIDYEAFGDLVVFDSTYRVNRYNLPFVPFIGVNHHR  268

Query  220  KSVTFA  237
             ++ F 
Sbjct  269  STIVFG  274



>ref|XP_006657954.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Oryza brachyantha]
Length=714

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  34   SPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDH  213
            +P F++   +DE D+L   FWADP++R +FN FGD +  D TY  N Y      F GV+H
Sbjct  293  NPSFFYTMQIDEDDKLTNFFWADPKSREDFNHFGDVLCLDTTYKINGYGRPLSLFLGVNH  352

Query  214  HKKSVTFAA  240
            HK+++ F A
Sbjct  353  HKQTIIFGA  361



>ref|XP_007018641.1| Far1-related sequence 5 isoform 1 [Theobroma cacao]
 ref|XP_007018642.1| Far1-related sequence 5 isoform 1 [Theobroma cacao]
 gb|EOY15866.1| Far1-related sequence 5 isoform 1 [Theobroma cacao]
 gb|EOY15867.1| Far1-related sequence 5 isoform 1 [Theobroma cacao]
Length=745

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V D   + +   P F++A   D  +    IFWAD  +R N+N FGDT++FD TY TNRY+
Sbjct  224  VFDYLKQMQTEDPAFFYAVQGDFGNSTGNIFWADAHSRMNYNHFGDTVAFDTTYRTNRYR  283

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            + F PFTG +HH + V F  
Sbjct  284  VPFAPFTGWNHHGQPVLFGC  303



>ref|XP_010446320.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Camelina sativa]
Length=798

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 53/80 (66%), Gaps = 4/80 (5%)
 Frame = +1

Query  13   YTEKKNA-SPDFYFAHD---VDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            Y  + NA +P+F++A      ++   +  +FWADP+AR +F  FGDT++FD TY +NRY+
Sbjct  257  YLRQMNADNPNFFYALQGGTTEDDHSVGNVFWADPKARTDFAYFGDTVTFDTTYRSNRYR  316

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L F PFTGV+HH + + F  
Sbjct  317  LPFAPFTGVNHHGQPILFGC  336



>ref|XP_010236728.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=785

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V + +T++++  P FYFA  +D  + +  +FWAD  AR  +  +GD +SFD TYGTNRY 
Sbjct  232  VSEYFTKRESLDPLFYFAIKLDVNNTVKSLFWADSNARRLYEAYGDCVSFDTTYGTNRYN  291

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PF G+  H  +  F 
Sbjct  292  LPFSPFVGITGHGSNCLFG  310



>ref|XP_008381561.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=705

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  13   YTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFV  192
            +   +  + +F++A D+D+  +L  IFWAD ++R  +  FGD ++FD TY TN+Y + F 
Sbjct  287  FVSMQGQNANFFYAIDLDKNGRLRNIFWADARSRATYEEFGDVVTFDTTYLTNKYDMPFA  346

Query  193  PFTGVDHHKKSV  228
            PF GV+HH++S+
Sbjct  347  PFVGVNHHRQSI  358



>ref|XP_010063176.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Eucalyptus 
grandis]
Length=708

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            V+D   +++ A P F+ A   D  +    IFWAD  +R N+  FGDT++FD +Y  NRY+
Sbjct  238  VLDYLKQRQAADPGFFCAVQGDFDNLAGNIFWADANSRKNYAYFGDTVNFDTSYRMNRYR  297

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTG +HH + V F 
Sbjct  298  VPFAPFTGWNHHGQPVLFG  316



>ref|XP_010245238.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
 ref|XP_010245239.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
 ref|XP_010245240.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
Length=731

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D +  ++  +P F+++  VD   Q+   FW D ++R +++ FGD +  D TYG  RY 
Sbjct  243  ILDYFECQRTNNPSFFYSIQVDSDGQMTNFFWTDARSRMDYHFFGDVVCLDPTYGICRYG  302

Query  181  LVFVPFTGVDHHKKSVTFAA  240
            L FVP  GV+HH ++V F +
Sbjct  303  LPFVPIVGVNHHYQTVLFGS  322



>ref|XP_006385723.1| hypothetical protein POPTR_0003s10970g [Populus trichocarpa]
 gb|ERP63520.1| hypothetical protein POPTR_0003s10970g [Populus trichocarpa]
Length=897

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D +   ++ +P+F++A D++E  QL  +FW D + R ++  FGD + FD TY  N YK
Sbjct  280  MLDHFMHMQDENPNFFYAIDLNEEQQLRNVFWVDAKGRLDYGNFGDVIFFDTTYLKNEYK  339

Query  181  LVFVPFTGVDHH  216
            L F PF GV+HH
Sbjct  340  LPFAPFIGVNHH  351



>gb|KFK32424.1| hypothetical protein AALP_AA6G240100 [Arabis alpina]
Length=789

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ +   +  +P F++A  +DE +Q+  +FWAD ++R  +  FGDT++ D  Y  N+++
Sbjct  146  LLEYFQRMQAQNPGFFYAIQLDEDNQMTNVFWADSRSRIAYTHFGDTVTLDTRYSCNQFR  205

Query  181  LVFVPFTGVDHHKKSVTFA  237
            L F PFTGV+HH  ++ F 
Sbjct  206  LPFAPFTGVNHHGHTILFG  224



>ref|XP_009405914.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405915.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405916.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405918.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
Length=864

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +1

Query  19   EKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPF  198
            EK+ A P FY+A  +D  DQ+  +FW+D ++  +F  FGD + FD +Y T+ Y   F PF
Sbjct  413  EKQIADPSFYYALQLDRDDQIANVFWSDAKSIVDFEYFGDVVCFDTSYKTSDYGRPFAPF  472

Query  199  TGVDHHKKSVTFAA  240
             GV+HHK+++ F A
Sbjct  473  IGVNHHKQAIIFGA  486



>ref|XP_011033962.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1 
[Populus euphratica]
 ref|XP_011033964.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1 
[Populus euphratica]
 ref|XP_011033965.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1 
[Populus euphratica]
 ref|XP_011033966.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1 
[Populus euphratica]
Length=897

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D +   ++ +P+F++A D++E  QL  +FW D + R ++  FGD + FD TY  N YK
Sbjct  280  MLDHFIHMQDENPNFFYAIDLNEEQQLRNVFWVDAKGRLDYGNFGDVIFFDTTYLKNEYK  339

Query  181  LVFVPFTGVDHH  216
            L F PF GV+HH
Sbjct  340  LPFAPFIGVNHH  351



>ref|XP_008227250.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Prunus 
mume]
Length=544

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/77 (39%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +1

Query  7    DKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLV  186
            + +  +K  S  FYF  + D   +L  +FWAD  +R  +  +GD + FD TY TNRY LV
Sbjct  32   EHFGAEKRKSESFYFKMEADPSGRLTNLFWADSTSRRAYKFYGDVIVFDTTYNTNRYGLV  91

Query  187  FVPFTGVDHHKKSVTFA  237
            F P  GV++H +++  A
Sbjct  92   FAPLIGVNNHGQTIILA  108



>ref|XP_004292735.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +I+ + EK+   P F++   VD+ +++   FW D +++ +F  FGD + FD TY TN+Y 
Sbjct  216  LINLFKEKQIEDPMFFYTVQVDQENRMTNFFWRDGKSKTDFECFGDVVVFDTTYRTNKYN  275

Query  181  LVFVPFTGVDHHKKSVTFA  237
            ++  PF GV+HH K+V F 
Sbjct  276  MICAPFVGVNHHWKNVLFG  294



>ref|XP_004297991.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=377

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = +1

Query  13   YTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFV  192
            +  +K     F +  + DE D++ R FWAD  +R  ++ +GD + FD TY TNRY ++F 
Sbjct  197  FQNEKEKDSSFVYTIESDEEDRVKRCFWADSISRRAYSFYGDVVIFDTTYNTNRYGMIFA  256

Query  193  PFTGVDHHKKSVTFAA  240
            PFTGV++H +S+ F  
Sbjct  257  PFTGVNNHGQSIIFGC  272



>ref|XP_007199084.1| hypothetical protein PRUPE_ppa019160mg, partial [Prunus persica]
 gb|EMJ00283.1| hypothetical protein PRUPE_ppa019160mg, partial [Prunus persica]
Length=662

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +1

Query  4    IDKYTEKKNA-SPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            I KY  K  A + +F++A D+DE  +L  +FWAD ++R  +  FGD ++FD TY TN+Y 
Sbjct  202  IQKYFLKMQAQNANFFYAIDLDESGRLRNVFWADSRSRAAYEEFGDAITFDTTYLTNKYD  261

Query  181  LVFVPFTGVDHHKKSV  228
            + F PF GV+HH  S+
Sbjct  262  MPFAPFVGVNHHGHSI  277



>ref|XP_011033967.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X2 
[Populus euphratica]
Length=874

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D +   ++ +P+F++A D++E  QL  +FW D + R ++  FGD + FD TY  N YK
Sbjct  280  MLDHFIHMQDENPNFFYAIDLNEEQQLRNVFWVDAKGRLDYGNFGDVIFFDTTYLKNEYK  339

Query  181  LVFVPFTGVDHH  216
            L F PF GV+HH
Sbjct  340  LPFAPFIGVNHH  351



>ref|XP_008792840.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792841.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Phoenix 
dactylifera]
Length=722

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  43   FYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHHKK  222
            F++A  VDE D+L  IFWAD ++  +FN FGD +  D TY  N Y   F PF GV+HHK+
Sbjct  273  FFYALQVDEDDKLTNIFWADSKSVMDFNYFGDVVCLDTTYKANGYGRPFAPFLGVNHHKQ  332

Query  223  SVTFAA  240
             V F A
Sbjct  333  IVIFGA  338



>ref|XP_003619906.1| FAR-RED IMPAIRED RESPONSE [Medicago truncatula]
Length=650

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            ++D +   +  SP F++A D+D+  ++  +FW D + R ++  FGD +SFD TY TN+YK
Sbjct  214  MLDCFMLMQEESPGFFYAIDMDDEGRMKNVFWVDAKGREDYQEFGDVISFDTTYITNKYK  273

Query  181  LVFVPFTGVDHHKKS  225
            + F PF GV++H +S
Sbjct  274  MPFAPFIGVNNHFQS  288



>ref|XP_008792843.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Phoenix 
dactylifera]
Length=702

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  43   FYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVPFTGVDHHKK  222
            F++A  VDE D+L  IFWAD ++  +FN FGD +  D TY  N Y   F PF GV+HHK+
Sbjct  273  FFYALQVDEDDKLTNIFWADSKSVMDFNYFGDVVCLDTTYKANGYGRPFAPFLGVNHHKQ  332

Query  223  SVTFAA  240
             V F A
Sbjct  333  IVIFGA  338



>emb|CAE02528.2| OSJNBb0003A12.15 [Oryza sativa Japonica Group]
Length=525

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +1

Query  16   TEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYKLVFVP  195
            T K+   P+F+F +  DE  +L  +FWAD ++  N+  FG  + FD+TY  N+Y L F+P
Sbjct  180  TRKQEEDPEFFFKYTTDEEGRLRNVFWADAESGLNYAAFGGVVIFDSTYRVNKYNLPFIP  239

Query  196  FTGVDHHKKSVTFAA  240
            F GV+HH+ +  F  
Sbjct  240  FIGVNHHRSTTIFGC  254



>ref|XP_008237973.1| PREDICTED: protein FAR1-RELATED SEQUENCE 3-like isoform X1 [Prunus 
mume]
Length=880

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    VIDKYTEKKNASPDFYFAHDVDELDQLCRIFWADPQARHNFNIFGDTMSFDATYGTNRYK  180
            +++ + + +  +P F++A  +DE + +  +FWAD ++R  +  FGD ++ D TY  N+Y+
Sbjct  226  LLEYFKKMQAENPGFFYAIQLDEDNHMANVFWADARSRAAYCHFGDAVTLDTTYRVNQYR  285

Query  181  LVFVPFTGVDHHKKSVTFA  237
            + F PFTGV+HH ++V F 
Sbjct  286  VPFAPFTGVNHHGQTVLFG  304



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515898514086