BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c39526_g1_i1 len=883 path=[861:0-882]

Length=883
                                                                      Score     E

ref|XP_002317245.1|  hypothetical protein POPTR_0011s04160g           49.3    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_007025815.1|  Uncharacterized protein TCM_030005               48.1    5e-04   



>ref|XP_002317245.1| hypothetical protein POPTR_0011s04160g [Populus trichocarpa]
 gb|EEE97857.1| hypothetical protein POPTR_0011s04160g [Populus trichocarpa]
Length=74

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 9/77 (12%)
 Frame = +3

Query  231  MSCISRVCRMAVASIAATETQTEQCSKYCTAFRAFRPSK----AVGAGAGDGELKRRKLE  398
            MS  SR C    AS+A  E Q    SK  + FR++   K    + G G  DGE KR++ E
Sbjct  1    MSYSSRNC--MEASLAGVEGQPSHGSKSNSTFRSWSSRKKSYFSGGNGGRDGESKRKQAE  58

Query  399  VDEESVRKVMLLNCWTQ  449
               +S ++VM LNCWTQ
Sbjct  59   ---DSFQRVMYLNCWTQ  72



>ref|XP_007025815.1| Uncharacterized protein TCM_030005 [Theobroma cacao]
 gb|EOY28437.1| Uncharacterized protein TCM_030005 [Theobroma cacao]
Length=81

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 48/83 (58%), Gaps = 11/83 (13%)
 Frame = +3

Query  231  MSCISRVCRMAVASIAATETQTEQCSKYCTAFRAFRPSK---AVGAGAGDGELKRR-KLE  398
            MS +SRVC MA AS+AA E   +  SK+ +  R    SK   A  A + D  L+ R K +
Sbjct  1    MSYLSRVC-MA-ASVAAVEGHRDCSSKWNSGLRPINASKRRYASTASSSDDRLRARGKPK  58

Query  399  VD-----EESVRKVMLLNCWTQS  452
             D     EES+++VM LNCWTQS
Sbjct  59   EDNGNQSEESLQRVMYLNCWTQS  81



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1798677760698