BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c39476_g1_i1 len=193 path=[171:0-192]

Length=193
                                                                      Score     E

gb|KDP40601.1|  hypothetical protein JCGZ_24600                       99.0    4e-22   
ref|XP_004956009.1|  PREDICTED: subtilisin-like protease-like         98.6    6e-22   
ref|XP_008357123.1|  PREDICTED: subtilisin-like protease              95.9    6e-21   
ref|XP_010091320.1|  Subtilisin-like protease                         92.8    6e-20   
ref|XP_004136374.1|  PREDICTED: subtilisin-like protease-like         92.0    1e-19   
ref|XP_010095549.1|  Subtilisin-like protease                         91.7    1e-19   
ref|XP_004164801.1|  PREDICTED: cucumisin-like                        92.0    1e-19   
ref|XP_007039328.1|  Subtilase family protein, putative isoform 2     91.7    1e-19   
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease              91.3    2e-19   
ref|XP_008221224.1|  PREDICTED: subtilisin-like protease              91.3    2e-19   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease              91.3    2e-19   
ref|NP_564107.1|  serine-type endopeptidase SBT5.2                    91.3    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65424.1|  subtilisin-like serine protease                       91.3    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5       91.3    2e-19   
ref|NP_001031070.1|  serine-type endopeptidase SBT5.2                 90.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010692513.1|  PREDICTED: CO(2)-response secreted protease      90.9    2e-19   
emb|CDX77071.1|  BnaC04g38660D                                        90.9    3e-19   
ref|XP_002893091.1|  subtilase                                        90.9    3e-19   
emb|CDY44210.1|  BnaC05g15670D                                        90.9    3e-19   
ref|XP_004287692.1|  PREDICTED: subtilisin-like protease-like         90.9    3e-19   
ref|XP_006416425.1|  hypothetical protein EUTSA_v10006877mg           90.9    3e-19   
ref|XP_009135013.1|  PREDICTED: subtilisin-like protease SBT5.3       90.9    3e-19   
ref|XP_010498448.1|  PREDICTED: CO(2)-response secreted protease-...  90.9    3e-19   
emb|CDX79081.1|  BnaA01g11480D                                        90.9    3e-19   
ref|XP_007226628.1|  hypothetical protein PRUPE_ppa022764mg           90.9    3e-19   
ref|XP_009149504.1|  PREDICTED: subtilisin-like protease              90.9    3e-19   
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease              90.9    3e-19   
ref|XP_011074702.1|  PREDICTED: CO(2)-response secreted protease-...  90.5    3e-19   
ref|XP_011074701.1|  PREDICTED: CO(2)-response secreted protease-...  90.5    3e-19   
ref|XP_010480961.1|  PREDICTED: subtilisin-like protease SBT3.5       90.5    4e-19   
ref|XP_006580141.1|  PREDICTED: subtilisin-like protease SDD1-lik...  90.5    4e-19   
gb|KHG24601.1|  Cucumisin                                             90.5    4e-19   
ref|XP_006306824.1|  hypothetical protein CARUB_v10008367mg           90.5    4e-19   
ref|NP_001169390.1|  putative subtilase family protein precursor      90.1    5e-19   Zea mays [maize]
ref|XP_008667163.1|  PREDICTED: putative subtilase family protein...  89.7    5e-19   
ref|XP_009802011.1|  PREDICTED: subtilisin-like protease              90.1    5e-19   
tpg|DAA41968.1|  TPA: putative subtilase family protein               90.1    5e-19   
ref|XP_003524182.2|  PREDICTED: subtilisin-like protease SDD1-lik...  90.1    5e-19   
gb|EAZ09847.1|  hypothetical protein OsI_32138                        90.1    5e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_010477246.1|  PREDICTED: CO(2)-response secreted protease ...  90.1    5e-19   
ref|XP_010463200.1|  PREDICTED: subtilisin-like protease SBT3.5       90.1    5e-19   
ref|XP_010477247.1|  PREDICTED: CO(2)-response secreted protease ...  90.1    5e-19   
gb|ACF86497.1|  unknown                                               90.1    5e-19   Zea mays [maize]
ref|XP_008667162.1|  PREDICTED: putative subtilase family protein...  90.1    5e-19   
emb|CDX82843.1|  BnaC01g12930D                                        90.1    6e-19   
emb|CBI34614.3|  unnamed protein product                              90.5    7e-19   
ref|XP_003578494.1|  PREDICTED: subtilisin-like protease SBT3.5       89.7    7e-19   
ref|NP_001063751.1|  Os09g0530800                                     89.7    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006829610.1|  hypothetical protein AMTR_s00122p00026080        89.4    8e-19   
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like    89.4    8e-19   
ref|XP_010542106.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  89.4    8e-19   
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760        89.4    9e-19   Sorghum bicolor [broomcorn]
ref|XP_002301847.2|  STOMATAL DENSITY AND DISTRIBUTION family pro...  89.4    9e-19   Populus trichocarpa [western balsam poplar]
emb|CDM80022.1|  unnamed protein product                              89.4    9e-19   
ref|XP_011075896.1|  PREDICTED: subtilisin-like protease SBT3.5       89.4    9e-19   
ref|XP_010543788.1|  PREDICTED: CO(2)-response secreted protease ...  89.4    1e-18   
ref|XP_008809445.1|  PREDICTED: subtilisin-like protease SBT5.3       89.4    1e-18   
emb|CDX98690.1|  BnaA03g44750D                                        89.0    1e-18   
ref|XP_007047459.1|  Subtilase family protein                         89.4    1e-18   
ref|XP_006304869.1|  hypothetical protein CARUB_v10012621mg           89.0    1e-18   
ref|XP_007136109.1|  hypothetical protein PHAVU_009G018600g           89.0    1e-18   
ref|XP_010262465.1|  PREDICTED: subtilisin-like protease SDD1         89.0    1e-18   
ref|XP_009140769.1|  PREDICTED: subtilisin-like protease SBT5.4       89.0    1e-18   
ref|XP_003523384.1|  PREDICTED: subtilisin-like protease-like         89.0    1e-18   
ref|XP_004504377.1|  PREDICTED: subtilisin-like protease SDD1-lik...  88.6    1e-18   
ref|XP_002451012.1|  hypothetical protein SORBIDRAFT_05g022600        89.0    1e-18   Sorghum bicolor [broomcorn]
gb|EMS55531.1|  Subtilisin-like protease                              89.0    1e-18   
ref|XP_008668394.1|  PREDICTED: putative subtilase family protein...  88.6    1e-18   
emb|CDX84657.1|  BnaA03g15730D                                        89.0    1e-18   
emb|CDX94044.1|  BnaC07g36780D                                        89.0    1e-18   
ref|XP_006580143.1|  PREDICTED: subtilisin-like protease SDD1-lik...  88.6    2e-18   
ref|XP_002273703.1|  PREDICTED: CO(2)-response secreted protease      88.6    2e-18   Vitis vinifera
ref|XP_009391633.1|  PREDICTED: subtilisin-like protease isoform X2   88.6    2e-18   
ref|XP_004504376.1|  PREDICTED: subtilisin-like protease SDD1-lik...  88.6    2e-18   
ref|XP_002465831.1|  hypothetical protein SORBIDRAFT_01g046525        85.5    2e-18   Sorghum bicolor [broomcorn]
emb|CDX94043.1|  BnaC07g36770D                                        88.6    2e-18   
ref|XP_006580142.1|  PREDICTED: subtilisin-like protease SDD1-lik...  88.2    2e-18   
ref|XP_006846917.1|  hypothetical protein AMTR_s00152p00071630        88.6    2e-18   
ref|XP_009391632.1|  PREDICTED: subtilisin-like protease isoform X1   88.6    2e-18   
ref|XP_009392092.1|  PREDICTED: subtilisin-like protease              88.2    2e-18   
ref|XP_010229480.1|  PREDICTED: CO(2)-response secreted protease-...  85.1    2e-18   
gb|AIC80773.1|  subtilase                                             88.6    2e-18   
ref|XP_010461117.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  88.2    2e-18   
ref|XP_006658495.1|  PREDICTED: subtilisin-like protease-like         88.6    2e-18   
ref|NP_567632.1|  Subtilase family protein                            88.2    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391366.1|  hypothetical protein EUTSA_v10018188mg           88.2    2e-18   
gb|EEE69927.1|  hypothetical protein OsJ_29791                        87.4    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046517.1|  Os02g0269600                                     88.2    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_568255.1|  Subtilase family protein                            88.2    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004308189.1|  PREDICTED: subtilisin-like protease-like         88.2    3e-18   
gb|EAZ09528.1|  hypothetical protein OsI_31804                        88.2    3e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease              88.2    3e-18   
ref|XP_010317055.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  88.2    3e-18   
emb|CDY25259.1|  BnaA02g21970D                                        88.2    3e-18   
ref|XP_004233282.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  88.2    3e-18   
ref|XP_007039330.1|  Subtilase family protein, putative               88.2    3e-18   
gb|EMT21268.1|  Subtilisin-like protease                              87.8    3e-18   
ref|XP_010499843.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  88.6    3e-18   
emb|CDX93811.1|  BnaA09g24110D                                        87.8    3e-18   
gb|EMS51782.1|  Subtilisin-like protease SDD1                         87.8    3e-18   
dbj|BAJ93850.1|  predicted protein                                    87.8    3e-18   
ref|XP_003572346.1|  PREDICTED: subtilisin-like protease SBT3.5       87.8    3e-18   
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg           87.8    3e-18   
emb|CDX98693.1|  BnaA03g44780D                                        87.8    3e-18   
ref|XP_004252763.1|  PREDICTED: subtilisin-like protease              87.8    3e-18   
ref|XP_008447369.1|  PREDICTED: subtilisin-like protease SDD1         87.8    3e-18   
gb|KFK44143.1|  hypothetical protein AALP_AA1G220600                  87.8    3e-18   
ref|XP_009114847.1|  PREDICTED: subtilisin-like protease SBT5.3       87.8    3e-18   
ref|XP_010532550.1|  PREDICTED: cucumisin-like                        87.8    3e-18   
ref|XP_006397048.1|  hypothetical protein EUTSA_v10028454mg           87.8    3e-18   
ref|XP_002461867.1|  hypothetical protein SORBIDRAFT_02g009600        87.8    3e-18   Sorghum bicolor [broomcorn]
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                 87.8    3e-18   
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like         87.8    3e-18   
ref|XP_006285171.1|  hypothetical protein CARUB_v10006516mg           87.8    3e-18   
ref|XP_010266013.1|  PREDICTED: CO(2)-response secreted protease-...  87.8    3e-18   
ref|XP_008652277.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  87.8    3e-18   
ref|XP_008652275.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  87.8    3e-18   
ref|XP_004152066.1|  PREDICTED: subtilisin-like protease SDD1-like    87.8    4e-18   
ref|XP_003554304.1|  PREDICTED: subtilisin-like protease SDD1-like    87.8    4e-18   
ref|XP_009614808.1|  PREDICTED: cucumisin-like                        87.8    4e-18   
ref|XP_007131422.1|  hypothetical protein PHAVU_011G012100g           87.0    4e-18   
gb|EMT21161.1|  Cucumisin                                             87.4    4e-18   
ref|XP_009768389.1|  PREDICTED: cucumisin-like                        87.8    4e-18   
ref|XP_008242125.1|  PREDICTED: subtilisin-like protease              87.8    4e-18   
ref|XP_007039327.1|  Subtilase family protein, putative isoform 1     87.8    4e-18   
ref|XP_010436935.1|  PREDICTED: subtilisin-like protease SBT3.3       87.4    4e-18   
gb|EMS68678.1|  Subtilisin-like protease                              87.4    4e-18   
gb|EYU28147.1|  hypothetical protein MIMGU_mgv1a018442mg              87.4    4e-18   
emb|CBI23085.3|  unnamed protein product                              87.8    5e-18   
ref|XP_008800195.1|  PREDICTED: xylem serine proteinase 1-like        85.1    5e-18   
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease              87.4    5e-18   
emb|CDP03800.1|  unnamed protein product                              87.4    5e-18   
gb|KDO60343.1|  hypothetical protein CISIN_1g004101mg                 87.4    5e-18   
gb|ABE66081.1|  subtilase family protein                              84.7    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010652423.1|  PREDICTED: subtilisin-like protease SDD1         87.4    5e-18   
gb|KGN58306.1|  hypothetical protein Csa_3G610820                     87.4    5e-18   
gb|AAK53589.1|AF352059_1  subtilisin-like protein                     87.4    5e-18   Glycine max [soybeans]
gb|EMS61069.1|  Subtilisin-like protease                              87.0    5e-18   
ref|XP_006348565.1|  PREDICTED: subtilisin-like protease-like         87.4    5e-18   
ref|XP_004166310.1|  PREDICTED: subtilisin-like protease SDD1-like    87.0    6e-18   
ref|XP_004289494.1|  PREDICTED: subtilisin-like protease-like         87.0    6e-18   
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg           87.0    6e-18   
gb|KHN09070.1|  Subtilisin-like protease                              87.0    6e-18   
ref|XP_006479431.1|  PREDICTED: subtilisin-like protease SDD1-like    87.0    6e-18   
ref|XP_006415135.1|  hypothetical protein EUTSA_v10006863mg           87.0    6e-18   
emb|CDY18654.1|  BnaA09g07410D                                        87.0    6e-18   
ref|XP_009614807.1|  PREDICTED: subtilisin-like protease SBT5.3       87.0    6e-18   
ref|XP_003545787.1|  PREDICTED: subtilisin-like protease-like         87.0    6e-18   
ref|NP_001236511.1|  subtilisin-type protease precursor               87.0    6e-18   
emb|CDX91186.1|  BnaC02g04110D                                        87.0    6e-18   
ref|XP_004978766.1|  PREDICTED: subtilisin-like protease-like         87.0    6e-18   
ref|XP_011098007.1|  PREDICTED: subtilisin-like protease SBT3.5       87.0    6e-18   
gb|EMT05074.1|  Subtilisin-like protease                              87.4    6e-18   
gb|KFK32412.1|  hypothetical protein AALP_AA6G238800                  87.0    6e-18   
gb|KFK45040.1|  hypothetical protein AALP_AA1G336300                  87.0    6e-18   
ref|XP_007204641.1|  hypothetical protein PRUPE_ppa001800mg           87.0    6e-18   
dbj|BAK05842.1|  predicted protein                                    87.0    7e-18   
ref|XP_009600483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  86.7    7e-18   
ref|XP_010470046.1|  PREDICTED: subtilisin-like protease SBT3.3       85.5    7e-18   
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  87.0    7e-18   
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  87.0    7e-18   
ref|XP_010661922.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  87.4    7e-18   
ref|XP_003634153.1|  PREDICTED: subtilisin-like protease SBT3.5       87.0    7e-18   
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative    87.0    7e-18   Ricinus communis
gb|EMS67122.1|  Subtilisin-like protease                              87.0    7e-18   
ref|XP_002526537.1|  Cucumisin precursor, putative                    87.0    7e-18   Ricinus communis
gb|EYU31525.1|  hypothetical protein MIMGU_mgv1a001949mg              86.7    7e-18   
ref|XP_010536423.1|  PREDICTED: CO(2)-response secreted protease-...  86.7    7e-18   
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease              86.7    7e-18   
ref|XP_006660880.1|  PREDICTED: subtilisin-like protease-like         86.7    7e-18   
ref|XP_002872522.1|  subtilase family protein                         86.7    8e-18   
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like         86.7    8e-18   
ref|XP_008800183.1|  PREDICTED: subtilisin-like protease SBT5.3       86.7    8e-18   
ref|XP_006306820.1|  hypothetical protein CARUB_v10008362mg           86.7    8e-18   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease              86.7    8e-18   
ref|XP_009355089.1|  PREDICTED: subtilisin-like protease SBT5.3       86.7    8e-18   
ref|XP_008346279.1|  PREDICTED: subtilisin-like protease              86.7    8e-18   
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like         86.7    8e-18   
ref|XP_004228919.2|  PREDICTED: CO(2)-response secreted protease-...  86.7    9e-18   
ref|XP_007046423.1|  Subtilisin-like serine endopeptidase family ...  85.9    9e-18   
gb|ADD09584.1|  proteinase inhibitor                                  86.7    9e-18   Trifolium repens [creeping white clover]
ref|XP_007131420.1|  hypothetical protein PHAVU_011G012100g           85.9    9e-18   
ref|XP_010451309.1|  PREDICTED: subtilisin-like protease SBT3.3       83.2    1e-17   
ref|XP_006829160.1|  hypothetical protein AMTR_s00001p00269990        86.7    1e-17   
ref|XP_010251788.1|  PREDICTED: CO(2)-response secreted protease-...  86.7    1e-17   
emb|CBI37197.3|  unnamed protein product                              87.0    1e-17   
ref|XP_010933213.1|  PREDICTED: subtilisin-like protease SDD1         86.3    1e-17   
emb|CBI38006.3|  unnamed protein product                              86.3    1e-17   
ref|NP_001169603.1|  putative subtilase family protein precursor      86.3    1e-17   Zea mays [maize]
ref|XP_010647672.1|  PREDICTED: subtilisin-like protease SBT3.5       86.3    1e-17   
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like         86.3    1e-17   
ref|NP_567360.1|  Subtilase family protein                            86.3    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KCW72613.1|  hypothetical protein EUGRSUZ_E01073                   86.7    1e-17   
dbj|BAD35681.1|  putative subtilisin-like serine proteinase           85.9    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002525580.1|  Xylem serine proteinase 1 precursor, putative    86.3    1e-17   Ricinus communis
ref|XP_010028239.1|  PREDICTED: subtilisin-like protease              86.3    1e-17   
gb|KCW54937.1|  hypothetical protein EUGRSUZ_I00910                   86.3    1e-17   
ref|XP_009407970.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  86.3    1e-17   
ref|XP_006365013.1|  PREDICTED: subtilisin-like protease-like         86.3    1e-17   
emb|CDY49640.1|  BnaCnng17920D                                        86.3    1e-17   
ref|XP_006287131.1|  hypothetical protein CARUB_v10000302mg           85.9    1e-17   
ref|NP_564412.1|  Subtilase 3.5                                       86.3    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010270603.1|  PREDICTED: subtilisin-like protease SBT5.3       85.9    1e-17   
ref|XP_009132975.1|  PREDICTED: subtilisin-like protease SBT5.3       85.9    1e-17   
gb|EYU36336.1|  hypothetical protein MIMGU_mgv1a019012mg              85.9    1e-17   
ref|NP_567359.1|  Subtilase family protein                            85.9    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105193.1|  PREDICTED: subtilisin-like protease SBT5.3       85.9    1e-17   
ref|XP_002458431.1|  hypothetical protein SORBIDRAFT_03g033440        85.9    1e-17   Sorghum bicolor [broomcorn]
gb|EMS57180.1|  Subtilisin-like protease                              85.5    2e-17   
ref|NP_001051353.1|  Os03g0761500                                     85.9    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EYU44466.1|  hypothetical protein MIMGU_mgv1a0020561mg             83.2    2e-17   
gb|KDP40600.1|  hypothetical protein JCGZ_24599                       85.9    2e-17   
emb|CDY07492.1|  BnaA07g25710D                                        85.9    2e-17   
ref|XP_009125836.1|  PREDICTED: subtilisin-like protease SBT5.4       85.9    2e-17   
ref|XP_003552427.1|  PREDICTED: subtilisin-like protease-like         85.9    2e-17   
emb|CBI23086.3|  unnamed protein product                              85.9    2e-17   
gb|EMT19033.1|  Subtilisin-like protease                              85.9    2e-17   
emb|CDP17236.1|  unnamed protein product                              85.9    2e-17   
ref|XP_004501532.1|  PREDICTED: subtilisin-like protease-like         85.9    2e-17   
ref|XP_010456502.1|  PREDICTED: subtilisin-like protease SBT3.3       85.9    2e-17   
ref|XP_009586900.1|  PREDICTED: subtilisin-like protease              85.9    2e-17   
ref|XP_003629621.1|  Subtilisin-like protease                         85.9    2e-17   
ref|NP_001046522.1|  Os02g0271000                                     85.5    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006282786.1|  hypothetical protein CARUB_v10006393mg           85.5    2e-17   
gb|KDP41644.1|  hypothetical protein JCGZ_16051                       85.5    2e-17   
ref|XP_007158029.1|  hypothetical protein PHAVU_002G118200g           85.5    2e-17   
ref|XP_007046422.1|  Subtilisin-like serine endopeptidase family ...  85.5    2e-17   
ref|XP_010554964.1|  PREDICTED: subtilisin-like protease SBT3.3       85.5    2e-17   
ref|XP_003634152.2|  PREDICTED: subtilisin-like protease SBT3.5       85.5    2e-17   
gb|AET04097.2|  subtilisin-like serine protease                       85.5    2e-17   
ref|XP_010912031.1|  PREDICTED: subtilisin-like protease              85.5    2e-17   
ref|XP_007131421.1|  hypothetical protein PHAVU_011G012100g           85.5    2e-17   
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease              85.5    2e-17   
ref|XP_009350314.1|  PREDICTED: subtilisin-like protease SBT5.3       85.5    2e-17   
gb|EMT05336.1|  Subtilisin-like protease                              85.5    2e-17   
ref|XP_002960359.1|  hypothetical protein SELMODRAFT_437460           85.5    2e-17   
ref|XP_008810058.1|  PREDICTED: subtilisin-like protease SDD1         85.5    2e-17   
ref|NP_001151463.1|  LOC100285096 precursor                           85.5    2e-17   Zea mays [maize]
ref|XP_004509477.1|  PREDICTED: subtilisin-like protease SDD1-lik...  85.5    2e-17   
ref|XP_003520616.1|  PREDICTED: subtilisin-like protease SDD1-like    85.5    2e-17   
ref|XP_004509478.1|  PREDICTED: subtilisin-like protease SDD1-lik...  85.5    2e-17   
ref|XP_006370742.1|  hypothetical protein POPTR_0001s460001g          83.2    2e-17   
ref|XP_002273195.2|  PREDICTED: subtilisin-like protease SBT3.5       85.5    2e-17   Vitis vinifera
emb|CDY65868.1|  BnaAnng21170D                                        85.1    2e-17   
ref|XP_004512297.1|  PREDICTED: subtilisin-like protease-like iso...  85.5    2e-17   
ref|XP_006286455.1|  hypothetical protein CARUB_v10000290mg           85.1    2e-17   
ref|XP_006286458.1|  hypothetical protein CARUB_v10000288mg           85.5    2e-17   
ref|XP_004512298.1|  PREDICTED: subtilisin-like protease-like iso...  85.5    2e-17   
ref|XP_006289363.1|  hypothetical protein CARUB_v10002849mg           85.5    2e-17   
ref|XP_008375469.1|  PREDICTED: cucumisin-like                        85.5    2e-17   
tpg|DAA51518.1|  TPA: putative subtilase family protein               85.5    2e-17   
ref|XP_009361969.1|  PREDICTED: cucumisin-like                        85.1    2e-17   
ref|XP_004512299.1|  PREDICTED: subtilisin-like protease-like iso...  85.5    2e-17   
emb|CDY61569.1|  BnaCnng38020D                                        85.9    2e-17   
ref|XP_008346979.1|  PREDICTED: cucumisin-like                        85.5    2e-17   
ref|XP_009137202.1|  PREDICTED: subtilisin-like protease SBT5.3       85.5    2e-17   
gb|EMT32761.1|  Subtilisin-like protease                              85.5    2e-17   
ref|XP_002891020.1|  subtilase family protein                         85.5    2e-17   
gb|KFK45041.1|  hypothetical protein AALP_AA1G336500                  85.1    3e-17   
ref|XP_010421967.1|  PREDICTED: subtilisin-like protease SBT3.3       85.1    3e-17   
ref|XP_002891022.1|  subtilase family protein                         85.1    3e-17   
ref|XP_002891021.1|  predicted protein                                85.1    3e-17   
gb|KHN10783.1|  Subtilisin-like protease SDD1                         85.1    3e-17   
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...  85.1    3e-17   
ref|XP_010455450.1|  PREDICTED: subtilisin-like protease SBT3.3       85.1    3e-17   
ref|XP_009782970.1|  PREDICTED: subtilisin-like protease SBT5.4       85.1    3e-17   
ref|XP_004146562.1|  PREDICTED: subtilisin-like protease-like         85.1    3e-17   
ref|XP_008796284.1|  PREDICTED: subtilisin-like protease SBT5.3       85.1    3e-17   
ref|XP_003541562.1|  PREDICTED: subtilisin-like protease-like         85.1    3e-17   
gb|KHN10324.1|  Subtilisin-like protease                              85.1    3e-17   
ref|XP_002871506.1|  subtilase family protein                         85.1    3e-17   
ref|XP_002437302.1|  hypothetical protein SORBIDRAFT_10g024550        85.1    3e-17   Sorghum bicolor [broomcorn]
ref|XP_002451014.1|  hypothetical protein SORBIDRAFT_05g022620        85.1    3e-17   Sorghum bicolor [broomcorn]
ref|XP_009391664.1|  PREDICTED: subtilisin-like protease SDD1         85.1    3e-17   
gb|EEE60418.1|  hypothetical protein OsJ_13612                        85.1    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009800439.1|  PREDICTED: subtilisin-like protease              85.1    3e-17   
ref|NP_001044510.1|  Os01g0795400                                     83.2    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease              85.1    3e-17   
ref|XP_009769238.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  85.1    3e-17   
emb|CAB36809.1|  subtilisin proteinase-like                           85.1    3e-17   
ref|XP_010908011.1|  PREDICTED: CO(2)-response secreted protease-...  85.1    3e-17   
ref|XP_002284864.1|  PREDICTED: subtilisin-like protease              85.1    3e-17   
emb|CAE76061.1|  B1248C03.20                                          85.1    3e-17   
ref|XP_006415136.1|  hypothetical protein EUTSA_v10006855mg           85.1    3e-17   
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease              85.1    3e-17   
ref|XP_009790288.1|  PREDICTED: subtilisin-like protease              85.1    3e-17   
ref|XP_002528535.1|  Cucumisin precursor, putative                    85.1    3e-17   
ref|XP_007210025.1|  hypothetical protein PRUPE_ppa018629mg           85.1    3e-17   
gb|KEH41295.1|  subtilisin-like serine endopeptidase family protein   84.7    3e-17   
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease              84.7    3e-17   
gb|ABF70004.1|  subtilisin-like serine proteinase, putative           84.7    3e-17   
emb|CBI23066.3|  unnamed protein product                              84.7    3e-17   
ref|XP_010105481.1|  Subtilisin-like protease                         81.3    4e-17   
ref|XP_006647148.1|  PREDICTED: subtilisin-like protease-like         85.1    4e-17   
ref|XP_006644839.1|  PREDICTED: subtilisin-like protease SDD1-like    84.7    4e-17   
ref|XP_004493834.1|  PREDICTED: subtilisin-like protease SDD1-like    84.7    4e-17   
ref|XP_010470495.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  84.7    4e-17   
ref|XP_010230283.1|  PREDICTED: subtilisin-like protease SDD1         85.1    4e-17   
emb|CAN60787.1|  hypothetical protein VITISV_034533                   84.7    4e-17   
ref|XP_002284869.3|  PREDICTED: subtilisin-like protease              84.7    4e-17   
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310        84.7    4e-17   
ref|XP_009769237.1|  PREDICTED: subtilisin-like protease isoform X1   84.7    4e-17   
gb|KDO84129.1|  hypothetical protein CISIN_1g004265mg                 84.7    4e-17   
ref|XP_006434737.1|  hypothetical protein CICLE_v10000364mg           84.7    4e-17   
ref|XP_008776598.1|  PREDICTED: subtilisin-like protease              84.7    4e-17   
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like         84.7    4e-17   
ref|XP_002967356.1|  hypothetical protein SELMODRAFT_408319           84.7    4e-17   
ref|XP_010061088.1|  PREDICTED: subtilisin-like protease SBT5.3       84.7    4e-17   
ref|XP_010437005.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  84.7    4e-17   
emb|CDY54842.1|  BnaC05g51310D                                        85.1    4e-17   
ref|XP_006425216.1|  hypothetical protein CICLE_v10024941mg           84.7    4e-17   
ref|XP_006467138.1|  PREDICTED: subtilisin-like protease-like iso...  84.7    4e-17   
gb|AES81608.2|  subtilisin-like serine protease                       84.7    4e-17   
ref|XP_008793983.1|  PREDICTED: subtilisin-like protease              84.7    4e-17   
ref|XP_003625390.1|  Subtilisin-like protease                         84.7    4e-17   
gb|KEH19206.1|  subtilisin-like serine protease                       84.3    4e-17   
tpg|DAA62442.1|  TPA: putative subtilase family protein               84.0    4e-17   
gb|KDO71607.1|  hypothetical protein CISIN_1g004205mg                 84.7    4e-17   
dbj|BAA13135.1|  subtilisin-like protein                              84.7    4e-17   
ref|XP_007042045.1|  Subtilase family protein, putative isoform 4     84.0    4e-17   
ref|XP_004293027.1|  PREDICTED: cucumisin-like                        84.7    4e-17   
gb|EYU28148.1|  hypothetical protein MIMGU_mgv1a026974mg              84.7    4e-17   
ref|XP_006342632.1|  PREDICTED: subtilisin-like protease-like         84.7    4e-17   
gb|EYU36340.1|  hypothetical protein MIMGU_mgv1a001790mg              84.7    4e-17   
gb|KEH19205.1|  subtilisin-like serine protease                       84.7    4e-17   
dbj|BAC53929.1|  serine protease-like protein                         84.3    4e-17   
gb|EMT21267.1|  Subtilisin-like protease                              84.3    4e-17   
ref|XP_011004403.1|  PREDICTED: subtilisin-like protease SBT3.5       84.7    4e-17   
ref|XP_003603196.1|  Subtilisin-type protease                         84.7    4e-17   
ref|XP_006286454.1|  hypothetical protein CARUB_v10000290mg           84.3    5e-17   
ref|XP_008444575.1|  PREDICTED: subtilisin-like protease              84.7    5e-17   
ref|XP_007162604.1|  hypothetical protein PHAVU_001G165300g           84.7    5e-17   
ref|XP_003550312.1|  PREDICTED: subtilisin-like protease-like         84.3    5e-17   
ref|NP_567633.2|  Subtilase family protein                            84.3    5e-17   
ref|XP_010478712.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  84.3    5e-17   
ref|XP_006653124.1|  PREDICTED: subtilisin-like protease-like         84.3    5e-17   
ref|XP_009392091.1|  PREDICTED: subtilisin-like protease SBT5.3       84.0    5e-17   
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease              84.3    5e-17   
ref|XP_009128710.1|  PREDICTED: subtilisin-like protease SBT5.3       84.3    5e-17   
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease              84.3    5e-17   
ref|XP_003581342.1|  PREDICTED: subtilisin-like protease SBT3.3       84.3    5e-17   
emb|CDP14563.1|  unnamed protein product                              84.3    5e-17   
gb|KFK42754.1|  hypothetical protein AALP_AA1G035200                  84.3    5e-17   
gb|EEC72889.1|  hypothetical protein OsI_06699                        84.3    5e-17   
emb|CDY67452.1|  BnaCnng55020D                                        84.3    5e-17   
gb|KDP26457.1|  hypothetical protein JCGZ_17615                       84.3    6e-17   
ref|XP_010919042.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  84.3    6e-17   
ref|XP_002892197.1|  hypothetical protein ARALYDRAFT_470387           84.3    6e-17   
ref|XP_010470496.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  84.0    6e-17   
ref|XP_009137200.1|  PREDICTED: subtilisin-like protease SBT5.3       84.3    6e-17   
ref|XP_006342631.1|  PREDICTED: subtilisin-like protease-like         84.3    6e-17   
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g           84.3    6e-17   
ref|XP_007220237.1|  hypothetical protein PRUPE_ppa001918mg           84.3    6e-17   
ref|XP_010916207.1|  PREDICTED: subtilisin-like protease SBT5.4 i...  84.3    6e-17   
ref|XP_004499011.1|  PREDICTED: subtilisin-like protease-like         84.3    6e-17   
ref|XP_011038086.1|  PREDICTED: subtilisin-like protease SBT3.5       84.3    6e-17   
ref|NP_001052081.1|  Os04g0127200                                     84.0    6e-17   
ref|XP_007047286.1|  Subtilisin-like serine endopeptidase family ...  84.3    6e-17   
gb|EPS65938.1|  hypothetical protein M569_08836                       84.3    6e-17   
ref|XP_004512212.1|  PREDICTED: subtilisin-like protease-like         84.3    6e-17   
ref|XP_008231725.1|  PREDICTED: subtilisin-like protease              84.3    6e-17   
ref|XP_002981073.1|  hypothetical protein SELMODRAFT_113931           84.0    6e-17   
ref|XP_009771086.1|  PREDICTED: subtilisin-like protease              84.3    6e-17   
ref|XP_006849918.1|  hypothetical protein AMTR_s00022p00110120        84.0    6e-17   
ref|XP_006651839.1|  PREDICTED: subtilisin-like protease-like         84.0    6e-17   
emb|CDY07491.1|  BnaA07g25700D                                        84.3    6e-17   
ref|XP_007158047.1|  hypothetical protein PHAVU_002G119700g           84.3    6e-17   
ref|NP_193895.2|  Subtilase family protein                            84.0    6e-17   
ref|XP_010421966.1|  PREDICTED: subtilisin-like protease SBT3.3       84.0    6e-17   
ref|XP_011017137.1|  PREDICTED: subtilisin-like protease              84.3    6e-17   
ref|XP_002868236.1|  predicted protein                                84.0    7e-17   
ref|XP_008239249.1|  PREDICTED: subtilisin-like protease              84.0    7e-17   
ref|XP_009105192.1|  PREDICTED: subtilisin-like protease SBT5.3       84.0    7e-17   
gb|KDP36888.1|  hypothetical protein JCGZ_08179                       84.0    7e-17   
ref|XP_002974998.1|  hypothetical protein SELMODRAFT_150329           84.0    7e-17   
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like         84.0    7e-17   
ref|XP_006301525.1|  hypothetical protein CARUB_v10021953mg           84.0    7e-17   
ref|XP_008804320.1|  PREDICTED: subtilisin-like protease SBT5.3       84.0    7e-17   
emb|CDP07365.1|  unnamed protein product                              84.0    7e-17   
ref|XP_002282841.2|  PREDICTED: uncharacterized protein LOC100259061  84.3    7e-17   
ref|XP_007042044.1|  Subtilase family protein, putative isoform 3     84.0    7e-17   
ref|NP_001238252.1|  subtilisin-type protease precursor               84.0    7e-17   
dbj|BAJ53097.1|  JHL20J20.3                                           84.0    7e-17   
ref|XP_009391854.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  84.0    7e-17   
ref|NP_001159267.1|  uncharacterized protein LOC100304357 precursor   84.0    8e-17   
gb|ABD64827.1|  putative subtilisin serine protease of stomatal d...  84.0    8e-17   
ref|XP_004142885.1|  PREDICTED: subtilisin-like protease-like iso...  83.6    8e-17   
emb|CDY49641.1|  BnaCnng17930D                                        84.0    8e-17   
ref|XP_010091321.1|  Subtilisin-like protease                         84.0    8e-17   
ref|XP_009400152.1|  PREDICTED: subtilisin-like protease SBT5.4       84.0    8e-17   
ref|XP_009606152.1|  PREDICTED: subtilisin-like protease SBT5.4       84.0    8e-17   
ref|XP_011028928.1|  PREDICTED: subtilisin-like protease              84.0    8e-17   
ref|XP_008452040.1|  PREDICTED: subtilisin-like protease              84.0    8e-17   
ref|XP_010916217.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  83.6    8e-17   
ref|XP_008392654.1|  PREDICTED: subtilisin-like protease SDD1         84.0    9e-17   
dbj|BAJ99493.1|  predicted protein                                    84.0    9e-17   
gb|EMT13355.1|  Subtilisin-like protease                              83.6    9e-17   
ref|XP_008804318.1|  PREDICTED: subtilisin-like protease              83.6    9e-17   
ref|XP_009387941.1|  PREDICTED: subtilisin-like protease Glyma18g...  83.2    9e-17   
emb|CDM82077.1|  unnamed protein product                              83.6    9e-17   
gb|KHN10158.1|  Subtilisin-like protease                              83.6    9e-17   
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like         83.6    9e-17   
gb|EYU28710.1|  hypothetical protein MIMGU_mgv1a002109mg              83.6    9e-17   
ref|XP_010457444.1|  PREDICTED: subtilisin-like protease SDD1         83.6    9e-17   
ref|XP_009604890.1|  PREDICTED: subtilisin-like protease              83.6    9e-17   
ref|XP_010470055.1|  PREDICTED: subtilisin-like protease SBT3.3       83.6    9e-17   
tpg|DAA62441.1|  TPA: putative subtilase family protein               83.2    9e-17   
ref|XP_008648121.1|  PREDICTED: putative subtilase family protein...  83.6    1e-16   
ref|XP_006435228.1|  hypothetical protein CICLE_v10000339mg           83.6    1e-16   
gb|EEE55729.1|  hypothetical protein OsJ_04215                        83.6    1e-16   
ref|XP_007133571.1|  hypothetical protein PHAVU_011G190300g           83.6    1e-16   
emb|CDM84531.1|  unnamed protein product                              83.6    1e-16   
ref|XP_002310134.2|  subtilase family protein                         83.6    1e-16   
dbj|BAD82002.1|  putative subtilase                                   83.6    1e-16   
ref|XP_003516513.1|  PREDICTED: subtilisin-like protease-like         83.6    1e-16   
ref|XP_009348700.1|  PREDICTED: subtilisin-like protease SBT5.3       83.6    1e-16   
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like         83.6    1e-16   
gb|AAG51763.1|AC066691_3  hypothetical protein; 8963-6048             83.6    1e-16   
ref|XP_010056036.1|  PREDICTED: subtilisin-like protease SBT5.3       83.6    1e-16   
ref|XP_010421968.1|  PREDICTED: subtilisin-like protease SBT3.3       83.6    1e-16   
ref|XP_010933350.1|  PREDICTED: LOW QUALITY PROTEIN: CO(2)-respon...  83.6    1e-16   
ref|XP_010529677.1|  PREDICTED: subtilisin-like protease SBT3.3       83.6    1e-16   
ref|XP_004954566.1|  PREDICTED: LOW QUALITY PROTEIN: xylem serine...  83.2    1e-16   
ref|XP_010449025.1|  PREDICTED: subtilisin-like protease SBT3.3 i...  83.6    1e-16   
ref|NP_564869.1|  Subtilase-like protein                              83.6    1e-16   
ref|XP_009344070.1|  PREDICTED: subtilisin-like protease SBT5.3       83.2    1e-16   
gb|KHN21060.1|  Subtilisin-like protease                              83.6    1e-16   
ref|XP_008231513.1|  PREDICTED: cucumisin-like                        81.6    1e-16   
ref|XP_009780984.1|  PREDICTED: subtilisin-like protease SBT5.3       83.6    1e-16   
ref|XP_002888489.1|  subtilase family protein                         83.6    1e-16   
ref|XP_006365833.1|  PREDICTED: subtilisin-like protease-like         83.6    1e-16   
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1     83.6    1e-16   
ref|XP_003544482.1|  PREDICTED: subtilisin-like protease-like         83.6    1e-16   
gb|EEE55325.1|  hypothetical protein OsJ_03327                        83.6    1e-16   
ref|XP_010056037.1|  PREDICTED: subtilisin-like protease SBT5.3       83.2    1e-16   
ref|XP_010475053.1|  PREDICTED: subtilisin-like protease SDD1         83.2    1e-16   
gb|KHN28302.1|  Subtilisin-like protease                              83.2    1e-16   
gb|AES74057.2|  subtilisin-like serine protease                       82.8    1e-16   
ref|XP_011080122.1|  PREDICTED: subtilisin-like protease SDD1         83.2    1e-16   
ref|XP_007017871.1|  Subtilisin-like serine endopeptidase family ...  83.2    1e-16   
gb|EYU19440.1|  hypothetical protein MIMGU_mgv1a001654mg              83.2    1e-16   
ref|XP_007210725.1|  hypothetical protein PRUPE_ppa022363mg           83.2    1e-16   
ref|XP_004142884.1|  PREDICTED: subtilisin-like protease-like iso...  83.2    1e-16   
ref|XP_007017870.1|  Subtilisin-like serine endopeptidase family ...  83.2    1e-16   
ref|XP_004309569.1|  PREDICTED: subtilisin-like protease SDD1-like    83.2    1e-16   
ref|XP_008344176.1|  PREDICTED: subtilisin-like protease isoform X2   83.2    1e-16   
gb|KEH19202.1|  subtilisin-like serine protease                       83.2    1e-16   
ref|XP_006369092.1|  subtilase family protein                         83.2    1e-16   
ref|XP_006355620.1|  PREDICTED: subtilisin-like protease-like         83.2    1e-16   
gb|KDO84930.1|  hypothetical protein CISIN_1g004113mg                 83.2    1e-16   
ref|XP_010461118.1|  PREDICTED: subtilisin-like protease SBT3.5       83.2    1e-16   
emb|CDY57477.1|  BnaAnng14590D                                        83.2    1e-16   
ref|XP_002867836.1|  subtilase family protein                         83.2    1e-16   
emb|CDM80019.1|  unnamed protein product                              83.2    2e-16   
ref|XP_009369762.1|  PREDICTED: subtilisin-like protease SBT5.4       83.2    2e-16   
gb|AHJ61058.1|  Hwi2                                                  83.2    2e-16   
ref|XP_008344175.1|  PREDICTED: subtilisin-like protease isoform X1   83.2    2e-16   
ref|XP_004232973.1|  PREDICTED: subtilisin-like protease SBT5.3       83.2    2e-16   
ref|XP_007051971.1|  Subtilase family protein                         83.2    2e-16   
ref|XP_011048159.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  83.2    2e-16   
ref|XP_009790648.1|  PREDICTED: subtilisin-like protease SDD1 iso...  83.2    2e-16   
ref|XP_002317663.1|  subtilase family protein                         83.2    2e-16   
ref|XP_011048158.1|  PREDICTED: subtilisin-like protease SBT3.5 i...  83.2    2e-16   
ref|NP_564414.2|  Subtilase family protein SBT3.3                     83.2    2e-16   
ref|XP_003589103.1|  Subtilisin-like protease                         83.2    2e-16   
ref|XP_004514528.1|  PREDICTED: cucumisin-like                        82.8    2e-16   
ref|XP_006286616.1|  hypothetical protein CARUB_v10002407mg           82.8    2e-16   
ref|XP_010528996.1|  PREDICTED: subtilisin-like protease SBT3.5       82.8    2e-16   
ref|XP_003612438.1|  Subtilisin-like protease                         82.8    2e-16   
gb|EAZ29545.1|  hypothetical protein OsJ_13620                        82.8    2e-16   
ref|XP_011020517.1|  PREDICTED: CO(2)-response secreted protease-...  82.8    2e-16   
gb|KEH36678.1|  subtilisin-like serine protease                       82.8    2e-16   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease-like         82.8    2e-16   
ref|XP_002977415.1|  hypothetical protein SELMODRAFT_232973           82.8    2e-16   
ref|XP_010483084.1|  PREDICTED: subtilisin-like protease SDD1         82.8    2e-16   
gb|KEH27645.1|  subtilisin-like serine protease                       82.8    2e-16   
ref|XP_009359651.1|  PREDICTED: subtilisin-like protease SBT5.4       82.8    2e-16   
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g           82.8    2e-16   
tpg|DAA57792.1|  TPA: putative subtilase family protein               82.8    2e-16   
gb|ABD33266.1|  Protease-associated PA; Proteinase inhibitor I9, ...  82.8    2e-16   
ref|XP_007156353.1|  hypothetical protein PHAVU_003G279300g           82.8    2e-16   
ref|XP_009114844.1|  PREDICTED: subtilisin-like protease SBT5.3       82.8    2e-16   
ref|XP_004500923.1|  PREDICTED: subtilisin-like protease-like         82.8    2e-16   
ref|XP_010059919.1|  PREDICTED: subtilisin-like protease              82.8    2e-16   
ref|XP_008675086.1|  PREDICTED: subtilisin-like protease isoform X3   82.8    2e-16   
ref|XP_004965849.1|  PREDICTED: cucumisin-like                        82.8    2e-16   
ref|XP_004292936.1|  PREDICTED: subtilisin-like protease-like         82.8    2e-16   
ref|XP_003636375.1|  Subtilisin-like protease                         82.8    2e-16   
ref|XP_003567246.1|  PREDICTED: CO(2)-response secreted protease-...  82.8    2e-16   
gb|AAD03431.1|  similar to the subtilase family of serine proteas...  82.8    2e-16   
ref|XP_003605881.1|  Subtilisin-like protease                         82.8    2e-16   
ref|XP_011069783.1|  PREDICTED: subtilisin-like protease              82.8    2e-16   
ref|XP_006495263.1|  PREDICTED: subtilisin-like protease-like         82.8    2e-16   
gb|EPS68445.1|  hypothetical protein M569_06321                       82.4    2e-16   
dbj|BAB21149.1|  subtilisin-like proteinase-like                      82.8    2e-16   
ref|XP_011083454.1|  PREDICTED: CO(2)-response secreted protease-...  82.8    2e-16   
emb|CDM84099.1|  unnamed protein product                              82.8    2e-16   
ref|XP_006306827.1|  hypothetical protein CARUB_v10008369mg           82.8    2e-16   
ref|XP_009595649.1|  PREDICTED: subtilisin-like protease              82.8    2e-16   
gb|EAY76130.1|  hypothetical protein OsI_04059                        82.8    2e-16   



>gb|KDP40601.1| hypothetical protein JCGZ_24600 [Jatropha curcas]
Length=765

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETPSARDNVG  181
            DTGIWPESPSF D+ IG IP RWKG CE+G DFN SN CNRK+IGARYY+   S RD +G
Sbjct  151  DTGIWPESPSFKDDHIGQIPSRWKGVCEEGSDFNKSN-CNRKLIGARYYISGGSPRDALG  209

Query  182  HGSH  193
            HG+H
Sbjct  210  HGTH  213



>ref|XP_004956009.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETP-------  160
            D+GIWPESPSFND   GP+P RWKG C  GDDFNSSN CNRK+IGARYY E+        
Sbjct  154  DSGIWPESPSFNDAGFGPVPGRWKGVCMAGDDFNSSN-CNRKLIGARYYNESDVRGPSQS  212

Query  161  ---SARDNVGHGSH  193
               S RD+VGHG+H
Sbjct  213  GGGSPRDDVGHGTH  226



>ref|XP_008357123.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=794

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 52/72 (72%), Gaps = 9/72 (13%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY--------VET  157
            DTGIWPES SFND  +GPIP RWKG C K DDF+SSN CNRK+IGAR+Y        +E 
Sbjct  175  DTGIWPESESFNDXDMGPIPSRWKGTCMKSDDFSSSN-CNRKLIGARFYSTPESDGTIEI  233

Query  158  PSARDNVGHGSH  193
             S RD VGHGSH
Sbjct  234  DSPRDTVGHGSH  245



>ref|XP_010091320.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB44294.1| Subtilisin-like protease [Morus notabilis]
Length=764

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 49/68 (72%), Gaps = 5/68 (7%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----ETPSAR  169
            DTGIWPESPSFND  IGPIP RWKG C +G DF  SN CNRK+IGARYY        S R
Sbjct  152  DTGIWPESPSFNDEGIGPIPSRWKGVCLEGSDFKKSN-CNRKLIGARYYANEEKTLDSPR  210

Query  170  DNVGHGSH  193
            D+ GHG+H
Sbjct  211  DSEGHGTH  218



>ref|XP_004136374.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN60051.1| hypothetical protein Csa_3G873800 [Cucumis sativus]
Length=772

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 49/71 (69%), Gaps = 8/71 (11%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-------VETP  160
            DTGIWPES SFND  +GPIP RWKG C  GDDF SSN CNRKIIGAR+Y       +   
Sbjct  147  DTGIWPESESFNDMGMGPIPSRWKGTCMTGDDFTSSN-CNRKIIGARFYESSESDGIRYH  205

Query  161  SARDNVGHGSH  193
            S RD  GHG+H
Sbjct  206  SPRDGAGHGTH  216



>ref|XP_010095549.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB60669.1| Subtilisin-like protease [Morus notabilis]
Length=669

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 51/71 (72%), Gaps = 8/71 (11%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-------VETP  160
            DTGIWPES SFNDN IG IP RW G C +G DFNSSN CNRK+IGAR+Y        E  
Sbjct  49   DTGIWPESTSFNDNGIGQIPPRWNGTCTEGHDFNSSN-CNRKLIGARFYGGDDSDSDEDQ  107

Query  161  SARDNVGHGSH  193
            +ARD VGHG+H
Sbjct  108  TARDKVGHGTH  118



>ref|XP_004164801.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=777

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 49/71 (69%), Gaps = 8/71 (11%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-------VETP  160
            DTGIWPES SFND  +GPIP RWKG C  GDDF SSN CNRKIIGAR+Y       +   
Sbjct  152  DTGIWPESESFNDMGMGPIPSRWKGTCMTGDDFTSSN-CNRKIIGARFYESSESDGIRYH  210

Query  161  SARDNVGHGSH  193
            S RD  GHG+H
Sbjct  211  SPRDGAGHGTH  221



>ref|XP_007039328.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY23829.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
Length=776

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 18/81 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-------VETP  160
            D+G+WPES SFND  +GPIP RWKG C++G  FNSSN CN+K+IGAR++       ++TP
Sbjct  148  DSGVWPESESFNDRGMGPIPSRWKGTCQEGQLFNSSN-CNKKLIGARWFIKGILDQIQTP  206

Query  161  ----------SARDNVGHGSH  193
                      SARDN GHG+H
Sbjct  207  INISNGEEFLSARDNSGHGTH  227



>ref|XP_010693651.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=782

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 50/78 (64%), Gaps = 14/78 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSFND+ +GPIP RWKG CE+G  F+ +  CN+KI+GAR +           
Sbjct  156  DTGIWPESPSFNDSGLGPIPARWKGACERGRGFDPARHCNKKIVGARVFYRGYEAATGKI  215

Query  149  ---VETPSARDNVGHGSH  193
               +E  S RD  GHGSH
Sbjct  216  NEDMEYKSPRDQDGHGSH  233



>ref|XP_008221224.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 51/73 (70%), Gaps = 10/73 (14%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY---------VE  154
            DTGIWPES SFND  +GPIP RWKG C K DDF+SSN CNRK+IGAR+Y          E
Sbjct  159  DTGIWPESESFNDKDMGPIPSRWKGTCMKSDDFSSSN-CNRKLIGARFYDTSESDDTETE  217

Query  155  TPSARDNVGHGSH  193
              S RD+ GHGSH
Sbjct  218  DGSPRDSQGHGSH  230



>ref|XP_009613609.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 gb|ABQ58079.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SF+D  +GPIPD WKG+CE G +F+SSN CNRK+IGARY+           
Sbjct  141  DTGVWPESKSFDDTGLGPIPDSWKGECESGTNFSSSN-CNRKLIGARYFSKGYETTLGPV  199

Query  152  ----ETPSARDNVGHGSH  193
                E+ SARD+ GHG+H
Sbjct  200  DVSKESKSARDDDGHGTH  217



>ref|NP_564107.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 sp|Q9LNU1.1|CRSP_ARATH RecName: Full=CO(2)-response secreted protease; AltName: Full=Subtilisin-like 
serine protease; Short=AtSBT5.2; AltName: Full=Tripeptidyl-peptidase 
II; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF79897.1|AC022472_6 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082. ESTs 
gb|T22485, gb|R65370, gb|AA651071 come from this gene [Arabidopsis 
thaliana]
 dbj|BAF00765.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29945.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=769

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 49/70 (70%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPES SFND  +GPIP RWKG C +  DF SSN CNRKIIGARYY       E  +
Sbjct  145  DTGIWPESESFNDKDMGPIPSRWKGTCMEAKDFKSSN-CNRKIIGARYYKNPDDDSEYYT  203

Query  164  ARDNVGHGSH  193
             RD +GHGSH
Sbjct  204  TRDVIGHGSH  213



>gb|AAM65424.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=769

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 49/70 (70%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPES SFND  +GPIP RWKG C +  DF SSN CNRKIIGARYY       E  +
Sbjct  145  DTGIWPESESFNDKDMGPIPSRWKGTCMEAKDFKSSN-CNRKIIGARYYKNPDDDSEYYT  203

Query  164  ARDNVGHGSH  193
             RD +GHGSH
Sbjct  204  TRDVIGHGSH  213



>ref|XP_010263869.1| PREDICTED: subtilisin-like protease SBT3.5 [Nelumbo nucifera]
Length=787

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPES SFND+ +G +P RW G C++G++FNSSN CNRKIIGAR+Y           
Sbjct  155  DTGIWPESESFNDDGMGEVPSRWNGVCQEGEEFNSSN-CNRKIIGARWYIKGYEAEFGKL  213

Query  149  -----VETPSARDNVGHGSH  193
                 +E  S RD VGHG+H
Sbjct  214  NTSGSIEFLSPRDAVGHGTH  233



>ref|NP_001031070.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 gb|AEE29946.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=730

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 49/70 (70%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPES SFND  +GPIP RWKG C +  DF SSN CNRKIIGARYY       E  +
Sbjct  106  DTGIWPESESFNDKDMGPIPSRWKGTCMEAKDFKSSN-CNRKIIGARYYKNPDDDSEYYT  164

Query  164  ARDNVGHGSH  193
             RD +GHGSH
Sbjct  165  TRDVIGHGSH  174



>ref|XP_010692513.1| PREDICTED: CO(2)-response secreted protease [Beta vulgaris subsp. 
vulgaris]
Length=760

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPES SF D  +GPIP RWKGKC +G DF+SSN C++K+IGARYY        T S
Sbjct  139  DTGIWPESESFIDKDMGPIPSRWKGKCMEGSDFSSSN-CSKKLIGARYYKDDDISAVTHS  197

Query  164  ARDNVGHGSH  193
            ARD +GHG+H
Sbjct  198  ARDTLGHGTH  207



>emb|CDX77071.1| BnaC04g38660D [Brassica napus]
Length=760

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 3/66 (5%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVET--PSARDN  175
            DTGIWPESPSF+D   G IP +WKG C +G DFN SN CNRK+IGARYY  T   SARD+
Sbjct  148  DTGIWPESPSFSDKGFGEIPSKWKGICMEGPDFNKSN-CNRKLIGARYYKSTGATSARDS  206

Query  176  VGHGSH  193
             GHG+H
Sbjct  207  NGHGTH  212



>ref|XP_002893091.1| subtilase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69350.1| subtilase [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 49/70 (70%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPES SFND  +GPIP RWKG C +  DF SSN CNRKIIGARYY       E  +
Sbjct  106  DTGIWPESESFNDKDMGPIPSRWKGTCMEAKDFKSSN-CNRKIIGARYYKNPDDDSEYYT  164

Query  164  ARDNVGHGSH  193
             RD +GHGSH
Sbjct  165  TRDVIGHGSH  174



>emb|CDY44210.1| BnaC05g15670D [Brassica napus]
Length=772

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 50/70 (71%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPES SFND  +GPIP RWKG C +  DFNSSN CNRKIIGAR+Y       E  +
Sbjct  147  DTGIWPESESFNDKDMGPIPSRWKGTCMEAKDFNSSN-CNRKIIGARFYKSPDDDSEYFT  205

Query  164  ARDNVGHGSH  193
             RD +GHG+H
Sbjct  206  TRDVIGHGTH  215



>ref|XP_004287692.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=763

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 50/77 (65%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSFND  + P+P RWKG C+ G+ FNSS  CNRK+IGARYY           
Sbjct  148  DTGIWPESPSFNDANMPPVPARWKGVCQSGEAFNSST-CNRKVIGARYYKSGYEAEEDSA  206

Query  149  --VETPSARDNVGHGSH  193
              V   S RD+ GHGSH
Sbjct  207  DTVAFSSPRDSAGHGSH  223



>ref|XP_006416425.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
 gb|ESQ34778.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
Length=766

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 50/70 (71%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPE+ SFND  +GPIP RWKG C +  DFNSSN CNRKIIGAR+Y       E  +
Sbjct  142  DTGIWPEAESFNDKDMGPIPSRWKGTCMEAKDFNSSN-CNRKIIGARFYKNPDDDSEYFT  200

Query  164  ARDNVGHGSH  193
             RD +GHGSH
Sbjct  201  TRDVIGHGSH  210



>ref|XP_009135013.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=751

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES  FND   GPIP RW+GKCE G+DFN++  CN K+IGA+YY           
Sbjct  162  DTGIWPESEVFNDQGFGPIPKRWRGKCESGEDFNATIHCNNKLIGAKYYQKGMMAEIRGK  221

Query  152  ------ETPSARDNVGHGSH  193
                  E  S RD +GHG+H
Sbjct  222  RKSMTREFKSNRDAIGHGTH  241



>ref|XP_010498448.1| PREDICTED: CO(2)-response secreted protease-like [Camelina sativa]
Length=769

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 49/70 (70%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPES SFND  +GPIP RWKG C +  DF S+N CNRKIIGARYY       E  +
Sbjct  145  DTGIWPESESFNDKDLGPIPSRWKGTCMEAKDFKSTN-CNRKIIGARYYKNPEDDSEYDT  203

Query  164  ARDNVGHGSH  193
             RD +GHGSH
Sbjct  204  TRDVIGHGSH  213



>emb|CDX79081.1| BnaA01g11480D [Brassica napus]
Length=751

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES  FND   GPIP RW+GKCE G+DFN++  CN K+IGA+YY           
Sbjct  162  DTGIWPESEVFNDQGFGPIPKRWRGKCESGEDFNATIHCNNKLIGAKYYQKGMMAEIRGK  221

Query  152  ------ETPSARDNVGHGSH  193
                  E  S RD +GHG+H
Sbjct  222  RKSMTREFKSNRDAIGHGTH  241



>ref|XP_007226628.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
 gb|EMJ27827.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
Length=722

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 51/73 (70%), Gaps = 10/73 (14%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY---------VE  154
            DTGIWPES SFND  +GPIP RWKG C K DDF+SSN CNRK+IGAR+Y          E
Sbjct  121  DTGIWPESESFNDKDMGPIPSRWKGTCMKSDDFSSSN-CNRKLIGARFYDTSESDDTETE  179

Query  155  TPSARDNVGHGSH  193
              S RD+ GHGSH
Sbjct  180  DGSPRDSEGHGSH  192



>ref|XP_009149504.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=772

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 50/70 (71%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPES SFND  +GPIP RWKG C +  DFNSSN CNRKIIGAR+Y       E  +
Sbjct  147  DTGIWPESESFNDKDMGPIPSRWKGTCMEAKDFNSSN-CNRKIIGARFYKSPDDDSEYFT  205

Query  164  ARDNVGHGSH  193
             RD +GHG+H
Sbjct  206  TRDVIGHGTH  215



>ref|XP_009770992.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
 gb|ABQ58080.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SF+D  +GP+PD WKG+CE G +F+SSN CNRK+IGARY+           
Sbjct  141  DTGVWPESKSFDDTGLGPVPDSWKGECESGTNFSSSN-CNRKLIGARYFSKGYETTLGPV  199

Query  152  ----ETPSARDNVGHGSH  193
                E+ SARD+ GHG+H
Sbjct  200  DVSKESKSARDDDGHGTH  217



>ref|XP_011074702.1| PREDICTED: CO(2)-response secreted protease-like isoform X2 [Sesamum 
indicum]
Length=733

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 52/69 (75%), Gaps = 6/69 (9%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----VETP-SA  166
            DTGIWPES SFND  IG IP RWKG C +G++F SS+ CNRKIIGARYY    +  P + 
Sbjct  140  DTGIWPESESFNDEGIGAIPSRWKGTCMEGENFTSSS-CNRKIIGARYYDDPELGIPGTP  198

Query  167  RDNVGHGSH  193
            RDNVGHGSH
Sbjct  199  RDNVGHGSH  207



>ref|XP_011074701.1| PREDICTED: CO(2)-response secreted protease-like isoform X1 [Sesamum 
indicum]
Length=762

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 52/69 (75%), Gaps = 6/69 (9%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----VETP-SA  166
            DTGIWPES SFND  IG IP RWKG C +G++F SS+ CNRKIIGARYY    +  P + 
Sbjct  140  DTGIWPESESFNDEGIGAIPSRWKGTCMEGENFTSSS-CNRKIIGARYYDDPELGIPGTP  198

Query  167  RDNVGHGSH  193
            RDNVGHGSH
Sbjct  199  RDNVGHGSH  207



>ref|XP_010480961.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=747

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVET--------  157
            D+G+WPES SFND  +GPIP RWKG C  G+DF+S   CNRK+IGARYY+E+        
Sbjct  137  DSGVWPESESFNDKGLGPIPQRWKGMCVDGEDFDSKKHCNRKLIGARYYMESLFRKNKTD  196

Query  158  --------PSARDNVGHGSH  193
                     SAR+ + HG+H
Sbjct  197  SRIPDTEYMSAREALPHGTH  216



>ref|XP_006580141.1| PREDICTED: subtilisin-like protease SDD1-like isoform X2 [Glycine 
max]
Length=788

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 53/81 (65%), Gaps = 18/81 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPESPSFND A+G IP RWKG C+ G  FNS+N CN+KIIGAR+++          
Sbjct  165  DTGIWPESPSFNDEAMGQIPSRWKGICQGGKHFNSTN-CNKKIIGARWFMKGISDQTKKL  223

Query  152  -------ETPSARDNVGHGSH  193
                   E  SARD +GHG+H
Sbjct  224  LQGNNSDEYLSARDAIGHGTH  244



>gb|KHG24601.1| Cucumisin [Gossypium arboreum]
Length=768

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 50/71 (70%), Gaps = 8/71 (11%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-------VETP  160
            DTGIWPES SFND A+GPIP RW G C K  DFN+SN CN+KIIGAR Y       ++  
Sbjct  145  DTGIWPESESFNDKAMGPIPSRWNGTCAKAQDFNTSN-CNKKIIGARSYEDDETSVIKYQ  203

Query  161  SARDNVGHGSH  193
            S RD VGHG+H
Sbjct  204  SPRDMVGHGTH  214



>ref|XP_006306824.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
 gb|EOA39722.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
Length=770

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 49/70 (70%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPES SFND  +GPIP RWKG C +  DF S+N CNRKIIGARYY       E  +
Sbjct  146  DTGIWPESESFNDKDMGPIPSRWKGTCMEAKDFKSTN-CNRKIIGARYYKNPDDDSEYYT  204

Query  164  ARDNVGHGSH  193
             RD +GHGSH
Sbjct  205  TRDVIGHGSH  214



>ref|NP_001169390.1| putative subtilase family protein precursor [Zea mays]
 gb|ACN33599.1| unknown [Zea mays]
 tpg|DAA40612.1| TPA: putative subtilase family protein [Zea mays]
Length=769

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF D+ IG +P RWKG+C  GD FN+SN CNRKIIGA++Y+          
Sbjct  138  DTGIWPESASFRDDGIGEVPRRWKGRCVAGDRFNASN-CNRKIIGAKWYIRGYEAEYGKM  196

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHG+H
Sbjct  197  NTTDIYEFMSARDAVGHGTH  216



>ref|XP_008667163.1| PREDICTED: putative subtilase family protein isoform X2 [Zea 
mays]
Length=626

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 51/74 (69%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----------V  151
            D+GIWPESPSF+D+  GP+P RWKG C+ G  FN+SN CNRK+IGAR+Y           
Sbjct  31   DSGIWPESPSFDDSGYGPVPKRWKGVCQTGQAFNASN-CNRKVIGARWYGADVSEEDLKA  89

Query  152  ETPSARDNVGHGSH  193
            E  SARD  GHG+H
Sbjct  90   EYRSARDANGHGTH  103



>ref|XP_009802011.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 7/71 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE-------TP  160
            DTGIWPES SF DN IGPIP RWKGKC  G +FN+++ CNRK+IGAR +V+         
Sbjct  141  DTGIWPESESFKDNGIGPIPTRWKGKCVDGIEFNATSSCNRKLIGARNFVKGVANDYHHQ  200

Query  161  SARDNVGHGSH  193
            SARD  GHG+H
Sbjct  201  SARDQNGHGTH  211



>tpg|DAA41968.1| TPA: putative subtilase family protein [Zea mays]
Length=710

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 51/74 (69%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----------V  151
            D+GIWPESPSF+D+  GP+P RWKG C+ G  FN+SN CNRK+IGAR+Y           
Sbjct  115  DSGIWPESPSFDDSGYGPVPKRWKGVCQTGQAFNASN-CNRKVIGARWYGADVSEEDLKA  173

Query  152  ETPSARDNVGHGSH  193
            E  SARD  GHG+H
Sbjct  174  EYRSARDANGHGTH  187



>ref|XP_003524182.2| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Glycine 
max]
Length=793

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 53/81 (65%), Gaps = 18/81 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPESPSFND A+G IP RWKG C+ G  FNS+N CN+KIIGAR+++          
Sbjct  170  DTGIWPESPSFNDEAMGQIPSRWKGICQGGKHFNSTN-CNKKIIGARWFMKGISDQTKKL  228

Query  152  -------ETPSARDNVGHGSH  193
                   E  SARD +GHG+H
Sbjct  229  LQGNNSDEYLSARDAIGHGTH  249



>gb|EAZ09847.1| hypothetical protein OsI_32138 [Oryza sativa Indica Group]
Length=769

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF D+ IG +P RWKG+C  G+ FN+SN CNRKIIGA++YV          
Sbjct  141  DTGIWPESASFRDDGIGEVPRRWKGQCVAGEKFNASN-CNRKIIGAKWYVKGYEAEYGKM  199

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHG+H
Sbjct  200  NTSDIYEFMSARDAVGHGTH  219



>ref|XP_010477246.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Camelina 
sativa]
Length=807

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 49/70 (70%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPES SFND  +GP+P RWKG C +  DF S+N CNRKIIGARYY       E  +
Sbjct  160  DTGIWPESESFNDKDMGPVPSRWKGTCMEAKDFKSTN-CNRKIIGARYYKNPDDDSEYDT  218

Query  164  ARDNVGHGSH  193
             RD +GHGSH
Sbjct  219  TRDVIGHGSH  228



>ref|XP_010463200.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=747

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVET--------  157
            D+G+WPES SFND  +GPIP RWKG C  G+DF+S   CNRK+IGARYY+E+        
Sbjct  137  DSGVWPESESFNDKGLGPIPQRWKGMCVDGEDFDSKKHCNRKLIGARYYMESLFRKNKTD  196

Query  158  --------PSARDNVGHGSH  193
                     SAR+ + HG+H
Sbjct  197  SRIPDTEYMSAREVLPHGTH  216



>ref|XP_010477247.1| PREDICTED: CO(2)-response secreted protease isoform X2 [Camelina 
sativa]
Length=784

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 49/70 (70%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPES SFND  +GP+P RWKG C +  DF S+N CNRKIIGARYY       E  +
Sbjct  160  DTGIWPESESFNDKDMGPVPSRWKGTCMEAKDFKSTN-CNRKIIGARYYKNPDDDSEYDT  218

Query  164  ARDNVGHGSH  193
             RD +GHGSH
Sbjct  219  TRDVIGHGSH  228



>gb|ACF86497.1| unknown [Zea mays]
Length=757

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 51/74 (69%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----------V  151
            D+GIWPESPSF+D+  GP+P RWKG C+ G  FN+SN CNRK+IGAR+Y           
Sbjct  163  DSGIWPESPSFDDSGYGPVPKRWKGVCQTGQAFNASN-CNRKVIGARWYGADVSEEDLKA  221

Query  152  ETPSARDNVGHGSH  193
            E  SARD  GHG+H
Sbjct  222  EYRSARDANGHGTH  235



>ref|XP_008667162.1| PREDICTED: putative subtilase family protein isoform X1 [Zea 
mays]
 gb|ACN34723.1| unknown [Zea mays]
 tpg|DAA41967.1| TPA: putative subtilase family protein [Zea mays]
Length=758

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 51/74 (69%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----------V  151
            D+GIWPESPSF+D+  GP+P RWKG C+ G  FN+SN CNRK+IGAR+Y           
Sbjct  163  DSGIWPESPSFDDSGYGPVPKRWKGVCQTGQAFNASN-CNRKVIGARWYGADVSEEDLKA  221

Query  152  ETPSARDNVGHGSH  193
            E  SARD  GHG+H
Sbjct  222  EYRSARDANGHGTH  235



>emb|CDX82843.1| BnaC01g12930D [Brassica napus]
Length=766

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 49/83 (59%), Gaps = 19/83 (23%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES  FND   GPIP RW+GKCE G+DFN++  CN K+IGA+YY           
Sbjct  174  DTGIWPESEVFNDQGFGPIPKRWRGKCESGEDFNATVHCNNKLIGAKYYQKGMMAEIRGK  233

Query  152  ---------ETPSARDNVGHGSH  193
                     E  S RD +GHG+H
Sbjct  234  RKYMATESREFKSNRDAIGHGTH  256



>emb|CBI34614.3| unnamed protein product [Vitis vinifera]
Length=2139

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 48/81 (59%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SFND   GPIP +WKG CE G  FNS+  CNRK+IGAR++V          
Sbjct  881  DTGIWPESKSFNDEGFGPIPSQWKGVCESGQQFNSTMHCNRKVIGARWFVNGFLAEYGQP  940

Query  152  -------ETPSARDNVGHGSH  193
                   E  S RD  GHG+H
Sbjct  941  LNTSGNQEFLSPRDANGHGTH  961


 Score = 81.6 bits (200),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 17/81 (21%)
 Frame = +2

Query  2     DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
             DTG+ PES  FND   GPIP  WKG C  G+ FN++  CNRK+IGAR+Y+          
Sbjct  1638  DTGVCPESEVFNDEGFGPIPSHWKGGCVSGELFNATTDCNRKLIGARWYIDGFLADNEQP  1697

Query  152   ----ETP---SARDNVGHGSH  193
                 E P   S RD++GHG+H
Sbjct  1698  SNTTENPDYLSPRDSIGHGTH  1718



>ref|XP_003578494.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=770

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF D+ IG +P RW+G+C  GD FN+SN CNRKIIGA++YV          
Sbjct  142  DTGIWPESASFRDDGIGEVPRRWRGRCVAGDRFNASN-CNRKIIGAKWYVKGYEAEYGKM  200

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHG+H
Sbjct  201  NTTDINEYMSARDAVGHGTH  220



>ref|NP_001063751.1| Os09g0530800 [Oryza sativa Japonica Group]
 dbj|BAF25665.1| Os09g0530800 [Oryza sativa Japonica Group]
 gb|EAZ45452.1| hypothetical protein OsJ_30103 [Oryza sativa Japonica Group]
Length=769

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF D+ IG +P RWKG+C  G+ FN+SN CNRKIIGA++YV          
Sbjct  141  DTGIWPESASFRDDGIGEVPRRWKGQCVAGEKFNASN-CNRKIIGAKWYVKGYEAEYGKM  199

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHG+H
Sbjct  200  NTSDIYEFMSARDAVGHGTH  219



>ref|XP_006829610.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
 gb|ERM97026.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
Length=732

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+G+WPES SFND  +GPIP RWKG C+ G  FNSSN CNRK+IGAR++V          
Sbjct  109  DSGVWPESESFNDKGMGPIPRRWKGICQPGKQFNSSN-CNRKLIGARWFVKGLEAQLGAP  167

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD+V HG+H
Sbjct  168  LSNVPGEILSARDSVDHGTH  187



>ref|XP_004957446.1| PREDICTED: subtilisin-like protease SDD1-like [Setaria italica]
Length=768

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF D+ IG +P RWKG+C  GD FN+SN CNRKIIGA++Y+          
Sbjct  140  DTGIWPESASFRDDGIGEVPRRWKGRCIAGDRFNASN-CNRKIIGAKWYIKGYEAEYGKM  198

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHG+H
Sbjct  199  NTTDVYEFMSARDAVGHGTH  218



>ref|XP_010542106.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Tarenaya hassleriana]
Length=712

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+G+WPES SFND  +GPIP RWKG C+ G  FN+S  CNRK+IGA+Y++          
Sbjct  91   DSGVWPESESFNDRGMGPIPSRWKGGCQSGQRFNASTHCNRKLIGAKYFIDGLVAETGNF  150

Query  152  ---ETP---SARDNVGHGSH  193
               E P   S RD VGHG+H
Sbjct  151  NTTENPEYISPRDYVGHGTH  170



>ref|XP_002460565.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
 gb|EER97086.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
Length=765

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF D+ IG +P RWKG+C  GD FN+SN CNRKIIGA++Y+          
Sbjct  137  DTGIWPESASFRDDGIGEVPRRWKGQCVAGDRFNASN-CNRKIIGAKWYIKGYEAEYGKM  195

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHG+H
Sbjct  196  NTTDIYEFMSARDAVGHGTH  215



>ref|XP_002301847.2| STOMATAL DENSITY AND DISTRIBUTION family protein [Populus trichocarpa]
 gb|EEE81120.2| STOMATAL DENSITY AND DISTRIBUTION family protein [Populus trichocarpa]
Length=769

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPESPSFND  + P+P +W+G C+KG DFNSSN CNRK+IGAR++           
Sbjct  144  DTGVWPESPSFNDQGMPPVPKKWRGICQKGQDFNSSN-CNRKLIGARFFTKGHRMASTSA  202

Query  152  ------ETPSARDNVGHGSH  193
                  E  S RD+ GHG+H
Sbjct  203  SPENVQEYASPRDSHGHGTH  222



>emb|CDM80022.1| unnamed protein product [Triticum aestivum]
 emb|CDM83040.1| unnamed protein product [Triticum aestivum]
Length=749

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----------V  151
            DTGIWPES SF+D   GPIP RWKGKC+ G D+ S+N C+RKIIGAR+Y          +
Sbjct  151  DTGIWPESRSFSDEGYGPIPSRWKGKCQLGPDWGSNN-CSRKIIGARFYTAGVSDVLLKM  209

Query  152  ETPSARDNVGHGSH  193
            +T S RDN GHG+H
Sbjct  210  DTLSPRDNNGHGTH  223



>ref|XP_011075896.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=783

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 48/80 (60%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SFND  +GPIP +WKG C  GD FN    CN+KIIGARY++          
Sbjct  161  DTGVWPESESFNDKGLGPIPAKWKGFCTSGDAFNPKQHCNKKIIGARYFINGFLAAYGEF  220

Query  152  ------ETPSARDNVGHGSH  193
                  E  S RD+ GHG+H
Sbjct  221  NATEANEFISTRDSAGHGTH  240



>ref|XP_010543788.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Tarenaya 
hassleriana]
Length=766

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 51/75 (68%), Gaps = 12/75 (16%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETP-------  160
            DTGIWPES SFND  +G IP RWKG C +G +F  SN CNRK+IGAR YV TP       
Sbjct  150  DTGIWPESSSFNDEGMGEIPSRWKGICMEGPNFTKSN-CNRKLIGARSYVVTPTRQDTES  208

Query  161  ----SARDNVGHGSH  193
                SARD+VGHG+H
Sbjct  209  GADASARDSVGHGTH  223



>ref|XP_008809445.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=796

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETPSA--RDN  175
            DTGIWPES SF+D  +G IP RW G C +G DFN+SN CN+K+IGARYY  T SA  RD 
Sbjct  179  DTGIWPESESFSDKGMGAIPSRWNGTCMEGTDFNASN-CNKKLIGARYYEGTGSASPRDE  237

Query  176  VGHGSH  193
             GHG+H
Sbjct  238  RGHGTH  243



>emb|CDX98690.1| BnaA03g44750D [Brassica napus]
Length=696

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 52/81 (64%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES  FND  +GPIP RW+GKCE G++FN++  CN+K+IGA+YYV          
Sbjct  100  DTGIWPESKVFNDQGLGPIPKRWRGKCEPGENFNATIHCNKKLIGAKYYVNGLLAEMGET  159

Query  152  -------ETPSARDNVGHGSH  193
                   E  S RD +GHG+H
Sbjct  160  FKTTTVREFKSNRDALGHGTH  180



>ref|XP_007047459.1| Subtilase family protein [Theobroma cacao]
 gb|EOX91616.1| Subtilase family protein [Theobroma cacao]
Length=760

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 50/78 (64%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SF D  +GPIP  WKG CE G +FNSSN CNRK+IGARY+           
Sbjct  139  DTGVWPESKSFADTGLGPIPSGWKGACEAGTNFNSSN-CNRKLIGARYFAKGYEATLGPI  197

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RD+ GHGSH
Sbjct  198  DETKESKSPRDDDGHGSH  215



>ref|XP_006304869.1| hypothetical protein CARUB_v10012621mg, partial [Capsella rubella]
 gb|EOA37767.1| hypothetical protein CARUB_v10012621mg, partial [Capsella rubella]
Length=759

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVET--------  157
            D+G+WPES SFND  +GPIP RWKG C  G+DF+S   CN+K+IGARYY+E+        
Sbjct  148  DSGVWPESESFNDKGLGPIPKRWKGMCIDGEDFDSKKHCNKKLIGARYYMESLFRKNKTD  207

Query  158  --------PSARDNVGHGSH  193
                     SAR+ + HG+H
Sbjct  208  SRIPDTEYMSAREKLPHGTH  227



>ref|XP_007136109.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
 gb|ESW08103.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
Length=768

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 11/72 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE--------T  157
            DTGIWPE+ SF+D+ +GP+P RWKG C K  DFNSSN CNRK+IGAR+Y +        T
Sbjct  150  DTGIWPEAASFSDDGMGPVPSRWKGTCMKSHDFNSSN-CNRKLIGARFYSDPNGDEGDST  208

Query  158  PSARDNVGHGSH  193
            P  RD++GHG+H
Sbjct  209  P--RDSIGHGTH  218



>ref|XP_010262465.1| PREDICTED: subtilisin-like protease SDD1 [Nelumbo nucifera]
Length=767

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPESPSFND+ + P+P +WKG C++G++FNSSN CNRK+IGAR+Y           
Sbjct  140  DTGVWPESPSFNDHLMPPVPKKWKGICQEGENFNSSN-CNRKLIGARFYTKGHMTSSPLP  198

Query  149  -----VETPSARDNVGHGSH  193
                  E  S RD+ GHG+H
Sbjct  199  KPTEVTEYISPRDSHGHGTH  218



>ref|XP_009140769.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=760

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 3/66 (5%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVET--PSARDN  175
            DTGIWPESPSF+D   G IP +WKG C +G DFN S+ CNRK+IGARYY  T   SARD+
Sbjct  148  DTGIWPESPSFSDKGFGEIPSKWKGICMEGPDFNKSS-CNRKLIGARYYKSTGATSARDS  206

Query  176  VGHGSH  193
             GHG+H
Sbjct  207  NGHGTH  212



>ref|XP_003523384.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45944.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 14/75 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE---------  154
            DTGIWPE+ SF+D  +GP+P RWKG C K  DFNSSN CNRK+IGAR+Y +         
Sbjct  149  DTGIWPEAASFSDEGMGPVPSRWKGTCMKSQDFNSSN-CNRKLIGARFYTDPTGNDDDEG  207

Query  155  --TPSARDNVGHGSH  193
              TP  RD+VGHG+H
Sbjct  208  DNTP--RDSVGHGTH  220



>ref|XP_004504377.1| PREDICTED: subtilisin-like protease SDD1-like isoform X2 [Cicer 
arietinum]
Length=599

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 12/75 (16%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SFND A+G IP RWKG C+ G  FNS+N CN+KIIGAR+++          
Sbjct  155  DTGIWPESASFNDEAMGKIPTRWKGVCQVGQHFNSTN-CNKKIIGARWFLKGISDHTNHT  213

Query  152  -ETPSARDNVGHGSH  193
             E  SARD +GHG+H
Sbjct  214  SEYLSARDAIGHGTH  228



>ref|XP_002451012.1| hypothetical protein SORBIDRAFT_05g022600 [Sorghum bicolor]
 gb|EES10000.1| hypothetical protein SORBIDRAFT_05g022600 [Sorghum bicolor]
Length=749

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 49/74 (66%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF+D   GP+P RWKG CE G  FN+SN CNRK+IGAR+Y           
Sbjct  161  DTGIWPESRSFDDTGYGPVPKRWKGVCETGQAFNASN-CNRKVIGARWYAGDATEEDLKG  219

Query  152  ETPSARDNVGHGSH  193
            E  SARD  GHG+H
Sbjct  220  EYRSARDANGHGTH  233



>gb|EMS55531.1| Subtilisin-like protease [Triticum urartu]
Length=700

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----------V  151
            DTGIWPES SF+DN  GP+P RWKGKC+ G+ FN+++ CNRKIIGAR+Y          +
Sbjct  133  DTGIWPESRSFDDNGYGPVPARWKGKCQSGEKFNTTS-CNRKIIGARWYGRGISAESLKI  191

Query  152  ETPSARDNVGHGSH  193
            +  S RD  GHG+H
Sbjct  192  DYKSPRDLNGHGTH  205



>ref|XP_008668394.1| PREDICTED: putative subtilase family protein isoform X1 [Zea 
mays]
Length=630

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF D+ IG +P RWKG+C  GD FN+SN CNRKIIGA++Y+          
Sbjct  138  DTGIWPESASFRDDGIGEVPRRWKGRCVAGDRFNASN-CNRKIIGAKWYIRGYEAEYGKM  196

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHG+H
Sbjct  197  NTTDIYEFMSARDAVGHGTH  216



>emb|CDX84657.1| BnaA03g15730D [Brassica napus]
Length=759

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 50/81 (62%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWP+S SF+DN +GPIP RWKGKC  G+ FN+S+ CNRK+IGARYY           
Sbjct  153  DTGIWPDSKSFSDNGLGPIPTRWKGKCVSGEWFNASSSCNRKLIGARYYAKGLLESYNGT  212

Query  152  -------ETPSARDNVGHGSH  193
                   E  S  D  GHG+H
Sbjct  213  YDAMEKDEVMSPLDVTGHGTH  233



>emb|CDX94044.1| BnaC07g36780D [Brassica napus]
Length=727

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES  FND  +GPIP RW+GKC  G+ FN++  CN+K+IGA+YYV          
Sbjct  160  DTGIWPESKVFNDQGLGPIPKRWRGKCVSGEKFNATIHCNKKLIGAKYYVSGLLAEMGGK  219

Query  152  -------ETPSARDNVGHGSH  193
                   +  S+RD +GHG+H
Sbjct  220  FNRTIIQDLKSSRDVIGHGTH  240



>ref|XP_006580143.1| PREDICTED: subtilisin-like protease SDD1-like isoform X4 [Glycine 
max]
 ref|XP_006580144.1| PREDICTED: subtilisin-like protease SDD1-like isoform X5 [Glycine 
max]
Length=650

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 53/81 (65%), Gaps = 18/81 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPESPSFND A+G IP RWKG C+ G  FNS+N CN+KIIGAR+++          
Sbjct  27   DTGIWPESPSFNDEAMGQIPSRWKGICQGGKHFNSTN-CNKKIIGARWFMKGISDQTKKL  85

Query  152  -------ETPSARDNVGHGSH  193
                   E  SARD +GHG+H
Sbjct  86   LQGNNSDEYLSARDAIGHGTH  106



>ref|XP_002273703.1| PREDICTED: CO(2)-response secreted protease [Vitis vinifera]
 emb|CBI29159.3| unnamed protein product [Vitis vinifera]
Length=777

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 52/84 (62%), Gaps = 22/84 (26%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETPSA-----  166
            DTGIWPESPSF+DN IG IP RWKG C +G DF  SN CNRK+IGARYY  TP A     
Sbjct  148  DTGIWPESPSFSDNGIGEIPSRWKGVCMEGSDFKKSN-CNRKLIGARYY-NTPKALIQPK  205

Query  167  ---------------RDNVGHGSH  193
                           RD+VGHG+H
Sbjct  206  SSSNKSHPINLTGSPRDSVGHGTH  229



>ref|XP_009391633.1| PREDICTED: subtilisin-like protease isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=775

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 50/83 (60%), Gaps = 20/83 (24%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETP-------  160
            DTG+WPESPSFND  +G IP RWKG C +G DF  SN CNRK+IGARYY   P       
Sbjct  145  DTGVWPESPSFNDAGMGRIPSRWKGICMEGSDFKKSN-CNRKLIGARYYTSQPESIRPPS  203

Query  161  ------------SARDNVGHGSH  193
                        S RD+VGHG+H
Sbjct  204  NGSHAIKVDAFGSPRDSVGHGTH  226



>ref|XP_004504376.1| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Cicer 
arietinum]
Length=773

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 12/75 (16%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SFND A+G IP RWKG C+ G  FNS+N CN+KIIGAR+++          
Sbjct  155  DTGIWPESASFNDEAMGKIPTRWKGVCQVGQHFNSTN-CNKKIIGARWFLKGISDHTNHT  213

Query  152  -ETPSARDNVGHGSH  193
             E  SARD +GHG+H
Sbjct  214  SEYLSARDAIGHGTH  228



>ref|XP_002465831.1| hypothetical protein SORBIDRAFT_01g046525 [Sorghum bicolor]
 gb|EER92829.1| hypothetical protein SORBIDRAFT_01g046525 [Sorghum bicolor]
Length=227

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 49/81 (60%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNA-IGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV---------  151
            DTG+WPES SF D+   GPIP  WKG C KGD+F+ +  CNRK+IGARYY+         
Sbjct  144  DTGVWPESESFRDDPHYGPIPSSWKGTCVKGDEFDPATACNRKLIGARYYLAGFESEVGP  203

Query  152  -------ETPSARDNVGHGSH  193
                   E  S RD VGHG+H
Sbjct  204  LNTSDGSEYRSPRDRVGHGTH  224



>emb|CDX94043.1| BnaC07g36770D [Brassica napus]
Length=773

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES  FND  +GPIP RW+GKCE G+ FN++  CN+K+IGA+YYV          
Sbjct  165  DTGIWPESKVFNDQGLGPIPKRWRGKCEPGEKFNATIHCNKKLIGAKYYVNGLLAEMGET  224

Query  152  -------ETPSARDNVGHGSH  193
                   E  S RD +GHG+H
Sbjct  225  FKTTTVREFKSNRDALGHGTH  245



>ref|XP_006580142.1| PREDICTED: subtilisin-like protease SDD1-like isoform X3 [Glycine 
max]
Length=669

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 53/81 (65%), Gaps = 18/81 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPESPSFND A+G IP RWKG C+ G  FNS+N CN+KIIGAR+++          
Sbjct  46   DTGIWPESPSFNDEAMGQIPSRWKGICQGGKHFNSTN-CNKKIIGARWFMKGISDQTKKL  104

Query  152  -------ETPSARDNVGHGSH  193
                   E  SARD +GHG+H
Sbjct  105  LQGNNSDEYLSARDAIGHGTH  125



>ref|XP_006846917.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
 gb|ERN08498.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
Length=784

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 10/73 (14%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE-TPSA----  166
            DTG+WPESPSF+D  +G IP RWKG C +G DFNSS +CNRK+IGARYY + +PS     
Sbjct  157  DTGVWPESPSFDDMDMGAIPARWKGVCMEGKDFNSS-YCNRKLIGARYYKDNSPSVAWTA  215

Query  167  ----RDNVGHGSH  193
                RD +GHG+H
Sbjct  216  QDTPRDTLGHGTH  228



>ref|XP_009391632.1| PREDICTED: subtilisin-like protease isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=826

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 50/83 (60%), Gaps = 20/83 (24%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETP-------  160
            DTG+WPESPSFND  +G IP RWKG C +G DF  SN CNRK+IGARYY   P       
Sbjct  196  DTGVWPESPSFNDAGMGRIPSRWKGICMEGSDFKKSN-CNRKLIGARYYTSQPESIRPPS  254

Query  161  ------------SARDNVGHGSH  193
                        S RD+VGHG+H
Sbjct  255  NGSHAIKVDAFGSPRDSVGHGTH  277



>ref|XP_009392092.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=574

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 49/74 (66%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SFND+  GP+P RWKGKCE G +F + N CNRKIIGARYY           
Sbjct  161  DTGIWPESRSFNDDGYGPVPSRWKGKCEVGQNF-TVNHCNRKIIGARYYSKDVDPSEVAR  219

Query  152  ETPSARDNVGHGSH  193
            +  S RD  GHG+H
Sbjct  220  DYDSPRDANGHGTH  233



>ref|XP_010229480.1| PREDICTED: CO(2)-response secreted protease-like, partial [Brachypodium 
distachyon]
Length=228

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY  148
            D+GIWPESPSF+D   GP+P RWKG C  GDDFNSSN CN+K+IGARYY
Sbjct  164  DSGIWPESPSFDDAGFGPVPARWKGTCMSGDDFNSSN-CNKKLIGARYY  211



>gb|AIC80773.1| subtilase [Cicer arietinum]
Length=720

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 12/75 (16%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SFND A+G IP RWKG C+ G  FNS+N CN+KIIGAR+++          
Sbjct  102  DTGIWPESASFNDEAMGKIPTRWKGVCQVGQHFNSTN-CNKKIIGARWFLKGISDHTNHT  160

Query  152  -ETPSARDNVGHGSH  193
             E  SARD +GHG+H
Sbjct  161  SEYLSARDAIGHGTH  175



>ref|XP_010461117.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.3 
[Camelina sativa]
Length=755

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SFNDN +GPIP +WKG CE G++F S+N CNRK+IGA+Y++          
Sbjct  142  DTGVWPESESFNDNGVGPIPRKWKGGCESGENFRSTN-CNRKLIGAKYFMKGFLAXNKGF  200

Query  152  ---ETP---SARDNVGHGSH  193
               ++P   SARD  GHG+H
Sbjct  201  NSTKSPDYISARDFDGHGTH  220



>ref|XP_006658495.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=806

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-------VETP  160
            D+G+WPESPSF+D   GP+P RWKG C  GD FNSSN CNRK+IGARYY        + P
Sbjct  173  DSGVWPESPSFDDAGFGPVPSRWKGVCMAGDGFNSSN-CNRKLIGARYYDLGVGEVKKRP  231

Query  161  SA-------RDNVGHGSH  193
            SA       RD  GHG+H
Sbjct  232  SARSSGSSPRDEAGHGTH  249



>ref|NP_567632.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB36807.1| serine protease-like protein [Arabidopsis thaliana]
 emb|CAB81270.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AEE84483.1| Subtilase family protein [Arabidopsis thaliana]
Length=772

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 50/81 (62%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES  FND+ +GPIP RW+GKCE G+ FN+   CN K+IGA+YY+          
Sbjct  173  DTGIWPESKVFNDHGLGPIPQRWRGKCESGEQFNAKIHCNNKLIGAKYYLSGLLAETGGK  232

Query  152  -------ETPSARDNVGHGSH  193
                   +  S RD +GHG+H
Sbjct  233  FNRTIIQDFKSNRDAIGHGTH  253



>ref|XP_006391366.1| hypothetical protein EUTSA_v10018188mg [Eutrema salsugineum]
 gb|ESQ28652.1| hypothetical protein EUTSA_v10018188mg [Eutrema salsugineum]
Length=729

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETPSA-----  166
            D+GIWPES SFND  +GPIP RWKGKCE GD F+    CN+K+IGA++++E  SA     
Sbjct  135  DSGIWPESGSFNDTGLGPIPKRWKGKCESGDGFDPKKHCNKKVIGAKFFIEGLSAMRDGQ  194

Query  167  ------------RDNVGHGSH  193
                        RD VGHG+H
Sbjct  195  YDFTEENDFRSSRDGVGHGTH  215



>gb|EEE69927.1| hypothetical protein OsJ_29791 [Oryza sativa Japonica Group]
Length=468

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 49/76 (64%), Gaps = 13/76 (17%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            D+G+WPESPSF+D   GP+P RWKG C  GDDFNSS+ CNRK+IGARYY           
Sbjct  146  DSGVWPESPSFDDAGFGPVPARWKGVCMAGDDFNSSS-CNRKLIGARYYDVGGEAKRQSA  204

Query  149  -VETPSARDNVGHGSH  193
                 S RD  GHG+H
Sbjct  205  RSSGSSPRDEAGHGTH  220



>ref|NP_001046517.1| Os02g0269600 [Oryza sativa Japonica Group]
 dbj|BAD28637.1| putative subtilisin-like serine proteinase [Oryza sativa Japonica 
Group]
 dbj|BAF08431.1| Os02g0269600 [Oryza sativa Japonica Group]
 gb|EAY85318.1| hypothetical protein OsI_06696 [Oryza sativa Indica Group]
 gb|EAZ22529.1| hypothetical protein OsJ_06196 [Oryza sativa Japonica Group]
Length=735

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 51/74 (69%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPESPSFND+  GP+P RWKG C+ GD FN++N CNRKIIGAR+Y           
Sbjct  143  DTGIWPESPSFNDDGYGPVPARWKGVCQTGDAFNTTN-CNRKIIGARWYSAGATDDMLKG  201

Query  152  ETPSARDNVGHGSH  193
            E  S RD  GHG+H
Sbjct  202  EYMSPRDFHGHGTH  215



>ref|NP_568255.1| Subtilase family protein [Arabidopsis thaliana]
 gb|ABE66153.1| subtilase family protein [Arabidopsis thaliana]
 gb|AED91742.1| Subtilase family protein [Arabidopsis thaliana]
Length=762

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+G+WPES SFND  +GPIP RWKG C  G+DF+S   CN+K+IGARYY+          
Sbjct  150  DSGVWPESQSFNDKGLGPIPKRWKGMCVDGEDFDSKKHCNKKLIGARYYMDSLFRRNKTD  209

Query  152  ------ETPSARDNVGHGSH  193
                  E  SAR+++ HG+H
Sbjct  210  SGIPDTEYMSARESLPHGTH  229



>ref|XP_004308189.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=770

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-VETP------  160
            DTGIWPESPSFND  IG +P RWKG C +G DF  SN CNRK+IGARYY VE        
Sbjct  145  DTGIWPESPSFNDEGIGAVPSRWKGVCMEGPDFKKSN-CNRKLIGARYYNVEMTRIGNQS  203

Query  161  -------SARDNVGHGSH  193
                   S RD+VGHG+H
Sbjct  204  HLAAPNGSPRDSVGHGTH  221



>gb|EAZ09528.1| hypothetical protein OsI_31804 [Oryza sativa Indica Group]
Length=810

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 49/76 (64%), Gaps = 13/76 (17%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            D+G+WPESPSF+D   GP+P RWKG C  GDDFNSS+ CNRK+IGARYY           
Sbjct  176  DSGVWPESPSFDDAGFGPVPARWKGVCMAGDDFNSSS-CNRKLIGARYYDVGGEAKRQSA  234

Query  149  -VETPSARDNVGHGSH  193
                 S RD  GHG+H
Sbjct  235  RSSGSSPRDEAGHGTH  250



>ref|XP_009599383.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=773

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SF+D  +GP+P  WKG+CE G +F+SSN CNRK+IGARY+           
Sbjct  145  DTGVWPESKSFDDTGLGPVPASWKGQCESGTNFSSSN-CNRKLIGARYFSRGYETTLGPI  203

Query  152  ----ETPSARDNVGHGSH  193
                E+ SARD+ GHG+H
Sbjct  204  DESRESKSARDDDGHGTH  221



>ref|XP_010317055.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Solanum 
lycopersicum]
Length=761

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 50/75 (67%), Gaps = 12/75 (16%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVET--------  157
            DTGIWPESPSF D  + P+P  WKG+C+ G+ FN+S  CNRKIIGARYY+          
Sbjct  144  DTGIWPESPSFRDTHMPPVPAGWKGQCQSGEAFNAS-ICNRKIIGARYYMSGYAAEEDEK  202

Query  158  ---PSARDNVGHGSH  193
                SARD+ GHGSH
Sbjct  203  IMFKSARDSSGHGSH  217



>emb|CDY25259.1| BnaA02g21970D [Brassica napus]
Length=742

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV-----ETPSA  166
            DTG+WPES  +ND   GPIP RWKG CE G+ FN S  CN+K+IGA+Y+V     E  S 
Sbjct  145  DTGVWPESEMYNDKGYGPIPSRWKGSCESGELFNGSIHCNKKLIGAKYFVDGLNAEYASP  204

Query  167  RDNVGHGSH  193
            RD  GHG+H
Sbjct  205  RDFNGHGTH  213



>ref|XP_004233282.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Solanum 
lycopersicum]
Length=757

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 50/75 (67%), Gaps = 12/75 (16%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVET--------  157
            DTGIWPESPSF D  + P+P  WKG+C+ G+ FN+S  CNRKIIGARYY+          
Sbjct  144  DTGIWPESPSFRDTHMPPVPAGWKGQCQSGEAFNAS-ICNRKIIGARYYMSGYAAEEDEK  202

Query  158  ---PSARDNVGHGSH  193
                SARD+ GHGSH
Sbjct  203  IMFKSARDSSGHGSH  217



>ref|XP_007039330.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23831.1| Subtilase family protein, putative [Theobroma cacao]
Length=1029

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES +F+D  +GPIP RWKG C+ GD FN++  CNRKIIGAR+++          
Sbjct  146  DTGIWPESKAFSDEGLGPIPSRWKGVCKSGDHFNAATHCNRKIIGARWFIDGFLAEYGQP  205

Query  152  ----ETP---SARDNVGHGSH  193
                E P   S RD  GHG+H
Sbjct  206  FNTSEDPEYFSPRDANGHGTH  226


 Score = 81.3 bits (199),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES  FND  + PIP RWKG CE G  FN +  CNRK+IGA+Y++          
Sbjct  898  DTGVWPESVVFNDEGLEPIPARWKGLCESGQLFNGTTDCNRKLIGAKYFIDGFLAGNNQP  957

Query  152  ----ETP---SARDNVGHGSH  193
                + P   S RD+ GHG+H
Sbjct  958  FNTTDNPDYMSPRDSFGHGTH  978



>gb|EMT21268.1| Subtilisin-like protease [Aegilops tauschii]
Length=740

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 50/74 (68%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----------V  151
            DTGIWPES SF+DN  GP+P RWKGKC+ G DFN+++ CNRKIIGAR+Y           
Sbjct  145  DTGIWPESRSFDDNGYGPVPARWKGKCQTGQDFNATS-CNRKIIGARWYGLGISDEVLNN  203

Query  152  ETPSARDNVGHGSH  193
               S RD  GHG+H
Sbjct  204  NYKSPRDIDGHGTH  217



>ref|XP_010499843.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Camelina sativa]
Length=1161

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SFNDN +GPIP  WKG CE G+ F S+N CNRK+IGA+Y++          
Sbjct  143  DTGVWPESESFNDNGVGPIPSHWKGGCEPGEKFISTN-CNRKLIGAKYFINGFLAENKGF  201

Query  152  ------ETPSARDNVGHGSH  193
                  +  SARD +GHG+H
Sbjct  202  NSTESRDYISARDFIGHGTH  221


 Score = 84.7 bits (208),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SFNDN +GPIP +WKG CE G++F S+N CNRK+IGA+Y++          
Sbjct  893  DTGVWPESESFNDNGVGPIPRKWKGGCELGENFRSTN-CNRKLIGAKYFMKGFLAQNKGF  951

Query  152  ---ETP---SARDNVGHGSH  193
               ++P   SARD  GH +H
Sbjct  952  NSAKSPDYISARDFDGHRTH  971



>emb|CDX93811.1| BnaA09g24110D [Brassica napus]
Length=752

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 54/80 (68%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+G+WPES SFNDN +GP+P  WKG+C+ G++F S+N CNRK+IGA+Y++          
Sbjct  142  DSGVWPESESFNDNGVGPVPSHWKGECQSGENFMSTN-CNRKLIGAKYFINGFLAENEGF  200

Query  152  ------ETPSARDNVGHGSH  193
                  +  SARD +GHG+H
Sbjct  201  NSTGSRDYISARDFIGHGTH  220



>gb|EMS51782.1| Subtilisin-like protease SDD1 [Triticum urartu]
Length=734

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF D+ IG +P RWKG+C  G+ FN+SN CNRKIIGA+++V          
Sbjct  143  DTGIWPESASFRDDGIGEVPRRWKGQCVAGERFNASN-CNRKIIGAKWFVKGYQAEYGKM  201

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHG+H
Sbjct  202  NTTDIHEYMSARDAVGHGTH  221



>dbj|BAJ93850.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 12/75 (16%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----VET----  157
            D+GIWPESPSF+D   GP+P +WKG C  GDDFN+SN CN+K+IGARYY    V++    
Sbjct  159  DSGIWPESPSFDDAGFGPVPSKWKGVCMAGDDFNTSN-CNKKLIGARYYDLGEVDSGRTR  217

Query  158  ---PSARDNVGHGSH  193
                S RD  GHG+H
Sbjct  218  GSGGSPRDAAGHGTH  232



>ref|XP_003572346.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=736

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 49/74 (66%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----------V  151
            DTGIWPES SF+DN  GP+P RWKG C+ G +F ++N CNRKIIGAR+Y           
Sbjct  144  DTGIWPESRSFDDNGYGPVPARWKGTCQAGQEFKATN-CNRKIIGARWYSKGVSEELLRS  202

Query  152  ETPSARDNVGHGSH  193
            E  S RD  GHG+H
Sbjct  203  EYTSPRDMHGHGTH  216



>ref|XP_007208070.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
 gb|EMJ09269.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
Length=777

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SF+D  +GP+P  WKG CE G +FNSSN CNRK+IGARY+           
Sbjct  148  DTGVWPESKSFDDTGLGPVPGSWKGACESGTNFNSSN-CNRKLIGARYFAKGYEATRGPI  206

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RD+ GHG+H
Sbjct  207  ETSKESKSPRDDDGHGTH  224



>emb|CDX98693.1| BnaA03g44780D [Brassica napus]
Length=765

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 51/81 (63%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+GIWPES  FND  +GPIP RW+GKC  G+ FN++  CN+K+IGA+YYV          
Sbjct  163  DSGIWPESKVFNDQGLGPIPKRWRGKCVSGEKFNATIHCNKKLIGAKYYVNGLLAEMGGK  222

Query  152  -------ETPSARDNVGHGSH  193
                   +  S+RD +GHG+H
Sbjct  223  FNRTIIQDFKSSRDIIGHGTH  243



>ref|XP_004252763.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 13/76 (17%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPES S+NDN +  +P RWKG+CE G  FNSS  CN+K+IGARY+           
Sbjct  161  DTGVWPESKSYNDNGMNDVPSRWKGECESGTQFNSS-MCNKKLIGARYFNKGLIASNPNI  219

Query  149  -VETPSARDNVGHGSH  193
             +E  SARD  GHG+H
Sbjct  220  TIEMNSARDTEGHGTH  235



>ref|XP_008447369.1| PREDICTED: subtilisin-like protease SDD1 [Cucumis melo]
Length=768

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 16/79 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPESPSF+D+ + PIP +W+G C++G DFNSSN CNRK+IGA++++          
Sbjct  143  DTGVWPESPSFSDSKMPPIPQKWRGACQEGQDFNSSN-CNRKLIGAKFFIKGHHVASSLP  201

Query  152  -----ETPSARDNVGHGSH  193
                 E  S RD+ GHG+H
Sbjct  202  SDVVQEYVSPRDSHGHGTH  220



>gb|KFK44143.1| hypothetical protein AALP_AA1G220600 [Arabis alpina]
Length=773

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 49/70 (70%), Gaps = 7/70 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY------VETPS  163
            DTGIWPES SF+D  +GPIP RWKG C +  DF SSN CNRKIIGAR+Y       E  +
Sbjct  149  DTGIWPESESFSDKDMGPIPSRWKGTCMEAKDFKSSN-CNRKIIGARFYKNPDDDSEYYT  207

Query  164  ARDNVGHGSH  193
             RD +GHGSH
Sbjct  208  TRDVIGHGSH  217



>ref|XP_009114847.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 54/80 (68%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+G+WPES SFNDN +GP+P  WKG+C+ G++F S+N CNRK+IGA+Y++          
Sbjct  142  DSGVWPESESFNDNGVGPVPSHWKGECQSGENFMSTN-CNRKLIGAKYFINGFLAENEGF  200

Query  152  ------ETPSARDNVGHGSH  193
                  +  SARD +GHG+H
Sbjct  201  NSTGSRDYISARDFIGHGTH  220



>ref|XP_010532550.1| PREDICTED: cucumisin-like [Tarenaya hassleriana]
Length=680

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 5/64 (8%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETPSARDNVG  181
            DTGIWPESPSF D  IGP P +WKG C+ G +F     CN KIIGARYYV++ SARDN G
Sbjct  104  DTGIWPESPSFTDKGIGPPPKKWKGVCKGGSNFT----CNNKIIGARYYVDS-SARDNEG  158

Query  182  HGSH  193
            HG+H
Sbjct  159  HGTH  162



>ref|XP_006397048.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
 gb|ESQ38501.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
Length=764

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 49/80 (61%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES  FND   GPIP RWKG CE G+ FN+S  CNRK+IGA+Y+V          
Sbjct  145  DTGVWPESQMFNDKGYGPIPSRWKGGCESGELFNASVHCNRKLIGAKYFVDGLVADVGDV  204

Query  152  ---ETP---SARDNVGHGSH  193
               E P   S RD  GHG+H
Sbjct  205  NRTENPEYLSPRDFSGHGTH  224



>ref|XP_002461867.1| hypothetical protein SORBIDRAFT_02g009600 [Sorghum bicolor]
 gb|EER98388.1| hypothetical protein SORBIDRAFT_02g009600 [Sorghum bicolor]
Length=826

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 50/74 (68%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----VETP---  160
            D+GIWPESPSFND   G  P RWKG C  GDDFNSSN CN K+IGARYY    V  P   
Sbjct  184  DSGIWPESPSFNDAGFGRPPSRWKGVCMTGDDFNSSN-CNNKLIGARYYDLSSVRGPSPS  242

Query  161  ---SARDNVGHGSH  193
               S RD+VGHG+H
Sbjct  243  NGGSPRDDVGHGTH  256



>gb|KDO79000.1| hypothetical protein CISIN_1g004301mg [Citrus sinensis]
Length=762

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SF+D  +GP+P  WKG CE G +FN+SN CNRK+IGARY+           
Sbjct  138  DTGVWPESKSFDDTGLGPVPSSWKGACETGTNFNASN-CNRKLIGARYFARGYEATLGPI  196

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RD+ GHG+H
Sbjct  197  DESKESKSPRDDDGHGTH  214



>ref|XP_006466502.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=762

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SF+D  +GP+P  WKG CE G +FN+SN CNRK+IGARY+           
Sbjct  138  DTGVWPESKSFDDTGLGPVPSSWKGACETGTNFNASN-CNRKLIGARYFARGYEATLGPI  196

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RD+ GHG+H
Sbjct  197  DESKESKSPRDDDGHGTH  214



>ref|XP_006285171.1| hypothetical protein CARUB_v10006516mg [Capsella rubella]
 gb|EOA18069.1| hypothetical protein CARUB_v10006516mg [Capsella rubella]
Length=683

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 5/64 (8%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETPSARDNVG  181
            DTG+WPES SF+D  IGPIP +WKG C  G +F     CNRK+IGARYYV+  SARD  G
Sbjct  104  DTGVWPESKSFSDKGIGPIPKKWKGTCSGGANFT----CNRKLIGARYYVQN-SARDTDG  158

Query  182  HGSH  193
            HGSH
Sbjct  159  HGSH  162



>ref|XP_010266013.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=780

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 10/73 (14%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETPSA-----  166
            DTGIWPES SF D  +GP+P RWKG C +G DF++SN CNRK+IGARYY +T  +     
Sbjct  155  DTGIWPESESFKDTNMGPVPSRWKGVCMEGRDFSASN-CNRKLIGARYYNDTTKSKGEIH  213

Query  167  ----RDNVGHGSH  193
                RD VGHG+H
Sbjct  214  EQTPRDTVGHGTH  226



>ref|XP_008652277.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Zea mays]
 tpg|DAA60324.1| TPA: putative subtilase family protein [Zea mays]
Length=815

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 50/74 (68%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----VETP---  160
            D+GIWPESPSFND   G  P RWKG C  GDDFNSSN CN K+IGARYY    V  P   
Sbjct  179  DSGIWPESPSFNDAGFGRPPSRWKGVCMAGDDFNSSN-CNNKLIGARYYDLSSVRGPAPS  237

Query  161  ---SARDNVGHGSH  193
               S RD+VGHG+H
Sbjct  238  GGGSPRDDVGHGTH  251



>ref|XP_008652275.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Zea mays]
Length=816

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 50/74 (68%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----VETP---  160
            D+GIWPESPSFND   G  P RWKG C  GDDFNSSN CN K+IGARYY    V  P   
Sbjct  179  DSGIWPESPSFNDAGFGRPPSRWKGVCMAGDDFNSSN-CNNKLIGARYYDLSSVRGPAPS  237

Query  161  ---SARDNVGHGSH  193
               S RD+VGHG+H
Sbjct  238  GGGSPRDDVGHGTH  251



>ref|XP_004152066.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
Length=770

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 54/79 (68%), Gaps = 16/79 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPESPSF+D+ + P+P +W+G C++G DFNSSN CNRK+IGA++++          
Sbjct  145  DTGVWPESPSFSDSKMPPVPQKWRGACQEGQDFNSSN-CNRKLIGAKFFIKGHHVASSLP  203

Query  152  -----ETPSARDNVGHGSH  193
                 E  S RD+ GHG+H
Sbjct  204  SDVAQEYVSPRDSHGHGTH  222



>ref|XP_003554304.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
 gb|KHN02462.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=768

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 50/76 (66%), Gaps = 13/76 (17%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPESPSFND  + PIP RWKG C+ G  FNSSN CNRK+IGARY+           
Sbjct  142  DTGVWPESPSFNDQGMPPIPKRWKGVCQAGKAFNSSN-CNRKLIGARYFTKGHFSVSPFR  200

Query  152  --ETPSARDNVGHGSH  193
              E  S RD+ GHG+H
Sbjct  201  IPEYLSPRDSSGHGTH  216



>ref|XP_009614808.1| PREDICTED: cucumisin-like [Nicotiana tomentosiformis]
Length=768

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 9/72 (13%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE--------T  157
            DTGIWPES SFND  +GP+P RWKG C KG DFNSS+ CNRK+IGAR+Y +        T
Sbjct  146  DTGIWPESESFNDKGMGPVPSRWKGTCTKGYDFNSSS-CNRKLIGARFYDDPGNSPTPVT  204

Query  158  PSARDNVGHGSH  193
             + RD+ GHG+H
Sbjct  205  GTPRDHDGHGTH  216



>ref|XP_007131422.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03416.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=563

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 52/81 (64%), Gaps = 18/81 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SFND  +G IP RWKG C+ G+ FNS+N CN+KIIGAR+++          
Sbjct  151  DTGIWPESASFNDEGMGQIPSRWKGVCQVGEHFNSTN-CNKKIIGARWFLKGITDQTKKL  209

Query  152  -------ETPSARDNVGHGSH  193
                   E  SARD +GHG+H
Sbjct  210  LHGNNTNEYLSARDAIGHGTH  230



>gb|EMT21161.1| Cucumisin [Aegilops tauschii]
Length=710

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF D+ IG +P RWKG+C  G+ FN+SN CNRKIIGA+++V          
Sbjct  145  DTGIWPESASFRDDGIGDVPRRWKGQCVAGERFNASN-CNRKIIGAKWFVKGYQAEYGKM  203

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHG+H
Sbjct  204  NTTDIHEYMSARDAVGHGTH  223



>ref|XP_009768389.1| PREDICTED: cucumisin-like [Nicotiana sylvestris]
Length=765

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 9/72 (13%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE--------T  157
            DTGIWPES SFND  +GP+P RWKG C KG DFNSS+ CNRK+IGAR+Y +        T
Sbjct  143  DTGIWPESESFNDKGMGPVPSRWKGTCTKGYDFNSSS-CNRKLIGARFYDDAGDSATPVT  201

Query  158  PSARDNVGHGSH  193
             + RD+ GHG+H
Sbjct  202  GTPRDHDGHGTH  213



>ref|XP_008242125.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 51/77 (66%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSFND+ + P+P RWKG CE G+ FN+S  CNRK+IGARYY           
Sbjct  148  DTGIWPESPSFNDDNMPPVPARWKGHCESGEAFNAST-CNRKLIGARYYKSGYEAEEDST  206

Query  149  --VETPSARDNVGHGSH  193
              V   S RD+ GHGSH
Sbjct  207  NIVSFRSPRDSSGHGSH  223



>ref|XP_007039327.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY23828.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=869

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 18/81 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-------VETP  160
            D+G+WPES SFND  +GPIP RWKG C++G  FNSSN CN+K+IGAR++       ++TP
Sbjct  241  DSGVWPESESFNDRGMGPIPSRWKGTCQEGQLFNSSN-CNKKLIGARWFIKGILDQIQTP  299

Query  161  ----------SARDNVGHGSH  193
                      SARDN GHG+H
Sbjct  300  INISNGEEFLSARDNSGHGTH  320



>ref|XP_010436935.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=761

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES  FND   GPIP RWKG CE G+ FN+S  CN+K+IGA+Y+V          
Sbjct  142  DTGVWPESEMFNDKGYGPIPSRWKGGCESGESFNASIHCNKKLIGAKYFVDGLVAAAGVV  201

Query  152  ---ETP---SARDNVGHGSH  193
               E P   S RD  GHG+H
Sbjct  202  NRTENPEYLSPRDFSGHGTH  221



>gb|EMS68678.1| Subtilisin-like protease [Triticum urartu]
Length=738

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVET--------  157
            DTGIWPES SF+DN  GP+P RWKGKC+ G DFN+++ CN+KIIGAR+Y           
Sbjct  144  DTGIWPESRSFDDNGYGPVPARWKGKCQTGQDFNATS-CNKKIIGARWYERGISDEVLNR  202

Query  158  --PSARDNVGHGSH  193
               S RD  GHG+H
Sbjct  203  NYKSPRDIEGHGTH  216



>gb|EYU28147.1| hypothetical protein MIMGU_mgv1a018442mg [Erythranthe guttata]
Length=773

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            D+GIWPES SFND  +GPIP  WKG CE G DFNSS+ CNRK++GARYY           
Sbjct  156  DSGIWPESESFNDLGMGPIPATWKGFCEPGVDFNSSH-CNRKLVGARYYLKGFEANFGPL  214

Query  149  ---VETPSARDNVGHGSH  193
               +   SARD +GHG+H
Sbjct  215  DPTINFRSARDALGHGTH  232



>emb|CBI23085.3| unnamed protein product [Vitis vinifera]
Length=1884

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 48/81 (59%), Gaps = 17/81 (21%)
 Frame = +2

Query  2     DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARY------------  145
             D+GIWPES  F+D  +GPIP RWKG C  G  FN++  CNRK+IGARY            
Sbjct  1279  DSGIWPESKVFSDKGLGPIPSRWKGGCSSGQSFNATKHCNRKLIGARYFLKGLEAEIGEP  1338

Query  146   -----YVETPSARDNVGHGSH  193
                  Y+E  S RD +GHG+H
Sbjct  1339  LNTTKYLEYLSPRDALGHGTH  1359



>ref|XP_008800195.1| PREDICTED: xylem serine proteinase 1-like [Phoenix dactylifera]
Length=349

 Score = 85.1 bits (209),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 48/66 (73%), Gaps = 3/66 (5%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETPSA--RDN  175
            DTGIWPES SF+D  +G  P RW G C +G DFN+SN CN+K+IGARYY    SA  RD 
Sbjct  26   DTGIWPESESFSDKGMGASPSRWNGTCMEGTDFNASN-CNKKLIGARYYKVKGSASPRDE  84

Query  176  VGHGSH  193
            VGHG+H
Sbjct  85   VGHGTH  90



>ref|XP_008238402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SF+D  +GP+P  WKG CE G +FNSSN CNRK+IGARY+           
Sbjct  147  DTGVWPESKSFDDTGLGPVPGSWKGACESGTNFNSSN-CNRKLIGARYFAKGYEATVGPI  205

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RD+ GHG+H
Sbjct  206  ETSKESKSPRDDDGHGTH  223



>emb|CDP03800.1| unnamed protein product [Coffea canephora]
Length=773

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF+D+ + P+P +W+G C++G+DFNSS+ CNRK+IGAR++           
Sbjct  145  DTGIWPESPSFSDDGMPPVPKKWRGICQQGEDFNSSS-CNRKLIGARFFTKGYRAASKSL  203

Query  149  -----VETPSARDNVGHGSH  193
                 VE  S RD  GHG+H
Sbjct  204  STDVAVEYVSPRDGQGHGTH  223



>gb|KDO60343.1| hypothetical protein CISIN_1g004101mg [Citrus sinensis]
Length=773

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPESPSF+D+ + P+P +W+G C++G  FNSSN CNRK+IGAR++           
Sbjct  158  DTGIWPESPSFDDHGMPPVPKKWRGVCQEGQSFNSSN-CNRKLIGARFFTKGHRVASTTM  216

Query  152  ------ETPSARDNVGHGSH  193
                  E  S RD+ GHG+H
Sbjct  217  SPNIIQEYVSPRDSTGHGTH  236



>gb|ABE66081.1| subtilase family protein [Arabidopsis thaliana]
Length=301

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 48/81 (59%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+GIWPES  FND  +GPIP RW+GKC  G+ FN++  CN+K+IGA+YY           
Sbjct  164  DSGIWPESKVFNDQGLGPIPKRWRGKCRSGEKFNATMHCNKKLIGAKYYQSGLLAMNGGK  223

Query  152  -------ETPSARDNVGHGSH  193
                   +  S RD  GHG+H
Sbjct  224  FNRIIIRDFKSNRDATGHGTH  244



>ref|XP_010652423.1| PREDICTED: subtilisin-like protease SDD1 [Vitis vinifera]
Length=766

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPESPSF+D+ + P+P +W+G C++G DFNSSN CNRK+IGAR++           
Sbjct  140  DTGVWPESPSFSDHGMPPVPKKWRGVCQEGQDFNSSN-CNRKLIGARFFSKGHRVASISP  198

Query  149  -----VETPSARDNVGHGSH  193
                 VE  SARD+ GHG+H
Sbjct  199  SSDTVVEYVSARDSHGHGTH  218



>gb|KGN58306.1| hypothetical protein Csa_3G610820 [Cucumis sativus]
Length=768

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 54/79 (68%), Gaps = 16/79 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPESPSF+D+ + P+P +W+G C++G DFNSSN CNRK+IGA++++          
Sbjct  143  DTGVWPESPSFSDSKMPPVPQKWRGACQEGQDFNSSN-CNRKLIGAKFFIKGHHVASSLP  201

Query  152  -----ETPSARDNVGHGSH  193
                 E  S RD+ GHG+H
Sbjct  202  SDVAQEYVSPRDSHGHGTH  220



>gb|AAK53589.1|AF352059_1 subtilisin-like protein [Glycine max]
Length=766

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 6/69 (9%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE-----TPSA  166
            DTGIWPE+ SF+D  +GP+P RWKG C K  DF SSN CNRK+IGARYY +       +A
Sbjct  149  DTGIWPEAASFSDKGMGPVPSRWKGTCMKSQDFYSSN-CNRKLIGARYYADPNDSGDNTA  207

Query  167  RDNVGHGSH  193
            RD+ GHG+H
Sbjct  208  RDSNGHGTH  216



>gb|EMS61069.1| Subtilisin-like protease [Triticum urartu]
Length=739

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----------V  151
            DTGIWPES SF+DN  GP+P RWKGKC+ G DFN+++ CN+KIIGAR+Y           
Sbjct  144  DTGIWPESRSFDDNGYGPVPARWKGKCQTGQDFNATS-CNKKIIGARWYGRGISDEVLNR  202

Query  152  ETPSARDNVGHGSH  193
               S RD  GHG+H
Sbjct  203  NYKSPRDIEGHGTH  216



>ref|XP_006348565.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=796

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 9/72 (13%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE--------T  157
            DTGIWPES SFND  IGP+P RWKG C +G DF SS+ CNRK+IGAR+Y E        T
Sbjct  138  DTGIWPESESFNDKGIGPVPSRWKGTCTRGYDFKSSS-CNRKLIGARFYDEPGEFKTPFT  196

Query  158  PSARDNVGHGSH  193
             + RD+ GHG+H
Sbjct  197  GTPRDHDGHGTH  208



>ref|XP_004166310.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
Length=768

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 54/79 (68%), Gaps = 16/79 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPESPSF+D+ + P+P +W+G C++G DFNSSN CNRK+IGA++++          
Sbjct  143  DTGVWPESPSFSDSKMPPVPQKWRGACQEGQDFNSSN-CNRKLIGAKFFIKGHHVASSLP  201

Query  152  -----ETPSARDNVGHGSH  193
                 E  S RD+ GHG+H
Sbjct  202  SDVAQEYVSPRDSHGHGTH  220



>ref|XP_004289494.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=740

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 7/71 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE-------TP  160
            D+GIWPE  SF+DN +GPIP RWKG+C  GD  N++ FCN+K+IGAR++           
Sbjct  133  DSGIWPEHRSFDDNGLGPIPSRWKGRCMPGDSENAATFCNKKLIGARHFTRGSRADNIVN  192

Query  161  SARDNVGHGSH  193
            +ARD++GHG+H
Sbjct  193  TARDDIGHGTH  203



>ref|XP_006426043.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
 gb|ESR39283.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
Length=763

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SF+D  +GP+P  WKG CE G +FN+SN CNRK+IGARY+           
Sbjct  139  DTGVWPESKSFDDTGLGPVPSSWKGACETGTNFNASN-CNRKLIGARYFARGYEATLGPI  197

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RD+ GHG+H
Sbjct  198  DESKESKSPRDDDGHGTH  215



>gb|KHN09070.1| Subtilisin-like protease [Glycine soja]
Length=766

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 6/69 (9%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE-----TPSA  166
            DTGIWPE+ SF+D  +GP+P RWKG C K  DF SSN CNRK+IGARYY +       +A
Sbjct  149  DTGIWPEAASFSDKGMGPVPSRWKGTCMKSQDFYSSN-CNRKLIGARYYADPNDSGDNTA  207

Query  167  RDNVGHGSH  193
            RD+ GHG+H
Sbjct  208  RDSNGHGTH  216



>ref|XP_006479431.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=784

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPESPSF+D+ + P+P +W+G C++G  FNSSN CNRK+IGAR++           
Sbjct  158  DTGIWPESPSFDDHGMPPVPKKWRGVCQEGQSFNSSN-CNRKLIGARFFTKGHRVASTTV  216

Query  152  ------ETPSARDNVGHGSH  193
                  E  S RD+ GHG+H
Sbjct  217  SPNIIQEYVSPRDSTGHGTH  236



>ref|XP_006415135.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
 gb|ESQ33488.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
Length=776

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 49/82 (60%), Gaps = 18/82 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+GIWPES SF+DN +GPIP RWKG CE    FN S  CNRK+IGA+Y+V          
Sbjct  142  DSGIWPESESFSDNGLGPIPKRWKGSCESKQSFNGSTVCNRKLIGAKYFVSGLLGGADES  201

Query  152  -----ETP---SARDNVGHGSH  193
                 E P   S RD  GHG+H
Sbjct  202  NWNTTENPEYVSPRDFNGHGTH  223



>emb|CDY18654.1| BnaA09g07410D [Brassica napus]
Length=745

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV-ETPSARDNV  178
            DTG+WPES SF+D   GP+P  WKG+CE G +F +S  CNRK+IGAR++V E+ S RD+ 
Sbjct  140  DTGVWPESKSFSDEGYGPVPSTWKGECETGTNFTAS-LCNRKLIGARFFVTESRSPRDDD  198

Query  179  GHGSH  193
            GHG+H
Sbjct  199  GHGTH  203



>ref|XP_009614807.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=768

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 49/72 (68%), Gaps = 9/72 (13%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE--------T  157
            DTGIWPES SFND  +GPIP RW G C  G DF SSN CN+KI+GAR+Y E        T
Sbjct  146  DTGIWPESESFNDKDMGPIPARWNGTCMDGQDFGSSN-CNKKIVGARFYEESDDSGIKIT  204

Query  158  PSARDNVGHGSH  193
             SARD  GHG+H
Sbjct  205  GSARDENGHGTH  216



>ref|XP_003545787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 50/78 (64%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF D  IG IP RWKG C +G DF  SN CNRK+IGARYY           
Sbjct  151  DTGIWPESPSFRDEGIGEIPSRWKGVCMEGSDFKKSN-CNRKLIGARYYNILATSGDNQT  209

Query  149  -VETP--SARDNVGHGSH  193
             +E    S RD+VGHG+H
Sbjct  210  HIEATKGSPRDSVGHGTH  227



>ref|NP_001236511.1| subtilisin-type protease precursor [Glycine max]
 gb|AAK53065.1| subtilisin-type protease precursor [Glycine max]
Length=766

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 6/69 (9%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE-----TPSA  166
            DTGIWPE+ SF+D  +GP+P RWKG C K  DF SSN CNRK+IGARYY +       +A
Sbjct  149  DTGIWPEAASFSDKGMGPVPSRWKGTCMKSQDFYSSN-CNRKLIGARYYADPNDSGDNTA  207

Query  167  RDNVGHGSH  193
            RD+ GHG+H
Sbjct  208  RDSNGHGTH  216



>emb|CDX91186.1| BnaC02g04110D [Brassica napus]
Length=760

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 49/80 (61%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+G+WPESPSF+D  +GPIP RWKG C  G+ F+S   CN+K+IGARYY+          
Sbjct  149  DSGVWPESPSFSDKGLGPIPKRWKGTCVDGEKFDSKKHCNKKLIGARYYMDSLFKNNRTD  208

Query  152  ------ETPSARDNVGHGSH  193
                  E  SAR+   HGSH
Sbjct  209  SGIPDTEYMSAREVFAHGSH  228



>ref|XP_004978766.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=743

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF+D+  GP+P RW+G C+KG +FN+++ CNRKIIGAR+Y           
Sbjct  144  DTGIWPESRSFDDSGYGPVPARWRGVCQKGAEFNATS-CNRKIIGARWYTGGLDAEKLKG  202

Query  152  ETPSARDNVGHGSH  193
            E  SARD  GHG+H
Sbjct  203  EYLSARDMNGHGTH  216



>ref|XP_011098007.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=764

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF+D  + P+PD WKG+C+ G+ FN S  CNRK+IGARYY           
Sbjct  149  DTGIWPESPSFSDAGMPPVPDGWKGQCQPGEAFNIST-CNRKVIGARYYLNGYQAEEESE  207

Query  149  --VETPSARDNVGHGSH  193
              V   SARD+ GHGSH
Sbjct  208  KIVTFRSARDSAGHGSH  224



>gb|EMT05074.1| Subtilisin-like protease [Aegilops tauschii]
Length=1097

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 49/74 (66%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF+D   GPIP RWKGKC+ G D+ S+N C RKIIGAR+Y           
Sbjct  177  DTGIWPESRSFSDEGYGPIPSRWKGKCQLGPDWGSNN-CTRKIIGARFYTAGVLDKHLKA  235

Query  152  ETPSARDNVGHGSH  193
            +T S RD  GHG+H
Sbjct  236  DTLSPRDRNGHGTH  249



>gb|KFK32412.1| hypothetical protein AALP_AA6G238800 [Arabis alpina]
Length=706

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = +2

Query  5    TGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVET--PSARDNV  178
            +GIWPESPSFND   G IP +WKG C  G DFN S+ CNRK+IGARYY  T   SARD  
Sbjct  96   SGIWPESPSFNDKGFGAIPSKWKGTCMGGPDFNKSH-CNRKLIGARYYTSTGATSARDVD  154

Query  179  GHGSH  193
            GHG+H
Sbjct  155  GHGTH  159



>gb|KFK45040.1| hypothetical protein AALP_AA1G336300 [Arabis alpina]
Length=776

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SFNDN +GPIP +WKG CE G++F S+N CNRK+IGA+Y++          
Sbjct  144  DTGVWPESESFNDNGVGPIPSKWKGGCESGENFISTN-CNRKLIGAKYFMNGFLAESQGF  202

Query  152  ------ETPSARDNVGHGSH  193
                  +  SARD +GHG+H
Sbjct  203  NSTNSRDYISARDYIGHGTH  222



>ref|XP_007204641.1| hypothetical protein PRUPE_ppa001800mg [Prunus persica]
 gb|EMJ05840.1| hypothetical protein PRUPE_ppa001800mg [Prunus persica]
Length=763

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 50/77 (65%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSFND  + P+P RWKG CE G+ FN+S  CNRK+IGARYY           
Sbjct  148  DTGIWPESPSFNDANMPPVPARWKGHCESGEAFNAST-CNRKLIGARYYKSGYEAEEDST  206

Query  149  --VETPSARDNVGHGSH  193
              V   S RD+ GHGSH
Sbjct  207  NIVSFRSPRDSSGHGSH  223



>dbj|BAK05842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF D+ IG +P RWKG+C  G+ FN+SN CNRKIIGA++++          
Sbjct  142  DTGIWPESASFRDDGIGEVPRRWKGQCVAGERFNASN-CNRKIIGAKWFIKGYQAEYGKM  200

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHG+H
Sbjct  201  NTADIHEYMSARDAVGHGTH  220



>ref|XP_009600483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.3 
[Nicotiana tomentosiformis]
Length=616

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 8/71 (11%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE-------TP  160
            DTGIWPES  FND  +GP+P RWKG C KG DFNSS+ CNRK+IGAR+Y +       T 
Sbjct  152  DTGIWPESERFNDKGMGPVPSRWKGTCTKGYDFNSSS-CNRKLIGARFYDDGGSPTPVTG  210

Query  161  SARDNVGHGSH  193
            + RD+ GHG+H
Sbjct  211  TPRDHDGHGTH  221



>ref|XP_010470046.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=410

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+G+WPES  FND   GPIP RWKG C  G+DF++S  CNRK+IGA+Y+V          
Sbjct  120  DSGVWPESEMFNDKGYGPIPSRWKGGCVSGEDFDASIHCNRKLIGAKYFVDGLVAEKGVL  179

Query  152  ---ETP---SARDNVGHGSH  193
               E P   S RD  GHG+H
Sbjct  180  NTTENPEYLSPRDYTGHGTH  199



>ref|XP_010271499.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Nelumbo 
nucifera]
Length=774

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPES SF D+ +G +P RW G C++G++FN+SN CNRK+IGAR+Y           
Sbjct  141  DTGIWPESESFKDDGMGEVPSRWNGVCQEGEEFNASN-CNRKVIGARWYIKGYAAEFGKL  199

Query  149  -----VETPSARDNVGHGSH  193
                 VE  S RD VGHG+H
Sbjct  200  NTSGDVEFLSPRDAVGHGTH  219



>ref|XP_010271498.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Nelumbo 
nucifera]
Length=777

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPES SF D+ +G +P RW G C++G++FN+SN CNRK+IGAR+Y           
Sbjct  144  DTGIWPESESFKDDGMGEVPSRWNGVCQEGEEFNASN-CNRKVIGARWYIKGYAAEFGKL  202

Query  149  -----VETPSARDNVGHGSH  193
                 VE  S RD VGHG+H
Sbjct  203  NTSGDVEFLSPRDAVGHGTH  222



>ref|XP_010661922.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Vitis vinifera]
Length=1488

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 48/81 (59%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SFND   GPIP +WKG CE G  FNS+  CNRK+IGAR++V          
Sbjct  155  DTGIWPESKSFNDEGFGPIPSQWKGVCESGQQFNSTMHCNRKVIGARWFVNGFLAEYGQP  214

Query  152  -------ETPSARDNVGHGSH  193
                   E  S RD  GHG+H
Sbjct  215  LNTSGNQEFLSPRDANGHGTH  235


 Score = 79.0 bits (193),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+ PES  FND   GPIP  WKG C  G+ FN++  CNRK+IGAR+Y+          
Sbjct  864  DTGVCPESEVFNDEGFGPIPSHWKGGCVSGELFNATTDCNRKLIGARWYIDGFLADNEQP  923

Query  152  ----ETP---SARDNVGHGSH  193
                E P   S RD++GHG+H
Sbjct  924  SNTTENPDYLSPRDSIGHGTH  944



>ref|XP_003634153.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARY------------  145
            DTGIWPES  F+D  +GPIP RWKG C  G  FN++  CNRK+IGARY            
Sbjct  151  DTGIWPESEVFSDKGLGPIPSRWKGGCSSGQSFNATKHCNRKLIGARYFFKGLEAEIGEP  210

Query  146  -----YVETPSARDNVGHGSH  193
                 Y+E  S RD +GHG+H
Sbjct  211  LNTTEYLEYLSPRDALGHGTH  231



>ref|XP_002510119.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52306.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=769

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 53/78 (68%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPE+ SF+D  +GPIP  WKG+CE G +FNSS+ CNRK+IGAR++           
Sbjct  142  DTGVWPEAKSFDDTGLGPIPRTWKGECETGKNFNSSS-CNRKLIGARFFSKGYEAAFGPV  200

Query  149  ---VETPSARDNVGHGSH  193
               VE+ S RD+ GHG+H
Sbjct  201  DETVESRSPRDDDGHGTH  218



>gb|EMS67122.1| Subtilisin-like protease [Triticum urartu]
Length=734

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----------V  151
            DTGIWPES SFND   GP+P RWKGKC+ G D+ S+N C+RKIIGAR+Y           
Sbjct  154  DTGIWPESRSFNDAGYGPVPSRWKGKCQVGHDWGSTN-CSRKIIGARFYSAGVPDQFLET  212

Query  152  ETPSARDNVGHGSH  193
            ++ S RD+ GHG+H
Sbjct  213  DSLSPRDHNGHGTH  226



>ref|XP_002526537.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF35815.1| Cucumisin precursor, putative [Ricinus communis]
Length=769

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARY------------  145
            DTG+WPESPSFND  + P+P +W+G C++G DF+SSN CNRK+IGAR+            
Sbjct  142  DTGVWPESPSFNDQGMPPVPKKWRGICQEGQDFSSSN-CNRKLIGARFFTKGHRVASISL  200

Query  146  ----YVETPSARDNVGHGSH  193
                Y E  S RD+ GHG+H
Sbjct  201  SSNMYQEYVSPRDSHGHGTH  220



>gb|EYU31525.1| hypothetical protein MIMGU_mgv1a001949mg [Erythranthe guttata]
Length=735

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF D  + P+P  WKG+C+ G+ FNSS  CNRK+IGARYY           
Sbjct  116  DTGIWPESPSFGDANMPPVPAGWKGQCQPGEAFNSST-CNRKVIGARYYLNGFEAEEELE  174

Query  149  ---VETPSARDNVGHGSH  193
               V   SARD+VGHGSH
Sbjct  175  NNSVSFKSARDSVGHGSH  192



>ref|XP_010536423.1| PREDICTED: CO(2)-response secreted protease-like [Tarenaya hassleriana]
Length=766

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 8/71 (11%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETP-------  160
            DTGIWPES SF D  +GPIP RWKG C +  DFNSSN CN+KIIGAR+Y +         
Sbjct  138  DTGIWPESASFYDKEMGPIPSRWKGTCVEAKDFNSSN-CNKKIIGARFYKDPEDEDGDYY  196

Query  161  SARDNVGHGSH  193
            ++RD +GHGSH
Sbjct  197  TSRDVIGHGSH  207



>ref|XP_011099335.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=768

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPESPSF+D   GP+P  WKG+CE G +F  SN CNRK++GARY+           
Sbjct  138  DTGVWPESPSFDDTGFGPVPSSWKGECEIGTNFTKSN-CNRKLVGARYFARGYEATLGPI  196

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RD+ GHG+H
Sbjct  197  DESKESRSPRDDDGHGTH  214



>ref|XP_006660880.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=768

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 51/80 (64%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF D+ IG +P RWKG+C  G+ FN SN CNRKIIGA++YV          
Sbjct  140  DTGIWPESASFRDDGIGEVPRRWKGRCIAGEKFNISN-CNRKIIGAKWYVKGYEAEYGKM  198

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHG+H
Sbjct  199  NTSDIFEFMSARDAVGHGTH  218



>ref|XP_002872522.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48781.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=737

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 48/80 (60%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES  FND   GPIP RWKG CE GD FN S  CNRK+IGA+Y+V          
Sbjct  142  DTGVWPESEMFNDKGYGPIPSRWKGGCESGDLFNGSIHCNRKLIGAKYFVDANNAEFGVL  201

Query  152  ---ETP---SARDNVGHGSH  193
               E P   S RD  GHG+H
Sbjct  202  NKTENPDYLSPRDINGHGTH  221



>ref|XP_006343203.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=770

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 50/78 (64%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SF+DN  GPIP  WKG+CE G +F S N CNRK+IGARY+           
Sbjct  144  DTGVWPESKSFDDNGFGPIPASWKGECESGTNFTSKN-CNRKLIGARYFAKGYESTLGPI  202

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RD+ GHG+H
Sbjct  203  DVSKESKSPRDDDGHGTH  220



>ref|XP_008800183.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 13/76 (17%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE-----TP--  160
            DTGIWPES SF+D  +G IP RW G C KG DFN+SN CN+K+IGARYY +     TP  
Sbjct  151  DTGIWPESESFSDEGMGAIPSRWNGTCMKGTDFNASN-CNKKLIGARYYKDDGAAATPVG  209

Query  161  -----SARDNVGHGSH  193
                 S RD +GHG+H
Sbjct  210  RATSDSPRDELGHGTH  225



>ref|XP_006306820.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
 gb|EOA39718.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
Length=771

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 49/82 (60%), Gaps = 18/82 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+GIWPES SF+DN +GPIP RWKG CE    FN S  CNRK+IGA+Y++          
Sbjct  137  DSGIWPESESFSDNGLGPIPKRWKGSCETKQSFNGSTVCNRKLIGAKYFISGLINGADES  196

Query  152  -----ETP---SARDNVGHGSH  193
                 E P   S RD  GHG+H
Sbjct  197  NWNTTENPEYISPRDFNGHGTH  218



>ref|XP_009758000.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SF+D+ +GPIP  WKG+CE G +F+SSN CNRK+IGARY+           
Sbjct  145  DTGVWPESKSFDDSGLGPIPASWKGQCESGTNFSSSN-CNRKLIGARYFSRGYETTLGPI  203

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RD+ GHG+H
Sbjct  204  DESKESKSPRDDDGHGTH  221



>ref|XP_009355089.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=781

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 50/78 (64%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF+D  IG +P RWKG C +G DF  SN CNRK+IGARYY           
Sbjct  156  DTGIWPESPSFSDEGIGAVPSRWKGVCMEGSDFKKSN-CNRKLIGARYYNVPVTTNGDQS  214

Query  149  ---VETPSARDNVGHGSH  193
                 + S RD+VGHG+H
Sbjct  215  HLASTSGSPRDSVGHGTH  232



>ref|XP_008346279.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=781

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 50/78 (64%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF+D  IG +P RWKG C +G DF  SN CNRK+IGARYY           
Sbjct  156  DTGIWPESPSFSDEGIGAVPSRWKGVCMEGSDFKKSN-CNRKLIGARYYNVPVTTNGDQS  214

Query  149  ---VETPSARDNVGHGSH  193
                 + S RD+VGHG+H
Sbjct  215  HLASTSGSPRDSVGHGTH  232



>ref|XP_004981675.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 54/78 (69%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPE PS++D   GP+P  WKG+CEKG+DFN+S+ CN+K+IGAR+++          
Sbjct  139  DTGVWPERPSYDDTGFGPVPAGWKGECEKGNDFNASS-CNKKLIGARFFLTGYEAAKGPV  197

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RDN GHG+H
Sbjct  198  DTSKESRSPRDNDGHGTH  215



>ref|XP_004228919.2| PREDICTED: CO(2)-response secreted protease-like [Solanum lycopersicum]
Length=764

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 9/72 (13%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE-----TP--  160
            DTGIWPES SFND  IGP+P RWKG C +G DF SS+ CNRK+IGAR+Y E     TP  
Sbjct  138  DTGIWPESESFNDKGIGPVPSRWKGTCTRGYDFKSSS-CNRKLIGARFYDEPGESKTPFV  196

Query  161  -SARDNVGHGSH  193
             + RD+ GHG+H
Sbjct  197  GTPRDHDGHGTH  208



>ref|XP_007046423.1| Subtilisin-like serine endopeptidase family protein isoform 2, 
partial [Theobroma cacao]
 gb|EOX90580.1| Subtilisin-like serine endopeptidase family protein isoform 2, 
partial [Theobroma cacao]
Length=531

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETPSA-----  166
            DTGIWPESPSF+D  + P+PD+WKG+C+ G+ FN+S+ CNRK+IGARYY+    A     
Sbjct  146  DTGIWPESPSFSDANMPPVPDQWKGQCQSGEAFNASS-CNRKVIGARYYMSGYEAEGVSE  204

Query  167  --------RDNVGHGSH  193
                    RD+ GHGSH
Sbjct  205  NTLLFRSPRDSSGHGSH  221



>gb|ADD09584.1| proteinase inhibitor [Trifolium repens]
Length=767

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPE  SF+D  +GP+P  WKG+CE G +FNSSN CNRK++GAR++           
Sbjct  140  DTGVWPELKSFDDTGLGPVPSSWKGECETGKNFNSSN-CNRKLVGARFFAKGYEAAFGPI  198

Query  149  ---VETPSARDNVGHGSH  193
                E+ S RD+ GHGSH
Sbjct  199  DEKAESKSPRDDDGHGSH  216



>ref|XP_007131420.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03414.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=510

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 52/81 (64%), Gaps = 18/81 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SFND  +G IP RWKG C+ G+ FNS+N CN+KIIGAR+++          
Sbjct  151  DTGIWPESASFNDEGMGQIPSRWKGVCQVGEHFNSTN-CNKKIIGARWFLKGITDQTKKL  209

Query  152  -------ETPSARDNVGHGSH  193
                   E  SARD +GHG+H
Sbjct  210  LHGNNTNEYLSARDAIGHGTH  230



>ref|XP_010451309.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=230

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE  154
            DTGIWPES  FND  +GPIP RW+GKCE G++FN++  CN+ +IGA+YY++
Sbjct  167  DTGIWPESKVFNDQGLGPIPKRWRGKCESGEEFNATIHCNKNLIGAKYYLK  217



>ref|XP_006829160.1| hypothetical protein AMTR_s00001p00269990 [Amborella trichopoda]
 gb|ERM96576.1| hypothetical protein AMTR_s00001p00269990 [Amborella trichopoda]
Length=774

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF D+ +  +P  WKG C++G+ F+SSN CNRKIIGAR+Y+          
Sbjct  144  DTGIWPESESFKDHGMSEVPSHWKGVCQEGEQFSSSN-CNRKIIGARWYIKGYNAEFGYL  202

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHGSH
Sbjct  203  NTSDSFEFLSARDAVGHGSH  222



>ref|XP_010251788.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=776

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 51/83 (61%), Gaps = 20/83 (24%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSFND  +G IP RWKG C +G DF  SN CNRK+IGARYY           
Sbjct  146  DTGIWPESPSFNDEGMGEIPSRWKGVCMEGSDFKKSN-CNRKLIGARYYTIFSDSTGSKS  204

Query  149  ------VETP--SARDNVGHGSH  193
                  V  P  S RD+VGHG+H
Sbjct  205  RGNRTHVIRPIGSPRDSVGHGTH  227



>emb|CBI37197.3| unnamed protein product [Vitis vinifera]
Length=1318

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPESPSF+D+ + P+P +W+G C++G DFNSSN CNRK+IGAR++           
Sbjct  712  DTGVWPESPSFSDHGMPPVPKKWRGVCQEGQDFNSSN-CNRKLIGARFFSKGHRVASISP  770

Query  149  -----VETPSARDNVGHGSH  193
                 VE  SARD+ GHG+H
Sbjct  771  SSDTVVEYVSARDSHGHGTH  790



>ref|XP_010933213.1| PREDICTED: subtilisin-like protease SDD1 [Elaeis guineensis]
Length=776

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 18/81 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPESPSF+D  + P+P RW+G C++G+ FNSSN CNRK+IGAR+Y           
Sbjct  150  DTGVWPESPSFSDQRMPPVPPRWRGACQEGESFNSSN-CNRKLIGARFYTKGHRANMPEK  208

Query  149  ------VETPSARDNVGHGSH  193
                  +E  S RD  GHG+H
Sbjct  209  PASASLLEYVSPRDAHGHGTH  229



>emb|CBI38006.3| unnamed protein product [Vitis vinifera]
Length=805

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 49/80 (61%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPES SF D  +G IP RW G C++G+ FN SN CNRKIIGAR+Y           
Sbjct  175  DTGIWPESDSFKDKGMGKIPSRWHGTCQEGEQFNRSN-CNRKIIGARWYIKGYEADFGKL  233

Query  149  -----VETPSARDNVGHGSH  193
                 VE  S RD VGHG+H
Sbjct  234  DTSGGVEFLSPRDAVGHGTH  253



>ref|NP_001169603.1| putative subtilase family protein precursor [Zea mays]
 gb|ACN34240.1| unknown [Zea mays]
 gb|AFW76265.1| putative subtilase family protein [Zea mays]
Length=767

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 12/76 (16%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNF-CNRKIIGARYY----------  148
            DTGIWPESPSF+D+ + P+P RW+G+C+ GD  + SNF CNRK+IG RYY          
Sbjct  150  DTGIWPESPSFSDHGMPPVPKRWRGQCQGGDANSPSNFTCNRKVIGGRYYLSGYQTEEGG  209

Query  149  -VETPSARDNVGHGSH  193
             ++  S RD+ GHGSH
Sbjct  210  AIKFVSPRDSSGHGSH  225



>ref|XP_010647672.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 49/80 (61%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPES SF D  +G IP RW G C++G+ FN SN CNRKIIGAR+Y           
Sbjct  146  DTGIWPESDSFKDKGMGKIPSRWHGTCQEGEQFNRSN-CNRKIIGARWYIKGYEADFGKL  204

Query  149  -----VETPSARDNVGHGSH  193
                 VE  S RD VGHG+H
Sbjct  205  DTSGGVEFLSPRDAVGHGTH  224



>ref|XP_003550022.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=760

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SF+D  +GP+P  WKG CE G +F +SN CNRK+IGAR++           
Sbjct  141  DTGVWPESKSFDDTGLGPVPSTWKGACETGTNFTASN-CNRKLIGARFFAKGVEAMLGPI  199

Query  152  ----ETPSARDNVGHGSH  193
                E+ SARD+ GHG+H
Sbjct  200  NETEESRSARDDDGHGTH  217



>ref|NP_567360.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03437.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=50.7, E=4.7e-13, n=3) [Arabidopsis thaliana]
 emb|CAB40046.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78176.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82894.1| Subtilase family protein [Arabidopsis thaliana]
Length=747

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 48/80 (60%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES  FND   GPIP RWKG CE G+ FN S  CNRK+IGA+Y++          
Sbjct  142  DTGVWPESEMFNDKGYGPIPSRWKGGCESGELFNGSIHCNRKLIGAKYFIDANNAQFGVL  201

Query  152  ---ETP---SARDNVGHGSH  193
               E P   S RD  GHG+H
Sbjct  202  NKTENPDYLSPRDFNGHGTH  221



>gb|KCW72613.1| hypothetical protein EUGRSUZ_E01073, partial [Eucalyptus grandis]
Length=1447

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF+D  +GPIP RWKG CE  + F+ +  CNRKIIGAR++V          
Sbjct  852  DTGIWPESKSFSDEGLGPIPSRWKGGCELAEQFDPAKHCNRKIIGARWFVDGFLAEYGKP  911

Query  152  -------ETPSARDNVGHGSH  193
                   E  S RD  GHG+H
Sbjct  912  LNASGDLEFLSPRDANGHGTH  932



>dbj|BAD35681.1| putative subtilisin-like serine proteinase [Oryza sativa Japonica 
Group]
Length=599

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNF-CNRKIIGARYY----------  148
            DTGIWPESPSF D+ + P+P RW+G+C++G+  + SNF CNRKIIG RYY          
Sbjct  152  DTGIWPESPSFRDHGMPPVPTRWRGQCQRGEANSPSNFTCNRKIIGGRYYLRGYQTEESG  211

Query  149  -----VETPSARDNVGHGSH  193
                 ++  S RD+ GHGSH
Sbjct  212  QSRSAIKFISPRDSSGHGSH  231



>ref|XP_002525580.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF36839.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=777

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 51/79 (65%), Gaps = 16/79 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF+D  +G IP RWKG C +G DF  SN CNRK+IGARYY           
Sbjct  151  DTGIWPESPSFSDKGLGEIPSRWKGVCMEGHDFKKSN-CNRKLIGARYYDTILRTYKNNK  209

Query  149  --VETP--SARDNVGHGSH  193
              V  P  S RD++GHG+H
Sbjct  210  THVAKPNGSPRDDIGHGTH  228



>ref|XP_010028239.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=762

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 49/77 (64%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPES SF+DN I  IP RWKG C  G DFN+S  CN+KIIGAR+Y           
Sbjct  141  DTGIWPESASFHDNGIPAIPSRWKGSCVSGGDFNAS-LCNKKIIGARFYHRGLVANNPKA  199

Query  149  --VETPSARDNVGHGSH  193
              V   SARD VGHG+H
Sbjct  200  IKVSKDSARDTVGHGTH  216



>gb|KCW54937.1| hypothetical protein EUGRSUZ_I00910, partial [Eucalyptus grandis]
Length=747

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 49/77 (64%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPES SF+DN I  IP RWKG C  G DFN+S  CN+KIIGAR+Y           
Sbjct  141  DTGIWPESASFHDNGIPAIPSRWKGSCVSGGDFNAS-LCNKKIIGARFYHRGLVANNPKA  199

Query  149  --VETPSARDNVGHGSH  193
              V   SARD VGHG+H
Sbjct  200  IKVSKDSARDTVGHGTH  216



>ref|XP_009407970.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407971.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=769

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF+D  +G IP RW+G C+KG+ F+ S+ CNRKIIGAR+Y+          
Sbjct  141  DTGIWPESESFSDRDMGEIPSRWRGVCQKGEKFHVSD-CNRKIIGARWYIKGYEAEFGKL  199

Query  152  ------ETPSARDNVGHGSH  193
                  E  SARD VGHG+H
Sbjct  200  NTSDILEFLSARDAVGHGTH  219



>ref|XP_006365013.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=758

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 13/76 (17%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE---------  154
            DTGIWPESPSF+D  + P+P  WKG+C+ G+ FN+S  CNRKIIGARYY+          
Sbjct  144  DTGIWPESPSFSDTNMPPVPAGWKGQCQSGEAFNAS-ICNRKIIGARYYMSGYAAEVDDG  202

Query  155  ---TPSARDNVGHGSH  193
                 SARD+ GHGSH
Sbjct  203  KTMFKSARDSTGHGSH  218



>emb|CDY49640.1| BnaCnng17920D [Brassica napus]
Length=757

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 50/81 (62%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+GIWPE+ SF D  +GPIP RWKGKC  GD F+++  CN+K+IGA +YV          
Sbjct  154  DSGIWPEAESFKDTGLGPIPQRWKGKCVSGDGFDATKHCNKKLIGAEFYVDSLAAETDGR  213

Query  152  -------ETPSARDNVGHGSH  193
                   E  SARD VGHG+H
Sbjct  214  YDFHADNEYRSARDGVGHGTH  234



>ref|XP_006287131.1| hypothetical protein CARUB_v10000302mg [Capsella rubella]
 gb|EOA20029.1| hypothetical protein CARUB_v10000302mg [Capsella rubella]
Length=742

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETP-------  160
            D+G+WPES SFND  +GPIP RWKGKC  G++F ++  CN+K+IGARYY+ +        
Sbjct  130  DSGVWPESVSFNDKGLGPIPSRWKGKCVDGEEFVATKHCNKKLIGARYYIPSHMKKNKTG  189

Query  161  ---------SARDNVGHGSH  193
                     SARD+  HG+H
Sbjct  190  MTSDENDYMSARDSDVHGTH  209



>ref|NP_564412.1| Subtilase 3.5 [Arabidopsis thaliana]
 sp|Q9MAP7.1|SBT35_ARATH RecName: Full=Subtilisin-like protease SBT3.5; AltName: Full=Subtilase 
subfamily 3 member 5; Short=AtSBT3.5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31278.1|AC006424_7 First of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAL67022.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAP04132.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE31542.1| Subtilase 3.5 [Arabidopsis thaliana]
Length=774

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES SFNDN +GPIP  WKG CE G+ F S+N CNRK+IGA+Y++          
Sbjct  142  DTGVWPESESFNDNGVGPIPSHWKGGCESGEKFISTN-CNRKLIGAKYFINGFLAENEGF  200

Query  152  ------ETPSARDNVGHGSH  193
                  +  SARD +GHG+H
Sbjct  201  NTTESRDYISARDFIGHGTH  220



>ref|XP_010270603.1| PREDICTED: subtilisin-like protease SBT5.3 [Nelumbo nucifera]
Length=759

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE---------  154
            DTGIWPESPSF+D  + P+P RWKG+C+ G++FN+S+ CNRK+IGARYY+          
Sbjct  144  DTGIWPESPSFSDYDMPPVPSRWKGQCQAGEEFNASS-CNRKVIGARYYLSGYEAEEDSV  202

Query  155  ----TPSARDNVGHGSH  193
                  S RD+ GHGSH
Sbjct  203  KTLTFKSPRDSSGHGSH  219



>ref|XP_009132975.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 50/81 (62%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWP+S SF+DN +GPIP RWKGKC  G+ FN+S+ CNRK+IGARYY           
Sbjct  153  DTGIWPDSKSFSDNGLGPIPTRWKGKCVSGEWFNASSSCNRKLIGARYYAKGLLESYNGT  212

Query  152  -------ETPSARDNVGHGSH  193
                   E  S  D  GHG+H
Sbjct  213  YDAMEKDEVMSPLDVTGHGTH  233



>gb|EYU36336.1| hypothetical protein MIMGU_mgv1a019012mg, partial [Erythranthe 
guttata]
Length=733

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 53/76 (70%), Gaps = 13/76 (17%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----------V  151
            DTGIWPESPSF D+ +  IP RWKG CE+G++FNSS+ CNRKIIGARY+          V
Sbjct  114  DTGIWPESPSFRDDGMTEIPTRWKGICEEGEEFNSSS-CNRKIIGARYFREGLRAANPGV  172

Query  152  ETP--SARDNVGHGSH  193
              P  SARD  GHG+H
Sbjct  173  AIPMYSARDIDGHGTH  188



>ref|NP_567359.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03440.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=48.3, E=2.3e-12, n=4) [Arabidopsis thaliana]
 emb|CAB40045.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78175.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82893.1| Subtilase family protein [Arabidopsis thaliana]
Length=756

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 48/80 (60%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+G+WPES  FND   GPIP RWKG CE G+ FN+S  CNRK+IGA+Y+V          
Sbjct  142  DSGVWPESEMFNDKGFGPIPSRWKGGCESGELFNASIHCNRKLIGAKYFVDGLVAEFGVV  201

Query  152  ------ETPSARDNVGHGSH  193
                  E  S RD  GHG+H
Sbjct  202  NRTQNPEYLSPRDFAGHGTH  221



>ref|XP_009105193.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=757

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 49/81 (60%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+GIWPES SF D  +GPIP RWKGKC  GD F++S  CN+K+IGA +YV          
Sbjct  154  DSGIWPESESFKDTGLGPIPQRWKGKCVSGDGFDASKHCNKKLIGAEFYVDSLAAETNGQ  213

Query  152  -------ETPSARDNVGHGSH  193
                   E  SARD  GHG+H
Sbjct  214  YDFHAENEYRSARDGAGHGTH  234



>ref|XP_002458431.1| hypothetical protein SORBIDRAFT_03g033440 [Sorghum bicolor]
 gb|EES03551.1| hypothetical protein SORBIDRAFT_03g033440 [Sorghum bicolor]
Length=785

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 52/78 (67%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVET--------  157
            D+GIWPES SF+D  +GP+P RWKG C+ GD F+SS+ CNRKIIGARYYV+         
Sbjct  155  DSGIWPESRSFSDQGLGPVPARWKGTCQGGDSFSSSS-CNRKIIGARYYVKAYEAHYKGL  213

Query  158  ------PSARDNVGHGSH  193
                   S RD+ GHG+H
Sbjct  214  NTTNAFRSPRDHDGHGTH  231



>gb|EMS57180.1| Subtilisin-like protease [Triticum urartu]
Length=612

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPE PS++D   GP+P  WKGKCE G DFNSS  CNRK+IGARY++          
Sbjct  104  DTGVWPERPSYDDAGFGPVPAGWKGKCEGGSDFNSSA-CNRKLIGARYFLAGYEASKGPV  162

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RDN GHG+H
Sbjct  163  DTTKESRSPRDNDGHGTH  180



>ref|NP_001051353.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|AAK63927.1|AC084282_8 putative serine protease [Oryza sativa Japonica Group]
 gb|ABF99010.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13267.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|EAZ28668.1| hypothetical protein OsJ_12679 [Oryza sativa Japonica Group]
 dbj|BAG95169.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95978.1| unnamed protein product [Oryza sativa Japonica Group]
Length=764

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 54/78 (69%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPE PS++D  +GP+P  WKGKCE+G+DFN+S  CN+K+IGAR+++          
Sbjct  143  DTGVWPERPSYDDAGLGPVPAGWKGKCEEGNDFNASA-CNKKLIGARFFLTGYEAAKGPV  201

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RDN GHG+H
Sbjct  202  DTSKESRSPRDNDGHGTH  219



>gb|EYU44466.1| hypothetical protein MIMGU_mgv1a0020561mg, partial [Erythranthe 
guttata]
Length=293

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPESPSF+D  +G +P  W+G+CE G +F  SN CN+K+IGARY+           
Sbjct  147  DTGVWPESPSFDDAGLGSVPGSWRGECETGTNFTKSN-CNKKLIGARYFARGYEATLGPI  205

Query  149  ---VETPSARDNVGHGSH  193
                E+ SARD+ GHG+H
Sbjct  206  DESTESKSARDDDGHGTH  223



>gb|KDP40600.1| hypothetical protein JCGZ_24599 [Jatropha curcas]
Length=775

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 50/79 (63%), Gaps = 16/79 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF+D  IG IP RWKG C +G DF  SN CNRK+IGARYY           
Sbjct  148  DTGIWPESPSFDDKGIGEIPSRWKGICMEGHDFKKSN-CNRKLIGARYYDTYQRTYKNNK  206

Query  149  --VETPSA--RDNVGHGSH  193
              V  PS   RD +GHG+H
Sbjct  207  THVPKPSGSPRDYIGHGTH  225



>emb|CDY07492.1| BnaA07g25710D [Brassica napus]
Length=757

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 49/81 (60%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+GIWPES SF D  +GPIP RWKGKC  GD F++S  CN+K+IGA +YV          
Sbjct  154  DSGIWPESESFKDTGLGPIPQRWKGKCVSGDGFDASKHCNKKLIGAEFYVDSLAAETNGQ  213

Query  152  -------ETPSARDNVGHGSH  193
                   E  SARD  GHG+H
Sbjct  214  YDFHAENEYRSARDGAGHGTH  234



>ref|XP_009125836.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=760

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 48/80 (60%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+G+WPESPSF+D  +GPIP RWKG C  G  F+S   CN+K+IGARYY+          
Sbjct  149  DSGVWPESPSFSDKGLGPIPKRWKGTCVDGAKFDSKKHCNKKLIGARYYMDSLFKNNRTD  208

Query  152  ------ETPSARDNVGHGSH  193
                  E  SAR+   HGSH
Sbjct  209  SGIADTEYMSAREVFAHGSH  228



>ref|XP_003552427.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=764

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 49/76 (64%), Gaps = 13/76 (17%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPES SF D  +  IP+RWKG CE+G DFN+S  CN K+IGARY+           
Sbjct  150  DTGVWPESESFKDEGMTKIPNRWKGTCEEGQDFNTS-MCNFKLIGARYFNKGVIAANSKV  208

Query  149  -VETPSARDNVGHGSH  193
             +   SARD VGHG+H
Sbjct  209  KISMNSARDTVGHGTH  224



>emb|CBI23086.3| unnamed protein product [Vitis vinifera]
Length=842

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARY------------  145
            DTGIWPES  F+D  +GPIP RWKG C  G  FN++  CNRK+IGARY            
Sbjct  217  DTGIWPESEVFSDKGLGPIPSRWKGGCSSGQSFNATKHCNRKLIGARYFFKGLEAEIGEP  276

Query  146  -----YVETPSARDNVGHGSH  193
                 Y+E  S RD +GHG+H
Sbjct  277  LNTTEYLEYLSPRDALGHGTH  297



>gb|EMT19033.1| Subtilisin-like protease [Aegilops tauschii]
Length=779

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF+D   GP+P RWKGKC+ G D+ S+N C+RKIIGAR+Y           
Sbjct  188  DTGIWPESRSFSDQGYGPVPSRWKGKCQVGPDWGSNN-CSRKIIGARFYTAGGPKEYCEG  246

Query  152  ETPSARDNVGHGSH  193
            E  S RD+ GHG+H
Sbjct  247  EPLSPRDHAGHGTH  260



>emb|CDP17236.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 13/76 (17%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPESPS+ D+ + PIP +WKG CE G DFNSS  CN K+IGARY+           
Sbjct  149  DTGVWPESPSYKDDGMTPIPSKWKGTCEAGQDFNSS-LCNLKLIGARYFNKGLVAANPKI  207

Query  149  -VETPSARDNVGHGSH  193
             +   S RD  GHG+H
Sbjct  208  VISMNSTRDTFGHGTH  223



>ref|XP_004501532.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=777

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPE  SF+D  +GP+P  WKG+CE G +FNSSN CN+K++GAR++           
Sbjct  150  DTGVWPELKSFDDTKLGPVPSSWKGECETGKNFNSSN-CNKKLVGARFFAKGYEAAFGPI  208

Query  149  ---VETPSARDNVGHGSH  193
                E+ S RD+ GHGSH
Sbjct  209  DETAESKSPRDDDGHGSH  226



>ref|XP_010456502.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=763

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 20/84 (24%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETP-------  160
            D+G+WPES SFND  +GPIP RWKGKC  G+ F S   CN+K+IGARYY+++        
Sbjct  145  DSGVWPESESFNDRGLGPIPARWKGKCVDGEGFESKKHCNKKLIGARYYIQSHIQKNKTE  204

Query  161  -------------SARDNVGHGSH  193
                          ARD+  HG+H
Sbjct  205  GITSDYIEQKEYMYARDSYAHGTH  228



>ref|XP_009586900.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 48/71 (68%), Gaps = 7/71 (10%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE-------TP  160
            DTGIWPES SF DN IGPIP RWKGKC  G  FN++  CNRK+IGAR +V+         
Sbjct  141  DTGIWPESESFKDNGIGPIPTRWKGKCVDGIAFNATRNCNRKLIGARNFVKGVENDYHHQ  200

Query  161  SARDNVGHGSH  193
            S RD  GHG+H
Sbjct  201  SPRDQNGHGTH  211



>ref|XP_003629621.1| Subtilisin-like protease [Medicago truncatula]
Length=797

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (65%), Gaps = 19/82 (23%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SFND A+G IP +WKG C+ G+ FNS+N CN+KIIGAR+++          
Sbjct  155  DTGIWPESASFNDEAMGKIPSKWKGVCQVGEKFNSTN-CNKKIIGARWFLKGITDHTKNL  213

Query  152  --------ETPSARDNVGHGSH  193
                    E  SARD +GHG+H
Sbjct  214  VLGNNDTTEYLSARDAIGHGTH  235



>ref|NP_001046522.1| Os02g0271000 [Oryza sativa Japonica Group]
 dbj|BAD29425.1| putative subtilisin-like serine proteinase [Oryza sativa Japonica 
Group]
 dbj|BAF08436.1| Os02g0271000 [Oryza sativa Japonica Group]
 gb|EAY85322.1| hypothetical protein OsI_06700 [Oryza sativa Indica Group]
 gb|EAZ22534.1| hypothetical protein OsJ_06201 [Oryza sativa Japonica Group]
 dbj|BAG92819.1| unnamed protein product [Oryza sativa Japonica Group]
Length=738

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 48/74 (65%), Gaps = 10/74 (14%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+GIWPES SF+DN   P+P RWKGKC+ G  FN++  CNRKIIG R+Y           
Sbjct  138  DSGIWPESRSFDDNGYSPVPARWKGKCQTGAAFNATTGCNRKIIGVRWYSGGIPDENLKG  197

Query  152  ETPSARDNVGHGSH  193
            E  SARD  GHG+H
Sbjct  198  EYMSARDLGGHGTH  211



>ref|XP_006282786.1| hypothetical protein CARUB_v10006393mg [Capsella rubella]
 gb|EOA15684.1| hypothetical protein CARUB_v10006393mg [Capsella rubella]
Length=683

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 46/64 (72%), Gaps = 5/64 (8%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETPSARDNVG  181
            D GIWPES SF+D  IGPIP +WKG C  G +F     CNRK+IGARYYV+  SARD  G
Sbjct  104  DGGIWPESKSFSDKGIGPIPKKWKGTCAGGANFT----CNRKVIGARYYVQ-DSARDTEG  158

Query  182  HGSH  193
            HGSH
Sbjct  159  HGSH  162



>gb|KDP41644.1| hypothetical protein JCGZ_16051 [Jatropha curcas]
Length=747

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 50/78 (64%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPE  SF+D  +GPIP  WKG CE G +FNSSN CNRK++GARY+           
Sbjct  120  DTGVWPELKSFDDTGLGPIPSTWKGTCETGTNFNSSN-CNRKLVGARYFSRGYEAAFGPV  178

Query  149  ---VETPSARDNVGHGSH  193
                E+ S RD+ GHG+H
Sbjct  179  DETAESKSPRDDDGHGTH  196



>ref|XP_007158029.1| hypothetical protein PHAVU_002G118200g [Phaseolus vulgaris]
 gb|ESW30023.1| hypothetical protein PHAVU_002G118200g [Phaseolus vulgaris]
Length=773

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 50/75 (67%), Gaps = 12/75 (16%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVE---------  154
            DTG+WPES SF+D  +GPIP +WKGKCE   DFN+SN CNRK+IGAR Y +         
Sbjct  144  DTGVWPESKSFDDAGLGPIPSKWKGKCELSVDFNASN-CNRKLIGARSYAKGYEATLGPI  202

Query  155  --TPSARDNVGHGSH  193
              T S RD  GHGSH
Sbjct  203  SGTISPRDTDGHGSH  217



>ref|XP_007046422.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOX90579.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=761

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETPSA-----  166
            DTGIWPESPSF+D  + P+PD+WKG+C+ G+ FN+S+ CNRK+IGARYY+    A     
Sbjct  146  DTGIWPESPSFSDANMPPVPDQWKGQCQSGEAFNASS-CNRKVIGARYYMSGYEAEGVSE  204

Query  167  --------RDNVGHGSH  193
                    RD+ GHGSH
Sbjct  205  NTLLFRSPRDSSGHGSH  221



>ref|XP_010554964.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=762

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 47/81 (58%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVET--------  157
            D+GIWPES SFND  +GPIP RWKG+C  G  F+    CNRK+IGARYY E         
Sbjct  155  DSGIWPESESFNDKDVGPIPKRWKGECVAGQGFDPEKLCNRKLIGARYYTEAILRQNNGT  214

Query  158  ---------PSARDNVGHGSH  193
                      SARD + HG+H
Sbjct  215  FNYAQNKEYASARDGLAHGTH  235



>ref|XP_003634152.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 48/81 (59%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARY------------  145
            D+GIWPES  F+D  +GPIP RWKG C  G  FN++  CNRK+IGARY            
Sbjct  151  DSGIWPESKVFSDKGLGPIPSRWKGGCSSGQSFNATKHCNRKLIGARYFLKGLEAEIGEP  210

Query  146  -----YVETPSARDNVGHGSH  193
                 Y+E  S RD +GHG+H
Sbjct  211  LNTTKYLEYLSPRDALGHGTH  231



>gb|AET04097.2| subtilisin-like serine protease [Medicago truncatula]
Length=781

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (65%), Gaps = 19/82 (23%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SFND A+G IP +WKG C+ G+ FNS+N CN+KIIGAR+++          
Sbjct  156  DTGIWPESASFNDEAMGKIPSKWKGVCQVGEKFNSTN-CNKKIIGARWFLKGITDHTKNL  214

Query  152  --------ETPSARDNVGHGSH  193
                    E  SARD +GHG+H
Sbjct  215  VLGNNDTTEYLSARDAIGHGTH  236



>ref|XP_010912031.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=765

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 13/76 (17%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPES SFND+ + P+P RWKG CE+G DF+SS  CNRK+IGAR++           
Sbjct  150  DTGIWPESQSFNDDGMTPVPARWKGVCEQGTDFSSSA-CNRKLIGARFFNKGLLAANPNL  208

Query  149  -VETPSARDNVGHGSH  193
             +   S RD  GHG+H
Sbjct  209  TIAVNSPRDTDGHGTH  224



>ref|XP_007131421.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03415.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=775

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 52/81 (64%), Gaps = 18/81 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SFND  +G IP RWKG C+ G+ FNS+N CN+KIIGAR+++          
Sbjct  151  DTGIWPESASFNDEGMGQIPSRWKGVCQVGEHFNSTN-CNKKIIGARWFLKGITDQTKKL  209

Query  152  -------ETPSARDNVGHGSH  193
                   E  SARD +GHG+H
Sbjct  210  LHGNNTNEYLSARDAIGHGTH  230



>ref|XP_010277120.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTGIWPES SF+D  +GP+P  WKG+CE G +FN+SN CNRK+IGAR++           
Sbjct  142  DTGIWPESLSFDDKGLGPVPSGWKGECEVGKNFNTSN-CNRKLIGARFFSKGYEATLGPI  200

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RD+ GHG+H
Sbjct  201  DETKESKSPRDDDGHGTH  218



>ref|XP_009350314.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=718

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV-------ETP  160
            D GIWPES   ND+ +GPIP RWKG+CE G+ FN++  CNRK+IGA++++       E P
Sbjct  91   DFGIWPESKMLNDHGVGPIPTRWKGRCESGESFNATTHCNRKLIGAKWFIDGFLADNEQP  150

Query  161  ---------SARDNVGHGSH  193
                     S RD  GHG+H
Sbjct  151  FNTVFREFYSPRDGAGHGTH  170



>gb|EMT05336.1| Subtilisin-like protease [Aegilops tauschii]
Length=792

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 50/74 (68%), Gaps = 11/74 (15%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY----------V  151
            DTGIWPES SFND   GP+P RWKGKC+ G D+ S N C+RKI+GAR+Y           
Sbjct  152  DTGIWPESRSFNDAGYGPVPSRWKGKCQVGHDWGSKN-CSRKIVGARFYSAGVPDQFLET  210

Query  152  ETPSARDNVGHGSH  193
            ++ S RD+ GHG+H
Sbjct  211  DSLSPRDHNGHGTH  224



>ref|XP_002960359.1| hypothetical protein SELMODRAFT_437460 [Selaginella moellendorffii]
 gb|EFJ37898.1| hypothetical protein SELMODRAFT_437460 [Selaginella moellendorffii]
Length=756

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 49/76 (64%), Gaps = 13/76 (17%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETP-------  160
            DTG+WPES SF+D  +GP+P RW+G C+ G  FNSS  CNRKIIGARYY +         
Sbjct  150  DTGVWPESESFSDEGMGPVPSRWRGICQAGQAFNSS-LCNRKIIGARYYYKGMRAENISA  208

Query  161  -----SARDNVGHGSH  193
                 SARD  GHGSH
Sbjct  209  AGDFFSARDKEGHGSH  224



>ref|XP_008810058.1| PREDICTED: subtilisin-like protease SDD1 [Phoenix dactylifera]
Length=771

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 51/81 (63%), Gaps = 18/81 (22%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTG+WPESPSF D  + P+P RW+G C++G+ FNSSN CNRK+IGAR+Y           
Sbjct  145  DTGVWPESPSFGDRRMPPVPRRWRGACQEGESFNSSN-CNRKLIGARFYSKGHRANMPEK  203

Query  149  ------VETPSARDNVGHGSH  193
                  +E  S RD  GHG+H
Sbjct  204  PAAASLLEYMSPRDAHGHGTH  224



>ref|NP_001151463.1| LOC100285096 precursor [Zea mays]
 gb|ACG42951.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 52/78 (67%), Gaps = 15/78 (19%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPE PS++D   GP+P  WKGKCE G+DFN+S  CN+K+IGAR+++          
Sbjct  142  DTGVWPERPSYDDTGFGPVPAGWKGKCEDGNDFNASA-CNKKLIGARFFLTGYEAAKGPV  200

Query  152  ----ETPSARDNVGHGSH  193
                E+ S RDN GHG+H
Sbjct  201  DTSKESRSPRDNDGHGTH  218



>ref|XP_004509477.1| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Cicer 
arietinum]
Length=762

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 50/77 (65%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF+D  +  +P  WKGKC+ G+ FN+S  CNRK+IGARYY           
Sbjct  147  DTGIWPESPSFSDTNMPAVPAGWKGKCQSGETFNAST-CNRKVIGARYYMKGYEAEEESN  205

Query  149  --VETPSARDNVGHGSH  193
              V   SARD+ GHGSH
Sbjct  206  AKVSFKSARDSTGHGSH  222



>ref|XP_003520616.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=768

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 50/76 (66%), Gaps = 13/76 (17%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPESPSFND  + PIP +WKG C+ G  FNS+N CNRK+IGARY+           
Sbjct  142  DTGVWPESPSFNDQGMPPIPQKWKGICQAGKAFNSTN-CNRKLIGARYFTKGHFSVSPFR  200

Query  152  --ETPSARDNVGHGSH  193
              E  S RD+ GHG+H
Sbjct  201  DPEYLSPRDSSGHGTH  216



>ref|XP_004509478.1| PREDICTED: subtilisin-like protease SDD1-like isoform X2 [Cicer 
arietinum]
Length=726

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 50/77 (65%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF+D  +  +P  WKGKC+ G+ FN+S  CNRK+IGARYY           
Sbjct  111  DTGIWPESPSFSDTNMPAVPAGWKGKCQSGETFNAST-CNRKVIGARYYMKGYEAEEESN  169

Query  149  --VETPSARDNVGHGSH  193
              V   SARD+ GHGSH
Sbjct  170  AKVSFKSARDSTGHGSH  186



>ref|XP_006370742.1| hypothetical protein POPTR_0001s460001g, partial [Populus trichocarpa]
 gb|ERP67311.1| hypothetical protein POPTR_0001s460001g, partial [Populus trichocarpa]
Length=350

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF+D  + P+P RW+GKC+ G+ FN+S+ CNRK+IGARYY           
Sbjct  144  DTGIWPESPSFSDADMPPVPARWRGKCQLGEAFNASS-CNRKVIGARYYKSGYEAEEDSS  202

Query  149  --VETPSARDNVGHGSH  193
              +   S RD+ GHGSH
Sbjct  203  RIMSFRSPRDSSGHGSH  219



>ref|XP_002273195.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 48/81 (59%), Gaps = 17/81 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARY------------  145
            D+GIWPES  F+D  +GPIP RWKG C  G  FN++  CNRK+IGARY            
Sbjct  151  DSGIWPESKVFSDKGLGPIPSRWKGGCSSGQSFNATKHCNRKLIGARYFLKGLEAEIGEP  210

Query  146  -----YVETPSARDNVGHGSH  193
                 Y+E  S RD +GHG+H
Sbjct  211  LNTTEYLEYLSPRDALGHGTH  231



>emb|CDY65868.1| BnaAnng21170D, partial [Brassica napus]
Length=672

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 48/80 (60%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+G+WPESPSF+D  +GPIP RWKG C  G  F+S   CN+K+IGARYY+          
Sbjct  61   DSGVWPESPSFSDKGLGPIPKRWKGTCVDGAKFDSKKHCNKKLIGARYYMDSLFKNNRTD  120

Query  152  ------ETPSARDNVGHGSH  193
                  E  SAR+   HGSH
Sbjct  121  SGIADTEYMSAREVFAHGSH  140



>ref|XP_004512297.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
Length=763

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF D  + P+P RWKG C+ G+ FN+S+ CNRK+IGARYY           
Sbjct  147  DTGIWPESPSFVDTDMPPVPRRWKGHCQIGEAFNASS-CNRKVIGARYYMSGFQAEEGSD  205

Query  149  --VETPSARDNVGHGSH  193
              V   SARD+ GHGSH
Sbjct  206  RKVSFGSARDSSGHGSH  222



>ref|XP_006286455.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
 gb|EOA19353.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
Length=574

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 48/80 (60%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVET--------  157
            D+G+WPES  FND   GPIP RWKG CE GD FN+S  CNRK+IGA+++V+         
Sbjct  142  DSGVWPESDMFNDKGYGPIPSRWKGGCESGDSFNASINCNRKLIGAKFFVDGLVADKRIL  201

Query  158  --------PSARDNVGHGSH  193
                     S RD  GHG+H
Sbjct  202  NRTLIADYLSPRDLNGHGTH  221



>ref|XP_006286458.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
 gb|EOA19356.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
Length=759

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 48/80 (60%), Gaps = 16/80 (20%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            DTG+WPES  FND   GPIP RWKG C  G  FN+S  CNRK+IGA+Y+V          
Sbjct  142  DTGVWPESEMFNDKGYGPIPSRWKGGCVSGQSFNASINCNRKLIGAKYFVDGYVAENGFL  201

Query  152  ---ETP---SARDNVGHGSH  193
               ETP   S RD  GHG+H
Sbjct  202  NTTETPEYISPRDFSGHGTH  221



>ref|XP_004512298.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
Length=743

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYY-----------  148
            DTGIWPESPSF D  + P+P RWKG C+ G+ FN+S+ CNRK+IGARYY           
Sbjct  147  DTGIWPESPSFVDTDMPPVPRRWKGHCQIGEAFNASS-CNRKVIGARYYMSGFQAEEGSD  205

Query  149  --VETPSARDNVGHGSH  193
              V   SARD+ GHGSH
Sbjct  206  RKVSFGSARDSSGHGSH  222



>ref|XP_006289363.1| hypothetical protein CARUB_v10002849mg, partial [Capsella rubella]
 gb|EOA22261.1| hypothetical protein CARUB_v10002849mg, partial [Capsella rubella]
Length=789

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 17/80 (21%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYV----------  151
            D+G+WPES  FNDN IGP+P  WKG CE G+ FN+S+ CN+K+IGA+Y++          
Sbjct  160  DSGVWPESEVFNDNGIGPVPSHWKGDCESGEMFNASH-CNKKLIGAKYFINGFLATHKTF  218

Query  152  ------ETPSARDNVGHGSH  193
                  +  S RDN GHG+H
Sbjct  219  NSTESLDFISPRDNSGHGTH  238



>ref|XP_008375469.1| PREDICTED: cucumisin-like [Malus domestica]
Length=732

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 44/64 (69%), Gaps = 4/64 (6%)
 Frame = +2

Query  2    DTGIWPESPSFNDNAIGPIPDRWKGKCEKGDDFNSSNFCNRKIIGARYYVETPSARDNVG  181
            DTGIWPES SF D+  GP P  WKG CE G +FN    CN KIIGARYY    SARD +G
Sbjct  144  DTGIWPESNSFRDDGFGPPPKSWKGACEGGQNFN----CNNKIIGARYYTLEESARDVIG  199

Query  182  HGSH  193
            HGSH
Sbjct  200  HGSH  203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 535532096008