BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c39420_g1_i1 len=638 path=[1:0-637]

Length=638
                                                                      Score     E

gb|ABB17076.1|  invertase inhibitor                                     178   2e-52   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009779273.1|  PREDICTED: cell wall / vacuolar inhibitor of...    176   5e-52   
ref|XP_006349845.1|  PREDICTED: cell wall / vacuolar inhibitor of...    174   4e-51   
ref|XP_009602450.1|  PREDICTED: cell wall / vacuolar inhibitor of...    173   1e-50   
ref|XP_006349844.1|  PREDICTED: cell wall / vacuolar inhibitor of...    172   2e-50   
gb|AFI47460.1|  invertase inhibitor                                     172   3e-50   
gb|ADM49013.1|  putative invertase inhibitor                            172   4e-50   
gb|AFI47461.1|  invertase inhibitor                                     171   6e-50   
pdb|2XQR|B  Chain B, Crystal Structure Of Plant Cell Wall Inverta...    171   7e-50   
pdb|1RJ1|A  Chain A, Crystal Structure Of A Cell Wall Invertase I...    171   7e-50   
gb|AAX63190.1|  putative invertase inhibitor precursor                  171   7e-50   Solanum tuberosum [potatoes]
gb|ADM49012.1|  putative invertase inhibitor                            171   9e-50   
gb|AFI47463.1|  invertase inhibitor                                     171   1e-49   
ref|NP_001234791.1|  tomato invertase inhibitor precursor               170   2e-49   
pdb|2CJ4|A  Chain A, Crystal Structure Of A Cell Wall Invertase I...    168   7e-49   
ref|XP_004252930.1|  PREDICTED: cell wall / vacuolar inhibitor of...    168   1e-48   
ref|XP_009604073.1|  PREDICTED: cell wall / vacuolar inhibitor of...    160   9e-46   
ref|XP_009589300.1|  PREDICTED: cell wall / vacuolar inhibitor of...    157   3e-44   
ref|XP_009780950.1|  PREDICTED: cell wall / vacuolar inhibitor of...    154   2e-43   
ref|XP_009779928.1|  PREDICTED: cell wall / vacuolar inhibitor of...    152   1e-42   
ref|XP_010500306.1|  PREDICTED: cell wall / vacuolar inhibitor of...    139   1e-37   
ref|XP_010479199.1|  PREDICTED: cell wall / vacuolar inhibitor of...    138   5e-37   
ref|XP_010549010.1|  PREDICTED: cell wall / vacuolar inhibitor of...    138   6e-37   
ref|XP_010461598.1|  PREDICTED: cell wall / vacuolar inhibitor of...    137   1e-36   
ref|XP_002894085.1|  hypothetical protein ARALYDRAFT_891603             136   2e-36   
ref|XP_002519258.1|  Pectinesterase inhibitor, putative                 137   2e-36   Ricinus communis
ref|XP_006303367.1|  hypothetical protein CARUB_v10010500mg             135   7e-36   
ref|XP_002273484.2|  PREDICTED: cell wall / vacuolar inhibitor of...    135   9e-36   Vitis vinifera
ref|XP_006393505.1|  hypothetical protein EUTSA_v10011825mg             135   9e-36   
gb|KFK26435.1|  hypothetical protein AALP_AA8G248000                    134   1e-35   
gb|EYU19077.1|  hypothetical protein MIMGU_mgv1a015091mg                134   1e-35   
emb|CDO98741.1|  unnamed protein product                                134   4e-35   
gb|AAG51534.1|AC051631_14  hypothetical protein; 80318-81409            132   7e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148010.1|  PREDICTED: cell wall / vacuolar inhibitor of...    132   9e-35   
emb|CDY20929.1|  BnaC06g01490D                                          131   1e-34   
emb|CDX93634.1|  BnaA06g04140D                                          131   2e-34   
ref|XP_002314521.1|  hypothetical protein POPTR_0010s07350g             131   3e-34   Populus trichocarpa [western balsam poplar]
gb|AGC75063.1|  vacuolar invertase inhibitor                            130   6e-34   
ref|XP_002279756.1|  PREDICTED: cell wall / vacuolar inhibitor of...    130   8e-34   Vitis vinifera
ref|XP_011096732.1|  PREDICTED: cell wall / vacuolar inhibitor of...    129   1e-33   
ref|XP_004252929.1|  PREDICTED: cell wall / vacuolar inhibitor of...    129   2e-33   
gb|AGC94752.1|  putative pectinesterase inhibitor                       127   7e-33   
ref|XP_009763718.1|  PREDICTED: cell wall / vacuolar inhibitor of...    126   2e-32   
ref|XP_003609812.1|  Pectinesterase inhibitor                           125   4e-32   
ref|NP_564516.2|  cell wall / vacuolar inhibitor of fructosidase 1      126   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002279801.1|  PREDICTED: cell wall / vacuolar inhibitor of...    125   5e-32   Vitis vinifera
ref|XP_011041481.1|  PREDICTED: cell wall / vacuolar inhibitor of...    124   1e-31   
ref|XP_006296761.1|  hypothetical protein CARUB_v10015473mg             122   6e-31   
ref|XP_009590146.1|  PREDICTED: cell wall / vacuolar inhibitor of...    122   9e-31   
ref|XP_010110653.1|  Pectinesterase inhibitor                           121   1e-30   
gb|ACO35698.1|  invertase inhibitor                                     121   2e-30   Solanum tuberosum [potatoes]
ref|XP_006349846.1|  PREDICTED: cell wall / vacuolar inhibitor of...    120   4e-30   
gb|AGS32044.1|  invertase inhibitor                                     119   2e-29   
gb|ACO35696.1|  invertase inhibitor                                     119   2e-29   Solanum tuberosum [potatoes]
gb|ACO35694.1|  invertase inhibitor                                     119   2e-29   Solanum tuberosum [potatoes]
gb|AAM94391.1|  invertase inhibitor-like protein                        119   2e-29   Ipomoea batatas [batate]
gb|AIT42248.1|  invertase inhibitor                                     118   2e-29   
ref|XP_003609825.1|  Pectinesterase inhibitor                           118   2e-29   
ref|XP_010465742.1|  PREDICTED: cell wall / vacuolar inhibitor of...    117   3e-29   
ref|XP_010505027.1|  PREDICTED: cell wall / vacuolar inhibitor of...    117   3e-29   
ref|XP_002313933.1|  hypothetical protein POPTR_0009s08690g             117   4e-29   Populus trichocarpa [western balsam poplar]
emb|CDY39016.1|  BnaC01g34800D                                          117   4e-29   
gb|KHN03269.1|  Putative invertase inhibitor                            117   6e-29   
ref|NP_001235420.1|  uncharacterized protein LOC100306719 precursor     117   6e-29   
ref|XP_003556749.1|  PREDICTED: cell wall / vacuolar inhibitor of...    117   7e-29   
ref|XP_010487590.1|  PREDICTED: cell wall / vacuolar inhibitor of...    116   1e-28   
emb|CDY35000.1|  BnaA01g27340D                                          115   2e-28   
ref|XP_007154411.1|  hypothetical protein PHAVU_003G117300g             116   2e-28   
ref|XP_007154412.1|  hypothetical protein PHAVU_003G117400g             116   2e-28   
ref|XP_009114400.1|  PREDICTED: cell wall / vacuolar inhibitor of...    115   2e-28   
ref|XP_011002592.1|  PREDICTED: cell wall / vacuolar inhibitor of...    115   3e-28   
ref|XP_008340696.1|  PREDICTED: cell wall / vacuolar inhibitor of...    114   7e-28   
ref|XP_006406762.1|  hypothetical protein EUTSA_v10021672mg             114   7e-28   
ref|XP_007154410.1|  hypothetical protein PHAVU_003G117200g             114   1e-27   
gb|KHN32727.1|  Pectinesterase inhibitor                                113   1e-27   
gb|KHN02871.1|  Pectinesterase inhibitor 2                              113   2e-27   
gb|AFK44620.1|  unknown                                                 113   2e-27   
ref|XP_003529510.2|  PREDICTED: cell wall / vacuolar inhibitor of...    113   2e-27   
gb|KHN32722.1|  Pectinesterase inhibitor                                112   3e-27   
gb|KHN03268.1|  Pectinesterase inhibitor                                113   3e-27   
ref|NP_001237215.1|  uncharacterized protein LOC100500640 precursor     113   3e-27   
ref|XP_008390421.1|  PREDICTED: cell wall / vacuolar inhibitor of...    112   4e-27   
ref|XP_006605560.1|  PREDICTED: cell wall / vacuolar inhibitor of...    112   4e-27   
gb|AFK48395.1|  unknown                                                 112   4e-27   
ref|XP_006419340.1|  hypothetical protein CICLE_v10006791mg             112   5e-27   
ref|XP_003556709.1|  PREDICTED: cell wall / vacuolar inhibitor of...    112   5e-27   
ref|XP_006488813.1|  PREDICTED: cell wall / vacuolar inhibitor of...    112   6e-27   
gb|KDO71995.1|  hypothetical protein CISIN_1g037982mg                   111   7e-27   
ref|XP_004508125.1|  PREDICTED: cell wall / vacuolar inhibitor of...    110   2e-26   
gb|KHN32720.1|  Pectinesterase inhibitor                                110   2e-26   
ref|XP_003609816.1|  hypothetical protein MTR_4g122800                  110   3e-26   
ref|XP_004508119.1|  PREDICTED: cell wall / vacuolar inhibitor of...    109   5e-26   
ref|XP_002279817.1|  PREDICTED: cell wall / vacuolar inhibitor of...    109   7e-26   Vitis vinifera
ref|XP_010098776.1|  Pectinesterase inhibitor 2                         108   9e-26   
ref|XP_003556745.1|  PREDICTED: cell wall / vacuolar inhibitor of...    108   1e-25   
ref|XP_008223387.1|  PREDICTED: cell wall / vacuolar inhibitor of...    108   2e-25   
ref|XP_003556739.1|  PREDICTED: cell wall / vacuolar inhibitor of...    108   2e-25   
ref|XP_007154409.1|  hypothetical protein PHAVU_003G117100g             107   2e-25   
ref|XP_007223575.1|  hypothetical protein PRUPE_ppa012287mg             107   3e-25   
ref|XP_008390420.1|  PREDICTED: cell wall / vacuolar inhibitor of...    107   5e-25   
ref|XP_004508122.1|  PREDICTED: cell wall / vacuolar inhibitor of...    106   6e-25   
gb|EYU45482.1|  hypothetical protein MIMGU_mgv1a014923mg                105   2e-24   
ref|XP_011071366.1|  PREDICTED: cell wall / vacuolar inhibitor of...    105   2e-24   
emb|CAN79657.1|  hypothetical protein VITISV_014507                     105   2e-24   Vitis vinifera
ref|XP_003609813.1|  Pectinesterase inhibitor                           105   3e-24   
ref|XP_009372099.1|  PREDICTED: cell wall / vacuolar inhibitor of...    104   4e-24   
ref|XP_004305718.1|  PREDICTED: cell wall / vacuolar inhibitor of...    103   7e-24   
ref|XP_007019911.1|  Cell wall / vacuolar inhibitor of fructosida...    105   1e-23   
gb|KDP27949.1|  hypothetical protein JCGZ_19029                         102   1e-23   
gb|KDP27950.1|  hypothetical protein JCGZ_19030                         102   2e-23   
gb|ADZ54776.1|  invertase inhibitor 2                                   102   2e-23   
ref|XP_010110654.1|  Putative invertase inhibitor                       102   3e-23   
gb|KHN32725.1|  Pectinesterase inhibitor                                100   5e-23   
ref|XP_010027117.1|  PREDICTED: cell wall / vacuolar inhibitor of...    101   5e-23   
ref|XP_002525501.1|  C, putative                                        101   6e-23   Ricinus communis
emb|CDO98740.1|  unnamed protein product                                101   8e-23   
gb|ABI17897.1|  invertase inhibitor                                     101   8e-23   Coffea canephora [robusta coffee]
gb|AAX63191.1|  putative invertase inhibitor precursor                99.8    2e-22   Solanum tuberosum [potatoes]
ref|XP_009372102.1|  PREDICTED: cell wall / vacuolar inhibitor of...    100   2e-22   
gb|ADM49016.1|  putative invertase inhibitor                          99.4    2e-22   
gb|ADZ54777.1|  invertase inhibitor 2                                 99.4    2e-22   
ref|XP_004288885.1|  PREDICTED: cell wall / vacuolar inhibitor of...  99.4    2e-22   
ref|XP_007035859.1|  Cell wall / vacuolar inhibitor of fructosida...  99.8    3e-22   
ref|XP_007223451.1|  hypothetical protein PRUPE_ppa011560mg             100   3e-22   
gb|ADZ54775.1|  invertase inhibitor 2                                 98.6    4e-22   
ref|XP_008390458.1|  PREDICTED: cell wall / vacuolar inhibitor of...  98.6    4e-22   
ref|XP_008368958.1|  PREDICTED: cell wall / vacuolar inhibitor of...  97.4    1e-21   
gb|EYU45481.1|  hypothetical protein MIMGU_mgv1a021463mg              96.3    2e-21   
ref|XP_007217364.1|  hypothetical protein PRUPE_ppa022749mg           95.9    1e-20   
ref|XP_007035858.1|  Cell wall / vacuolar inhibitor of fructosida...  94.7    2e-20   
ref|XP_008367865.1|  PREDICTED: cell wall / vacuolar inhibitor of...  93.6    2e-20   
ref|XP_009372103.1|  PREDICTED: cell wall / vacuolar inhibitor of...  94.4    3e-20   
ref|XP_010042127.1|  PREDICTED: cell wall / vacuolar inhibitor of...  94.0    4e-20   
ref|XP_008223407.1|  PREDICTED: cell wall / vacuolar inhibitor of...  94.4    5e-20   
ref|XP_004508121.1|  PREDICTED: cell wall / vacuolar inhibitor of...  91.7    6e-20   
ref|XP_009780951.1|  PREDICTED: cell wall / vacuolar inhibitor of...  92.0    8e-20   
ref|XP_008229307.1|  PREDICTED: cell wall / vacuolar inhibitor of...  92.0    1e-19   
ref|XP_010027116.1|  PREDICTED: cell wall / vacuolar inhibitor of...  92.0    2e-19   
ref|XP_008345204.1|  PREDICTED: uncharacterized protein LOC103408118  94.0    2e-19   
ref|XP_004508255.1|  PREDICTED: cell wall / vacuolar inhibitor of...  91.7    3e-19   
ref|XP_004298183.1|  PREDICTED: cell wall / vacuolar inhibitor of...  90.1    5e-19   
gb|KCW61322.1|  hypothetical protein EUGRSUZ_H04069                   88.2    5e-18   
ref|XP_008368766.1|  PREDICTED: cell wall / vacuolar inhibitor of...  86.7    9e-18   
ref|XP_010045343.1|  PREDICTED: cell wall / vacuolar inhibitor of...  86.7    2e-17   
gb|AFK40449.1|  unknown                                               86.3    2e-17   
ref|XP_004296231.1|  PREDICTED: cell wall / vacuolar inhibitor of...  85.5    4e-17   
ref|XP_007035856.1|  Plant invertase/pectin methylesterase inhibi...  85.5    4e-17   
ref|XP_010685378.1|  PREDICTED: cell wall / vacuolar inhibitor of...  84.7    9e-17   
gb|KHN02873.1|  hypothetical protein glysoja_009739                   84.7    1e-16   
ref|XP_008370564.1|  PREDICTED: cell wall / vacuolar inhibitor of...  82.8    3e-16   
gb|KDO71996.1|  hypothetical protein CISIN_1g047345mg                 82.8    5e-16   
ref|XP_007154406.1|  hypothetical protein PHAVU_003G116900g           82.8    6e-16   
ref|XP_010042126.1|  PREDICTED: cell wall / vacuolar inhibitor of...  82.0    7e-16   
ref|XP_008390456.1|  PREDICTED: cell wall / vacuolar inhibitor of...  81.3    1e-15   
ref|XP_006419339.1|  hypothetical protein CICLE_v10006511mg           81.3    2e-15   
ref|XP_008351148.1|  PREDICTED: cell wall / vacuolar inhibitor of...  80.5    2e-15   
ref|XP_008390454.1|  PREDICTED: cell wall / vacuolar inhibitor of...  80.1    2e-15   
ref|XP_009372129.1|  PREDICTED: cell wall / vacuolar inhibitor of...  80.9    2e-15   
ref|XP_007147385.1|  hypothetical protein PHAVU_006G119800g           80.9    2e-15   
ref|XP_010045344.1|  PREDICTED: putative invertase inhibitor          80.1    4e-15   
ref|NP_001238267.1|  uncharacterized protein LOC100527840 precursor   80.1    5e-15   
ref|XP_003546307.1|  PREDICTED: uncharacterized protein LOC100791177  80.1    5e-15   
ref|XP_008340697.1|  PREDICTED: cell wall / vacuolar inhibitor of...  78.2    1e-14   
ref|XP_003609811.1|  Pectinesterase inhibitor                         79.0    1e-14   
emb|CAD31845.1|  putative invertase inhibitor                         76.3    1e-14   Cicer arietinum [garbanzo]
ref|XP_003550936.1|  PREDICTED: cell wall / vacuolar inhibitor of...  79.0    1e-14   
ref|XP_004296225.1|  PREDICTED: cell wall / vacuolar inhibitor of...  78.6    1e-14   
gb|AFK48253.1|  unknown                                               77.8    1e-14   
gb|KHN03271.1|  hypothetical protein glysoja_004297                   78.2    2e-14   
ref|XP_004517182.1|  PREDICTED: cell wall / vacuolar inhibitor of...  77.8    2e-14   
ref|XP_006488812.1|  PREDICTED: cell wall / vacuolar inhibitor of...  77.4    3e-14   
ref|XP_010098775.1|  Pectinesterase inhibitor                         77.4    5e-14   
ref|XP_008223467.1|  PREDICTED: cell wall / vacuolar inhibitor of...  77.0    5e-14   
ref|XP_004514989.1|  PREDICTED: cell wall / vacuolar inhibitor of...  76.6    7e-14   
ref|XP_007208900.1|  hypothetical protein PRUPE_ppa026908mg           76.3    9e-14   
ref|XP_004508124.1|  PREDICTED: cell wall / vacuolar inhibitor of...  75.5    2e-13   
ref|XP_003594702.1|  Pectinesterase inhibitor                         75.5    2e-13   
gb|AFK46429.1|  unknown                                               75.1    3e-13   
gb|KDP27948.1|  hypothetical protein JCGZ_19028                       74.3    4e-13   
ref|NP_188339.1|  plant invertase/pectin methylesterase inhibitor...  73.2    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486535.1|  PREDICTED: cell wall / vacuolar inhibitor of...  74.3    4e-13   
ref|XP_011019524.1|  PREDICTED: uncharacterized protein LOC105122226  73.9    5e-13   
gb|KFK39050.1|  hypothetical protein AALP_AA3G194200                  73.6    5e-13   
ref|XP_004508126.1|  PREDICTED: cell wall / vacuolar inhibitor of...  72.8    1e-12   
ref|XP_002525502.1|  C, putative                                      71.2    2e-12   Ricinus communis
ref|XP_004508127.1|  PREDICTED: cell wall / vacuolar inhibitor of...  72.4    2e-12   
ref|XP_002311377.2|  invertase/pectin methylesterase inhibitor fa...  71.2    4e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006419341.1|  hypothetical protein CICLE_v10006032mg           71.2    5e-12   
ref|XP_002885188.1|  hypothetical protein ARALYDRAFT_318477           69.7    5e-12   
ref|XP_002519255.1|  enzyme inhibitor, putative                       70.5    9e-12   Ricinus communis
ref|XP_006440545.1|  hypothetical protein CICLE_v10023580mg           70.5    9e-12   
gb|AGX27452.1|  cell wall and vascular inhibitor of beta-fructosi...  70.1    1e-11   
ref|XP_010024810.1|  PREDICTED: cell wall / vacuolar inhibitor of...  70.5    1e-11   
gb|AFK35451.1|  unknown                                               70.1    1e-11   
gb|AFK44617.1|  unknown                                               70.1    1e-11   
ref|XP_004508123.1|  PREDICTED: cell wall / vacuolar inhibitor of...  69.7    2e-11   
ref|XP_007224999.1|  hypothetical protein PRUPE_ppa020400mg           68.6    2e-11   
ref|XP_010052514.1|  PREDICTED: putative invertase inhibitor          68.2    5e-11   
ref|XP_002304471.2|  hypothetical protein POPTR_0003s12200g           68.2    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_004300864.1|  PREDICTED: uncharacterized protein LOC101308973  65.9    1e-10   
ref|XP_004296224.1|  PREDICTED: uncharacterized protein LOC101304956  66.2    2e-10   
gb|KDP45596.1|  hypothetical protein JCGZ_17203                       65.1    3e-10   
ref|XP_004508256.1|  PREDICTED: cell wall / vacuolar inhibitor of...  65.1    6e-10   
ref|XP_006369713.1|  hypothetical protein POPTR_0001s29550g           63.9    7e-10   
emb|CDY34999.1|  BnaA01g27350D                                        63.5    2e-09   
ref|XP_008808258.1|  PREDICTED: putative invertase inhibitor          62.4    6e-09   
ref|XP_007154402.1|  hypothetical protein PHAVU_003G116500g           62.0    7e-09   
ref|XP_006431605.1|  hypothetical protein CICLE_v10003542mg           62.0    7e-09   
ref|XP_003609804.1|  hypothetical protein MTR_4g122660                61.6    1e-08   
ref|XP_006841650.1|  hypothetical protein AMTR_s00003p00239480        61.2    1e-08   
gb|KHN03275.1|  Pectinesterase inhibitor                              61.2    1e-08   
ref|XP_006492567.1|  PREDICTED: pectinesterase inhibitor-like         61.2    1e-08   
ref|XP_009114389.1|  PREDICTED: cell wall / vacuolar inhibitor of...  61.2    1e-08   
ref|XP_006431609.1|  hypothetical protein CICLE_v10002621mg           61.2    2e-08   
gb|KDO71994.1|  hypothetical protein CISIN_1g0317991mg                60.5    2e-08   
ref|XP_008368956.1|  PREDICTED: uncharacterized protein LOC103432541  59.7    2e-08   
ref|XP_007221576.1|  hypothetical protein PRUPE_ppa1027160mg          60.8    2e-08   
ref|XP_002883047.1|  enzyme inhibitor/ pectinesterase                 60.5    2e-08   
ref|XP_007051172.1|  Uncharacterized protein TCM_004852               60.8    3e-08   
ref|XP_008340695.1|  PREDICTED: uncharacterized protein LOC103403627  61.2    3e-08   
ref|XP_008227855.1|  PREDICTED: putative invertase inhibitor          60.1    4e-08   
ref|NP_188340.3|  plant invertase/pectin methylesterase inhibitor...  60.1    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004310173.1|  PREDICTED: cell wall / vacuolar inhibitor of...  59.3    5e-08   
ref|XP_008808257.1|  PREDICTED: putative invertase inhibitor          58.9    8e-08   
ref|XP_006431604.1|  hypothetical protein CICLE_v10004017mg           58.5    1e-07   
emb|CDX82376.1|  BnaA03g34450D                                        58.5    1e-07   
ref|XP_007221543.1|  hypothetical protein PRUPE_ppa026414mg           58.5    1e-07   
ref|XP_010906022.1|  PREDICTED: putative invertase inhibitor          58.5    1e-07   
dbj|BAA94992.1|  invertase inhibitor-like protein                     58.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008223468.1|  PREDICTED: cell wall / vacuolar inhibitor of...  57.0    2e-07   
ref|XP_003589451.1|  Pectinesterase inhibitor                         57.8    3e-07   
ref|XP_010524588.1|  PREDICTED: pectinesterase inhibitor-like         57.4    3e-07   
ref|XP_009146034.1|  PREDICTED: cell wall / vacuolar inhibitor of...  57.4    4e-07   
ref|XP_002885187.1|  invertase/pectin methylesterase inhibitor fa...  57.4    4e-07   
gb|KFK39049.1|  hypothetical protein AALP_AA3G194100                  57.4    4e-07   
ref|XP_010549009.1|  PREDICTED: cell wall / vacuolar inhibitor of...  56.6    5e-07   
ref|XP_006406763.1|  hypothetical protein EUTSA_v10021610mg           57.0    6e-07   
ref|XP_007052414.1|  Plant invertase/pectin methylesterase inhibi...  56.6    7e-07   
ref|XP_003604267.1|  hypothetical protein MTR_4g007280                55.1    9e-07   
ref|XP_008788715.1|  PREDICTED: putative invertase inhibitor          56.2    1e-06   
ref|XP_004501778.1|  PREDICTED: pectinesterase inhibitor-like         56.2    1e-06   
ref|XP_003609810.1|  Pectinesterase inhibitor                         57.8    1e-06   
emb|CDY72175.1|  BnaCnng76330D                                        56.2    1e-06   
emb|CDX75904.1|  BnaC03g39870D                                        55.8    1e-06   
ref|XP_008655849.1|  PREDICTED: cell wall / vacuolar inhibitor of...  56.2    1e-06   
ref|XP_006299434.1|  hypothetical protein CARUB_v10015597mg           55.8    1e-06   
ref|XP_010054538.1|  PREDICTED: putative invertase inhibitor          55.8    1e-06   
ref|XP_011032948.1|  PREDICTED: cell wall / vacuolar inhibitor of...  55.8    2e-06   
gb|KDO41794.1|  hypothetical protein CISIN_1g037300mg                 55.1    2e-06   
ref|XP_010054537.1|  PREDICTED: putative invertase inhibitor          55.5    2e-06   
ref|XP_006379439.1|  hypothetical protein POPTR_0008s01400g           55.5    2e-06   
ref|XP_004292606.1|  PREDICTED: uncharacterized protein LOC101293953  54.7    2e-06   
ref|XP_002315244.1|  hypothetical protein POPTR_0010s21690g           55.1    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006406761.1|  hypothetical protein EUTSA_v10022234mg           55.1    3e-06   
emb|CDX70617.1|  BnaC03g07010D                                        55.1    3e-06   
ref|XP_009114409.1|  PREDICTED: pectinesterase inhibitor              54.7    3e-06   
ref|XP_008365733.1|  PREDICTED: uncharacterized protein LOC103429356  53.5    3e-06   
emb|CDX82377.1|  BnaA03g34440D                                        55.1    3e-06   
ref|XP_009135522.1|  PREDICTED: cell wall / vacuolar inhibitor of...  54.7    3e-06   
ref|XP_010105650.1|  Putative invertase inhibitor                     54.7    3e-06   
gb|KHN17764.1|  Putative invertase inhibitor                          54.7    3e-06   
ref|XP_010934890.1|  PREDICTED: putative invertase inhibitor isof...  54.7    3e-06   
ref|XP_010934889.1|  PREDICTED: putative invertase inhibitor isof...  55.1    3e-06   
ref|XP_003550591.1|  PREDICTED: putative invertase inhibitor-like     55.1    3e-06   
ref|XP_010094461.1|  Putative invertase inhibitor                     54.7    4e-06   
emb|CDY35001.1|  BnaA01g27330D                                        54.3    4e-06   
ref|XP_008450606.1|  PREDICTED: pectinesterase inhibitor-like         53.9    5e-06   
ref|XP_010054539.1|  PREDICTED: putative invertase inhibitor          54.3    6e-06   
ref|NP_188338.1|  plant invertase/pectin methylesterase inhibitor...  53.9    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465741.1|  PREDICTED: cell wall / vacuolar inhibitor of...  53.9    6e-06   
ref|XP_010444399.1|  PREDICTED: cell wall / vacuolar inhibitor of...  53.9    6e-06   
ref|XP_010505038.1|  PREDICTED: cell wall / vacuolar inhibitor of...  53.9    6e-06   
ref|XP_010484247.1|  PREDICTED: cell wall / vacuolar inhibitor of...  53.5    8e-06   
ref|XP_004292607.1|  PREDICTED: cell wall / vacuolar inhibitor of...  53.1    8e-06   
ref|XP_010906021.1|  PREDICTED: putative invertase inhibitor          53.5    8e-06   
ref|XP_002517758.1|  C, putative                                      53.1    1e-05   Ricinus communis
ref|XP_010660396.1|  PREDICTED: cell wall / vacuolar inhibitor of...  53.5    1e-05   
gb|KCW87519.1|  hypothetical protein EUGRSUZ_B03967                   52.0    1e-05   
ref|XP_006381545.1|  hypothetical protein POPTR_0006s13710g           53.5    1e-05   
ref|XP_010041723.1|  PREDICTED: putative invertase inhibitor          53.1    1e-05   
ref|XP_006281177.1|  hypothetical protein CARUB_v10027212mg           53.1    1e-05   
ref|XP_008370626.1|  PREDICTED: putative invertase inhibitor          52.8    1e-05   
ref|XP_010487584.1|  PREDICTED: cell wall / vacuolar inhibitor of...  52.8    2e-05   
ref|XP_010096509.1|  Pectinesterase inhibitor                         53.1    2e-05   
ref|XP_009376582.1|  PREDICTED: uncharacterized protein LOC103965273  52.4    2e-05   
ref|XP_010487591.1|  PREDICTED: pectinesterase inhibitor-like         52.4    2e-05   
ref|XP_002264426.1|  PREDICTED: putative invertase inhibitor          52.0    4e-05   
ref|XP_010554869.1|  PREDICTED: putative invertase inhibitor isof...  52.0    4e-05   
ref|XP_006836659.1|  hypothetical protein AMTR_s00088p00049450        51.2    5e-05   
ref|XP_006375732.1|  hypothetical protein POPTR_0013s01430g           51.2    5e-05   
emb|CCC42228.1|  pectin methyl esterase inhibitor                     51.6    6e-05   
ref|NP_001078166.1|  putative pectinesterase inhibitor                51.2    6e-05   
ref|XP_002264553.1|  PREDICTED: putative invertase inhibitor          51.2    7e-05   
ref|XP_010107090.1|  Putative invertase inhibitor                     51.2    7e-05   
emb|CDX78636.1|  BnaA03g05480D                                        50.8    7e-05   
ref|XP_010649385.1|  PREDICTED: cell wall / vacuolar inhibitor of...  51.2    7e-05   
ref|XP_010462937.1|  PREDICTED: cell wall / vacuolar inhibitor of...  51.2    7e-05   
ref|XP_008235482.1|  PREDICTED: cell wall / vacuolar inhibitor of...  51.2    8e-05   
ref|XP_007012508.1|  Plant invertase/pectin methylesterase inhibi...  50.8    8e-05   
emb|CAN61449.1|  hypothetical protein VITISV_001468                   51.6    8e-05   
gb|EMT15551.1|  Pectinesterase inhibitor                              50.8    8e-05   
gb|ABY21305.1|  pollen allergen Pla o 1                               50.4    1e-04   
ref|XP_010468224.1|  PREDICTED: pectinesterase inhibitor-like         50.4    1e-04   
ref|XP_009131474.1|  PREDICTED: pectinesterase inhibitor-like         50.4    1e-04   
ref|XP_002517248.1|  Pectinesterase inhibitor, putative               50.4    1e-04   
ref|XP_010510197.1|  PREDICTED: cell wall / vacuolar inhibitor of...  50.4    1e-04   
gb|EMT15763.1|  Pectinesterase inhibitor                              50.4    1e-04   
ref|XP_007206622.1|  hypothetical protein PRUPE_ppa021753mg           50.4    1e-04   
gb|EMS58472.1|  hypothetical protein TRIUR3_30303                     50.1    2e-04   
ref|XP_010505073.1|  PREDICTED: pectinesterase inhibitor-like         50.1    2e-04   
ref|XP_002452731.1|  hypothetical protein SORBIDRAFT_04g031470        50.1    2e-04   
gb|ACI01434.1|  pectin methylesterase inhibitor                       50.4    2e-04   
ref|XP_010664040.1|  PREDICTED: putative invertase inhibitor          50.4    2e-04   
ref|XP_010414128.1|  PREDICTED: cell wall / vacuolar inhibitor of...  50.1    2e-04   
gb|KEH24400.1|  plant invertase/pectin methylesterase inhibitor       50.1    2e-04   
emb|CCC42230.1|  pectin methyl esterase inhibitor                     50.4    2e-04   
ref|XP_002455536.1|  hypothetical protein SORBIDRAFT_03g012790        50.4    2e-04   
ref|XP_011029371.1|  PREDICTED: cell wall / vacuolar inhibitor of...  49.7    2e-04   
ref|XP_009764005.1|  PREDICTED: putative invertase inhibitor          49.7    2e-04   
ref|XP_007221519.1|  hypothetical protein PRUPE_ppa015672mg           48.1    2e-04   
emb|CDY39017.1|  BnaC01g34810D                                        49.3    3e-04   
gb|EAY73714.1|  hypothetical protein OsI_01592                        49.7    3e-04   
ref|XP_010456178.1|  PREDICTED: pectinesterase inhibitor-like         49.3    3e-04   
ref|XP_002864910.1|  C/VIF2                                           49.3    3e-04   
gb|AFK49569.1|  unknown                                               49.7    3e-04   
gb|KDP29028.1|  hypothetical protein JCGZ_16417                       49.3    3e-04   
sp|Q8GT41.1|PLA1_PLAAC  RecName: Full=Putative invertase inhibito...  49.3    3e-04   
ref|XP_002516195.1|  Pectinmethylesterase inhibitor 2 precursor, ...  49.3    4e-04   
sp|P83326.2|PMEI_ACTDE  RecName: Full=Pectinesterase inhibitor; A...  49.3    4e-04   
ref|XP_006392565.1|  hypothetical protein EUTSA_v10011943mg           48.9    4e-04   
ref|XP_004293424.1|  PREDICTED: cell wall / vacuolar inhibitor of...  49.7    4e-04   
ref|XP_008340692.1|  PREDICTED: pectinesterase inhibitor-like         48.9    4e-04   
ref|XP_006350971.1|  PREDICTED: cell wall / vacuolar inhibitor of...  48.9    5e-04   
ref|NP_001042864.1|  Os01g0311700                                     49.3    5e-04   
ref|NP_201267.1|  cell wall / vacuolar inhibitor of fructosidase 2    48.5    6e-04   
ref|NP_001154196.1|  plant invertase/pectin methylesterase inhibi...  48.5    6e-04   
ref|XP_011005060.1|  PREDICTED: putative invertase inhibitor          48.5    6e-04   
ref|XP_009776041.1|  PREDICTED: pectinesterase inhibitor-like         48.5    6e-04   
ref|XP_007048339.1|  Cell wall / vacuolar inhibitor of fructosida...  49.3    7e-04   
ref|XP_010058446.1|  PREDICTED: putative invertase inhibitor          48.5    8e-04   
ref|XP_004301715.1|  PREDICTED: putative invertase inhibitor-like     47.8    9e-04   
emb|CCC42229.1|  pectin methyl esterase inhibitor                     48.1    0.001   
ref|XP_010422738.1|  PREDICTED: pectinesterase inhibitor-like         47.8    0.001   



>gb|ABB17076.1| invertase inhibitor [Nicotiana langsdorffii x Nicotiana sanderae]
Length=165

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 122/170 (72%), Gaps = 7/170 (4%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAI  340
            M+NL+  MM LIL  +      ++LVE+TC+ TPNY+LC+K + SD R++  D ITTLA+
Sbjct  1    MKNLIFLMMFLILLQT----NANNLVETTCKNTPNYQLCLKTLLSDKRSETGD-ITTLAL  55

Query  339  IMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVP  166
            IMVDAIK+K+ + A+ I+ L+ +      K  L+ CAF YKVILTAS+PEA EALTKG P
Sbjct  56   IMVDAIKSKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDP  115

Query  165  KFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            KFAE G+V SSG +Q+CE  F+ ++SP +ALN  VH LSDV  AI++ LL
Sbjct  116  KFAEDGMVGSSGDAQECEEYFKGSKSPFSALNDAVHQLSDVGRAIVRNLL  165



>ref|XP_009779273.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana sylvestris]
Length=166

 Score =   176 bits (447),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 124/170 (73%), Gaps = 6/170 (4%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAI  340
            M+NL++ MMLL +    +    ++LVE+TC+ TPNY+LC+K + SD R++   DITTLA+
Sbjct  1    MKNLIVLMMLLTIL---LQTNANNLVETTCKNTPNYQLCLKTLLSDKRSE-TGDITTLAL  56

Query  339  IMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVP  166
            IMVDAIK+K+ + A+ I+ L+ +      K  L+ CAF YKVILTAS+PEA EALTKG P
Sbjct  57   IMVDAIKSKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDP  116

Query  165  KFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            KFAE G+V SSG +Q+CE  F+ ++SP +ALN  VH+LSDV  AI++ LL
Sbjct  117  KFAEDGMVGSSGDAQECEEYFKGSKSPFSALNVAVHELSDVGRAIVRNLL  166



>ref|XP_006349845.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Solanum tuberosum]
 gb|AAX63189.1| putative invertase inhibitor precursor [Solanum tuberosum]
Length=171

 Score =   174 bits (442),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 124/178 (70%), Gaps = 12/178 (7%)
 Frame = -3

Query  534  LKIKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDI  355
            +KI +   + LAM+L       + NG ++LVE+TC+ TPNY LCVK +S D R++ A DI
Sbjct  1    MKIFIFLMMFLAMLL-------VTNGNNNLVETTCKNTPNYNLCVKTLSLDKRSETAGDI  53

Query  354  TTLAIIMVDAIKAKSQETAIMINNLQKTR--EDLKTALEQCAFDYKVILTASIPEAYEAL  181
            TTLA+IMVDAIK+K+ + A  I+ L+ +   +  K  L+ CAF YKVILTAS+PEA EAL
Sbjct  54   TTLALIMVDAIKSKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILTASMPEAIEAL  113

Query  180  TKGVPKFAEKGVVASSGSSQQCELGFQK---AQSPLTALNTEVHDLSDVATAIIKILL  16
            TKG PKFAE G+V SSG +Q+CE  F+      SPL+ LN +VH+LSDV  AI++ LL
Sbjct  114  TKGDPKFAEDGMVGSSGDAQECEEYFKAITIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>ref|XP_009602450.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana tomentosiformis]
 emb|CAA73333.1| invertase inhibitor [Nicotiana tabacum]
Length=166

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 122/171 (71%), Gaps = 8/171 (5%)
 Frame = -3

Query  519  MRNLV-LAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLA  343
            M+NL+ L M L IL  +      ++LVE+TC+ TPNY+LC+K + SD R+    DITTLA
Sbjct  1    MKNLIFLTMFLTILLQT----NANNLVETTCKNTPNYQLCLKTLLSDKRS-ATGDITTLA  55

Query  342  IIMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGV  169
            +IMVDAIKAK+ + A+ I+ L+ +      K  L+ CAF YKVILTAS+PEA EALTKG 
Sbjct  56   LIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGD  115

Query  168  PKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            PKFAE G+V SSG +Q+CE  F+ ++SP +ALN  VH+LSDV  AI++ LL
Sbjct  116  PKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL  166



>ref|XP_006349844.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Solanum tuberosum]
Length=168

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 117/170 (69%), Gaps = 4/170 (2%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAI  340
            M+ L+  MM L L    + NG + LVE+TC+ TPNY+LCVK  S D R++ A DI TLA+
Sbjct  1    MKILIFLMMFLTLVL--VTNGINKLVETTCKNTPNYDLCVKTFSLDKRSETAGDIKTLAL  58

Query  339  IMVDAIKAKSQETAIMINNLQKTR--EDLKTALEQCAFDYKVILTASIPEAYEALTKGVP  166
            IMVDAIK+K+     +I+NL+ +   +     L++CAF YKVILT SIPEA EALTKG P
Sbjct  59   IMVDAIKSKANHAFSIISNLRHSSPPQAWIHPLKECAFSYKVILTVSIPEAIEALTKGDP  118

Query  165  KFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            KFAE  +V +SG +Q+CE  F+    PL+ LN +VHDLSD+  AII+ LL
Sbjct  119  KFAEDAMVGTSGDAQECEDNFKSKSPPLSKLNIDVHDLSDINRAIIRNLL  168



>gb|AFI47460.1| invertase inhibitor [Solanum tuberosum]
Length=171

 Score =   172 bits (436),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 121/173 (70%), Gaps = 7/173 (4%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAI  340
            M+ L+  MM L +    +  G ++LVE+TC+ TPNY LCV+ +S D R+Q A DITTLA+
Sbjct  1    MKILLFLMMFLAMLI--VTKGNNNLVETTCKNTPNYNLCVETLSLDKRSQTAGDITTLAL  58

Query  339  IMVDAIKAKSQETAIMINNLQKTR--EDLKTALEQCAFDYKVILTASIPEAYEALTKGVP  166
            IMVDAIK+K+ + A  I+ L+ +   +  K  L+ CAF YKVILTAS+PEA EALTKG P
Sbjct  59   IMVDAIKSKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILTASMPEAIEALTKGDP  118

Query  165  KFAEKGVVASSGSSQQCELGFQK---AQSPLTALNTEVHDLSDVATAIIKILL  16
            KFAE G+V SSG +Q+CE  F+      SPL+ LN +VH+LSDV  AI++ LL
Sbjct  119  KFAEDGMVGSSGDAQECEEYFKAITIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>gb|ADM49013.1| putative invertase inhibitor [Solanum tuberosum]
Length=168

 Score =   172 bits (435),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 116/170 (68%), Gaps = 4/170 (2%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAI  340
            M+  +  MM L L    + NG + LVE+TC+ TPNY+LCVK  S D R++ A DI TLA+
Sbjct  1    MKIFIFLMMFLTLVL--VTNGINKLVETTCKNTPNYDLCVKTFSLDKRSETAGDIKTLAL  58

Query  339  IMVDAIKAKSQETAIMINNLQK--TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVP  166
            IMVDAIK+K+     +I+NL+   T +     L++CAF YKVILT SIPEA EALTKG P
Sbjct  59   IMVDAIKSKANHAFSIISNLRHSSTPQAWIHPLKECAFSYKVILTVSIPEAIEALTKGDP  118

Query  165  KFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            KFAE  +V +SG +Q+CE  F+    PL+ LN +VHDLSD+  AI++ LL
Sbjct  119  KFAEDAMVGTSGDAQECEDNFKSKSPPLSKLNIDVHDLSDINRAIVRNLL  168



>gb|AFI47461.1| invertase inhibitor [Solanum tuberosum]
 gb|AFI47462.1| invertase inhibitor [Solanum tuberosum]
 gb|AIT42247.1| invertase inhibitor [Solanum tuberosum]
Length=171

 Score =   171 bits (434),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 123/178 (69%), Gaps = 12/178 (7%)
 Frame = -3

Query  534  LKIKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDI  355
            +KI +   + LAM+L       +  G ++LVE+TC+ TPNY LCVK +S D R++ A DI
Sbjct  1    MKILLFLMMFLAMLL-------VTKGKNNLVETTCKNTPNYNLCVKTLSLDKRSETAGDI  53

Query  354  TTLAIIMVDAIKAKSQETAIMINNLQKTR--EDLKTALEQCAFDYKVILTASIPEAYEAL  181
            TTLA+IMVDAIK+K+ + A  I+ L+ +   +  K  L+ CAF YKVILTAS+PEA EAL
Sbjct  54   TTLALIMVDAIKSKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILTASMPEAIEAL  113

Query  180  TKGVPKFAEKGVVASSGSSQQCELGFQK---AQSPLTALNTEVHDLSDVATAIIKILL  16
            TKG PKFAE G+V SSG +Q+CE  F+      SPL+ LN +VH+LSDV  AI++ LL
Sbjct  114  TKGDPKFAEDGMVGSSGDAQECEEYFKAITIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>pdb|2XQR|B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|D Chain D, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|F Chain F, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|H Chain H, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|J Chain J, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|L Chain L, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
Length=149

 Score =   171 bits (432),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  459  GGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNL  280
            G ++LVE+TC+ TPNY+LC+K + SD R+    DITTLA+IMVDAIKAK+ + A+ I+ L
Sbjct  1    GANNLVETTCKNTPNYQLCLKTLLSDKRS-ATGDITTLALIMVDAIKAKANQAAVTISKL  59

Query  279  QKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELG  106
            + +      K  L+ CAF YKVILTAS+PEA EALTKG PKFAE G+V SSG +Q+CE  
Sbjct  60   RHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEY  119

Query  105  FQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            F+ ++SP +ALN  VH+LSDV  AI++ LL
Sbjct  120  FKGSKSPFSALNIAVHELSDVGRAIVRNLL  149



>pdb|1RJ1|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco
 pdb|1RJ4|A Chain A, Structure Of A Cell Wall Invertase Inhibitor From Tobacco 
In Complex With Cd2+
 pdb|1RJ4|B Chain B, Structure Of A Cell Wall Invertase Inhibitor From Tobacco 
In Complex With Cd2+
 pdb|1RJ4|C Chain C, Structure Of A Cell Wall Invertase Inhibitor From Tobacco 
In Complex With Cd2+
 pdb|1RJ4|D Chain D, Structure Of A Cell Wall Invertase Inhibitor From Tobacco 
In Complex With Cd2+
Length=151

 Score =   171 bits (432),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 112/149 (75%), Gaps = 3/149 (2%)
 Frame = -3

Query  456  GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQ  277
            G++LVE+TC+ TPNY+LC+K + SD R+    DITTLA+IMVDAIKAK+ + A+ I+ L+
Sbjct  4    GNNLVETTCKNTPNYQLCLKTLLSDKRS-ATGDITTLALIMVDAIKAKANQAAVTISKLR  62

Query  276  KTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF  103
             +      K  L+ CAF YKVILTAS+PEA EALTKG PKFAE G+V SSG +Q+CE  F
Sbjct  63   HSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYF  122

Query  102  QKAQSPLTALNTEVHDLSDVATAIIKILL  16
            + ++SP +ALN  VH+LSDV  AI++ LL
Sbjct  123  KGSKSPFSALNIAVHELSDVGRAIVRNLL  151



>gb|AAX63190.1| putative invertase inhibitor precursor [Solanum tuberosum]
 gb|ADZ54774.1| invertase inhibitor 1 [Solanum tuberosum]
 gb|AFI47459.1| invertase inhibitor [Solanum tuberosum]
Length=171

 Score =   171 bits (433),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 120/173 (69%), Gaps = 7/173 (4%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAI  340
            M+ L+  MM L +    +  G ++LVE+TC+ TPNY LCVK +S D R++ A DITTLA+
Sbjct  1    MKILLFLMMFLAMLI--VTKGNNNLVETTCKNTPNYNLCVKTLSLDKRSETAGDITTLAL  58

Query  339  IMVDAIKAKSQETAIMINNLQKTR--EDLKTALEQCAFDYKVILTASIPEAYEALTKGVP  166
            IMVDAIK K+ + A  I+ L+ +   +  K  L+ CAF YKVILTAS+PEA EALTKG P
Sbjct  59   IMVDAIKYKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILTASMPEATEALTKGDP  118

Query  165  KFAEKGVVASSGSSQQCELGFQK---AQSPLTALNTEVHDLSDVATAIIKILL  16
            KFAE G+V SSG +Q+CE  F+      SPL+ LN +VH+LSDV  AI++ LL
Sbjct  119  KFAEDGMVGSSGDAQECEEYFKAITIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>gb|ADM49012.1| putative invertase inhibitor [Solanum tuberosum]
 gb|ADM49014.1| putative invertase inhibitor [Solanum tuberosum]
Length=171

 Score =   171 bits (433),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 119/173 (69%), Gaps = 7/173 (4%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAI  340
            M+  +  MM L +    +  G ++LVE+TC+ TPNY LCVK +S D R++ A DITTLA+
Sbjct  1    MKIFIFLMMFLAMLI--VTKGNNNLVETTCKNTPNYNLCVKTLSLDKRSETAGDITTLAL  58

Query  339  IMVDAIKAKSQETAIMINNLQKTR--EDLKTALEQCAFDYKVILTASIPEAYEALTKGVP  166
            IMVDAIK K+ + A  I+ L+ +   +  K  L+ CAF YKVILTAS+PEA EALTKG P
Sbjct  59   IMVDAIKYKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILTASMPEATEALTKGDP  118

Query  165  KFAEKGVVASSGSSQQCELGFQK---AQSPLTALNTEVHDLSDVATAIIKILL  16
            KFAE G+V SSG +Q+CE  F+      SPL+ LN +VH+LSDV  AI++ LL
Sbjct  119  KFAEDGMVGSSGDAQECEEYFKAITIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>gb|AFI47463.1| invertase inhibitor [Solanum tuberosum]
Length=171

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 123/178 (69%), Gaps = 12/178 (7%)
 Frame = -3

Query  534  LKIKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDI  355
            +KI +   + LAM+L       +  G ++LVE+TC+ TPNY LCV+ +S D R++ A DI
Sbjct  1    MKILLFLMMFLAMLL-------VTKGKNNLVETTCKNTPNYNLCVRTLSLDKRSETAGDI  53

Query  354  TTLAIIMVDAIKAKSQETAIMINNLQKTR--EDLKTALEQCAFDYKVILTASIPEAYEAL  181
            TTLA+IMVDAIK+K+ + A  I+ L+ +   +  K  L+ CAF YKVILTAS+PEA EAL
Sbjct  54   TTLALIMVDAIKSKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILTASMPEAIEAL  113

Query  180  TKGVPKFAEKGVVASSGSSQQCELGFQK---AQSPLTALNTEVHDLSDVATAIIKILL  16
            TKG PKFAE G+V SSG +Q+CE  F+      SPL+ LN +VH+LSDV  AI++ LL
Sbjct  114  TKGDPKFAEDGMVGSSGDAQECEEYFKAITIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>ref|NP_001234791.1| tomato invertase inhibitor precursor [Solanum lycopersicum]
 emb|CAA09420.1| tomato invertase inhibitor [Solanum lycopersicum]
Length=171

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 119/169 (70%), Gaps = 5/169 (3%)
 Frame = -3

Query  507  VLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVD  328
            +L  +++ L    + +G ++LVE+TC+ TPNY LCVK +S D R++ A DITTLA+IMVD
Sbjct  3    ILIFLIMFLAMLLVTSGNNNLVETTCKNTPNYNLCVKTLSLDKRSEKAGDITTLALIMVD  62

Query  327  AIKAKSQETAIMINNLQKTR--EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAE  154
            AIK+K+ + A  I+ L+ +   +  K  L+ CAF YKVIL AS+PEA EALTKG PKFAE
Sbjct  63   AIKSKANQAANTISKLRHSNPPQAWKDPLKNCAFSYKVILPASMPEALEALTKGDPKFAE  122

Query  153  KGVVASSGSSQQCELGFQKA---QSPLTALNTEVHDLSDVATAIIKILL  16
             G+V SSG +Q+CE  F+      SPL+ LN +VH+LSDV  AI++ LL
Sbjct  123  DGMVGSSGDAQECEEYFKATTIKYSPLSKLNIDVHELSDVGRAIVRNLL  171



>pdb|2CJ4|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco At Ph 4.6
 pdb|2CJ4|B Chain B, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco At Ph 4.6
 pdb|2CJ5|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco (Ph 5.0)
 pdb|2CJ6|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco (Ph 7.5)
 pdb|2CJ7|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco (ph 9.0)
 pdb|2CJ8|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco (Ph 9.5)
 pdb|2CJ8|B Chain B, Crystal Structure Of A Cell Wall Invertase Inhibitor 
From Tobacco (Ph 9.5)
Length=150

 Score =   168 bits (425),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 111/148 (75%), Gaps = 3/148 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++LVE+TC+ TPNY+LC+K + SD R+    DITTLA+IMVDAIKAK+ + A+ I+ L+ 
Sbjct  4    NNLVETTCKNTPNYQLCLKTLLSDKRS-ATGDITTLALIMVDAIKAKANQAAVTISKLRH  62

Query  273  TRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ  100
            +      K  L+ CAF YKVILTAS+PEA EALTKG PKFAE G+V SSG +Q+CE  F+
Sbjct  63   SNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFK  122

Query  99   KAQSPLTALNTEVHDLSDVATAIIKILL  16
             ++SP +ALN  VH+LSDV  AI++ LL
Sbjct  123  GSKSPFSALNIAVHELSDVGRAIVRNLL  150



>ref|XP_004252930.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Solanum lycopersicum]
Length=168

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 117/170 (69%), Gaps = 4/170 (2%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAI  340
            M+ L+  MM   L    + NG ++LVE+TC+ TPNY+LCVK  S D R++ A DI TLA+
Sbjct  1    MKILIFLMMFFTLVL--VTNGINNLVETTCKNTPNYDLCVKTFSLDKRSEKAGDIKTLAL  58

Query  339  IMVDAIKAKSQETAIMINNLQKTR--EDLKTALEQCAFDYKVILTASIPEAYEALTKGVP  166
            IMVDAIK+K+ +   +I+ L+ +   +     L++CAF YKVILTASIPEA EALTKG P
Sbjct  59   IMVDAIKSKANQAFSIISKLRHSNPPQAWIHPLKECAFSYKVILTASIPEAIEALTKGNP  118

Query  165  KFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            KFAE  +V +SG +Q+CE  F+     LT LN +VH+LSD+  AII+ LL
Sbjct  119  KFAEDAMVGTSGDAQECENNFKSKSLQLTKLNIDVHNLSDINRAIIRNLL  168



>ref|XP_009604073.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana tomentosiformis]
Length=169

 Score =   160 bits (406),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 118/173 (68%), Gaps = 9/173 (5%)
 Frame = -3

Query  522  MMRNLV-LAMML-LILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITT  349
            MM+ LV +A+ L L+L TS       +LV++TC+ TPN +LC+K + +DPR+   D + T
Sbjct  1    MMKTLVYVALFLSLVLQTS----ADKNLVQNTCKNTPNVQLCLKTLLADPRSANGD-VNT  55

Query  348  LAIIMVDAIKAKSQETAIMINNLQKTREDLK--TALEQCAFDYKVILTASIPEAYEALTK  175
            LA+I+VDAIK ++ + A  I+ LQ++         L+ CAF YKVILTAS+PEA EALTK
Sbjct  56   LALIIVDAIKVQATQAAATISKLQQSNPPAAWIVPLKNCAFSYKVILTASMPEATEALTK  115

Query  174  GVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            G PKFAE  VV SSG + QCE  F    SPLTALNT V +LSDVA AII+ LL
Sbjct  116  GDPKFAEDAVVGSSGDADQCEKNFGGNNSPLTALNTAVRELSDVARAIIRTLL  168



>ref|XP_009589300.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana tomentosiformis]
Length=169

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++LVE+TC+ TPNY LC+K + SD R+  + DITTLA+I+VDAIKAK+ + A +I+ L++
Sbjct  23   NNLVETTCKNTPNYNLCLKTLLSDKRS-ASGDITTLALIVVDAIKAKANQAAKIISKLRQ  81

Query  273  TRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ  100
            +      +  L++C F YKVILT S+PEA EALTKG PKFAE G+V   G SQ CE  F+
Sbjct  82   SNPPAAWRVPLKKCGFSYKVILTVSLPEAIEALTKGNPKFAEDGMVGCFGDSQDCEENFK  141

Query  99   KAQSPLTALNTEVHDLSDVATAIIKILL  16
             + SPL+ LNT VH+LS V  AII+ LL
Sbjct  142  SSFSPLSGLNTAVHELSVVGRAIIRNLL  169



>ref|XP_009780950.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
isoform X1 [Nicotiana sylvestris]
Length=169

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 105/148 (71%), Gaps = 3/148 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++LVE+TC+ TPNY LC+K + SD R+ G D ITTLA+I+VDAIK K+ + A  I+ L++
Sbjct  23   NNLVETTCKNTPNYNLCLKTLLSDKRSAGGD-ITTLALIVVDAIKVKANQAAEFISKLRQ  81

Query  273  TRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ  100
            +      +  L++CAF YKVILT S+PEA EALTKG PKFAE G+V   G SQ CE  F+
Sbjct  82   SNPPTAWRVPLKKCAFSYKVILTVSLPEAVEALTKGNPKFAEDGMVVCFGDSQDCEENFK  141

Query  99   KAQSPLTALNTEVHDLSDVATAIIKILL  16
             + SPLT LNT V +LS V  AII+ LL
Sbjct  142  SSFSPLTGLNTAVLELSVVGRAIIRNLL  169



>ref|XP_009779928.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana sylvestris]
Length=171

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 117/176 (66%), Gaps = 9/176 (5%)
 Frame = -3

Query  522  MMRNLV-LAMML-LILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITT  349
            MM+ LV LA+ L L+L TS       +LV++TC+ TPN +LC+K + +DPR+   D + T
Sbjct  1    MMKKLVYLALFLTLVLQTS----ADKNLVQNTCKNTPNVQLCLKTLLADPRSANGD-VHT  55

Query  348  LAIIMVDAIKAKSQETAIMINNLQKTREDLK--TALEQCAFDYKVILTASIPEAYEALTK  175
            +A+I+VDAIK ++ +    I+ LQ++         L+ CAF YKV LT S+PEA EALTK
Sbjct  56   MALIIVDAIKVQATQATATISKLQQSNPPAAWIVPLKNCAFSYKVTLTTSVPEAIEALTK  115

Query  174  GVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL*LK  7
            G PKFAE  +V S G + QCE  F    SPLTALNT +H+LSDVA AII+ LL L+
Sbjct  116  GNPKFAEDAIVGSFGDADQCEKIFGGNNSPLTALNTVMHELSDVARAIIRTLLLLQ  171



>ref|XP_010500306.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
Length=159

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            +++ TC++TP+++LCV +++SDPR   AD I+ LA+I++D IK  + +T   IN L K R
Sbjct  18   MIDQTCKQTPDFKLCVSLLNSDPRGSSAD-ISGLALILIDKIKVLATKTLTEINGLYKKR  76

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             +LK AL+QC+  YK IL A +PEA EA++KGVPKF E GV+ +   +  CE GFQ  +S
Sbjct  77   PELKQALDQCSRRYKTILNADVPEAIEAISKGVPKFGEDGVIDAGVEASVCEEGFQ-GKS  135

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT+L   + ++S V  A++++LL
Sbjct  136  PLTSLTKSMQNISSVTRAVVRMLL  159



>ref|XP_010479199.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
Length=159

 Score =   138 bits (347),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 100/144 (69%), Gaps = 2/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            +++ TC++TP++ LCV +++SDPR   AD I+ LA+I++D IK  + +T   IN L K R
Sbjct  18   MIDQTCKQTPDFNLCVSLLNSDPRGSSAD-ISGLALILIDKIKVLATKTLNEINGLYKKR  76

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             +LK AL+QC+  YK IL A +PEA EA++KGVPKF E GV+ +   +  CE GFQ  +S
Sbjct  77   PELKQALDQCSRRYKTILNADVPEAIEAISKGVPKFGEDGVIDAGVEASVCEEGFQ-GKS  135

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT+L   + ++S V  A++++LL
Sbjct  136  PLTSLTKSMQNISSVTRAVVRMLL  159



>ref|XP_010549010.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Tarenaya 
hassleriana]
Length=169

 Score =   138 bits (347),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 93/144 (65%), Gaps = 2/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
             +E TC++TPNY LCV ++ SDPR   AD  T LA+I+VD IKA + ET   I+ L K R
Sbjct  28   FIEKTCKQTPNYNLCVSLLKSDPRGSSAD-TTGLALILVDHIKATATETLKKISRLYKKR  86

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             +L+  L  C   YK IL A +P A EAL+KGVPK+AE  VV +   +  CE GF   +S
Sbjct  87   RELREPLVSCTSKYKAILEADVPSAVEALSKGVPKYAEDAVVDAGVEASICERGFH-GKS  145

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLTAL   + D+SDVA  I+++LL
Sbjct  146  PLTALTKSLEDISDVARPIVRMLL  169



>ref|XP_010461598.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
Length=159

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 100/144 (69%), Gaps = 2/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            +++ TC++TP+++LCV +++SDPR   AD  + LA+I++D IK  + +T   IN L K R
Sbjct  18   MIDQTCKQTPDFKLCVSLLNSDPRGSSAD-TSGLALILIDKIKVLATKTLTEINGLYKKR  76

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             +LK AL+QC+  YK IL A +PEA EA++KGVPKF E GV+ +   +  CE GFQ  +S
Sbjct  77   PELKQALDQCSRRYKTILNADVPEAIEAISKGVPKFGEDGVMDAGVEASACEEGFQ-GKS  135

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT+L   + ++S V  A++++LL
Sbjct  136  PLTSLTKSMQNISSVTRAVVRMLL  159



>ref|XP_002894085.1| hypothetical protein ARALYDRAFT_891603 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70344.1| hypothetical protein ARALYDRAFT_891603 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 98/144 (68%), Gaps = 2/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            ++E TC+ TP++ LCV +++SDPR   AD  + LA+I++D IK  + +T   IN L K R
Sbjct  11   IIEQTCKETPDFNLCVSLLNSDPRGSSAD-TSGLALILIDKIKGLTTKTLNEINGLYKKR  69

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             +LK AL++C+  YK IL A +PEA EA++KGVPKF E GV+ +   +  CE GF K +S
Sbjct  70   PELKRALDECSRRYKTILNADVPEAIEAISKGVPKFGEDGVIDAGVEASVCEGGF-KGKS  128

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT+L   +  +S+V  AI+++LL
Sbjct  129  PLTSLTKSMQKISNVTRAIVRMLL  152



>ref|XP_002519258.1| Pectinesterase inhibitor, putative [Ricinus communis]
 gb|EEF43122.1| Pectinesterase inhibitor, putative [Ricinus communis]
Length=178

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 98/161 (61%), Gaps = 2/161 (1%)
 Frame = -3

Query  498  MMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIK  319
            ++ L+LT S  +   + L+ + C++TPNY LCV  ++SDPR+  AD  T LA+IMVD IK
Sbjct  20   IIFLLLTQSSFVQSDASLISNICKQTPNYNLCVTSLNSDPRSAKAD-TTGLALIMVDIIK  78

Query  318  AKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVA  139
            A++  +   I +       LK  L  CA  Y  ILT  IPEAYEAL KGVPKFA+     
Sbjct  79   ARATASLNFIRHQYHKSPRLKKQLTSCAHGYDAILTLDIPEAYEALQKGVPKFAQDAAND  138

Query  138  SSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            ++  +  CE GF    SP+  LN  VHD S VA+A+I++LL
Sbjct  139  AAVEANSCEGGFH-GNSPMKKLNVLVHDTSAVASAVIRLLL  178



>ref|XP_006303367.1| hypothetical protein CARUB_v10010500mg [Capsella rubella]
 gb|EOA36265.1| hypothetical protein CARUB_v10010500mg [Capsella rubella]
Length=164

 Score =   135 bits (339),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 98/144 (68%), Gaps = 2/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            +++ TC+ TP++ LCV +++SDPR   AD  + LA+I++D IK  + +T   IN L K R
Sbjct  23   MIDQTCKETPDFNLCVSLLNSDPRGSSAD-TSGLALILIDKIKGLATKTLNEINGLYKKR  81

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             +LK AL+QC+  YK I+ A +PEA EA++KGVPKF E GV+ +   +  CE GF K +S
Sbjct  82   PELKRALDQCSRRYKTIIKADVPEAIEAISKGVPKFGEDGVIDAGVEASVCEEGF-KGKS  140

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT+L   +  +S+V  AI+++LL
Sbjct  141  PLTSLTKSMQKISNVTRAIVRMLL  164



>ref|XP_002273484.2| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Vitis 
vinifera]
Length=169

 Score =   135 bits (339),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 107/170 (63%), Gaps = 5/170 (3%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAI  340
            MR+ V  + ++ L+ + I    +DLV+ TC++TPNY+LCVK + +DPR+  A D+T LA+
Sbjct  1    MRSSVFLLCVVSLSLTQIQFSRADLVDQTCKQTPNYDLCVKTLRADPRSSTA-DVTGLAL  59

Query  339  IMVDAIKAKSQETAIMINNLQKTREDLKT--ALEQCAFDY-KVILTASIPEAYEALTKGV  169
            + VDAIKAK+  T   IN L  T  D KT  AL  C   Y   +L A IP A EAL KG 
Sbjct  60   VTVDAIKAKATATLDRINGLLGTTPDPKTKAALSHCGELYDNAVLKADIPSAIEALKKGN  119

Query  168  PKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKIL  19
            PKFAE+GV  ++  +  CE  F  A SP+T+ N  V DLS VA+AII +L
Sbjct  120  PKFAEQGVNDAANEADSCERAFGGA-SPITSFNRSVSDLSRVASAIIGLL  168



>ref|XP_006393505.1| hypothetical protein EUTSA_v10011825mg [Eutrema salsugineum]
 gb|ESQ30791.1| hypothetical protein EUTSA_v10011825mg [Eutrema salsugineum]
Length=170

 Score =   135 bits (339),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 103/159 (65%), Gaps = 8/159 (5%)
 Frame = -3

Query  492  LLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAK  313
            ++++ + P      +++E TC+ TP++ LCV ++ SDPR   AD  + LA+I+VD IK  
Sbjct  20   MMVMVSEP------NMIEQTCKETPDFNLCVSLLDSDPRGSSAD-TSGLALILVDKIKGL  72

Query  312  SQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASS  133
            + +T   IN L K R +LK AL++C+  YK IL A +PEA EA++KGVPKF E GV+ + 
Sbjct  73   ATKTLNEINGLYKRRPELKHALDECSRRYKTILNADVPEAIEAISKGVPKFGEDGVIDAG  132

Query  132  GSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
              +  CE GF   +SPLT L   +  +S+VA AI+++LL
Sbjct  133  VEASVCERGFI-GKSPLTNLTKSMQRISNVARAIVRMLL  170



>gb|KFK26435.1| hypothetical protein AALP_AA8G248000 [Arabis alpina]
Length=159

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 98/146 (67%), Gaps = 2/146 (1%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            S +++ TC+ TP++ LCV +++SDPR   AD  + LA+I+VD IK  + +T   IN L K
Sbjct  16   SSMIDQTCKETPDFNLCVSLLNSDPRGSSAD-TSGLALILVDKIKVLATKTLHEINGLYK  74

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
             R +LK AL +C+  YK IL A +PEA EA++KGVPKF E GV+ +   +  CE GF K 
Sbjct  75   KRPELKQALGECSRRYKTILNADVPEAIEAISKGVPKFGEDGVIDAGVEASVCEEGF-KG  133

Query  93   QSPLTALNTEVHDLSDVATAIIKILL  16
            +SPLT+L   +  +S+V  AI+++LL
Sbjct  134  KSPLTSLTKSMQKISNVTRAIVRMLL  159



>gb|EYU19077.1| hypothetical protein MIMGU_mgv1a015091mg [Erythranthe guttata]
Length=168

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 97/145 (67%), Gaps = 2/145 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+ESTCR TPNY+LC+ ++ + P + G  D+  L +I+VDAIKAK++   + I+ +++  
Sbjct  25   LIESTCRNTPNYQLCISILRASPHS-GTADMAGLGLILVDAIKAKTEAALLAIDEVKQLH  83

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK-AQ  91
             +L  ALE+C   Y  +L A IPEA   L KGVPKFAE G+V ++  +  CE  F   AQ
Sbjct  84   PELTQALEECRRTYNAVLKADIPEAVAGLKKGVPKFAESGMVDTAWEADICEGSFGSVAQ  143

Query  90   SPLTALNTEVHDLSDVATAIIKILL  16
             PL+ +N ++HDL++VA ++I+ LL
Sbjct  144  PPLSGVNKDLHDLAEVAASVIRNLL  168



>emb|CDO98741.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            +DL+E+TCR TP+Y+LC   + SDPR+  AD    L +I+VDA+K K+      IN L+ 
Sbjct  41   NDLIENTCRNTPDYQLCFSTLLSDPRSFDAD-TYGLGLIIVDALKDKATSAVNAINRLKG  99

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
            +  +    L +C+  Y  IL A IPEA E L KGVPKFAE G+  ++   Q CE  F+++
Sbjct  100  SNPEFIRPLIKCSISYNAILKADIPEAIEGLRKGVPKFAEYGMADTAVEVQGCENSFKQS  159

Query  93   QSPLTALNTEVHDLSDVATAIIKILL  16
             SPLT LN +V+DLS VA +II++LL
Sbjct  160  NSPLTDLNKQVYDLSIVAKSIIRMLL  185



>gb|AAG51534.1|AC051631_14 hypothetical protein; 80318-81409 [Arabidopsis thaliana]
 gb|AAL06571.1|AF412119_1 At1g47960/T2J15_13 [Arabidopsis thaliana]
 gb|AAL07005.1| At1g47960/T2J15_13 [Arabidopsis thaliana]
 gb|AAL90926.1| At1g47960/T2J15_13 [Arabidopsis thaliana]
 gb|AAM60881.1| unknown [Arabidopsis thaliana]
Length=166

 Score =   132 bits (332),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            ++E TC+ TP++ LCV +++SDPR   AD  + LA+I++D IK  + +T   IN L K R
Sbjct  25   IIEPTCKETPDFNLCVSLLNSDPRGSSAD-TSGLALILIDKIKGLATKTLNEINGLYKKR  83

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             +LK AL++C+  YK IL A +PEA EA++KGVPKF E GV+ +   +  C+ GF    S
Sbjct  84   PELKRALDECSRRYKTILNADVPEAIEAISKGVPKFGEDGVIDAGVEASVCQGGFN-GSS  142

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT+L   +  +S+V  AI+++LL
Sbjct  143  PLTSLTKSMQKISNVTRAIVRMLL  166



>ref|XP_009148010.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Brassica 
rapa]
Length=162

 Score =   132 bits (332),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 99/146 (68%), Gaps = 2/146 (1%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++++E TC+ TP++ LCV ++ SDPR   AD  + LA+I+VD IK  + +T   IN+L K
Sbjct  19   ANMIEQTCKETPDFNLCVSLLDSDPRGSSAD-TSGLALILVDKIKGLATKTLKEINSLYK  77

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
             R +LK AL++C+  Y  IL A +PEA EA++KGVPKF E GV+ +   +  CE  F K 
Sbjct  78   KRPELKQALDECSRRYNTILKADVPEAIEAISKGVPKFGEDGVIDAGVEAAVCEGEF-KG  136

Query  93   QSPLTALNTEVHDLSDVATAIIKILL  16
            +SPLT+L   +  +S+VA AI+++LL
Sbjct  137  KSPLTSLTKSMQKVSNVARAIVRMLL  162



>emb|CDY20929.1| BnaC06g01490D [Brassica napus]
Length=163

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 97/144 (67%), Gaps = 2/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            ++E TC+ TP++ LCV ++ SDPR   AD  + LA+I+VD IK  + +T   IN+L K R
Sbjct  22   MIEQTCKETPDFNLCVSLLDSDPRGSSAD-TSGLALILVDKIKGLATKTLKEINSLYKKR  80

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             +LK AL++C+  YK IL A +PEA EA++KGVPKF E GV+ +   +  CE  F K +S
Sbjct  81   PELKQALDECSRRYKTILKADVPEAIEAISKGVPKFGEDGVIDAGVEAAVCEGEF-KGKS  139

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT+L   +  +S+V  AI+++LL
Sbjct  140  PLTSLTKSMQKVSNVTRAIVRMLL  163



>emb|CDX93634.1| BnaA06g04140D [Brassica napus]
Length=160

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            ++E TC+ TP++ LCV ++ SDPR   AD  + LA+I+VD IK  + +T   IN L K R
Sbjct  19   MIEQTCKETPDFNLCVSLLDSDPRGSSAD-TSGLALILVDKIKGLATKTLKEINTLYKKR  77

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             +LK AL++C+  Y  IL A +PEA EA++KGVPKF E GV+ +   +  CE  F K +S
Sbjct  78   PELKQALDECSRRYNTILKADVPEAIEAISKGVPKFGEDGVIDAGVEAAVCEGEF-KGKS  136

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT+L   +  +S+VA AI+++LL
Sbjct  137  PLTSLTKSMQKVSNVARAIVRMLL  160



>ref|XP_002314521.1| hypothetical protein POPTR_0010s07350g [Populus trichocarpa]
 gb|EEF00692.1| hypothetical protein POPTR_0010s07350g [Populus trichocarpa]
Length=178

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 101/171 (59%), Gaps = 2/171 (1%)
 Frame = -3

Query  528  IKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITT  349
            I +  +L  A +LL    + + +  +DL+  TC+ TP Y LCV  + S P++ GAD +  
Sbjct  10   IFLSPSLFTATLLLTSQCTIVQSAANDLIAQTCKHTPYYNLCVTSLKSVPKSSGAD-VQG  68

Query  348  LAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGV  169
            LA+IMVD ++AK+      IN   K    L+  L  CA  Y  ILTA IPEA EAL KG 
Sbjct  69   LALIMVDIVRAKASTALRFINQELKRSPGLRRPLRFCASCYDAILTADIPEAIEALQKGD  128

Query  168  PKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            PKFAE G   ++  +  CE GF   +SPLT LN EVHD S VA+AI ++LL
Sbjct  129  PKFAENGTNDAAVEATSCEDGFH-GKSPLTNLNREVHDTSVVASAITRLLL  178



>gb|AGC75063.1| vacuolar invertase inhibitor [Solanum lycopersicum]
Length=175

 Score =   130 bits (327),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 108/175 (62%), Gaps = 7/175 (4%)
 Frame = -3

Query  519  MRNLVLAMMLLI-LTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPR---AQGADDIT  352
            MRNL   +MLL  L+     N  ++++ +TCR TP Y LC+ V+ SDPR   A+G+DDIT
Sbjct  1    MRNLFPILMLLTNLSLHIDNNNNNNIIRATCRETPYYSLCLSVLESDPRSYKAEGSDDIT  60

Query  351  TLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKG  172
            TL +IMVDA+K+KS E    +  L+K+  + +  L QC   Y  +L A +  A EAL +G
Sbjct  61   TLGLIMVDAVKSKSIEIMKKLKELEKSNPEWRVPLNQCYMVYNTVLRADVTVAVEALKRG  120

Query  171  VPKFAEKGVVASSGSSQQCELGF---QKAQSPLTALNTEVHDLSDVATAIIKILL  16
            VPKFAE G+      +Q CE  F    K+  P++ ++ ++ +LS VA +II++LL
Sbjct  121  VPKFAEDGMDDVVVEAQTCEFSFNYYNKSDFPISNMSKDIVELSKVAKSIIRMLL  175



>ref|XP_002279756.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Vitis vinifera]
Length=169

 Score =   130 bits (326),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 106/171 (62%), Gaps = 5/171 (3%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAI  340
            MR+ V  + ++ L+ + I    +DLV+ TCR+TPNY+LCV+ + SDPR+  A D+  LA+
Sbjct  1    MRSSVFLLCVVGLSLTQIQFSSADLVKQTCRQTPNYDLCVQTLRSDPRSSHA-DVAGLAM  59

Query  339  IMVDAIKAKSQETAIMINNLQKTREDLKT--ALEQCAFDY-KVILTASIPEAYEALTKGV  169
            +MVD IKAKS  T   I+ L  T    KT   L +CA  Y   +L A IP A EAL  G 
Sbjct  60   VMVDMIKAKSIATLHRISELLGTAPHPKTKATLRRCAELYDNAVLKADIPSAMEALKTGN  119

Query  168  PKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            PKFAE+G   ++  +  CE  F  A SP+T+ N  V DLS VA+AII++LL
Sbjct  120  PKFAEQGANDAANEADSCERAFSGA-SPITSFNRSVSDLSRVASAIIRLLL  169



>ref|XP_011096732.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Sesamum indicum]
Length=169

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 99/145 (68%), Gaps = 2/145 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E+TCR T N++LC+  + ++P +  AD +  LA+I+VDA+KAK++     I  L+   
Sbjct  26   LIETTCRSTSNFQLCLSTLLANPLSATAD-VAELALIIVDAVKAKTETALSGIEELKWLH  84

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK-AQ  91
             +L  AL QC+  YK +L A +PEA  ALT+GVPKFAE G+V ++  ++ CE  F++ A+
Sbjct  85   PELTDALGQCSNSYKAVLKADVPEAVAALTRGVPKFAEFGMVDAAWEAEICEGSFERVAE  144

Query  90   SPLTALNTEVHDLSDVATAIIKILL  16
            SPL+ LN ++HDL+ VA  IIK LL
Sbjct  145  SPLSELNRDIHDLAVVAAGIIKNLL  169



>ref|XP_004252929.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Solanum lycopersicum]
Length=175

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 109/175 (62%), Gaps = 7/175 (4%)
 Frame = -3

Query  519  MRNLVLAMMLLI-LTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPR---AQGADDIT  352
            MRNL   +MLL  L+ +   N  ++++ +TCR TP Y LC+ V+ SDPR   A+G+DDIT
Sbjct  1    MRNLFPILMLLTNLSLNIDNNNNNNIIRATCRETPYYSLCLSVLESDPRSYKAEGSDDIT  60

Query  351  TLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKG  172
            TL +IMVDA+K+KS E    +  L+K+  + +  L QC   Y  +L A +  A EAL +G
Sbjct  61   TLGLIMVDAVKSKSIEIMKKLKELEKSNPEWRVPLNQCYMVYNTVLRADVTVAVEALKRG  120

Query  171  VPKFAEKGVVASSGSSQQCELGF---QKAQSPLTALNTEVHDLSDVATAIIKILL  16
            VPKFAE G+      +Q CE  F    K+  P++ ++ ++ +LS VA +II++LL
Sbjct  121  VPKFAEDGMDDVVVEAQTCEFSFNYYNKSDFPISNMSKDIVELSKVAKSIIRMLL  175



>gb|AGC94752.1| putative pectinesterase inhibitor [Euphorbia lathyris]
Length=172

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 99/160 (62%), Gaps = 1/160 (1%)
 Frame = -3

Query  495  MLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKA  316
            ++LILT    +      +  TC++TP Y LC+  +++DPR+  AD +  LA+IMVD +K 
Sbjct  14   IILILTQFKTVQSNPQTISQTCKQTPYYNLCLNHLTADPRSSTAD-VKGLALIMVDLLKG  72

Query  315  KSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVAS  136
            K+  +A  I  +   R DL+  L++CA  Y VILTA+IP A EAL KG PKFAE G+  +
Sbjct  73   KTTRSAQFIKQITGKRPDLQKLLKECARKYDVILTANIPVAIEALEKGDPKFAEGGMNDA  132

Query  135  SGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            +     CE  F+  +SPL++ N  +HD S VA+AI + LL
Sbjct  133  AIEVNSCESSFRGTKSPLSSYNKLLHDTSLVASAIARQLL  172



>ref|XP_009763718.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana sylvestris]
Length=172

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 105/173 (61%), Gaps = 6/173 (3%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPR---AQGADDITT  349
            MRNL    ML+        N  ++L+ STCR TPNY LC+  + SDPR   A+GAD +TT
Sbjct  1    MRNLFPIFMLITNLAFNNDNNNNNLINSTCRATPNYPLCLTTLQSDPRTSEAEGAD-LTT  59

Query  348  LAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGV  169
            L ++MVDA+K KS E       L+K+  +L+  L QC   Y  +L A +  A EAL +GV
Sbjct  60   LGLVMVDAVKLKSIEIMENFKKLEKSNPELRLPLSQCYIVYYAVLHADVTVAVEALKRGV  119

Query  168  PKFAEKGVVASSGSSQQCELGFQKAQ--SPLTALNTEVHDLSDVATAIIKILL  16
            PKFAE G+V  +  ++ CE  F+     SP++ +N E+ +LS VA +II++LL
Sbjct  120  PKFAENGMVDVAVEAETCEFSFKYNGLVSPVSDVNREIIELSSVAKSIIRMLL  172



>ref|XP_003609812.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES92009.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=173

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 103/172 (60%), Gaps = 6/172 (3%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPII----NGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDIT  352
            M  L LA++L  + +S  I       ++L++ TC++TPNY  C+  + SDPR+  AD +T
Sbjct  4    MNPLALAIILCTMVSSHCIIIHPKSNANLIQQTCKQTPNYANCIHYLKSDPRSSDAD-VT  62

Query  351  TLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKG  172
             LA+IMVD IK+K+      IN L K   D K AL  CA  Y+ IL A +P++  AL +G
Sbjct  63   GLALIMVDIIKSKANTALNKINQLIKGSHDQKEALNSCAGRYRAILVADVPKSVAALKQG  122

Query  171  VPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
             PKFAE G    +  +  CE GF K +SP++  N ++HD++ +  AI+K LL
Sbjct  123  DPKFAEDGANDVAIEATTCENGF-KGKSPISDENIDMHDVAVITAAIVKQLL  173



>ref|NP_564516.2| cell wall / vacuolar inhibitor of fructosidase 1 [Arabidopsis 
thaliana]
 sp|F4HWQ8.1|CVIF1_ARATH RecName: Full=Cell wall / vacuolar inhibitor of fructosidase 
1; Short=AtC/VIF1; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE32232.1| cell wall / vacuolar inhibitor of fructosidase 1 [Arabidopsis 
thaliana]
Length=205

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 91/140 (65%), Gaps = 2/140 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            ++E TC+ TP++ LCV +++SDPR   AD  + LA+I++D IK  + +T   IN L K R
Sbjct  25   IIEPTCKETPDFNLCVSLLNSDPRGSSAD-TSGLALILIDKIKGLATKTLNEINGLYKKR  83

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             +LK AL++C+  YK IL A +PEA EA++KGVPKF E GV+ +   +  C+ GF    S
Sbjct  84   PELKRALDECSRRYKTILNADVPEAIEAISKGVPKFGEDGVIDAGVEASVCQGGFN-GSS  142

Query  87   PLTALNTEVHDLSDVATAII  28
            PLT+L   +  +S+V  AI 
Sbjct  143  PLTSLTKSMQKISNVTRAIF  162



>ref|XP_002279801.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Vitis 
vinifera]
 emb|CAN79656.1| hypothetical protein VITISV_014506 [Vitis vinifera]
Length=169

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 105/171 (61%), Gaps = 5/171 (3%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAI  340
            MR+ V  + ++ L+ + I    SDLV+ TC+ TPNY+LCVK + SDPR+  A D+  LA+
Sbjct  1    MRSSVFLLCVMGLSLTQIEFSTSDLVKQTCKHTPNYDLCVKTLLSDPRSSHA-DVAGLAM  59

Query  339  IMVDAIKAKSQETAIMINNLQKTREDLKT--ALEQCAFDY-KVILTASIPEAYEALTKGV  169
            +MVD IKAK+  T   I+ L  T    KT  AL +C   Y   +L A +P A +AL  GV
Sbjct  60   VMVDVIKAKTIATLHRISELLGTTRYPKTKAALRRCVELYDNAVLKADLPSAMQALKTGV  119

Query  168  PKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            PKFAE+G   ++  +  CE  F  A SP+T+ N  V DL  VA+AII++LL
Sbjct  120  PKFAEEGTNDAANEADSCERTFSGA-SPITSFNRYVSDLCRVASAIIRLLL  169



>ref|XP_011041481.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011041482.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
isoform X2 [Populus euphratica]
Length=178

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 90/149 (60%), Gaps = 2/149 (1%)
 Frame = -3

Query  462  NGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINN  283
            +  +DL+  TC+ TP Y LCV  + S P++ GAD +  LA+IMVD ++AK+      IN 
Sbjct  32   SAANDLIAQTCKHTPYYSLCVTSLKSVPKSSGAD-VQGLALIMVDIVRAKASTALRFINQ  90

Query  282  LQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF  103
              K    L+  L  CA  Y  ILTA IPEA EAL KG PKFAE G   ++  +  CE GF
Sbjct  91   ELKRSPGLRRPLRFCASCYDAILTADIPEAIEALQKGDPKFAENGTNDAAIEATSCEDGF  150

Query  102  QKAQSPLTALNTEVHDLSDVATAIIKILL  16
               +SPLT LN  VHD S VA+AI ++LL
Sbjct  151  H-GKSPLTNLNRVVHDTSVVASAITRLLL  178



>ref|XP_006296761.1| hypothetical protein CARUB_v10015473mg [Capsella rubella]
 gb|EOA29659.1| hypothetical protein CARUB_v10015473mg [Capsella rubella]
Length=162

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 92/147 (63%), Gaps = 2/147 (1%)
 Frame = -3

Query  456  GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQ  277
            GS +V+ TC++TP+Y LC+ ++ SDPR+  AD +  LA+I+VD IKA   ET   IN   
Sbjct  18   GSSIVDMTCKQTPDYTLCLSLLRSDPRSSSADTVG-LALILVDKIKALGTETLGRINEAY  76

Query  276  KTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
            KT+  LK AL++C   YK I+  ++  A  A+ KG PKFAE  VV S   +  CE GF K
Sbjct  77   KTKTMLKRALDECNLRYKTIVDVNVHTAIIAI-KGNPKFAEDAVVDSGVEASVCEGGFPK  135

Query  96   AQSPLTALNTEVHDLSDVATAIIKILL  16
             QSPLT L   +  + DV  AI+++LL
Sbjct  136  GQSPLTELTQRMDKICDVTRAIVRMLL  162



>ref|XP_009590146.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Nicotiana tomentosiformis]
 emb|CAA73334.1| invertase inhibitor homologue [Nicotiana tabacum]
 gb|AAN60076.1| vacuolar invertase inhibitor [Nicotiana tabacum]
 gb|AAT01640.1| invertase inhibitor [Nicotiana tabacum]
Length=172

 Score =   122 bits (305),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 105/173 (61%), Gaps = 6/173 (3%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPR---AQGADDITT  349
            MRNL    ML+        N  ++++ +TCR T NY LC+  + SDPR   A+GAD +TT
Sbjct  1    MRNLFPIFMLITNLAFNDNNNSNNIINTTCRATTNYPLCLTTLHSDPRTSEAEGAD-LTT  59

Query  348  LAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGV  169
            L ++MVDA+K KS E    I  L+K+  +L+  L QC   Y  +L A +  A EAL +GV
Sbjct  60   LGLVMVDAVKLKSIEIMKSIKKLEKSNPELRLPLSQCYIVYYAVLHADVTVAVEALKRGV  119

Query  168  PKFAEKGVVASSGSSQQCELGFQKAQ--SPLTALNTEVHDLSDVATAIIKILL  16
            PKFAE G+V  +  ++ CE  F+     SP++ +N E+ +LS VA +II++LL
Sbjct  120  PKFAENGMVDVAVEAETCEFSFKYNGLVSPVSDMNKEIIELSSVAKSIIRMLL  172



>ref|XP_010110653.1| Pectinesterase inhibitor [Morus notabilis]
 gb|EXC27498.1| Pectinesterase inhibitor [Morus notabilis]
Length=178

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = -3

Query  507  VLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVD  328
            ++ ++  + TT    +  ++ +E TC+RTPNY LCV  + SDPR+  A D+  LA+IMV 
Sbjct  13   LIVLLFALYTTQSRASPANNAIEQTCKRTPNYNLCVSSLRSDPRSSDA-DVRGLALIMVG  71

Query  327  AIKAKSQETAIMINNLQKT--REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAE  154
             I+AK++ET   I +L K   + D K  L  CA  Y  I+TA +P+A +AL  G  KFAE
Sbjct  72   VIEAKAKETLSHIKDLIKASPKRDEKQPLSSCADYYNAIITADVPQATQALKTGNYKFAE  131

Query  153  KGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            +G   +   +  CE  F   +SPLT +N  VHD++ +A A+ +ILL
Sbjct  132  QGTDDTENEADFCEKSFS-GRSPLTEMNKLVHDVAAIAAAMTRILL  176



>gb|ACO35698.1| invertase inhibitor [Solanum tuberosum]
Length=178

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 103/178 (58%), Gaps = 10/178 (6%)
 Frame = -3

Query  519  MRNLVLAMMLL----ILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRA---QGAD  361
            MRNL   +ML+    +   +   N   +L+ STCR TP Y LC+  + SDPR+   +G D
Sbjct  1    MRNLFPILMLITNLALNNDNNNNNNNYNLIHSTCRETPYYSLCLTTLQSDPRSNEVEGDD  60

Query  360  DITTLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEAL  181
             ITTL +IMVDA+K+KS E    I  L+K+  + +  L QC   Y  +L A +  A EAL
Sbjct  61   AITTLGLIMVDAVKSKSIEIMEKIKELEKSNPEWQAPLSQCYVAYNAVLRADVTVAVEAL  120

Query  180  TKGVPKFAEKGVVASSGSSQQCELGF---QKAQSPLTALNTEVHDLSDVATAIIKILL  16
             KGVPKFAE G+      +Q CE  F    K   P++ L+ E+ +LS VA +II++LL
Sbjct  121  KKGVPKFAEDGMDDVVVEAQTCEYSFNYYNKLDFPISNLSREIIELSKVAKSIIRMLL  178



>ref|XP_006349846.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Solanum tuberosum]
 gb|ACO35697.1| invertase inhibitor [Solanum tuberosum]
Length=178

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 103/178 (58%), Gaps = 10/178 (6%)
 Frame = -3

Query  519  MRNLVLAMMLL----ILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRA---QGAD  361
            MRNL   +ML+    +   +   N   +L+ +TCR TP Y LC+  + SDPR+   +G D
Sbjct  1    MRNLFPILMLITNLALNNDNNNNNNNYNLIHATCRETPYYSLCLTTLQSDPRSNEVEGDD  60

Query  360  DITTLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEAL  181
             ITTL +IMVDA+K+KS E    I  L+K+  + +  L QC   Y  +L A +  A EAL
Sbjct  61   AITTLGLIMVDAVKSKSIEIMEKIKELEKSNPEWRAPLSQCYVAYNAVLRADVTVAVEAL  120

Query  180  TKGVPKFAEKGVVASSGSSQQCELGF---QKAQSPLTALNTEVHDLSDVATAIIKILL  16
             KGVPKFAE G+      +Q CE  F    K   P++ L+ E+ +LS VA +II++LL
Sbjct  121  KKGVPKFAEDGMDDVVVEAQTCEYSFNYYNKLDFPISNLSREIIELSKVAKSIIRMLL  178



>gb|AGS32044.1| invertase inhibitor [Solanum torvum]
Length=176

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 102/176 (58%), Gaps = 8/176 (5%)
 Frame = -3

Query  519  MRNLVLAMMLL--ILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPR---AQGADDI  355
            MRNL   +ML+  +   +   N  ++ ++ TCR TPNY LC+  + SDPR    +  DDI
Sbjct  1    MRNLFPILMLITNLALNNDSNNNNNNFIDETCRATPNYSLCLTTLQSDPRTYEVKEGDDI  60

Query  354  TTLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTK  175
            TTL ++MVDA+K KS E   M+ +L+K+  + +  L QC   Y  +L A +  A EAL K
Sbjct  61   TTLGLVMVDAVKLKSIEIIKMLKDLEKSHPEWRGPLSQCYVAYNAVLRADVTVAVEALKK  120

Query  174  GVPKFAEKGVVASSGSSQQCELGFQ---KAQSPLTALNTEVHDLSDVATAIIKILL  16
            GVPKFA+  +      +Q CE  F    K   P+  L+ ++ +LS VA +IIK+LL
Sbjct  121  GVPKFADHSMDDVVVEAQTCESSFSYYYKLDFPIFNLSRDIIELSKVAKSIIKMLL  176



>gb|ACO35696.1| invertase inhibitor [Solanum tuberosum]
Length=180

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 89/149 (60%), Gaps = 6/149 (4%)
 Frame = -3

Query  444  VESTCRRTPNYELCVKVVSSDPRA---QGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            + +TCR TP Y LC+  + SDPR+   +G D ITTL +IMVD +K+KS E    I  L+K
Sbjct  32   IHATCRETPYYSLCLTTLQSDPRSNEVEGDDAITTLGLIMVDVVKSKSIEIMEKIKELEK  91

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF---  103
            +  + +  L QC   Y  +L A +  A EAL KGVPKFAE G+      +Q CE  F   
Sbjct  92   SNPEWRAPLSQCYVAYNAVLRADVTVAVEALKKGVPKFAEDGMDDVVVEAQTCEYSFNYH  151

Query  102  QKAQSPLTALNTEVHDLSDVATAIIKILL  16
             K   P++ L+ E+ +LS VA +II++LL
Sbjct  152  NKLDFPISNLSREIIELSKVAKSIIRMLL  180



>gb|ACO35694.1| invertase inhibitor [Solanum tuberosum]
 gb|ACO35695.1| invertase inhibitor [Solanum tuberosum]
 gb|ADM49015.1| putative invertase inhibitor [Solanum tuberosum]
 gb|AFF27602.1| invertase inhibitor [Solanum tuberosum]
Length=181

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 89/149 (60%), Gaps = 6/149 (4%)
 Frame = -3

Query  444  VESTCRRTPNYELCVKVVSSDPRA---QGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            + +TCR TP Y LC+  + SDPR+   +G D ITTL +IMVD +K+KS E    I  L+K
Sbjct  33   IHATCRETPYYSLCLTTLQSDPRSNEVEGDDAITTLGLIMVDVVKSKSIEIMEKIKELEK  92

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF---  103
            +  + +  L QC   Y  +L A +  A EAL KGVPKFAE G+      +Q CE  F   
Sbjct  93   SNPEWRAPLSQCYVAYNAVLRADVTVAVEALKKGVPKFAEDGMDDVVVEAQTCEYSFNYY  152

Query  102  QKAQSPLTALNTEVHDLSDVATAIIKILL  16
             K   P++ L+ E+ +LS VA +II++LL
Sbjct  153  NKLDFPISNLSREIIELSKVAKSIIRMLL  181



>gb|AAM94391.1| invertase inhibitor-like protein [Ipomoea batatas]
Length=192

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 109/196 (56%), Gaps = 32/196 (16%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIINGG-----------------SDLVESTCRRTPNYELCVKVV  391
            M++L  AMML+    S ++NGG                   L+ + C  TPNY LCV V+
Sbjct  1    MKSLFTAMMLI----SSVLNGGKIGNTNYSSDDDDGSSNGGLINTACNNTPNYALCVSVL  56

Query  390  SSDPR-AQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTRE-DLKTALEQCAFDYKVI  217
            +SDPR +  A ++ TL ++MVDA+KAK++E    I  L+K++  + +  L QC   Y  +
Sbjct  57   ASDPRTSSKAVNVETLGLVMVDAVKAKAEEMIETIRELEKSKPVEWRLPLSQCYIYYYAV  116

Query  216  LTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ---------KAQSPLTALNTE  64
            + A +PEA  AL +GVPKFAE G+  ++  ++ CE  F+          + S +   N +
Sbjct  117  VHADVPEAEAALKRGVPKFAEDGMADAAVEAESCEAAFKLQNEDIILDYSGSAIDETNKD  176

Query  63   VHDLSDVATAIIKILL  16
            V  LS VAT+IIK+LL
Sbjct  177  VIQLSAVATSIIKMLL  192



>gb|AIT42248.1| invertase inhibitor [Solanum tuberosum]
Length=179

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 89/149 (60%), Gaps = 6/149 (4%)
 Frame = -3

Query  444  VESTCRRTPNYELCVKVVSSDPRA---QGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            + +TCR TP Y LC+  + SDP +   +G D ITTL +IMVDA+K+KS E    I  L+K
Sbjct  31   IHATCRETPYYSLCLTTLQSDPHSNEVEGDDAITTLGLIMVDAVKSKSIEIMEKIKKLEK  90

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF---  103
            +  + +  L QC   Y  +L A +  A EAL KGVPKFAE G+      +Q CE  F   
Sbjct  91   SNPEWRAPLSQCYVAYNAVLRADVTVAVEALKKGVPKFAENGMDDVVVEAQTCEYSFNYY  150

Query  102  QKAQSPLTALNTEVHDLSDVATAIIKILL  16
             K   P++ L+ E+ +LS VA +II++LL
Sbjct  151  NKLDFPISNLSREIIELSKVAKSIIRMLL  179



>ref|XP_003609825.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES92022.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=175

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 97/166 (58%), Gaps = 3/166 (2%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMV  331
            L+L   L++  +  I    ++L++ TC+ TPNY LC++ ++SDP+A  A DI  L++IMV
Sbjct  12   LILCTFLVVTQSRTIQPNDANLIQQTCKNTPNYALCIQYLNSDPKAPSA-DIRGLSLIMV  70

Query  330  DAIKAKSQETAIMINNLQKTR-EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAE  154
            + IK K+  T   I  L KT     K AL  C   Y  I+ A + EA EAL KG PKFAE
Sbjct  71   NVIKTKATATLNKIRQLLKTSPPSQKGALTSCESKYNTIIVADVAEATEALQKGNPKFAE  130

Query  153  KGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
             G   +    + CE GF    SPLTA N  +H+++ +A AII+ LL
Sbjct  131  DGASDADVEQEACEGGF-SGNSPLTADNNVMHNVATIARAIIRNLL  175



>ref|XP_010465742.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
Length=165

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 90/146 (62%), Gaps = 2/146 (1%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
             ++V++TC++TP+Y LC+ ++ SDPR+  AD +  L +I+VD IKA   ET   IN   K
Sbjct  22   GNIVDTTCKQTPDYTLCLSLLRSDPRSSSADTVG-LGLILVDKIKALGTETLGQINAAYK  80

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
            T+  LK AL++C   YK I+   +  A  A+ KG PKFAE  VV +   +  CE GF K 
Sbjct  81   TKPMLKRALDECNQRYKTIVDVDVHTAITAI-KGNPKFAEGAVVDAGVEASVCEGGFPKG  139

Query  93   QSPLTALNTEVHDLSDVATAIIKILL  16
            QSPLT L   +  + DV  AII++LL
Sbjct  140  QSPLTGLTQRMGKICDVTRAIIRMLL  165



>ref|XP_010505027.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
 ref|XP_010505065.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
Length=162

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
             ++V++TCR+TP Y LC+ ++ SDPR+  AD +  L +I+VD IKA   ET   IN   K
Sbjct  19   GNIVDTTCRQTPEYSLCLSLLRSDPRSSSADTVG-LGLILVDKIKALGTETLGQINAAYK  77

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
            T+  LK AL++C   YK I+   +  A  A+ KG PKFAE  VV +   +  CE  F K 
Sbjct  78   TKPMLKRALDECNLRYKTIVDFDVHTAITAI-KGNPKFAEGAVVDAGVEASVCEGEFPKG  136

Query  93   QSPLTALNTEVHDLSDVATAIIKILL  16
            QSPLT L   ++ + DV  AII++LL
Sbjct  137  QSPLTGLTQRINKICDVTRAIIRMLL  162



>ref|XP_002313933.1| hypothetical protein POPTR_0009s08690g [Populus trichocarpa]
 gb|EEE87888.1| hypothetical protein POPTR_0009s08690g [Populus trichocarpa]
Length=175

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 104/176 (59%), Gaps = 8/176 (5%)
 Frame = -3

Query  522  MMRNLVLAMMLLILTTSPIING-----GSDLVESTCRRTPNYELCVKVVSSDPRAQGADD  358
            M   LV+ ++ +I    P+        G++L+E TC++TP Y+LCV+ + S PR+   D 
Sbjct  1    MKSTLVIFLVFIIYFIFPVNASLPSILGNNLIEKTCKQTPYYDLCVRSLISSPRSFNTD-  59

Query  357  ITTLAIIMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEA  184
            +  LA IMV  I A++  T   IN L + R+D  +K AL+ CA  Y  I+   IPE+ +A
Sbjct  60   VEGLAKIMVHTINARATHTLHRINKLLQHRQDTNMKRALQSCASRYDAIIKEDIPESLQA  119

Query  183  LTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            L  G  KFAE G V ++  ++ CE  F++ +SPL  +N  VHD+S VA +I++ ++
Sbjct  120  LRLGNYKFAEAGTVDAAFEARLCEKEFRRCKSPLADMNRVVHDVSIVAASIVQTIV  175



>emb|CDY39016.1| BnaC01g34800D [Brassica napus]
Length=175

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 91/145 (63%), Gaps = 2/145 (1%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            D+V+ TC++TP+Y LC+ ++ SDPR+  AD +  L +I+VD IKA   ET   IN   KT
Sbjct  33   DIVDKTCKQTPDYSLCLSLLRSDPRSSSADTVG-LGLILVDKIKALGTETLGQINMAYKT  91

Query  270  REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQ  91
            +  LK  L++C   YK I+   +  A  A+ KG PKFAE  +V +   +  CE GF K Q
Sbjct  92   KPMLKKPLDECNLRYKTIVDVDVHTAIIAI-KGNPKFAEGAIVDAGVEASVCEGGFPKGQ  150

Query  90   SPLTALNTEVHDLSDVATAIIKILL  16
            SP+T L  +++++ DV  AI+++LL
Sbjct  151  SPITGLTQKMNEICDVTRAIVRMLL  175



>gb|KHN03269.1| Putative invertase inhibitor [Glycine soja]
Length=179

 Score =   117 bits (293),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 103/169 (61%), Gaps = 5/169 (3%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIIN--GGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAII  337
            LVLA + +  T S II+    ++L+E TC++TP+++LC++ +SSDPR+  AD +T LA+I
Sbjct  12   LVLATISVPATNSRIIHQKNNANLIEETCKQTPHHDLCIQYLSSDPRSTEAD-VTGLALI  70

Query  336  MVDAIKAKSQETAIMINNL-QKTRE-DLKTALEQCAFDYKVILTASIPEAYEALTKGVPK  163
            MV+ IK K+      I+ L QK  E   K  L  CA  YK I+ A + +A  +L KG PK
Sbjct  71   MVNVIKIKANNALDKIHQLLQKNPEPSQKEPLSSCAARYKAIVEADVAQAVASLQKGDPK  130

Query  162  FAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            FAE G   ++  +  CE  F   +SPLT  N  +HD++ +  AI++ LL
Sbjct  131  FAEDGANDAAIEATTCENSFSAGKSPLTNHNNAMHDVATITAAIVRQLL  179



>ref|NP_001235420.1| uncharacterized protein LOC100306719 precursor [Glycine max]
 gb|ACU15029.1| unknown [Glycine max]
Length=182

 Score =   117 bits (293),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 103/169 (61%), Gaps = 5/169 (3%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIIN--GGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAII  337
            LVLA + +  T S II+    ++L+E TC++TP+++LC++ +SSDPR+  AD +T LA+I
Sbjct  15   LVLATISVPATNSRIIHQKNNANLIEETCKQTPHHDLCIQYLSSDPRSTEAD-VTGLALI  73

Query  336  MVDAIKAKSQETAIMINNL-QKTRE-DLKTALEQCAFDYKVILTASIPEAYEALTKGVPK  163
            MV+ IK K+      I+ L QK  E   K  L  CA  YK I+ A + +A  +L KG PK
Sbjct  74   MVNVIKIKANNALDKIHQLLQKNPEPSQKEPLSSCAARYKAIVEADVAQAVASLQKGDPK  133

Query  162  FAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            FAE G   ++  +  CE  F   +SPLT  N  +HD++ +  AI++ LL
Sbjct  134  FAEDGANDAAIEATTCENSFSAGKSPLTNHNNAMHDVATITAAIVRQLL  182



>ref|XP_003556749.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Glycine max]
Length=175

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 91/144 (63%), Gaps = 4/144 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC+RTPN  LC++++ +DPRA  A DI  LA+I+VD IKAK+ E    I  L K  
Sbjct  36   LIEETCKRTPNPNLCLQLLKADPRAPSA-DIAGLALILVDVIKAKATEAEKTIKQLLKQG  94

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             + K AL +CA DY  IL   +P A  A+ +G PKFAE  V   +  +  CE GF   +S
Sbjct  95   GN-KKALSECADDYDGILKLDVPTATRAV-RGNPKFAENAVSDCAVEADSCENGFH-GKS  151

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT +N  +HD+++VA AII+ LL
Sbjct  152  PLTHVNNGMHDVANVARAIIRNLL  175



>ref|XP_010487590.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Camelina sativa]
Length=164

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
             ++V++TC++TP+Y LC+ ++ SDPR+  AD +  L +I+VD IKA   ET   IN   K
Sbjct  21   GNIVDTTCKQTPDYTLCLSLLRSDPRSSSADTVG-LGLILVDKIKALGTETLGQINAAYK  79

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
            T+  LK AL++C   YK I+   +  A  A+  G PKFAE  VV +   +  C  GF K 
Sbjct  80   TKPMLKRALDECNLRYKTIVDVDVHTAITAI-NGNPKFAEGAVVDAGVEASVCAGGFPKG  138

Query  93   QSPLTALNTEVHDLSDVATAIIKILL  16
            QSPLT L   ++ + DV  AII++LL
Sbjct  139  QSPLTGLTQRMNKICDVTRAIIRMLL  164



>emb|CDY35000.1| BnaA01g27340D [Brassica napus]
Length=159

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            D+V+ TC++TP+Y LC+ ++ SDPR+  AD +  L +I+VD IKA   ET   IN   KT
Sbjct  17   DIVDKTCKQTPDYSLCLSLLRSDPRSSSADTVG-LGLILVDKIKALGTETLGQINMAYKT  75

Query  270  REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQ  91
            +  LK  L++C   YK I+   +  A  A+ +G PKFAE  +V +   +  CE GF K Q
Sbjct  76   KPMLKKPLDECNLRYKTIVDVDVHTAIIAI-RGNPKFAEGAIVDAGVEASVCEGGFPKGQ  134

Query  90   SPLTALNTEVHDLSDVATAIIKILL  16
            SP+T L  +++ + DV  AI+++LL
Sbjct  135  SPITGLTQKMNKICDVTRAIVRMLL  159



>ref|XP_007154411.1| hypothetical protein PHAVU_003G117300g [Phaseolus vulgaris]
 gb|ESW26405.1| hypothetical protein PHAVU_003G117300g [Phaseolus vulgaris]
Length=180

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 91/146 (62%), Gaps = 4/146 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+ESTC++TPNY LC++ + + P +  AD ++ LA+IMV+ IKAK+ +   +I++LQK  
Sbjct  37   LIESTCKKTPNYNLCLQYLKASPGSSTAD-VSGLALIMVNVIKAKANDALKIIHDLQKKG  95

Query  267  EDLK--TALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
               K   AL  CA +Y  +L   +P+A  AL  G PKFAE G   ++  +  CE GF   
Sbjct  96   GGPKQQGALSSCASNYNAVLVGDVPKATYALQAGDPKFAEDGANDAANEATYCENGFS-G  154

Query  93   QSPLTALNTEVHDLSDVATAIIKILL  16
             SPLT  N  +HD++ V  AI+++LL
Sbjct  155  NSPLTKQNNAMHDVAVVTAAIVRLLL  180



>ref|XP_007154412.1| hypothetical protein PHAVU_003G117400g [Phaseolus vulgaris]
 gb|ESW26406.1| hypothetical protein PHAVU_003G117400g [Phaseolus vulgaris]
Length=180

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 91/146 (62%), Gaps = 4/146 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+ESTC++TPNY LC++ + + P +  AD +  LA+IMV+ IKAK+ +T  +I++LQK  
Sbjct  37   LIESTCKKTPNYNLCLQYLKASPGSSTAD-VRGLALIMVNVIKAKAYDTLKIIHDLQKKG  95

Query  267  EDLKT--ALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
               K   AL  CA  Y  +L A + +A EAL KG PKFAE G   ++  +  CE  F   
Sbjct  96   GGPKQQEALSSCASKYNTVLVADVAQATEALLKGNPKFAENGANDAANEATYCESDFS-G  154

Query  93   QSPLTALNTEVHDLSDVATAIIKILL  16
             SPLT  N  +HD++ V  AI+++LL
Sbjct  155  NSPLTKQNNAMHDVAAVTAAIVRLLL  180



>ref|XP_009114400.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Brassica 
rapa]
Length=160

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            D+V+ TC++TP+Y LC+ ++ SDPR+  AD +  L +I+VD IKA   ET   IN   KT
Sbjct  18   DIVDKTCKQTPDYSLCLSLLRSDPRSSSADTVG-LGLILVDKIKALGTETLGQINMAYKT  76

Query  270  REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQ  91
            +  LK  L++C   YK I+   +  A  A+ +G PKFAE  +V +   +  CE GF K Q
Sbjct  77   KPMLKKPLDECNLRYKTIVDVDVHTAIIAI-RGNPKFAEGAIVDAGVEASVCEGGFPKGQ  135

Query  90   SPLTALNTEVHDLSDVATAIIKILL  16
            SP+T L  +++ + DV  AI+++LL
Sbjct  136  SPITGLTQKMNKICDVTRAIVRMLL  160



>ref|XP_011002592.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Populus euphratica]
Length=175

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 105/177 (59%), Gaps = 10/177 (6%)
 Frame = -3

Query  522  MMRNLVLAMMLLILTTSPIING------GSDLVESTCRRTPNYELCVKVVSSDPRAQGAD  361
            M   LV+ ++ +I    P+ N       G++L+E TC++TP Y+LCV+ + S PR+   D
Sbjct  1    MKSTLVIFLVFIIYFIFPV-NAFLPSILGNNLIEKTCKQTPYYDLCVRSLISSPRSFNTD  59

Query  360  DITTLAIIMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYE  187
             +  LA IMV  I A++  T   IN L + R+D  +K AL+ CA  Y  I+   IPE+ +
Sbjct  60   -VEGLAKIMVHTINARATHTLRRINKLLQHRQDTNMKRALQSCASRYDAIIKEDIPESLQ  118

Query  186  ALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            AL  G  KFAE G + ++  ++ CE  F++ +SPL  +N  VHD+S VA +I++ ++
Sbjct  119  ALRLGNYKFAEAGTMDAALEARLCEKEFRRCKSPLADMNRVVHDVSIVAASIVQTIV  175



>ref|XP_008340696.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=174

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 98/164 (60%), Gaps = 12/164 (7%)
 Frame = -3

Query  519  MRNLV-LAMMLLI-LTTSPI-------INGGSDLVESTCRRTPNYELCVKVVSSDPRAQG  367
            M+NL+ LA+  LI ++  P+       +   + L++ TC++TP++ LCV  + SDPR+  
Sbjct  1    MKNLIPLALTFLIQISLLPVSQCRPVYVPNDATLIDQTCQKTPDHNLCVSSLRSDPRSSS  60

Query  366  ADDITTLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYE  187
            AD +  L IIMVD +K K+ +T   IN+L K R   K+ L  CA  Y  ++TA +PEA +
Sbjct  61   AD-VKGLGIIMVDVVKGKATDTLNQINDLLKQRPGDKS-LSSCAEVYNTVITADVPEASQ  118

Query  186  ALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHD  55
              + G PKFAE+G+  ++G +  CE GF    SPLT  N  VHD
Sbjct  119  GFSLGNPKFAEQGMNDAAGEAVSCENGF-SGSSPLTDKNKSVHD  161



>ref|XP_006406762.1| hypothetical protein EUTSA_v10021672mg [Eutrema salsugineum]
 gb|ESQ48215.1| hypothetical protein EUTSA_v10021672mg [Eutrema salsugineum]
Length=163

 Score =   114 bits (285),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            ++++ TC++TP+Y LCV ++ SDPR+  AD    LA+I++D IKA   ET   IN   KT
Sbjct  21   NIIDKTCKQTPDYTLCVSLLRSDPRSSSAD-TAGLALILIDKIKALGTETLGQINVAYKT  79

Query  270  REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQ  91
            +  LK  L++C   YK+I+   +  A  AL KG PKFAE  +V +   +  CE GF K Q
Sbjct  80   KPMLKQPLDECNQRYKIIVDVDVHTAIIAL-KGDPKFAEDAIVDAGVEASVCESGFAKGQ  138

Query  90   SPLTALNTEVHDLSDVATAIIKILL  16
            SPLT L  ++  + DV  AI+++LL
Sbjct  139  SPLTGLIQKMEKMCDVTRAIVRMLL  163



>ref|XP_007154410.1| hypothetical protein PHAVU_003G117200g [Phaseolus vulgaris]
 gb|ESW26404.1| hypothetical protein PHAVU_003G117200g [Phaseolus vulgaris]
Length=197

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 90/146 (62%), Gaps = 4/146 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+ESTC++TPNY LC++ + + P +  AD +  LA+IMV+ IKAK+ +T  +I++LQK  
Sbjct  54   LIESTCKKTPNYNLCLQYLKASPGSSTAD-VRGLALIMVNVIKAKAYDTLKIIHDLQKKG  112

Query  267  EDLKT--ALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
               K    L  CA  Y  +L A + +A EAL KG PKFAE G   ++  +  CE  F   
Sbjct  113  GGAKQQEVLSSCASRYHTVLVADVAQATEALQKGDPKFAENGANDAANEATYCESDF-SG  171

Query  93   QSPLTALNTEVHDLSDVATAIIKILL  16
             SPLT  N  +HD++ V  AI+++LL
Sbjct  172  NSPLTNQNNAMHDVAAVTAAIVRLLL  197



>gb|KHN32727.1| Pectinesterase inhibitor [Glycine soja]
Length=155

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 4/144 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC+RTP   LC++++  DPRA  A D   LA+I+VD IKAK+ E    I  L K  
Sbjct  16   LIEETCKRTPKPNLCLQLLKGDPRAPSA-DTAGLALILVDVIKAKANEAEKTIKQLLKQG  74

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             + K AL +CA DYK IL   IP+A  A+ +G PKFAE  V   +  +  CE GF   +S
Sbjct  75   GN-KKALSECAVDYKGILILDIPQATRAV-RGDPKFAENTVSDCAVEADSCENGFH-GKS  131

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT +N  + D+++VA AII+ LL
Sbjct  132  PLTHVNNGMRDVANVARAIIRTLL  155



>gb|KHN02871.1| Pectinesterase inhibitor 2 [Glycine soja]
Length=164

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 86/147 (59%), Gaps = 4/147 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E+TCR+TPNY +C++ + + P +  AD +T LA IMV  +KAK+      I  LQ+  
Sbjct  19   LIENTCRKTPNYNVCLESLKASPGSSSAD-VTGLAQIMVKEMKAKANYALKRIQELQRVG  77

Query  267  ---EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
                  + AL  C   YK +L A +P+A EAL KG PKFAE G   ++  +  CE  F  
Sbjct  78   AGPNKQRRALSSCVDKYKTVLIADVPQATEALQKGDPKFAEDGANDAANEATFCEADFSA  137

Query  96   AQSPLTALNTEVHDLSDVATAIIKILL  16
              SPLT  N  +HD++ V  AI+++LL
Sbjct  138  GNSPLTKQNNAMHDVAAVTAAIVRLLL  164



>gb|AFK44620.1| unknown [Lotus japonicus]
Length=178

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 86/146 (59%), Gaps = 2/146 (1%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            + LV  TC+ TP    C + + +DPR+  AD +T LA+IMVD I+AK+      I+ L K
Sbjct  35   AQLVAKTCKNTPYPSACPQFLQADPRSSSAD-VTGLALIMVDVIQAKTNGVLNKISQLLK  93

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
               D K AL  C   Y  IL A IP+A +AL  G PKFAE GV  +S  +  CE GF   
Sbjct  94   GGGD-KPALNSCQGRYNAILKADIPQATQALKTGNPKFAEDGVADASVEANTCESGFSSG  152

Query  93   QSPLTALNTEVHDLSDVATAIIKILL  16
            +SPLT+ N  +H  ++VA AII+ LL
Sbjct  153  KSPLTSENNGMHIATEVARAIIRNLL  178



>ref|XP_003529510.2| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 isoform 
1 [Glycine max]
Length=191

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 86/147 (59%), Gaps = 4/147 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT-  271
            L+E+TCR+TPNY +C++ + + P +  AD +T LA IMV  +KAK+      I  LQ+  
Sbjct  46   LIENTCRKTPNYNVCLESLKASPGSSSAD-VTGLAQIMVKEMKAKANYALKRIQELQRVG  104

Query  270  --REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
                  + AL  C   YK +L A +P+A EAL KG PKFAE G   ++  +  CE  F  
Sbjct  105  AGPNKQRRALSSCVDKYKTVLIADVPQATEALQKGDPKFAEDGANDAANEATFCEADFSA  164

Query  96   AQSPLTALNTEVHDLSDVATAIIKILL  16
              SPLT  N  +HD++ V  AI+++LL
Sbjct  165  GNSPLTKQNNAMHDVAAVTAAIVRLLL  191



>gb|KHN32722.1| Pectinesterase inhibitor [Glycine soja]
Length=155

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 90/144 (63%), Gaps = 4/144 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC+RTPN  LC++++ +DPRA  A DI  LA+I+VD IKAK+ E    I  L K  
Sbjct  16   LIEETCKRTPNPNLCLQLLKADPRAPSA-DIAGLALILVDVIKAKATEAEKTIKQLLKQG  74

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             + K AL +CA DY  IL   +P A  A+ +G PKFAE  V   +  +  CE GF   +S
Sbjct  75   GN-KKALSECADDYDGILMLDVPTATRAV-RGDPKFAENTVSDCAVEADSCENGFH-GKS  131

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT +N  + D+++VA AII+ LL
Sbjct  132  PLTHVNNGMRDVANVARAIIRNLL  155



>gb|KHN03268.1| Pectinesterase inhibitor [Glycine soja]
Length=184

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 106/184 (58%), Gaps = 10/184 (5%)
 Frame = -3

Query  540  TKLKIKMMRNLVLAMMLLILTTSP-----IINGGSDLVESTCRRTPNYELCVKVVSSDPR  376
            T LK  ++   +LA++++I   S      ++     L+E+TC++TPNY +C++ + + P 
Sbjct  2    TNLKPLILFFYLLAIVVMISIPSSHCSRTLLPENEKLIENTCKKTPNYNVCLESLKASPG  61

Query  375  AQGADDITTLAIIMVDAIKAKSQETAIMINNLQK---TREDLKTALEQCAFDYKVILTAS  205
            +  AD +T LA IMV  +KAK+ +    I  LQ+   +    + AL  CA  YK +L A 
Sbjct  62   SSSAD-VTGLAQIMVKEMKAKANDALKRIQELQRVGASGPKQRRALSSCADKYKAVLIAD  120

Query  204  IPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA-QSPLTALNTEVHDLSDVATAII  28
            +P+A EAL KG PKFAE G   ++  +  CE  F  A  SPLT  N  +HD++ V  AI+
Sbjct  121  VPQATEALQKGDPKFAEDGANDAANEATYCETDFSAAGNSPLTKQNNAMHDVAAVTAAIV  180

Query  27   KILL  16
            ++LL
Sbjct  181  RLLL  184



>ref|NP_001237215.1| uncharacterized protein LOC100500640 precursor [Glycine max]
 gb|ACU15780.1| unknown [Glycine max]
Length=184

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 106/184 (58%), Gaps = 10/184 (5%)
 Frame = -3

Query  540  TKLKIKMMRNLVLAMMLLILTTSP-----IINGGSDLVESTCRRTPNYELCVKVVSSDPR  376
            T LK  ++   +LA++++I   S      ++     L+E+TC++TPNY +C++ + + P 
Sbjct  2    TNLKSLILFFYLLAIVVMISIPSSHCSRTLLPENEKLIENTCKKTPNYNVCLESLKASPG  61

Query  375  AQGADDITTLAIIMVDAIKAKSQETAIMINNLQK---TREDLKTALEQCAFDYKVILTAS  205
            +  AD +T LA IMV  +KAK+ +    I  LQ+   +    + AL  CA  YK +L A 
Sbjct  62   SSSAD-VTGLAQIMVKEMKAKANDALKRIQELQRVGASGPKQRRALSSCADKYKAVLIAD  120

Query  204  IPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA-QSPLTALNTEVHDLSDVATAII  28
            +P+A EAL KG PKFAE G   ++  +  CE  F  A  SPLT  N  +HD++ V  AI+
Sbjct  121  VPQATEALQKGDPKFAEDGANDAANEATYCETDFSAAGNSPLTKQNNAMHDVAAVTAAIV  180

Query  27   KILL  16
            ++LL
Sbjct  181  RLLL  184



>ref|XP_008390421.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=175

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 89/146 (61%), Gaps = 3/146 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++L++ TC++TPNY LCV  + SDPR+  A D+  L  I VD  K K+ +TA  IN L K
Sbjct  33   ANLIDQTCKKTPNYNLCVSSLKSDPRSVKA-DVAGLGFITVDIAKDKATDTANRINELLK  91

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
                    L+ CA  Y  IL A +PEA +    G PKFAE+G+  ++ +++ CE  F  +
Sbjct  92   QSPS-DQRLKTCATFYHTILVADVPEASQGFKLGNPKFAEQGMNDAADATEACEKEFS-S  149

Query  93   QSPLTALNTEVHDLSDVATAIIKILL  16
            +SPLT  N  VHDLS +A AI ++LL
Sbjct  150  KSPLTDKNKVVHDLSSIAAAIARLLL  175



>ref|XP_006605560.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Glycine max]
Length=155

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 90/144 (63%), Gaps = 4/144 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC+RTP   LC++++  DPRA  A DI  LA+I+VD I+AK+ E    I  L K  
Sbjct  16   LIEETCKRTPKPNLCLQLLKGDPRAPSA-DIAGLALILVDVIQAKANEAEKTIKQLLKQG  74

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             + K AL +CA DYK IL   IPEA  A+ +G PKFA+  V   +  +  CE  F   +S
Sbjct  75   GN-KKALSECAVDYKRILILDIPEATRAV-RGDPKFADDAVSDCAVEADICENRFN-GKS  131

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT +N  + D+++VA AII+ILL
Sbjct  132  PLTHVNNGMRDVANVARAIIRILL  155



>gb|AFK48395.1| unknown [Lotus japonicus]
Length=184

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 99/177 (56%), Gaps = 13/177 (7%)
 Frame = -3

Query  513  NLVLAMMLLILTTSP-------IINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDI  355
            +  L  +LLI+ + P        +     L+E+TC+ TPNY +C + + + P   GAD +
Sbjct  10   SFYLQALLLIMISIPATIHCRTFLPNSGKLIETTCKNTPNYNVCFQSLKASPGGSGAD-V  68

Query  354  TTLAIIMVDAIKAKSQETAIMINNLQKTREDLKT----ALEQCAFDYKVILTASIPEAYE  187
            T LA IMV  +KAK+ +   +I+ LQK +  L T    AL  CA  Y+ IL   IP+A E
Sbjct  69   TGLAQIMVRVMKAKANDALNVIHELQKVKIGLGTEQRRALSSCADKYRAILIGDIPQATE  128

Query  186  ALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            AL KG PKFAE G   ++  +  CE  F   +S LT  N  +HD++ V  AI+++LL
Sbjct  129  ALQKGDPKFAEDGANDAANEATYCESEFS-GKSLLTKQNNVMHDVAAVTGAIVRMLL  184



>ref|XP_006419340.1| hypothetical protein CICLE_v10006791mg [Citrus clementina]
 gb|ESR32580.1| hypothetical protein CICLE_v10006791mg [Citrus clementina]
Length=169

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 86/144 (60%), Gaps = 1/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC++TP Y LCV  + SDPR++ A D+  +A+IMVD IKAK+      I  L++  
Sbjct  27   LIEHTCKQTPYYGLCVTSLKSDPRSKTAGDVQAIALIMVDIIKAKAGGALQHIEKLKQKY  86

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
              L+  L  C   +  I+   +P+A EALTKG PKFA      ++  +  CE GF   +S
Sbjct  87   PALRVPLSACKDRFNAIIIGDVPQAVEALTKGDPKFAVDAANDAALEADSCERGFS-GKS  145

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            P+T +N   HD+S +  +I+K++L
Sbjct  146  PITQMNKLNHDISIITASIVKMML  169



>ref|XP_003556709.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Glycine max]
Length=175

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 90/144 (63%), Gaps = 4/144 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC+RTPN  LC++++ +DPRA  A DI  LA+I+VD IKAK+ E    I  L K  
Sbjct  36   LIEETCKRTPNPNLCLQLLKADPRAPSA-DIAGLALILVDMIKAKATEAEKTIKQLLKQG  94

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             + K AL +CA DY  IL   +P A  A+ +G PKFAE  V   +  +  CE GF   +S
Sbjct  95   GN-KKALSECADDYDGILMLDVPTATRAV-RGDPKFAENTVSDCAVEADSCENGFH-GKS  151

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT +N  + D+++VA AII+ LL
Sbjct  152  PLTHVNNGMRDVANVARAIIRNLL  175



>ref|XP_006488813.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Citrus sinensis]
Length=169

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 87/144 (60%), Gaps = 1/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC++TP Y LCV  + SDPR++ A D+  +A+IMVD IKAK+  +   I  L++  
Sbjct  27   LIEQTCKQTPYYGLCVTSLKSDPRSKTAGDVQAIALIMVDIIKAKAGGSLQHIEKLKQKY  86

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
              L+  L  C   +  I+   +P+A EALTKG PKFA      ++  +  CE GF   +S
Sbjct  87   PALRVPLSACKDRFNAIIIGDVPQAVEALTKGDPKFAVDAANDAALEADSCERGFS-GKS  145

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            P+T +N   HD+S +  +++K++L
Sbjct  146  PITQMNKLNHDISIITASVVKMML  169



>gb|KDO71995.1| hypothetical protein CISIN_1g037982mg [Citrus sinensis]
Length=169

 Score =   111 bits (278),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 86/144 (60%), Gaps = 1/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC++TP Y LCV  + SDPR++ A D+  +A+IMVD IKAK+  +   I  L++  
Sbjct  27   LIEQTCKQTPYYGLCVTSLKSDPRSKTAGDVQAIALIMVDIIKAKAGGSLQHIEKLKQKY  86

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
              L+  L  C   +  I+   +P+A EALTKG PKFA      ++  +  CE GF   +S
Sbjct  87   PALRVPLSACKDRFNAIIIGDVPQAVEALTKGDPKFAVDAANDAALEADSCERGFS-GKS  145

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            P+T +N   HD+S +  +I+K +L
Sbjct  146  PITQMNKLNHDISIITASIVKTML  169



>ref|XP_004508125.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=170

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 96/167 (57%), Gaps = 7/167 (4%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMV  331
            L+L  ++++     +    ++L++ TCR+TPNY LC++ ++  P +  AD +  LA IMV
Sbjct  9    LILCTIVVVTQGKTVTTNNANLIQQTCRKTPNYGLCIQYLNGSPGSSTAD-VNGLAQIMV  67

Query  330  DAIKAKSQETAIMINNLQK--TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFA  157
            + IK K+   +I +N + +   R   K AL  C   Y  +L A IP+A +AL +G PKFA
Sbjct  68   NVIKTKA---SIALNKIHQIIGRSAQKVALNSCVDKYNAVLVADIPQAIQALQRGNPKFA  124

Query  156  EKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            E G   ++  +  CE GF   +SPLTA N    D + +  AI+++LL
Sbjct  125  EDGANDAAVEANSCENGF-SGKSPLTAENRATQDAAAITAAIVRLLL  170



>gb|KHN32720.1| Pectinesterase inhibitor [Glycine soja]
Length=155

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 89/144 (62%), Gaps = 4/144 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC+RTP   LC++++  DPRA  A D   LA+I+VD IKAK+ E    I  L K  
Sbjct  16   LIEETCKRTPKPNLCLQLLKGDPRAPSA-DTAGLALILVDVIKAKANEAEKTIKQLLKQG  74

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             + K AL +CA DYK IL   IP+A  A+ +G PKFA+  V   +  +  CE  F   +S
Sbjct  75   GN-KKALSECAVDYKGILILDIPQATRAV-RGDPKFADDAVSDCAVEADICENRFN-GKS  131

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT +N  + D+++VA AII+ILL
Sbjct  132  PLTHVNNGMRDVANVARAIIRILL  155



>ref|XP_003609816.1| hypothetical protein MTR_4g122800 [Medicago truncatula]
 gb|ACJ85961.1| unknown [Medicago truncatula]
 gb|AES92013.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
 gb|AFK46417.1| unknown [Medicago truncatula]
 gb|AFK48537.1| unknown [Medicago truncatula]
Length=182

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 86/144 (60%), Gaps = 2/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E+TC++TPNY +C + + +      A D+T LA IMV  +KAK+ +    I+ LQ+  
Sbjct  41   LIENTCKKTPNYNVCFQSLKA-YSGTSAGDVTGLAQIMVKVMKAKANDGLNKIHQLQRLG  99

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
               + AL  C   Y+ IL A IP+A EAL KG PKFAE G   ++  +  CE  F   +S
Sbjct  100  NGARKALSSCGDKYRAILIADIPQAIEALEKGDPKFAEDGANDAANEATYCESEFN-GKS  158

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT  N  +HD+S V ++I++ LL
Sbjct  159  PLTKQNNAMHDVSAVTSSIVRQLL  182



>ref|XP_004508119.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=170

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 96/167 (57%), Gaps = 7/167 (4%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMV  331
            L+L  ++++     +    ++L++ TCR+TPNY LC++ ++  P +  AD +  LA IMV
Sbjct  9    LILCTIVVVTQGKTVTTNYANLIQQTCRKTPNYGLCIQYLNGSPGSSTAD-VNGLAQIMV  67

Query  330  DAIKAKSQETAIMINNLQK--TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFA  157
            + IK K+   +I +N + +   R   K AL  C   Y  +L A IP+A +AL +G PKFA
Sbjct  68   NVIKTKA---SIALNKIHQIIGRSAQKVALNSCVDKYNAVLVADIPQAIQALQRGNPKFA  124

Query  156  EKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            E G   ++  +  CE GF   +SPLTA N    D + +  AI+++LL
Sbjct  125  EDGANDAAVEANSCENGF-SGKSPLTAENRATQDAAAITAAIVRLLL  170



>ref|XP_002279817.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Vitis vinifera]
Length=177

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 100/179 (56%), Gaps = 6/179 (3%)
 Frame = -3

Query  543  KTKLKIKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGA  364
            KT + + +   L+  ++L     S + +  +  V+  C++TP + LC+K + SDPR+ GA
Sbjct  2    KTSISLPIFIFLLYTLLLSFTHCSVLAHKNTPFVDKICKQTPYHALCLKTLLSDPRSAGA  61

Query  363  DDITTLAIIMVDAIKAKSQETAIMINNLQK---TREDLKTALEQCAFDYKVILTASIPEA  193
            D +  LAIIMVD IK  +      IN L K   T    + AL  C   Y  +L   +PEA
Sbjct  62   D-VRGLAIIMVDVIKRDTVSILSRINELLKKGGTDPHTRGALLDCIDKYNAVLKGDVPEA  120

Query  192  YEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
             EAL KG  KFAE+G   +S  ++ CE  F+   SP+T +N  VH +S VA +I+++LL
Sbjct  121  MEALEKGDYKFAEQGATDASLEARVCEENFE--TSPITNMNKLVHHVSLVAASIVRMLL  177



>ref|XP_010098776.1| Pectinesterase inhibitor 2 [Morus notabilis]
 gb|EXB75679.1| Pectinesterase inhibitor 2 [Morus notabilis]
Length=151

 Score =   108 bits (270),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 91/148 (61%), Gaps = 4/148 (3%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            +DL E TC+RT NY LC+  + S+PR+ GA D+  LA+IMV  I+AK++ T   I +L K
Sbjct  4    NDLFEQTCKRTTNYGLCISFLRSNPRSSGA-DVRGLALIMVGVIEAKAKGTLSQIKDLIK  62

Query  273  T--REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ  100
               + D K  L  CA  Y  IL+  +PEA +AL  G  KFAE+G   ++  +  CE  F 
Sbjct  63   ASPQRDDKQPLSSCAEYYDAILSGDVPEAIQALKTGNYKFAEQGSNNAALEANMCENRFS  122

Query  99   KAQSPLTALNTEVHDLSDVATAIIKILL  16
              +SPLT +N  VHD++ VA AI ++LL
Sbjct  123  -GKSPLTKMNKLVHDVAVVAAAITRVLL  149



>ref|XP_003556745.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Glycine max]
Length=175

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 89/144 (62%), Gaps = 4/144 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC+RTP   LC++++  DPRA  A D  +LA+I+VD IKAK+ E    I  L K  
Sbjct  36   LIEETCKRTPKPNLCLQLLKGDPRAPSA-DTASLALILVDVIKAKANEAEKTIKQLLKQG  94

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             + K AL +CA DYK IL   IP+A  A+ +G PKFA+  V   +  +  CE  F   +S
Sbjct  95   GN-KKALSECAVDYKGILILDIPQATRAV-RGDPKFADDAVSDCAVEADICENRFN-GKS  151

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT +N  + D+++VA AII+ LL
Sbjct  152  PLTHVNNGMRDVANVARAIIRTLL  175



>ref|XP_008223387.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Prunus mume]
Length=176

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 92/147 (63%), Gaps = 3/147 (2%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMV  331
            L++ ++ + L +  +    ++L++ TC++TPNY LCV  + SDPR+  AD ++ L +I+V
Sbjct  15   LLVFLLPVALCSRVVFPTDANLIDQTCKQTPNYALCVSSLKSDPRSSTAD-VSGLGVILV  73

Query  330  DAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEK  151
            D +KAKS +T   IN L K R     AL+ CA  Y  ++ A +PEA +  + G PKFAE+
Sbjct  74   DIVKAKSTDTLNKINTLLKQRPG-NQALKSCARFYDTVVEALVPEAQQGFSLGNPKFAEQ  132

Query  150  GVVASSGSSQQCELGFQKAQSPLTALN  70
            G+  ++G ++ CE GF   +SPLT  N
Sbjct  133  GMNDAAGEAETCEDGF-SGKSPLTDNN  158



>ref|XP_003556739.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Glycine max]
Length=175

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 88/144 (61%), Gaps = 4/144 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC+RTP   LC++++  DPRA  A D   LA+I+VD IKAK+ E    I  L K  
Sbjct  36   LIEETCKRTPKPNLCLQLLKGDPRAPSA-DTAGLALILVDVIKAKANEAEKTIKQLLKQG  94

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             + K AL +CA DYK IL   IP+A  A+ +G PKFA+  V   +  +  CE  F   +S
Sbjct  95   GN-KKALSECAVDYKGILILDIPQATRAV-RGDPKFADDAVSDCAVEADICENRFN-GKS  151

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT +N  + D+++VA AII+ LL
Sbjct  152  PLTHVNNGMRDVANVARAIIRTLL  175



>ref|XP_007154409.1| hypothetical protein PHAVU_003G117100g [Phaseolus vulgaris]
 gb|ESW26403.1| hypothetical protein PHAVU_003G117100g [Phaseolus vulgaris]
Length=177

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 94/153 (61%), Gaps = 5/153 (3%)
 Frame = -3

Query  468  IINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMI  289
            ++N G +L+E TC++TP++ LC++ +SSDPR+  AD I  LA+IMV+ IK K+      I
Sbjct  28   LLNKG-NLIEETCKQTPHHNLCIQYLSSDPRSADAD-IAGLALIMVNVIKTKANNALDKI  85

Query  288  NNL-QKTREDL-KTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQC  115
            + L Q + E   K AL  CA  YK IL A + +A  AL KG PKFAE G   ++  +  C
Sbjct  86   HQLLQGSPEPAQKEALISCADRYKAILEADVAQAIAALQKGDPKFAEDGANDAAIEATSC  145

Query  114  ELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            E GF   +SPLT  N  +HD++    AI++ LL
Sbjct  146  ESGF-SGKSPLTNENNVMHDVAATTGAIVRQLL  177



>ref|XP_007223575.1| hypothetical protein PRUPE_ppa012287mg [Prunus persica]
 gb|EMJ24774.1| hypothetical protein PRUPE_ppa012287mg [Prunus persica]
Length=176

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 92/147 (63%), Gaps = 3/147 (2%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMV  331
            L++ ++ + L +  +    ++L++ TC++TPNY LCV  + SDPR+  AD ++ L +I+V
Sbjct  15   LLVFLLPVALCSRVVFPTDANLIDQTCKQTPNYALCVSSLKSDPRSSTAD-VSGLGVILV  73

Query  330  DAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEK  151
            D +KAKS +T   IN L K R     AL+ CA  Y  ++ A +PEA +  + G PKFAE+
Sbjct  74   DIVKAKSTDTLNKINTLLKQRPG-DQALKSCARFYDTVVEALVPEAQQGFSLGNPKFAEQ  132

Query  150  GVVASSGSSQQCELGFQKAQSPLTALN  70
            G+  ++G ++ CE GF   +SPLT  N
Sbjct  133  GMNDAAGEAKTCEDGFS-GKSPLTDNN  158



>ref|XP_008390420.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=184

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 90/148 (61%), Gaps = 3/148 (2%)
 Frame = -3

Query  456  GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQ  277
            GSDL+++TC++TP+Y LC+  + S+P +  AD +  LA+I  DA+ A + +T   I+ L 
Sbjct  36   GSDLIQTTCKKTPHYNLCLSTLQSNPDSSNAD-VPGLALIASDALLANASDTLDYIHGLL  94

Query  276  KTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF  103
            K   +  L+ AL  CA  Y  I+  S+P+A EAL  G   FA+ G+  ++  ++ CE GF
Sbjct  95   KQSPEVHLQKALANCAELYIPIVKFSLPQAIEALXNGHFGFAKYGISDAAKEAEACEKGF  154

Query  102  QKAQSPLTALNTEVHDLSDVATAIIKIL  19
                SPLT  N  V+DLS VA AI+ +L
Sbjct  155  GGVXSPLTDRNALVNDLSGVAVAILNLL  182



>ref|XP_004508122.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=175

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 104/177 (59%), Gaps = 9/177 (5%)
 Frame = -3

Query  531  KIKMMRNLVLAMMLLILT---TSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGAD  361
            K+K +  L + +  LI+T   T+P  N  ++L+  TC+ TPNY +C+K + +DPR+  +D
Sbjct  3    KLKPLALLAIILYTLIVTSHSTNPKSN--TNLIHQTCKHTPNYAICIKYLEADPRSSTSD  60

Query  360  DITTLAIIMVDAIKAKSQETAIMINNLQK-TRE-DLKTALEQCAFDYKVILTASIPEAYE  187
             +T LA+IMVD IK K+  +   I +L K T E + K AL  C   Y+ I+ A +P+   
Sbjct  61   -VTGLALIMVDVIKTKANSSLNKIKHLIKGTHEPNKKEALNSCGGRYRAIVEADVPKCVA  119

Query  186  ALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            AL +G PKFAE G   ++  +  CE GF   +SPL+  N  + D++ +   I+K LL
Sbjct  120  ALKEGDPKFAEDGANDAAIEATACENGFF-GKSPLSDDNIAMQDVAAITATIVKQLL  175



>gb|EYU45482.1| hypothetical protein MIMGU_mgv1a014923mg [Erythranthe guttata]
Length=174

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 90/147 (61%), Gaps = 6/147 (4%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQE--TAIMINNLQ  277
            +L+ESTC+ TP YELC+  + +DP +  A D+  LA+IM+ A++AKS+E  +A+      
Sbjct  32   NLIESTCKNTPIYELCIATLRADPGSDAA-DVAGLALIMIGAVEAKSKEALSAVKKLLKG  90

Query  276  KTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
                D + AL+QC   YK +L   +P A  A+ +G PKFAE G+  +   +  CE  F  
Sbjct  91   GGGGD-REALKQCKDKYKAVLEGDVPVAKRAV-RGNPKFAEGGMADAKVEADDCEDAFG-  147

Query  96   AQSPLTALNTEVHDLSDVATAIIKILL  16
             +SPLT +N +V DL+ VA AII+ LL
Sbjct  148  GKSPLTKVNGDVRDLAVVARAIIRNLL  174



>ref|XP_011071366.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Sesamum indicum]
Length=178

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 88/147 (60%), Gaps = 4/147 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            LV STC+ TP+Y LC+ V+   PR+  AD +  LA+I V A+K +++     I  ++K  
Sbjct  33   LVVSTCKNTPHYRLCLAVLRRSPRSAKAD-VWELALIAVGAVKTEAERAMDAIKKVRKGG  91

Query  267  E--DLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK-  97
            E  ++  AL+QC   Y  +L   + EA E L  G PKFAE G+  +   +  CE GF   
Sbjct  92   EGKEVAAALKQCEEVYDAVLEGDVQEAEEGLKLGDPKFAENGMADAVVEADSCEGGFAGV  151

Query  96   AQSPLTALNTEVHDLSDVATAIIKILL  16
             +SPL+ +N+ VHD+++VA AII+ LL
Sbjct  152  GKSPLSRVNSAVHDIAEVARAIIRNLL  178



>emb|CAN79657.1| hypothetical protein VITISV_014507 [Vitis vinifera]
Length=177

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 99/179 (55%), Gaps = 6/179 (3%)
 Frame = -3

Query  543  KTKLKIKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGA  364
            KT + + +   L+  ++L     S + +  +  V+  C++TP + LC+K + SDPR+  A
Sbjct  2    KTSISLPIFIFLLYTLLLSFTHCSVLAHKNTPFVDKICKQTPYHALCLKTLLSDPRSAVA  61

Query  363  DDITTLAIIMVDAIKAKSQETAIMINNLQK---TREDLKTALEQCAFDYKVILTASIPEA  193
            D +  LAIIMVD IK  +      IN L K   T    + AL  C   Y  +L   +PEA
Sbjct  62   D-VRGLAIIMVDVIKRDTVSILSRINELLKKGGTDPHTRGALLDCIDKYNAVLKGDVPEA  120

Query  192  YEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
             EAL KG  KFAE+G   +S  ++ CE  F+   SP+T +N  VH +S VA +I+++LL
Sbjct  121  MEALEKGDYKFAEQGATDASLEARVCEENFE--TSPITNMNKLVHHVSLVAASIVRMLL  177



>ref|XP_003609813.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES92010.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=176

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 95/175 (54%), Gaps = 9/175 (5%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPIIN-----GGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDI  355
            M  L LA+ L I+ +    N       + L++ TC++TPNY LC+K + SDPR   A D+
Sbjct  4    MNALALAIFLCIIVSCHCTNINQKTNNATLIQQTCKQTPNYALCIKYLKSDPRTSDA-DL  62

Query  354  TTLAIIMVDAIKAKSQETAIMINNLQKTREDLKT--ALEQCAFDYKVILTASIPEAYEAL  181
               A+ MVD IK  +      +  L K   +L    AL  CA  Y+ IL   +P++  AL
Sbjct  63   VNYALYMVDRIKTTTITAYNKVTQLLKGGHELYQTEALSSCAGRYRSILVDVVPKSIAAL  122

Query  180  TKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
             +G PK AE G   ++  +  CE GF K +SP++  N ++HD++ +  AI+K LL
Sbjct  123  KQGDPKVAEDGANDAANDATTCENGF-KGKSPISDENIDMHDVAVITAAIVKQLL  176



>ref|XP_009372099.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Pyrus 
x bretschneideri]
Length=184

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 95/151 (63%), Gaps = 3/151 (2%)
 Frame = -3

Query  465  INGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMIN  286
            ++ GS+L+++TC++TP+Y LC+  + S+P +  AD +  LA I  DA+ A + +T   I+
Sbjct  33   LDKGSNLIQTTCKKTPHYNLCLSTLQSNPDSSNAD-VPRLARIASDALLANASDTLDYIH  91

Query  285  NL-QKTRE-DLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCE  112
             L +++RE  L+ AL  CA  Y  I+  S+P+A EAL  G   FA+ G+  ++  ++ CE
Sbjct  92   GLLKQSREVQLQKALANCAELYIPIVKFSLPQAIEALGNGHFGFAKYGISDAATEAEACE  151

Query  111  LGFQKAQSPLTALNTEVHDLSDVATAIIKIL  19
             GF   +SPLT  N  V+DLS VA AI+ +L
Sbjct  152  KGFGGVKSPLTDRNALVNDLSGVAVAILNLL  182



>ref|XP_004305718.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Fragaria vesca subsp. vesca]
Length=145

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 87/143 (61%), Gaps = 3/143 (2%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC +TP+  LCV  + SDPR+  AD +  LA+IMVD +  K +     ++ L K  
Sbjct  5    LIEQTCNKTPHPILCVYSLKSDPRSARAD-VPGLALIMVDVVSGKVKGILKKLDTLLKQS  63

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
               K AL+ C  DY ++L   I  A  A+T G PKFAE+ +  +S S+  CE  F K +S
Sbjct  64   PSNK-ALQNCNQDYHIVLNIEISAAKGAITLGDPKFAEQYMNDASNSADSCEREF-KGRS  121

Query  87   PLTALNTEVHDLSDVATAIIKIL  19
            PLT LN ++ D+S VA+AI+KIL
Sbjct  122  PLTKLNKDIVDVSRVASAIVKIL  144



>ref|XP_007019911.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative isoform 
1 [Theobroma cacao]
 gb|EOY17136.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative isoform 
1 [Theobroma cacao]
Length=263

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 93/151 (62%), Gaps = 7/151 (5%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAI-KAKSQETAIMINNLQ  277
             +L+E TCR+TP Y+LCV  + ++P ++ A D+  LA IMVD++ K K+ +T  +I+ L 
Sbjct  112  GNLIERTCRQTPFYDLCVWSLKTNPESRNA-DVKKLARIMVDSVLKNKASDTLDLIDELL  170

Query  276  KTREDLKTALEQ----CAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCEL  109
            +    L  AL +    CA  Y VI+   +PE  EAL  G  KFAE+G   ++  +  CE+
Sbjct  171  QDGFTLDPALHKALSSCAERYSVIIGGDVPEIIEALETGDYKFAERGTNDAAMEANSCEV  230

Query  108  GFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
             F   +SPLT +N  VHD+S VA +I+KI+L
Sbjct  231  EF-PGKSPLTHMNKVVHDVSVVAASIVKIIL  260



>gb|KDP27949.1| hypothetical protein JCGZ_19029 [Jatropha curcas]
Length=153

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 91/169 (54%), Gaps = 24/169 (14%)
 Frame = -3

Query  522  MMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLA  343
            ++ + ++  ++L+ T   I+   ++L+E TC+RTPNY LCV  + SD R+  A D   LA
Sbjct  9    LVHHFLVISIVLLGTYFSIVQSDANLIEQTCKRTPNYNLCVTSLKSDSRSSTA-DTRGLA  67

Query  342  IIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPK  163
            +IMVD +K ++ ET  +IN L +                      +IP A EAL KG PK
Sbjct  68   LIMVDVLKNRATETLQVINQLLQ----------------------NIPVAIEALEKGDPK  105

Query  162  FAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            FAE   + ++  +  CE  F    SPLT  NT VHD   VA AII+ LL
Sbjct  106  FAETAAMDAAYEASYCEDNFN-GSSPLTKHNTLVHDTGAVAAAIIRNLL  153



>gb|KDP27950.1| hypothetical protein JCGZ_19030 [Jatropha curcas]
Length=175

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 92/170 (54%), Gaps = 3/170 (2%)
 Frame = -3

Query  522  MMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLA  343
            +  +L++  + L+ T    +   ++L+  TC+ +PNY LCV  + SD R+  AD    LA
Sbjct  8    LAHHLLVISVTLLGTQFVTVQSDANLIVQTCKNSPNYNLCVNSLRSDSRSTKADS-QGLA  66

Query  342  IIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKV-ILTASIPEAYEALTKGVP  166
            +IMV  +K ++ ET  +I    K    L+  L  C  +Y V IL+A IP A EAL KG P
Sbjct  67   LIMVHVLKNRATETLQVIKQELKRNPRLRKELSSCVENYDVGILSADIPVAIEALEKGDP  126

Query  165  KFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            KFAE     ++  +  CE  F    SPLT  N  VH+   VA AII+ LL
Sbjct  127  KFAETAARDAADEASFCEENFN-GNSPLTKYNKVVHETGAVAAAIIRPLL  175



>gb|ADZ54776.1| invertase inhibitor 2 [Solanum tuberosum]
Length=158

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 85/151 (56%), Gaps = 7/151 (5%)
 Frame = -3

Query  519  MRNLVLAMMLL----ILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRA---QGAD  361
            MRNL   +ML+    +   +   N   +L+ +TCR TP Y LC+  + SDPR+   +G D
Sbjct  1    MRNLFPILMLITNLALNNDNSNNNNNYNLIHATCRETPYYSLCLTTLQSDPRSNEVEGDD  60

Query  360  DITTLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEAL  181
             ITTL +IMVDA+K+KS E    I  L+K+  + +  L QC   Y  +L A +  A EAL
Sbjct  61   AITTLGLIMVDAVKSKSIEIMEKIKELEKSNPEWRAPLSQCYVAYNAVLRADVTVAVEAL  120

Query  180  TKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             KGVPKFAE G+      +Q C    + A+S
Sbjct  121  KKGVPKFAEDGMDDVVVEAQTCNFNSKYARS  151



>ref|XP_010110654.1| Putative invertase inhibitor [Morus notabilis]
 gb|EXC27499.1| Putative invertase inhibitor [Morus notabilis]
Length=191

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 90/147 (61%), Gaps = 4/147 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TC+RTP+Y+LCV  + S+P + GA D+  LA IMVD + +K+ ET   I +L K  
Sbjct  44   LIEKTCKRTPHYDLCVSSLESNPESSGA-DLRGLARIMVDLVLSKATETLDYIRSLLKQE  102

Query  267  ED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
             D  L+ +L  CA  Y  ++  S+P+A +AL  G   FA  G+  ++  +  C+  F K+
Sbjct  103  PDPELEKSLAYCAELYIPVVKYSLPQAIDALLGGHFGFANYGISDAAKQANACDKNFSKS  162

Query  93   Q-SPLTALNTEVHDLSDVATAIIKILL  16
              SPL   N+ ++DLS+VA AII ILL
Sbjct  163  STSPLAEKNSLLNDLSEVAAAIISILL  189



>gb|KHN32725.1| Pectinesterase inhibitor, partial [Glycine soja]
Length=134

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 86/138 (62%), Gaps = 4/138 (3%)
 Frame = -3

Query  429  RRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTREDLKTA  250
            +RTP   LC++++  DPRA  AD I  LA+I+V+ IKAK++E    I  L K   + K A
Sbjct  1    KRTPEPNLCLQLLKGDPRAPSAD-IAGLALILVEVIKAKAKEAEKTIKQLLKQGGN-KKA  58

Query  249  LEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALN  70
            L +CA DYK IL   IP+A  A+ +G PKFA+  V   +  +  CE  F   +SPLT +N
Sbjct  59   LSECAVDYKGILILDIPQATRAV-RGDPKFADDAVSDCAVEADICENRFN-GKSPLTHVN  116

Query  69   TEVHDLSDVATAIIKILL  16
              + D+++VA AII+ILL
Sbjct  117  NGMRDVANVARAIIRILL  134



>ref|XP_010027117.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
Length=172

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 92/161 (57%), Gaps = 5/161 (3%)
 Frame = -3

Query  534  LKIKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDI  355
            +K  M+  LV    LL++T  P     +DLV+ TC++TPN + CV ++S DPR+  AD  
Sbjct  1    MKTPMLFTLVSFTQLLLITILP--PASADLVDDTCKKTPNVDFCVTILSLDPRSSTAD-T  57

Query  354  TTLAIIMVDAIKAKSQETAIMINNLQKTREDLKT--ALEQCAFDYKVILTASIPEAYEAL  181
             TL +IMVD ++A ++ T   I  L+      +T  AL  C   Y  I++A +P + E+L
Sbjct  58   KTLGLIMVDKVEAHAKSTLTKIKYLRGKAAHPRTKQALPSCEQSYGFIVSAMVPPSKESL  117

Query  180  TKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVH  58
            TKG  KFA + + A+    Q+CE GF  ++SP++  N   H
Sbjct  118  TKGDYKFAVEYMNAAVNDVQECEAGFGGSKSPISDSNDYEH  158



>ref|XP_002525501.1| C, putative [Ricinus communis]
 gb|EEF36859.1| C, putative [Ricinus communis]
Length=181

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 97/177 (55%), Gaps = 24/177 (14%)
 Frame = -3

Query  501  AMMLLILTTSPIING------GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAI  340
            + +L+ +   P+IN       GS+L+E TCR+TP Y+LC+  + S+P +  A DI  LA 
Sbjct  3    SFLLVFVFIFPVINAAIPSIFGSNLIEKTCRKTPYYQLCISTLVSNPHSFDA-DIEGLAK  61

Query  339  IMVDAIKAKSQETAIMINNL------------QKTREDLKTALEQCAFDYKVILTASIPE  196
            IMV  I AK+  T   IN L            QK +++L+     CA  Y  IL   +P+
Sbjct  62   IMVHTIDAKATHTLNRINELLEQSQRGSRSHDQKEQQELR----DCADRYNEILKGDVPQ  117

Query  195  AYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIK  25
            A +AL KG  + A++    ++  +  CE  F   QSPL+ +N +VHD+S VA +I+K
Sbjct  118  AMQALHKGNFRSAKERTFDAAAEAISCEEEF-SGQSPLSDMNMKVHDISVVAASILK  173



>emb|CDO98740.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 96/166 (58%), Gaps = 4/166 (2%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMV  331
            L+    L++LT  P +    DL+  TC +TPN  LCVK++  D R+  AD +  LA++ V
Sbjct  9    LLFPYALVVLTIVPPL-ISCDLISETCDQTPNDRLCVKILRKDNRSLDAD-VAGLALVAV  66

Query  330  DAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEK  151
            +A++ K+  T   I  L+++   L  AL +C  +Y VIL   +P+A  ++ +  P+ AE 
Sbjct  67   EAVRDKANSTLQSIKELKRSNLTLANALMECQENYYVILRIDVPKAVGSMREN-PRLAEH  125

Query  150  GVVASSGSSQQCELGFQK-AQSPLTALNTEVHDLSDVATAIIKILL  16
            G+  +   +Q CE    K  QSPL  +N  V+DLS VA +II+ILL
Sbjct  126  GMADAVIEAQGCEASLNKLEQSPLADVNAAVYDLSVVALSIIRILL  171



>gb|ABI17897.1| invertase inhibitor [Coffea canephora]
Length=178

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 98/174 (56%), Gaps = 9/174 (5%)
 Frame = -3

Query  519  MRNLVLAMMLL-----ILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDI  355
            MRN    M+L      +LT  P +    DL+  TC +TPN  LCVK++  D R+  AD +
Sbjct  1    MRNFTSFMLLFPYALVVLTIVPPL-ISCDLISETCDQTPNDRLCVKILRKDNRSLDAD-V  58

Query  354  TTLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTK  175
              LA++ V+A++ K+  T   I  L+++   L  AL +C  +Y VIL   +P+A  ++ +
Sbjct  59   AGLALVAVEAVRDKANSTLQSIKELKRSNLTLANALMECQENYYVILRIDVPKAVGSMRE  118

Query  174  GVPKFAEKGVVASSGSSQQCELGFQK-AQSPLTALNTEVHDLSDVATAIIKILL  16
              P+ AE G+  +   +Q CE    K  QSPL  +N  V+DLS VA +II+I+L
Sbjct  119  N-PRLAEHGMADAVIEAQGCEASLNKLEQSPLADVNAAVYDLSVVALSIIRIML  171



>gb|AAX63191.1| putative invertase inhibitor precursor [Solanum tuberosum]
Length=153

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 3/113 (3%)
 Frame = -3

Query  444  VESTCRRTPNYELCVKVVSSDPRA---QGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            + +TCR TP Y LC+  + SDPR+   +G D ITTL +IMVDA+K+KS E    I  L+K
Sbjct  30   IHATCRETPYYSLCLTTLQSDPRSNEVEGDDAITTLGLIMVDAVKSKSIEIMEKIKELEK  89

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQC  115
            +  + +  L QC   Y  +L A +  A EAL KGVPKFAE G+      +Q C
Sbjct  90   SNPEWRAPLSQCYVAYNAVLRADVTVAVEALKKGVPKFAEDGMDDVVVEAQTC  142



>ref|XP_009372102.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Pyrus x bretschneideri]
Length=175

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 88/146 (60%), Gaps = 3/146 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++L++ TC++TPNY LCV  + SD R+ G  D+  L  I VD  K K+ +TA  IN L K
Sbjct  33   ANLIDQTCKKTPNYNLCVSSLKSDLRS-GKADVAGLGFITVDIAKDKATDTANRINELLK  91

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
                    L+ CA  Y  IL A +PEA +    G PKFAE+G+  ++ +++ CE  F  +
Sbjct  92   QSPS-DQRLKTCATFYHTILVADVPEASQGFKLGNPKFAEQGMNDAADAAEACEKEFS-S  149

Query  93   QSPLTALNTEVHDLSDVATAIIKILL  16
            +SPLT  N  VHDLS +A AI ++LL
Sbjct  150  KSPLTDKNKVVHDLSSIAAAIARLLL  175



>gb|ADM49016.1| putative invertase inhibitor [Solanum tuberosum]
Length=153

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 81/142 (57%), Gaps = 7/142 (5%)
 Frame = -3

Query  519  MRNLVLAMMLL----ILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRA---QGAD  361
            MRNL   +ML+    +   +   N   +L+ +TCR TP Y LC+  + SDPR+   +G D
Sbjct  1    MRNLFPILMLITNLALNNDNNNNNNNYNLIHATCRETPYYSLCLTTLQSDPRSNEVEGDD  60

Query  360  DITTLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEAL  181
             ITTL +IMVDA+K+KS E    I  L+K+  + +  L QC   Y  +L A +  A EAL
Sbjct  61   AITTLGLIMVDAVKSKSIEIMEKIKELEKSNPEWRAPLSQCYVAYNAVLRADVTVAVEAL  120

Query  180  TKGVPKFAEKGVVASSGSSQQC  115
             KGVPKFAE G+      +Q C
Sbjct  121  KKGVPKFAEDGMDDVVVEAQTC  142



>gb|ADZ54777.1| invertase inhibitor 2 [Solanum tuberosum]
Length=158

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 84/151 (56%), Gaps = 7/151 (5%)
 Frame = -3

Query  519  MRNLVLAMMLL----ILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRA---QGAD  361
            MRNL   +ML+    +   +   N   +L+ +TCR TP Y LC+  + SDPR+   +G D
Sbjct  1    MRNLFPILMLITNLALNNDNNNNNNNYNLIHATCRETPYYSLCLTTLQSDPRSNEVEGDD  60

Query  360  DITTLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEAL  181
             ITTL +IMVDA+K+KS      I  L+K+  + +  L QC   Y  +L A +  A EAL
Sbjct  61   AITTLGLIMVDAVKSKSIGIMEKIKELEKSNPEWRAPLSQCYVAYNAVLRADVTVAVEAL  120

Query  180  TKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
             KGVPKFAE G+      +Q C    + A+S
Sbjct  121  KKGVPKFAEDGMDDVVVEAQTCNFNSKYARS  151



>ref|XP_004288885.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Fragaria vesca subsp. vesca]
Length=146

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 87/148 (59%), Gaps = 13/148 (9%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINN-----  283
            L++ TCR+TPN  LCV  + SDPR+ GA D+  L IIMVD +KAK    AI+  N     
Sbjct  5    LIDETCRKTPNPNLCVSSLKSDPRSSGA-DVKGLGIIMVDVVKAK----AIIGQNKVSGL  59

Query  282  LQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF  103
            L+++  DL+  L+ C+ DY  I    +P A  A ++ +P  AE+ +  ++  ++ CEL F
Sbjct  60   LKQSPGDLR--LKVCSGDYDAISNHQVPNASLAFSRDIPHIAEEDMSEAADEARACELSF  117

Query  102  QKAQSPLTALNTEVHDLSDVATAIIKIL  19
               +SPLT +N  V D++ +  AI K L
Sbjct  118  S-GRSPLTDVNNAVADVASITAAIAKQL  144



>ref|XP_007035859.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative [Theobroma 
cacao]
 gb|EOY06785.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative [Theobroma 
cacao]
Length=181

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 85/152 (56%), Gaps = 4/152 (3%)
 Frame = -3

Query  462  NGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINN  283
             G ++LVE+TC++TP Y LC+  + SDPR+  A D+  L  I  D +KA++  T   I  
Sbjct  31   GGANNLVETTCKKTPFYNLCLSTLQSDPRSSRA-DLAGLVHIGADKVKARATATLRQIIG  89

Query  282  LQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCEL  109
            L +  +D  L+TAL  C   Y  I+   +P   EA+ KG PKF  +G   ++  +  CE 
Sbjct  90   LLRAAKDPKLQTALRDCVDLYDTIIKYDMPVTIEAVAKGNPKFGVQGATDAANEADDCER  149

Query  108  GF-QKAQSPLTALNTEVHDLSDVATAIIKILL  16
             F    +SP++  N  VHDLS +  +I ++LL
Sbjct  150  RFGNPPKSPISGSNKAVHDLSAIVASIAQLLL  181



>ref|XP_007223451.1| hypothetical protein PRUPE_ppa011560mg [Prunus persica]
 gb|EMJ24650.1| hypothetical protein PRUPE_ppa011560mg [Prunus persica]
Length=206

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 91/152 (60%), Gaps = 4/152 (3%)
 Frame = -3

Query  465  INGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMIN  286
            ++ G DL+E TC++TP+Y+LCV  + S+P++    D+  LA I+ D + AK+ +T   I+
Sbjct  53   LDEGGDLIEKTCKKTPHYDLCVSTLQSNPQSSNT-DVPGLAHIISDFLLAKATDTLDYIH  111

Query  285  NL--QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCE  112
             L  Q    +L+ AL  CA  Y  ++  S+P+A +ALT G   FA  G+  ++  +  CE
Sbjct  112  GLLKQSPEAELQKALANCAELYIPVVKFSLPQAIDALTNGHFGFANYGISDAAKEADACE  171

Query  111  LGFQKA-QSPLTALNTEVHDLSDVATAIIKIL  19
             GF  + +SPLT  N  V +LS VA AII +L
Sbjct  172  KGFSGSTKSPLTDGNKLVDNLSGVAVAIINLL  203



>gb|ADZ54775.1| invertase inhibitor 2 [Solanum tuberosum]
Length=153

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 80/142 (56%), Gaps = 7/142 (5%)
 Frame = -3

Query  519  MRNLVLAMMLL----ILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRA---QGAD  361
            MRNL   +ML+    +   +   N   +L+ STCR TP Y LC   + SDPR+   +G D
Sbjct  1    MRNLFPILMLITNLALNNDNNNNNNNYNLIHSTCRETPYYSLCPTTLQSDPRSNEVEGDD  60

Query  360  DITTLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEAL  181
             ITTL +IMVDA+K+KS E    I  L+K+  + +  L QC   Y  +L A +  A EAL
Sbjct  61   AITTLGLIMVDAVKSKSIEIMEKIKELEKSNPEWQAPLSQCYVAYNAVLRADVTVAVEAL  120

Query  180  TKGVPKFAEKGVVASSGSSQQC  115
             KGVPKFAE G+      +Q C
Sbjct  121  KKGVPKFAEDGMDDVVVEAQTC  142



>ref|XP_008390458.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=145

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 80/135 (59%), Gaps = 3/135 (2%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DL++ TC+ TPNY+LCV  + SDPR+  AD +  L +I+V+    K+ +    I  L K 
Sbjct  4    DLIDQTCKVTPNYDLCVSSLESDPRSAYAD-VAGLGLIIVNVATVKATDVVNKIEELLKQ  62

Query  270  REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQ  91
              + K  L+ C   Y+ +L A IPEA +    G PKFAE+G++ ++G ++ C+  F   +
Sbjct  63   NPEEK-PLKYCTRYYRKVLEADIPEASQGFRSGNPKFAEEGMIGATGEAESCQSSFS-GK  120

Query  90   SPLTALNTEVHDLSD  46
            SPLT +N    D+S+
Sbjct  121  SPLTDMNKGFQDVSN  135



>ref|XP_008368958.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=146

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 81/145 (56%), Gaps = 3/145 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++L+  TC +TP  +LCV  + SDPR+  AD +  L IIMVDA+KAK++E  +++  L  
Sbjct  3    ANLIAQTCNQTPYPDLCVSTLQSDPRSAKAD-VKGLGIIMVDAVKAKAREABLLVEELVD  61

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
             +E    A   C F+Y  I    IP+A EA  KG  K AE  +     ++  CE GF   
Sbjct  62   -KELGNVAASNCRFNYSDIFQLDIPQAVEAFPKGDYKSAELAMTNVVANADSCERGFSGG  120

Query  93   QSPLTALNTEVHDLSDVATAIIKIL  19
             SP    +  VHD++ VA AI K+L
Sbjct  121  -SPFKEQSQAVHDVAYVAAAIAKVL  144



>gb|EYU45481.1| hypothetical protein MIMGU_mgv1a021463mg, partial [Erythranthe 
guttata]
Length=137

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 77/128 (60%), Gaps = 4/128 (3%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINN-LQK  274
            +L+ +TC+ TPNY LC+  + +D R   A D+  L +IMV A+K KS+E    +N  L K
Sbjct  11   NLIATTCKNTPNYRLCINTLQAD-RGSAAADVAGLGLIMVAAVKEKSKEALSTVNKLLVK  69

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
            +  + K AL+QC   YK +L   +PEA ++L +G PKFAE G+   +  +  CE  F   
Sbjct  70   SGSNPKKALQQCRDAYKAVLEGDVPEAEQSL-RGNPKFAENGMADVAVEADSCEAAF-GG  127

Query  93   QSPLTALN  70
            +SPLT +N
Sbjct  128  KSPLTVVN  135



>ref|XP_007217364.1| hypothetical protein PRUPE_ppa022749mg [Prunus persica]
 gb|EMJ18563.1| hypothetical protein PRUPE_ppa022749mg [Prunus persica]
Length=181

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 83/147 (56%), Gaps = 2/147 (1%)
 Frame = -3

Query  456  GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQ  277
            G++L++ TC++TP Y+LCV  ++SDPR+  AD +  L ++M D +KAK+ ++   IN L 
Sbjct  37   GANLIDLTCKKTPYYDLCVISLNSDPRSYTAD-VAGLGVVMADVVKAKATDSLNKINELL  95

Query  276  KTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
             T+     +L  C   YK ++ A +P A EA   G  K A++G+  +      CE  F +
Sbjct  96   -TQSPGDRSLTTCVDYYKTVIEADVPLANEAFASGNAKLADQGMSDAGIVIDLCESQFSE  154

Query  96   AQSPLTALNTEVHDLSDVATAIIKILL  16
              SPLT  N   HD++ V   I + +L
Sbjct  155  GSSPLTDKNKAAHDVAAVGAGIARTML  181



>ref|XP_007035858.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative [Theobroma 
cacao]
 gb|EOY06784.1| Cell wall / vacuolar inhibitor of fructosidase 1, putative [Theobroma 
cacao]
Length=173

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 83/150 (55%), Gaps = 4/150 (3%)
 Frame = -3

Query  456  GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNL-  280
             S+L+E+TC++TP ++LCV  + SDPR+  AD +  LA I  D +  K+      I  L 
Sbjct  25   ASNLIETTCKQTPFFDLCVSSLQSDPRSSNAD-VAGLAHIAADNVNVKATANLQQITGLL  83

Query  279  -QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF  103
               T  +L+ AL+ C   Y  I+ A IP A EA+ KG PKFA      ++  +Q CE GF
Sbjct  84   GGATDPELQKALQGCVDKYNAIIQADIPVAIEAILKGNPKFAVSSATDAANEAQSCEKGF  143

Query  102  -QKAQSPLTALNTEVHDLSDVATAIIKILL  16
                +SP++  N  V+ LS V  +I  +LL
Sbjct  144  ANPPKSPISDSNKVVNQLSLVLQSIASLLL  173



>ref|XP_008367865.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=146

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 80/145 (55%), Gaps = 3/145 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++L+  TC +TP  +LCV  + SDPR+  A D+  L IIMVDA+KAK+ E ++ +  L  
Sbjct  3    ANLIAQTCNQTPYPDLCVSTLQSDPRSAKA-DVKGLGIIMVDAVKAKAHEASLQVEEL-V  60

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
             ++    AL+ C F+Y  I    IP+A EA  K   K AE G+     +   CE  F   
Sbjct  61   DKDPGNVALQDCRFNYDDIFQLDIPQAVEAFDKDDYKSAELGMTNVVANEDSCERRFSGG  120

Query  93   QSPLTALNTEVHDLSDVATAIIKIL  19
             SP    +  +HD++ VA AI K+L
Sbjct  121  -SPFKDESQALHDVAYVAAAIAKVL  144



>ref|XP_009372103.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Pyrus 
x bretschneideri]
Length=176

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 3/135 (2%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DL++ TC+ TPNY+LCV  + SDPR+  AD +  L +I+V+    K+ +    I  L K 
Sbjct  35   DLIDQTCKVTPNYDLCVSSLKSDPRSAYAD-VAGLGLIIVNVATVKATDVVNKIEELLK-  92

Query  270  REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQ  91
            +   +  L  C   Y+ +L A IPEA        PKFAE+G++ ++G ++ CE  F   +
Sbjct  93   QNPAEKPLTYCTRYYRKVLEADIPEASHGFRSDNPKFAEEGMIGATGEAESCESSFS-GK  151

Query  90   SPLTALNTEVHDLSD  46
            SPLT +N    D+S+
Sbjct  152  SPLTDMNKGFQDVSN  166



>ref|XP_010042127.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
Length=174

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 96/175 (55%), Gaps = 3/175 (2%)
 Frame = -3

Query  534  LKIKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDI  355
            +K  ++  L+    +L++T  P  +  +DLV  TCR+TP    C   +  DPR+  AD  
Sbjct  1    MKTPVLFKLLSFSQILLITVLPFASASTDLVNYTCRKTPYTVFCAAALGLDPRSSTAD-T  59

Query  354  TTLAIIMVDAIKAKSQETAIMINNLQKTREDLKT--ALEQCAFDYKVILTASIPEAYEAL  181
             TL +IMVD ++A ++ T   I  L+      +T  AL  C   Y  I++A +P + E+L
Sbjct  60   KTLGLIMVDKVEAHAKSTLTKIKYLRGKAAHPRTKQALTSCEQSYGFIVSAMVPPSKESL  119

Query  180  TKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            TKG  KFA + + A+    Q+CE GF  ++SP++  N   H  + VA+AI  +LL
Sbjct  120  TKGDYKFAVEYMNAAVNDVQECEAGFGGSKSPISDSNDYEHKAAAVASAIAGLLL  174



>ref|XP_008223407.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Prunus 
mume]
Length=205

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 89/152 (59%), Gaps = 4/152 (3%)
 Frame = -3

Query  465  INGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMIN  286
            ++ G DL+  TC++TP+Y+LCV  + S+P++    D+  LA I+ D + AK+ +T   I+
Sbjct  52   LDEGGDLIVKTCKKTPHYDLCVSTLQSNPQSSNT-DVPGLAHIISDFLLAKATDTLDYIH  110

Query  285  NL--QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCE  112
             L  Q    +L+ AL  CA  Y  ++  S+P+A +ALT G   FA  G+  ++  +  CE
Sbjct  111  GLLKQSPEAELQKALANCAELYIPVVKFSLPQAIDALTNGHFGFANYGISDAAKEADACE  170

Query  111  LGFQKA-QSPLTALNTEVHDLSDVATAIIKIL  19
              F  + +SPLT  N  V +LS VA AII +L
Sbjct  171  KEFSGSTESPLTDRNKLVDNLSGVAVAIINLL  202



>ref|XP_004508121.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=106

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 64/107 (60%), Gaps = 1/107 (1%)
 Frame = -3

Query  336  MVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFA  157
            MV  +KAK+ E    I+ LQ+     + AL  C+  YK IL A IP+A EAL KG PKFA
Sbjct  1    MVKVMKAKANEGLSKIHELQRVGNGARKALNSCSDKYKAILVADIPQAIEALQKGDPKFA  60

Query  156  EKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            E G   ++  +  CE GF   +SPLT  N  +HD+S VA AI++ LL
Sbjct  61   EDGANDAANEANYCESGFY-GKSPLTKQNNAMHDVSSVAAAIVRELL  106



>ref|XP_009780951.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
isoform X2 [Nicotiana sylvestris]
Length=135

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 79/148 (53%), Gaps = 37/148 (25%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++LVE+TC+ TPNY LC+K + SD R+ G  DITTLA+I+VDAIK K+ + A  I+ L++
Sbjct  23   NNLVETTCKNTPNYNLCLKTLLSDKRSAGG-DITTLALIVVDAIKVKANQAAEFISKLRQ  81

Query  273  TRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ  100
            +      +  L++CAF YK                                   CE  F+
Sbjct  82   SNPPTAWRVPLKKCAFSYK----------------------------------DCEENFK  107

Query  99   KAQSPLTALNTEVHDLSDVATAIIKILL  16
             + SPLT LNT V +LS V  AII+ LL
Sbjct  108  SSFSPLTGLNTAVLELSVVGRAIIRNLL  135



>ref|XP_008229307.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Prunus mume]
Length=146

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 82/147 (56%), Gaps = 2/147 (1%)
 Frame = -3

Query  456  GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQ  277
            G++L++ TC++TP Y+LCV  ++SDPR+  AD +  L ++M D +KAK+ ++   IN L 
Sbjct  2    GANLIDLTCKKTPYYDLCVISLNSDPRSYTAD-VGGLGVVMADVVKAKATDSLNKINELL  60

Query  276  KTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
            K     ++ L  C   YK ++   +  A EA   G  K A++G+  +      CE  F +
Sbjct  61   KQSPGDRS-LTICVDYYKTVIEGDVSLANEAFASGNAKLADQGMSDAGIVIDLCESQFSE  119

Query  96   AQSPLTALNTEVHDLSDVATAIIKILL  16
              SPLT  N   HD++ V  AI + +L
Sbjct  120  GSSPLTDKNKAAHDVAAVGAAIARTML  146



>ref|XP_010027116.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
 ref|XP_010042128.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
 gb|KCW61321.1| hypothetical protein EUGRSUZ_H04068 [Eucalyptus grandis]
Length=171

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 86/157 (55%), Gaps = 6/157 (4%)
 Frame = -3

Query  534  LKIKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDI  355
            +K  ++   +    +L++   P  +  +DLV+ TC++TP+ + C+  + SDPR+  AD  
Sbjct  1    MKTPVLFTFLSFTQILVIAILPFTS--ADLVDYTCKKTPHADFCISALRSDPRSSTAD-T  57

Query  354  TTLAIIMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEAL  181
             TL +IMVD + A ++ T   I +L +   D   K AL  C   YK  ++A +P + E+L
Sbjct  58   ATLGLIMVDKVDANAKSTVTKIKDLLRKSPDRGTKQALTSCEESYKYCISALVPSSKESL  117

Query  180  TKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALN  70
            TKG PKFA   +   +  +  CE GF   +SPL+  N
Sbjct  118  TKGDPKFAVDNMRQEAIQASSCEEGFG-GKSPLSGSN  153



>ref|XP_008345204.1| PREDICTED: uncharacterized protein LOC103408118 [Malus domestica]
Length=316

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 79/143 (55%), Gaps = 3/143 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++L+  TC +TP  +LCV  + SDPR+  AD +  L IIMVDA+KAK++E  +++  L  
Sbjct  3    ANLIAQTCNQTPYPDLCVSTLQSDPRSAKAD-VKGLGIIMVDAVKAKAREADLLVEELVD  61

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
             +E    A   C F+Y  I    IP+A EA  KG  K AE  +     ++  CE GF   
Sbjct  62   -KELGNVAASNCRFNYSDIFQLDIPQAVEAFPKGDYKSAELAMTNVVANADSCERGFSGG  120

Query  93   QSPLTALNTEVHDLSDVATAIIK  25
             SP    +  VHD++ VA AI K
Sbjct  121  -SPFKEQSQAVHDVAYVAAAIAK  142



>ref|XP_004508255.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=176

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 96/176 (55%), Gaps = 11/176 (6%)
 Frame = -3

Query  528  IKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITT  349
            ++M+++L + +   ++ T       ++LVE TC++T NY LC+K ++SDPR+  + D+  
Sbjct  1    MRMLKSLAVILCSFLVVTE----CNANLVEETCKKTQNYNLCIKCLNSDPRSSTS-DLNG  55

Query  348  LAIIMVDAIKAKSQETAIMINNLQKTRED-----LKTALEQCAFDYKVILTASIPEAYEA  184
            LA+IMV+ IK K+Q T I I  + +T  D      K  L  C  +Y  IL   + +AY A
Sbjct  56   LALIMVNTIKLKAQTTLIKIRQVIETIGDKLTPPQKQTLNSCTTNYNTILNVDVHDAYIA  115

Query  183  LTKGVPKFAEKGVVASSGSSQQCELGF-QKAQSPLTALNTEVHDLSDVATAIIKIL  19
            L +G P+ A+ GV  ++     CE  F +K    +  L   +  ++DVAT    I+
Sbjct  116  LQQGNPRAAKDGVNDAATKGSTCENDFSRKFPDGIGILGDTIKIMNDVATVASNII  171



>ref|XP_004298183.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Fragaria vesca subsp. vesca]
Length=142

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 84/144 (58%), Gaps = 13/144 (9%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINN-----  283
            L++ TC++TPN  LCV  + SDPR+ GA D+  L IIMVD +KAK    AI+  N     
Sbjct  5    LIDETCQKTPNPNLCVSSLKSDPRSSGA-DVKGLGIIMVDVVKAK----AIIGQNKVSGL  59

Query  282  LQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF  103
            L+++  DL+  L+  + DY  I    +P A  A ++ +P  AE+ +  ++  ++ CEL F
Sbjct  60   LKQSPGDLR--LKVGSGDYDAISNHQVPNASLAFSRDIPHIAEEDMSEAADEARACELSF  117

Query  102  QKAQSPLTALNTEVHDLSDVATAI  31
               +SPLT +N  V D++ +  AI
Sbjct  118  S-GRSPLTDVNNAVADVAAITAAI  140



>gb|KCW61322.1| hypothetical protein EUGRSUZ_H04069 [Eucalyptus grandis]
Length=174

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 86/154 (56%), Gaps = 3/154 (2%)
 Frame = -3

Query  471  PIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIM  292
            P  +  +DLV  TC++TP    C   +S DPR+  AD   TL +IMVD ++A ++ T   
Sbjct  22   PFASAPTDLVNYTCKKTPYTVFCAAALSLDPRSSTAD-TKTLGLIMVDKVEAHAKSTLTK  80

Query  291  INNLQKTREDLKT--ALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQ  118
            I  L+      +T  AL  C   Y  I++A +P + E+LTKG  KFA + + A+    Q+
Sbjct  81   IKYLRGKAAHPRTKQALPSCEQSYGFIVSAMVPPSKESLTKGDYKFAVEYMNAAVNDVQE  140

Query  117  CELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            CE GF  ++SP++  N   H  + VA+AI  +LL
Sbjct  141  CEAGFGGSKSPISDSNDYEHKAAAVASAIAGLLL  174



>ref|XP_008368766.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=146

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 3/145 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++L+  TC +TP  +LCV  + SDPR+  A D+  L IIMVDA++AK++E  + +  L  
Sbjct  3    ANLIAQTCNQTPYPDLCVSTLQSDPRSAKA-DVKGLGIIMVDAVRAKAREANLQVEELID  61

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
             RE   T    C  +Y  I    IP+A EA  K   K  E  +     ++  CE GF   
Sbjct  62   -REPGNTPATNCRLNYSDIFHLHIPDAVEAFPKDDYKSXELAMXNVVTNADSCERGFSGG  120

Query  93   QSPLTALNTEVHDLSDVATAIIKIL  19
             SP    +  +HD++ VA AI K+L
Sbjct  121  -SPFKDESQALHDVAYVAAAIAKVL  144



>ref|XP_010045343.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
Length=188

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 80/147 (54%), Gaps = 5/147 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L+E TCR TP Y+LC+  + SDP +  A DI  LA IM  ++ A +  T   I  L    
Sbjct  39   LIEQTCRLTPFYDLCLSSLKSDPTSSAA-DIRGLARIMAGSVLASASHTLDQIQELLGQA  97

Query  267  EDLKT--ALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF--Q  100
             D +T   L  CA  Y  ++  ++P+A +AL KG   FA  G+  +   +++CE  F  Q
Sbjct  98   PDPETEKPLAYCAELYIPVVKYTLPQALDALNKGQLGFAVYGLSDAGTEAEECEKNFSGQ  157

Query  99   KAQSPLTALNTEVHDLSDVATAIIKIL  19
               SP+T  N  V +L DVA AI+KIL
Sbjct  158  GGGSPVTQGNKLVRNLVDVALAIVKIL  184



>gb|AFK40449.1| unknown [Lotus japonicus]
Length=176

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 75/144 (52%), Gaps = 2/144 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
             V+  C++TP    CV+ +  DPR+ GAD +  LA+IMVD IKAK   T   I  L K  
Sbjct  33   FVDEICKQTPYPSDCVQFLRQDPRSSGAD-VKGLALIMVDVIKAKGTNTVNKIKQLLKGS  91

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQS  88
               K  L  C   YK ++  ++PEA   L  G    AE    A+S  +Q CE+ F   +S
Sbjct  92   TGEKKPLNICLDRYKGVVEINVPEAILTLKAGKITIAEDMAAATSDEAQYCEVIFH-GKS  150

Query  87   PLTALNTEVHDLSDVATAIIKILL  16
            PLT  N  +H  ++V   II+ LL
Sbjct  151  PLTIENNGMHVAAEVTRHIIRHLL  174



>ref|XP_004296231.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Fragaria vesca subsp. vesca]
Length=174

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 83/148 (56%), Gaps = 3/148 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNL--  280
            +DL+  TC++TP Y+LC+  + S        DI  LA IM D + + + +T   I++L  
Sbjct  27   TDLLSKTCKKTPYYDLCLSSLQSS-PQSSNSDIAGLAHIMADLVLSNATDTLDYIHSLLK  85

Query  279  QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ  100
            Q    DL+  L  CA  Y  ++  ++P++ +AL+ G   FA  G+  ++  +Q CE GF 
Sbjct  86   QSPEADLQKPLANCAELYIPVVKYTLPQSIDALSNGHYGFANYGISDAAKEAQACEKGFS  145

Query  99   KAQSPLTALNTEVHDLSDVATAIIKILL  16
             +  PLT  NT V  LS+VA AII ++L
Sbjct  146  GSTKPLTDRNTLVSCLSEVAVAIINLVL  173



>ref|XP_007035856.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY06782.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=181

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 89/155 (57%), Gaps = 5/155 (3%)
 Frame = -3

Query  471  PIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIM  292
            P I  G DLV+  C++TP Y+LC+  + S+ +   +D +  LA ++ D + A + +T   
Sbjct  27   PSIQCG-DLVDQICKQTPFYDLCISTLRSNSKGTESD-VKGLASVVADILLANATDTLNY  84

Query  291  INNL--QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQ  118
            I     Q +  +++ AL  CA  Y  ++  ++P+A EAL+KG  +FA  G+  ++  +  
Sbjct  85   IRAQINQASDPEMERALAYCAELYIPVVKYNLPQAIEALSKGQFEFASDGLSDAAKEADA  144

Query  117  CELGFQKAQ-SPLTALNTEVHDLSDVATAIIKILL  16
            CE  F  +  SPL+  N  +H LSDVA AI+KILL
Sbjct  145  CEKKFSGSMASPLSDRNKLLHSLSDVAVAIVKILL  179



>ref|XP_010685378.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Beta vulgaris subsp. vulgaris]
Length=184

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 87/149 (58%), Gaps = 4/149 (3%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNL-Q  277
            +DLV +TC++TP+  LC   + SD R+  A D   L +IM+D +K +  ++   + +L +
Sbjct  35   NDLVTTTCKQTPDPILCEASLRSDSRSSKAADSEGLILIMIDVVKTRFSDSFRYVEDLTR  94

Query  276  KTRE-DLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ  100
            KT + D+  AL++C   Y+V+L  S+  A  A+ +G PKF E+ +V +   ++ C + F 
Sbjct  95   KTHDPDVIRALQECKQLYRVVLDVSVGLAVRAVKQGDPKFGEQAMVDAGNEAEGCRMAFP  154

Query  99   KAQSP--LTALNTEVHDLSDVATAIIKIL  19
            + + P  +      +H +S+VA ++IK L
Sbjct  155  EGKVPGRIVGRTRMLHGVSNVAASMIKSL  183



>gb|KHN02873.1| hypothetical protein glysoja_009739 [Glycine soja]
Length=182

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 91/167 (54%), Gaps = 4/167 (2%)
 Frame = -3

Query  507  VLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVD  328
            +L +  ++ T +   +G  DLV+  C++TP Y+LC  ++ S+P A  +D    +A+IMV+
Sbjct  15   ILLLSCILFTPTHSSDGDGDLVDQICKKTPFYDLCSSILHSNPLAPKSDS-KGMALIMVN  73

Query  327  AIKAKSQETAIMINNL--QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAE  154
             I A + +T   I  L  Q + E L+  L  CA  Y  ++   +P+A +A+ +G   FA 
Sbjct  74   DILANATDTLSYIEELIKQTSDEQLEQQLAFCAESYIPVVKYILPQAADAINQGRFGFAS  133

Query  153  KGVVASSGSSQQCELGFQKA-QSPLTALNTEVHDLSDVATAIIKILL  16
              +V +      C+  F  + Q+PL+  N  +  L DVA AI+K+LL
Sbjct  134  YCIVDAQKEVNACDKKFSGSTQAPLSDRNDIMQKLVDVAAAIVKLLL  180



>ref|XP_008370564.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
 ref|XP_008367867.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=146

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 77/145 (53%), Gaps = 3/145 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++L+  TC +TP  +LCV  + SDPR+  A D+  L IIM+DA++AK+++    +  L  
Sbjct  3    ANLIAQTCNQTPCPDLCVSTLQSDPRSTKA-DVKGLGIIMIDAVRAKARDANRQLEEL-I  60

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
             R+       +C F+Y  I    IP+A EA  K   K AE  +     ++  CE GF   
Sbjct  61   NRDVGNVPAGKCRFNYSDIFQLDIPQAIEAFPKDDYKSAELAMTNVVANADSCERGFSGG  120

Query  93   QSPLTALNTEVHDLSDVATAIIKIL  19
             SP    +  +HD++ V  AI K+L
Sbjct  121  -SPFKDESQALHDVAYVVAAIAKVL  144



>gb|KDO71996.1| hypothetical protein CISIN_1g047345mg [Citrus sinensis]
Length=176

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 78/145 (54%), Gaps = 3/145 (2%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L++ TC+ T  Y LCV  + SDPR+  AD +  LAII+V+ ++AK+ ET   + +L K  
Sbjct  32   LIKETCKHTEYYNLCVASLESDPRSLNAD-VKELAIILVELLQAKANETLWHVGDLFKKV  90

Query  267  ED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
             D  L      C  +Y+ I+   IPEA +AL  G    ++K   A++  +  CE  F   
Sbjct  91   SDPALYRFYGTCIEEYRAIVERQIPEAIDALQSGDYMVSKKDAEAAAAHADSCEEQFAGE  150

Query  93   QSPLTALNTEVHDLSDVATAIIKIL  19
              P +  N  VH LS V ++I+ IL
Sbjct  151  TQPFSDQNKAVHGLSLVTSSILGIL  175



>ref|XP_007154406.1| hypothetical protein PHAVU_003G116900g [Phaseolus vulgaris]
 gb|ESW26400.1| hypothetical protein PHAVU_003G116900g [Phaseolus vulgaris]
Length=188

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 83/147 (56%), Gaps = 4/147 (3%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNL--QK  274
            LV+  CR+TP Y+LC  ++ S+P A   D    +A+IMV+ I+A + +T   I  L  Q 
Sbjct  41   LVDQICRKTPFYDLCSSILHSNPLAPKTDP-KGMALIMVNDIQANATDTLSYIEELIKQT  99

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ-K  97
            + E L+  L  CA  Y  ++   +P+A +A+++G   FA   +V +      C+  F   
Sbjct  100  SDEQLEQQLAFCAESYIPVVKYILPQAADAISQGRFGFASYCIVDAQKEVNACDKKFSAS  159

Query  96   AQSPLTALNTEVHDLSDVATAIIKILL  16
            +QSPL+  N  +  L DVA+AI+K+LL
Sbjct  160  SQSPLSDRNDIMQKLVDVASAIVKLLL  186



>ref|XP_010042126.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
Length=172

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 93/175 (53%), Gaps = 5/175 (3%)
 Frame = -3

Query  534  LKIKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDI  355
            +K  M+  LV    LL++T  P+    +DL++ TC++ P+ + C+ ++ SDPR+  AD  
Sbjct  1    MKTPMLFTLVSFAQLLLITILPL--ASADLIDDTCKKMPDVDSCIAILRSDPRSSTAD-T  57

Query  354  TTLAIIMVDAIKAKSQETAIMINNLQKTREDLKT--ALEQCAFDYKVILTASIPEAYEAL  181
             TL +I VD   + ++ T   I +L     D KT  AL  C   Y  I ++ +P + E+ 
Sbjct  58   PTLGLISVDTADSNAEVTLDEIKDLLGKSPDSKTKQALTSCEASYGNIRSSLVPPSRESF  117

Query  180  TKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            TKG  KFA + +  ++ ++  CE GF   +SP+   N    +   +A+AI   LL
Sbjct  118  TKGDYKFAVQYMNDAANAAAVCEAGFGGPKSPIYDANMFERNAGLLASAIASSLL  172



>ref|XP_008390456.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=149

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 72/132 (55%), Gaps = 1/132 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINN-LQKT  271
            LV+ TC++TPN++LC  ++ SDPR+  A+D   LA IMVD ++AK+ ++   IN+ L K+
Sbjct  5    LVDQTCKQTPNFDLCETLLRSDPRSLNAEDAKGLASIMVDIVQAKATKSMDKINDLLNKS  64

Query  270  REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQ  91
                +     C  +Y  I+   IP+A EA +      AE  +   +     C+  F    
Sbjct  65   PVKNQALFTSCIDNYNTIIDDDIPQASEAFSNDDNITAEDRLKDXTFEVDLCDKQFSGLS  124

Query  90   SPLTALNTEVHD  55
            +PL  +N +VHD
Sbjct  125  NPLKDVNKDVHD  136



>ref|XP_006419339.1| hypothetical protein CICLE_v10006511mg [Citrus clementina]
 gb|ESR32579.1| hypothetical protein CICLE_v10006511mg [Citrus clementina]
Length=176

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 3/145 (2%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L++ TC+ T  Y LCV  + SDPR+  AD +  LAII+V+ ++A + ET   + +L K  
Sbjct  32   LIQETCKHTDYYNLCVASLESDPRSLNAD-VKELAIILVELLQANANETLWHVGDLFKKV  90

Query  267  ED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
             D  L      C  +Y+ I+   IPEA +AL  G    ++K   A++  +  CE  F   
Sbjct  91   SDPALYRFYGTCIEEYRAIVERQIPEAIDALQSGDYMVSKKDAEAAAAHADSCEEQFAGE  150

Query  93   QSPLTALNTEVHDLSDVATAIIKIL  19
              P +  N  VH LS V ++I+ IL
Sbjct  151  TQPFSDQNKAVHGLSLVTSSILGIL  175



>ref|XP_008351148.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
 ref|XP_008351149.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=149

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 72/132 (55%), Gaps = 1/132 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINN-LQKT  271
            LV+ TC++TPN++LC  ++ SDPR+  A+D   LA IMVD ++AK+ ++   IN+ L K+
Sbjct  5    LVDQTCKQTPNFDLCETLLRSDPRSLNAEDAKGLASIMVDIVQAKATKSMDKINDLLNKS  64

Query  270  REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQ  91
                +     C  +Y  I+   IP+A EA +      AE  +   +     C+  F    
Sbjct  65   PVKNQALFTSCIDNYNTIIDDDIPQASEAFSNDDNITAEDRLKDVTFEVDLCDKQFSGLS  124

Query  90   SPLTALNTEVHD  55
            +PL  +N +VHD
Sbjct  125  NPLKDVNKDVHD  136



>ref|XP_008390454.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=149

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 72/132 (55%), Gaps = 1/132 (1%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINN-LQKT  271
            LV+ TC++TPN++LC  ++ SDPR+  A+D   LA IMVD ++AK+ ++   IN+ L K+
Sbjct  5    LVDQTCKQTPNFDLCETLLRSDPRSLNAEDAKGLASIMVDIVQAKATKSMDKINDLLNKS  64

Query  270  REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQ  91
                +     C  +Y  I+   IP+A EA +      AE  +   +     C+  F    
Sbjct  65   PVKNQALFTSCIDNYNTIIDDDIPQASEAFSNDDNITAEDRLKDITFEVDLCDKQFSGLS  124

Query  90   SPLTALNTEVHD  55
            +PL  +N +VHD
Sbjct  125  NPLKDVNKDVHD  136



>ref|XP_009372129.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Pyrus x bretschneideri]
Length=177

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 76/145 (52%), Gaps = 6/145 (4%)
 Frame = -3

Query  471  PIING------GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKS  310
            PII+G       + LV+ T ++TPN++LC  ++ SDPR+  A+D   LA IMVD ++AK+
Sbjct  20   PIIHGRIIFPMNAALVDQTYKQTPNFDLCETLLRSDPRSLNAEDAKGLASIMVDIVQAKA  79

Query  309  QETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSG  130
             ++   IN L K+  +       C  +Y  I+   IP+A EA +      AE  +   + 
Sbjct  80   TKSMDKINGLLKSPGENLALFTSCIDNYNTIIDDDIPQASEAFSNDDNITAEDRLKDVTF  139

Query  129  SSQQCELGFQKAQSPLTALNTEVHD  55
                C+  F    +PL  +N +VHD
Sbjct  140  EVDLCDKQFSGPSNPLKDVNKDVHD  164



>ref|XP_007147385.1| hypothetical protein PHAVU_006G119800g [Phaseolus vulgaris]
 gb|ESW19379.1| hypothetical protein PHAVU_006G119800g [Phaseolus vulgaris]
Length=188

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 85/157 (54%), Gaps = 4/157 (3%)
 Frame = -3

Query  477  TSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETA  298
            T P  +G  DLV+  C++TP Y+LC  ++ S+P +    D+  +A++MV+ I A + +T 
Sbjct  31   TFPWKDGDGDLVDQICKKTPFYDLCSSILHSNPLSSKP-DLKGVALLMVNNIVANATDTL  89

Query  297  IMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSS  124
              I  L K   D  L+ AL  CA  Y  ++   +P+A +A+++G   FA   +  +    
Sbjct  90   SYIEGLLKQTPDRELEQALAFCAESYIPLVKYILPQAADAISQGRFGFASYCISDALKEV  149

Query  123  QQCELGFQK-AQSPLTALNTEVHDLSDVATAIIKILL  16
              C+  F    Q+PL   N  V  L D+A+AIIK+LL
Sbjct  150  SSCDKKFSGTTQAPLGERNDIVQKLVDLASAIIKLLL  186



>ref|XP_010045344.1| PREDICTED: putative invertase inhibitor [Eucalyptus grandis]
Length=180

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 81/151 (54%), Gaps = 4/151 (3%)
 Frame = -3

Query  459  GGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNL  280
            G  DL++ TC +T  Y LC K + SDPR+  A D+  LA+IM++   A++ +T   I  L
Sbjct  29   GAGDLIDGTCGQTLYYGLCAKSLRSDPRSASA-DLKGLAVIMLNVTTAEAADTLSYIKAL  87

Query  279  QKTREDLKTA--LEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELG  106
             K + D   A  LE CA  Y  +   ++P A +AL +G  +FA+  +  ++     CE  
Sbjct  88   VKRKVDPAEAKPLEYCAGLYSPMARLTLPLAAKALIQGRYRFADYRLAEAAMQPPTCEGR  147

Query  105  FQKA-QSPLTALNTEVHDLSDVATAIIKILL  16
            F  A +SPLT  N   HDL  V+  I+  L+
Sbjct  148  FGGAVESPLTDRNVLAHDLCAVSMDIVNQLM  178



>ref|NP_001238267.1| uncharacterized protein LOC100527840 precursor [Glycine max]
 gb|ACU17031.1| unknown [Glycine max]
 gb|KHN12854.1| Pectinesterase inhibitor [Glycine soja]
Length=189

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 85/155 (55%), Gaps = 4/155 (3%)
 Frame = -3

Query  471  PIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIM  292
            P  +G  DLV+  C++TP Y+LC  ++ S+P +    D+  +A++MV+ I A + +T   
Sbjct  34   PWKDGNGDLVDQVCKKTPFYDLCSSILHSNPLSPKP-DLKGVALLMVNNILANATDTLSY  92

Query  291  INNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQ  118
            I  L K   D  L+ +L  CA  Y  I+   +P+A +A+++G   FA   +  +      
Sbjct  93   IEGLIKQTPDRELEQSLAFCAESYIPIVKYILPQAADAISQGRFGFASYCISDALKEVSS  152

Query  117  CELGFQKA-QSPLTALNTEVHDLSDVATAIIKILL  16
            C+  F  A Q+PL   N  V  L +VA+AI+K+LL
Sbjct  153  CDKKFSGATQAPLGDRNDIVQKLVNVASAIVKLLL  187



>ref|XP_003546307.1| PREDICTED: uncharacterized protein LOC100791177 [Glycine max]
 gb|KHN24851.1| Pectinesterase inhibitor [Glycine soja]
Length=188

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 93/172 (54%), Gaps = 8/172 (5%)
 Frame = -3

Query  510  LVLAMMLLILTTS----PIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLA  343
             +LA + + LT S    P  +G  DLV+  C++TP Y+LC  ++ S+P +    D+  +A
Sbjct  16   FLLASISIPLTQSQPSFPWKDGNGDLVDQICKKTPFYDLCSSILHSNPPSPKP-DLKGVA  74

Query  342  IIMVDAIKAKSQETAIMINNL--QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGV  169
            ++MV+ I A + +T   I  L  Q +  +L+ AL  CA  Y  I+   +P+A +A+++G 
Sbjct  75   LLMVNNILANATDTLSYIEGLIKQTSDRELEQALAFCAELYIPIVKYILPQAADAISQGR  134

Query  168  PKFAEKGVVASSGSSQQCELGFQ-KAQSPLTALNTEVHDLSDVATAIIKILL  16
              FA   +  +      C+  F   AQ+PL   N  V  L +VA AI+K+LL
Sbjct  135  FGFASYCISDALKEVSSCDKKFSGAAQAPLGDRNDIVQKLVNVAAAIVKLLL  186



>ref|XP_008340697.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Malus domestica]
Length=136

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 63/110 (57%), Gaps = 2/110 (2%)
 Frame = -3

Query  348  LAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGV  169
            L  I VD  KAK+ +TA  IN L K     +T L+ CA  Y  IL A IPEA +    G 
Sbjct  4    LGFITVDMAKAKATDTANRINELLKQSPSDQT-LKSCATFYHTILVADIPEASQGFKLGN  62

Query  168  PKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKIL  19
            PKFAE+G+  ++G+++ CE  F   +SPLT  N   HDLS +   I +++
Sbjct  63   PKFAEQGMNDAAGAAEACEKEFS-GKSPLTDKNKVFHDLSSITATIARLV  111



>ref|XP_003609811.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES92008.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
 gb|AFK46179.1| unknown [Medicago truncatula]
Length=179

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 81/147 (55%), Gaps = 3/147 (2%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNL--Q  277
            DLV+  C++TP Y+LC  ++ ++P A  +D    +A+IMV+ I A + +T   I  L  Q
Sbjct  32   DLVDQICKQTPFYDLCSSILHANPLAPKSDP-KGMALIMVNDILANATDTLSYIEELIKQ  90

Query  276  KTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
             T +DL+  L  CA  Y  ++   +P+A +A+++G   FA   +V +      C   F  
Sbjct  91   TTDKDLEQQLAFCAESYIPVVKYILPQAADAISQGRYGFASYSIVDAEKEIGACNKKFPG  150

Query  96   AQSPLTALNTEVHDLSDVATAIIKILL  16
            + S L   N+ +  L DVA AI+K+LL
Sbjct  151  SSSLLGDRNSIMQKLVDVAAAIVKLLL  177



>emb|CAD31845.1| putative invertase inhibitor [Cicer arietinum]
Length=77

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = -3

Query  249  LEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALN  70
            L  C+  YK IL A IP+A EAL KG PKFAE G   ++  +  CE GF   +SPLT  N
Sbjct  1    LNSCSDKYKAILVADIPQAIEALQKGDPKFAEDGANDAANEANYCESGFY-GKSPLTKQN  59

Query  69   TEVHDLSDVATAIIKILL  16
              +HD+S VA AI++ LL
Sbjct  60   NAMHDVSSVAAAIVRELL  77



>ref|XP_003550936.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Glycine max]
Length=184

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 93/172 (54%), Gaps = 4/172 (2%)
 Frame = -3

Query  522  MMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLA  343
            ++  L+L+ +L   T S   +G  DLV+  C++TP Y+LC  ++ S+P A  +D    +A
Sbjct  12   LLHILLLSCILFTPTDSSDGDGDGDLVDQICKKTPFYDLCSSILHSNPLAPKSDP-KGMA  70

Query  342  IIMVDAIKAKSQETAIMINNL--QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGV  169
            +IMV+ I   + +T   I  L  Q + E L+  L  CA  Y  ++   +P+A +A+ +G 
Sbjct  71   LIMVNGILTNATDTLSYIEELIKQTSDEQLEQQLAFCAESYIPVVKYILPQAADAINQGR  130

Query  168  PKFAEKGVVASSGSSQQCELGFQKA-QSPLTALNTEVHDLSDVATAIIKILL  16
              FA   +V +      C+  F  + Q+PL+  N  +  L DVA AIIK+LL
Sbjct  131  FGFASYCIVDAQKEVNACDKKFSGSTQAPLSDRNDIMQKLVDVAAAIIKLLL  182



>ref|XP_004296225.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Fragaria vesca subsp. vesca]
Length=166

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 73/141 (52%), Gaps = 7/141 (5%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            +DL++ TC+ TP   LCV V+ +DPR++G  D+   A IMV  ++ K+ +    I  L K
Sbjct  29   NDLIDDTCKGTPKPVLCVSVLRADPRSEGG-DVNDFAFIMVGEVEVKASDAMQQIGRLSK  87

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKA  94
            T+      +  C  +Y V++   IP+A +A   G    A + +    G +  CE GF   
Sbjct  88   TK-----PVSDCRENYVVVVRDDIPQAEDAAKGGDAGKATQLMNDVVGKADSCERGFH-G  141

Query  93   QSPLTALNTEVHDLSDVATAI  31
            +S LT  N  V D + VA A+
Sbjct  142  RSLLTKWNNAVKDFASVAAAL  162



>gb|AFK48253.1| unknown [Lotus japonicus]
Length=132

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 66/102 (65%), Gaps = 4/102 (4%)
 Frame = -3

Query  456  GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINN--  283
            G++L+E TC++TP+++LC+  + SDP++    D+T LA+IM++ +K ++      I++  
Sbjct  31   GTNLIEETCKQTPHHDLCIHYLKSDPQS-SKKDVTGLALIMINTMKTQANNALDKIHHLL  89

Query  282  LQKTRED-LKTALEQCAFDYKVILTASIPEAYEALTKGVPKF  160
            LQ + E  LK AL +CA  Y+ I+ A + +A   L KG PKF
Sbjct  90   LQGSSEPALKQALNECAGRYRAIVEADVAQANAGLQKGDPKF  131



>gb|KHN03271.1| hypothetical protein glysoja_004297 [Glycine soja]
Length=184

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 93/172 (54%), Gaps = 4/172 (2%)
 Frame = -3

Query  522  MMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLA  343
            ++  L+L+ +L   T S   +G  DLV+  C++TP Y+LC  ++ S+P A  +D    +A
Sbjct  12   LLHILLLSCILFTPTDSSDGDGDGDLVDQICKKTPFYDLCSSILHSNPLAPKSDP-KGMA  70

Query  342  IIMVDAIKAKSQETAIMINNL--QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGV  169
            +IMV+ I   + +T   I  L  Q + E L+  L  CA  Y  ++   +P+A +A+ +G 
Sbjct  71   LIMVNGILTNATDTLSYIEELIKQTSDEQLEQQLAFCAESYIPVVKYILPQAADAINQGR  130

Query  168  PKFAEKGVVASSGSSQQCELGFQKA-QSPLTALNTEVHDLSDVATAIIKILL  16
              FA   +V +      C+  F  + Q+PL+  N  +  L DVA AI+K+LL
Sbjct  131  FGFASYCIVDAQKEVNACDKKFSGSTQAPLSDRNDIMQKLVDVAAAIVKLLL  182



>ref|XP_004517182.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=176

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 78/150 (52%), Gaps = 4/150 (3%)
 Frame = -3

Query  456  GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQ  277
             +DLV+  CR+TPNY LC+  + S+P+A    D   +A+IMV+ I     +T      L 
Sbjct  26   NNDLVDQVCRKTPNYNLCISTLQSNPQAHNT-DTKGIALIMVNDIVLNVNDTLKFTEGLI  84

Query  276  KTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF  103
            K   D  L+  L+ CA  Y  ++   +P+A +A+ +   K+A   +  +      C   F
Sbjct  85   KKSTDVGLQKKLDFCAETYIPLVKYVLPQAGDAVNQSRFKYASYSISYAGKEIGSCNNKF  144

Query  102  QKA-QSPLTALNTEVHDLSDVATAIIKILL  16
              +  SPL+  N  +  L D+A+AI+K+LL
Sbjct  145  SASTTSPLSDRNGTIQKLFDIASAILKLLL  174



>ref|XP_006488812.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Citrus sinensis]
Length=176

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 78/149 (52%), Gaps = 11/149 (7%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L++ TC+ T  Y LCV  + SDPR+  AD +  LAII+V+ ++A + ET   + +L K  
Sbjct  32   LIQETCKHTDYYNLCVASLESDPRSLNAD-VKELAIILVELLQANANETLWHVGDLFKKV  90

Query  267  ED------LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELG  106
             D        T +E+    Y+ I+   IPEA +AL  G    ++K   A++  +  CE  
Sbjct  91   SDPALYRFYGTRIEE----YRAIVERQIPEAIDALQSGDYMVSKKDAEAAAAHADSCEEQ  146

Query  105  FQKAQSPLTALNTEVHDLSDVATAIIKIL  19
            F     P +  N  VH LS V ++I+ IL
Sbjct  147  FAGETQPFSDQNKAVHGLSLVTSSILGIL  175



>ref|XP_010098775.1| Pectinesterase inhibitor [Morus notabilis]
 gb|EXB75678.1| Pectinesterase inhibitor [Morus notabilis]
Length=186

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 75/149 (50%), Gaps = 4/149 (3%)
 Frame = -3

Query  456  GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQ  277
             ++ +E TC++T  Y+LC  ++ SDPR+  A D+  L  I V   +AK++ET   I  L 
Sbjct  34   ANNFIEQTCKQTAYYDLCTSILRSDPRSSDA-DVKGLTFIEVGVWEAKAKETLSHIEELI  92

Query  276  K--TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF  103
            K   ++D K AL  CA +Y  I+T  IP+A   L     K  E     +   +  C   F
Sbjct  93   KGSPKQDEKAALSSCANNYNAIITTDIPKAIGGLDANDFKTTEVSAEDACRKADSCAESF  152

Query  102  QKAQSPLTALNTEVHDLSDVATAIIKILL  16
                SPL+ +N  VHD + +   +  I+L
Sbjct  153  S-GSSPLSEMNKLVHDTAALTATMALIML  180



>ref|XP_008223467.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Prunus mume]
Length=173

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L++ TC++TPNY++CV  ++SDPR+ GA D+  L +IMVDA+K K+       N L K  
Sbjct  33   LIDKTCKQTPNYDVCVSTINSDPRSTGA-DVKGLGLIMVDAVKDKATGALNKANELLKQS  91

Query  267  EDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGV  145
                 AL  C   Y  +L   +P+  +A T+G  K AE+G+
Sbjct  92   PG-DQALLSCVKIYNEVLQNDVPQGSQAFTQGDSKSAEQGM  131



>ref|XP_004514989.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
 ref|XP_004514990.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=173

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 87/174 (50%), Gaps = 8/174 (5%)
 Frame = -3

Query  519  MRNLVLAMMLLILT----TSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDIT  352
            M+ + + +  L L     +  ++   +DLV+  CR+TPNY LC+  + S+P+A    D  
Sbjct  1    MKKISICVSFLFLNILHVSCSLVPQNNDLVDQVCRKTPNYNLCISTLQSNPQAHNT-DTK  59

Query  351  TLAIIMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALT  178
             +A+IMV+ I     +T      L K   D  L+  L+ CA  Y  ++   +P+A +A+ 
Sbjct  60   GIALIMVNDIVLNVNDTLKFTEGLIKKSTDVGLQKKLDFCAETYIPLVKYVLPQAGDAVN  119

Query  177  KGVPKFAEKGVVASSGSSQQCELGFQKA-QSPLTALNTEVHDLSDVATAIIKIL  19
            +   K+A   +  +      C   F  +  SPL+  N  +  L D+A+AI+K+L
Sbjct  120  QSRFKYASYSISYAGKEIGSCNNKFSASTTSPLSDRNGTIQKLFDIASAILKLL  173



>ref|XP_007208900.1| hypothetical protein PRUPE_ppa026908mg [Prunus persica]
 gb|EMJ10099.1| hypothetical protein PRUPE_ppa026908mg [Prunus persica]
Length=173

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 62/106 (58%), Gaps = 12/106 (11%)
 Frame = -3

Query  447  LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTR  268
            L++ TC++TPNY++CV  ++SDPR+ GA D+  L +IMVDA+K K+         L K  
Sbjct  33   LIDKTCKQTPNYDVCVSTLNSDPRSTGA-DVKGLGLIMVDAVKDKATGA------LNKAD  85

Query  267  EDLK-----TALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGV  145
            E LK      AL  C   Y  +L   +P+  +A T+G  K AE+G+
Sbjct  86   ELLKQSPGDQALLSCVKTYNEVLQNDVPQGSQAFTQGDSKSAEQGM  131



>ref|XP_004508124.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Cicer arietinum]
Length=176

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 79/150 (53%), Gaps = 4/150 (3%)
 Frame = -3

Query  456  GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQ  277
             +DLV+  C++TP Y+LC+  + S+P+A+   D   +A IMV+ I +    T   I  L 
Sbjct  26   NNDLVDQVCKKTPYYDLCISTLQSNPQAKNT-DTKGIAFIMVNDIVSNVSGTVNFIEGLM  84

Query  276  KTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF  103
            K  +D  L+  L+ C   Y  ++   +P A +A+ K   +FA   ++ +      C   F
Sbjct  85   KNTKDKVLEQNLQYCDERYIPLVKTILPHAADAVNKNRFQFANYTMIFALSEIDDCNKKF  144

Query  102  QKAQS-PLTALNTEVHDLSDVATAIIKILL  16
              + S PL+  N+ +  + DVA+AI+ +LL
Sbjct  145  TNSTSLPLSDRNSIIQKMLDVASAILTLLL  174



>ref|XP_003594702.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|ABN09094.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES64953.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=178

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 89/167 (53%), Gaps = 5/167 (3%)
 Frame = -3

Query  504  LAMMLLILTTSPIINGGS-DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVD  328
             A+ +++L + P  +  S DL++  C++TP Y+LC  +++S+P A    D+  +A++MV+
Sbjct  11   FAIHIILLASIPFTSSQSNDLIDQICKKTPFYDLCSSILNSNPLAPKT-DLKGVALVMVN  69

Query  327  AIKAKSQETAIMINNLQK--TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAE  154
             I   + +T   I +L K  T  +++ AL  CA  Y  ++  ++P+A +A+ +    FA 
Sbjct  70   NILTNASDTLNYIESLIKKTTDREMEKALAFCAESYIPVVKYTLPQAADAINQNRFGFAS  129

Query  153  KGVVASSGSSQQCELGFQK-AQSPLTALNTEVHDLSDVATAIIKILL  16
              +  +      C   F     SPL   N  V  L DVA+AIIK LL
Sbjct  130  YCISDAVKEVNSCNKKFSGVGMSPLGDRNGIVQKLVDVASAIIKQLL  176



>gb|AFK46429.1| unknown [Medicago truncatula]
Length=192

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 88/167 (53%), Gaps = 5/167 (3%)
 Frame = -3

Query  504  LAMMLLILTTSPIINGGS-DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVD  328
             A+ +++L + P  +  S DL++  C++TP Y+LC  +++S+P A    D   +A++MV+
Sbjct  11   FAIHIILLASIPFTSSQSNDLIDQICKKTPFYDLCSSILNSNPLAPKT-DFKGVALVMVN  69

Query  327  AIKAKSQETAIMINNLQK--TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAE  154
             I   + +T   I +L K  T  +++ AL  CA  Y  ++  ++P+A +A+ +    FA 
Sbjct  70   NILTNASDTLNYIESLIKKTTDREMEKALAFCAESYIPVVKYTLPQAADAINQNRFGFAS  129

Query  153  KGVVASSGSSQQCELGFQK-AQSPLTALNTEVHDLSDVATAIIKILL  16
              +  +      C   F     SPL   N  V  L DVA+AIIK LL
Sbjct  130  YCISDAVKEVNSCNKKFSGVGMSPLGDRNGIVQKLVDVASAIIKQLL  176



>gb|KDP27948.1| hypothetical protein JCGZ_19028 [Jatropha curcas]
Length=176

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 89/167 (53%), Gaps = 7/167 (4%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMV  331
            ++L  +LL  T+ P     SDL+   C++TP Y+LCV   S +P++    D+ T+A  + 
Sbjct  11   MILFYILLFSTSLPETQC-SDLINQICKKTPFYDLCVS--SLNPQSP-VSDVKTVASTLA  66

Query  330  DAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFA  157
            + I + + +T   I  L K   D  L+  L  CA  Y  ++  ++P+A +ALT+G   F 
Sbjct  67   NLILSNATDTLSYIQGLIKEGADPQLQKPLANCAELYIPVVRYNLPQAIDALTRGRFGFT  126

Query  156  EKGVVASSGSSQQCELGFQKA-QSPLTALNTEVHDLSDVATAIIKIL  19
               +  +   +  CE  F  + QSPL+  N  V +L DVA AI+K+L
Sbjct  127  SYLLSDAGKQADDCEKSFSGSNQSPLSFRNKLVSNLCDVAVAILKLL  173



>ref|NP_188339.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
 gb|AEE75909.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
Length=112

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = -3

Query  318  AKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVA  139
            A   ET   IN   KT+  LK  L++C+  YK I+   +  A  ++ KG PKFAE  VV 
Sbjct  13   ALGAETVGQINEAYKTKPMLKKPLDECSMRYKTIVDVDVHTAIISI-KGNPKFAEGAVVD  71

Query  138  SSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            +   +  CE GF K QSPLT+L   +  + DV  AII++LL
Sbjct  72   AGVEASICEGGFTKGQSPLTSLTQRMEKICDVTRAIIRMLL  112



>ref|XP_004486535.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=180

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 89/172 (52%), Gaps = 10/172 (6%)
 Frame = -3

Query  504  LAMMLLILTTSPIINGGSD----LVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAII  337
             A+ +L+L + P  +  +D    L++  C++TP Y+LC  +++S+P      D+ ++A++
Sbjct  8    FAIHILLLISIPFTSSQTDENNNLIDQICKKTPFYDLCTSILNSNPLTPKT-DLKSVALV  66

Query  336  MVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPK  163
            MV+ I   + +T   I  L K   D  ++ AL  CA  Y  ++  ++P+A +A+T+    
Sbjct  67   MVNNILTNASDTLNYIEGLIKKTSDREMEQALAFCAESYIPVVKYTLPQAADAITQNRFG  126

Query  162  FAEKGVVASSGSSQQCE---LGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            FA   V  +      C    LG     SPL   N  V  L DVA+AIIK LL
Sbjct  127  FASYCVSDAVKEVNSCNKKFLGSVTLLSPLGDRNGIVQKLVDVASAIIKQLL  178



>ref|XP_011019524.1| PREDICTED: uncharacterized protein LOC105122226 [Populus euphratica]
Length=175

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 82/154 (53%), Gaps = 8/154 (5%)
 Frame = -3

Query  471  PIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIM  292
            P+   G DLV+  C++TP Y+LC  V+S  P +    D+ +LA  M + + +   +T   
Sbjct  23   PLTQCG-DLVDKICKKTPFYDLC--VLSLQPNS--GTDVKSLASKMANLVLSNVTDTLNF  77

Query  291  INNL--QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQ  118
            I  L  Q+T   L+  L +CA  Y  ++  ++P+A +AL +G   FA       S  +  
Sbjct  78   IQGLVKQETGTSLERPLAECAELYIPVVKYNLPQAIDALIRGRYGFANYVFSDVSKQADA  137

Query  117  CELGFQ-KAQSPLTALNTEVHDLSDVATAIIKIL  19
            CE  F  + +SPLT  N  + +LSDVA AII IL
Sbjct  138  CEKHFSGENESPLTERNKLISNLSDVAVAIINIL  171



>gb|KFK39050.1| hypothetical protein AALP_AA3G194200 [Arabis alpina]
Length=152

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 66/119 (55%), Gaps = 2/119 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
             D V+ TC++TP+Y LC+ ++ SDP +  A +   L++ +VD IKA    T   I+   +
Sbjct  19   GDFVDKTCKQTPHYTLCLSLLRSDPSSSTA-NTAGLSLFLVDKIKALGITTLRHIDRAYE  77

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
             +  LK  L++C   YK I+   +  A  A+ KG PKFAE  + + S  +  CE GF K
Sbjct  78   MKPMLKRPLDKCNSRYKRIVGEYVKTAITAI-KGNPKFAEGAIASFSIEASLCEEGFAK  135



>ref|XP_004508126.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=176

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 77/148 (52%), Gaps = 4/148 (3%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DLV+  C++TP Y+LC   + S+P+A+   D   +A+IMV  I +   +T      L K 
Sbjct  28   DLVDQVCKKTPYYDLCNSTLQSNPQAKNT-DTKGIALIMVKDIVSNVNDTLNFTEGLIKN  86

Query  270  RED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
              D  L+  L+ CA  Y  ++ + +P+A +A+ +   K+A   +  +      C   F  
Sbjct  87   TSDVGLEKKLDFCAETYIPLVKSVLPQAVDAVNQSRFKYANYSIFYAGKEIGYCNNKFSG  146

Query  96   A-QSPLTALNTEVHDLSDVATAIIKILL  16
            +  SPL+  N  +  L D+A+AI+ +LL
Sbjct  147  STTSPLSDRNVTIQKLFDIASAILNLLL  174



>ref|XP_002525502.1| C, putative [Ricinus communis]
 gb|EEF36860.1| C, putative [Ricinus communis]
Length=115

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 14/117 (12%)
 Frame = -3

Query  336  MVDAIKAKSQETAIMINNL--------QKTREDLKTALEQCAFDYKVILTASIPEAYEAL  181
            MV  I+AK+  T   IN L         K RE LK     CA  Y  IL A +P+A + L
Sbjct  1    MVFTIEAKATHTLHRINELLEHSKGLSHKKREGLKA----CAERYNSILKADVPQALQGL  56

Query  180  TKGVPKFAEKGVVASSGSSQQCELGFQ--KAQSPLTALNTEVHDLSDVATAIIKILL  16
             KG  KFAE+G   ++  +  CE  F   K+ SP++ +N+ VHD+S VA +I++I+L
Sbjct  57   KKGNYKFAEEGSFDAATEAMSCEDEFSSCKSASPISEMNSLVHDVSIVAASIVQIML  113



>ref|XP_004508127.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=173

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 83/160 (52%), Gaps = 4/160 (3%)
 Frame = -3

Query  489  LILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKS  310
            L+  +  ++   +DLV+  C++TP Y+LC+  + S+P+A+   D   +A+IMV  I +  
Sbjct  15   LLHVSCSLVPQNNDLVDQVCKKTPYYDLCISTLQSNPQAKNT-DTKGIALIMVKDIVSNL  73

Query  309  QETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVAS  136
             +T      L K   D  LK  L+ CA  Y  ++   +P+A +A+ +   ++A   +  +
Sbjct  74   NDTLNFTQGLIKKTSDVGLKKNLDFCAETYIPLVKYVLPQAADAVNQSRFEYANYSINDA  133

Query  135  SGSSQQCELGFQKA-QSPLTALNTEVHDLSDVATAIIKIL  19
                  C   F  +  SPL+  N  +  L D+A+AI+K+L
Sbjct  134  GKEIGSCNNKFSGSTTSPLSDRNVTIQKLFDIASAILKLL  173



>ref|XP_002311377.2| invertase/pectin methylesterase inhibitor family protein [Populus 
trichocarpa]
 gb|EEE88744.2| invertase/pectin methylesterase inhibitor family protein [Populus 
trichocarpa]
Length=174

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 76/148 (51%), Gaps = 7/148 (5%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNL--  280
             DLV   C++TP Y+LC  V+S  P +    D+ TLA  M + + +   +T   I  L  
Sbjct  27   GDLVGQICKKTPFYDLC--VLSLQPNS--GTDVKTLASKMANLVLSNVTDTLNFIQGLVK  82

Query  279  QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ  100
            Q+T   L+  L  CA  Y  ++  ++P+A +AL +G   FA       S  +  CE  F 
Sbjct  83   QETGTSLERPLADCAELYIPVVKYNLPQAIDALIRGRYGFANYVFSDVSKQADACEKNFS  142

Query  99   -KAQSPLTALNTEVHDLSDVATAIIKIL  19
             + +SPLT  N  + +L DVA AII IL
Sbjct  143  GEDESPLTDRNKLISNLCDVAVAIINIL  170



>ref|XP_006419341.1| hypothetical protein CICLE_v10006032mg [Citrus clementina]
 ref|XP_006488814.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Citrus sinensis]
 gb|ESR32581.1| hypothetical protein CICLE_v10006032mg [Citrus clementina]
Length=176

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 76/153 (50%), Gaps = 4/153 (3%)
 Frame = -3

Query  468  IINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMI  289
            II    +L+   CRRTP  +LC+  +  +  +  + D+  LA IM + +   + +T   I
Sbjct  20   IIQCDDNLINQICRRTPFRDLCIATLEPNTNSS-SSDVKGLASIMANIVLGNASDTLNYI  78

Query  288  NNLQKTREDLKT--ALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQC  115
              L K   D +   AL  CA  Y  ++   +P+A +AL+KG   FA   +  +   +  C
Sbjct  79   EGLIKQAPDPQQERALANCAELYIPVVRYELPQAIDALSKGHFGFANYCIADAGKQADAC  138

Query  114  ELGFQ-KAQSPLTALNTEVHDLSDVATAIIKIL  19
            E GF   A+SPL+  N  +  L  +A AII +L
Sbjct  139  EKGFSGSAKSPLSDRNNLLKSLCGIAVAIINLL  171



>ref|XP_002885188.1| hypothetical protein ARALYDRAFT_318477 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61447.1| hypothetical protein ARALYDRAFT_318477 [Arabidopsis lyrata subsp. 
lyrata]
Length=112

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 56/101 (55%), Gaps = 1/101 (1%)
 Frame = -3

Query  318  AKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVA  139
            A   ET   IN   KT+  LK  L++C+  YK I+   +  A  A+ KG PKFAE  +V 
Sbjct  13   ALGAETLGQINEAYKTKPMLKKPLDECSLRYKTIVDVDVHTAIIAV-KGNPKFAEGAIVD  71

Query  138  SSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            +   +  CE GF K QS LT+L   +  + DV  AI++ILL
Sbjct  72   AGVEASICEGGFTKGQSTLTSLTQRMEKICDVTRAIVRILL  112



>ref|XP_002519255.1| enzyme inhibitor, putative [Ricinus communis]
 gb|EEF43119.1| enzyme inhibitor, putative [Ricinus communis]
Length=175

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 78/148 (53%), Gaps = 4/148 (3%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNL--Q  277
            DL+  TC++TP Y+LCV  + S+ +A  A D+  LA  M +   + +  T      +  Q
Sbjct  27   DLINRTCKKTPYYDLCVSSLQSNSQASSA-DVKGLASTMANITLSNATHTLYYSQEIIDQ  85

Query  276  KTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
             T  +L+ AL  CA  Y  I+   +P+A + +  G   F + G++ +    Q C+     
Sbjct  86   NTNPELERALTYCAEVYIPIVDYILPQAIDGVRNGHFGFFKYGILDAEEKVQACDKKIPD  145

Query  96   A-QSPLTALNTEVHDLSDVATAIIKILL  16
            + + PLT +N  + +L +V+ A+IKILL
Sbjct  146  SVKLPLTEMNRVMQNLCNVSVALIKILL  173



>ref|XP_006440545.1| hypothetical protein CICLE_v10023580mg [Citrus clementina]
 gb|ESR53785.1| hypothetical protein CICLE_v10023580mg [Citrus clementina]
Length=175

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 79/146 (54%), Gaps = 6/146 (4%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            +DL+  TC+++ +  +C  +  SDPR+ GA D+  LA I++D     + ET  +I  LQ 
Sbjct  27   ADLITETCKKSYSVSMCEPIFRSDPRSAGAKDVKGLAKILLDICIGNATETLNVIKKLQA  86

Query  273  TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQ---QCELGF  103
            +  +L+  L +CA DYK+++      A + L +   K A K  +A  G ++    CE  +
Sbjct  87   SDPNLEQLLSRCASDYKLMIEDDFGGAKKKLDENAYKEAAK--LAFYGGARGPVDCEGTY  144

Query  102  Q-KAQSPLTALNTEVHDLSDVATAII  28
            + K  SP+   NT++  L  +A +II
Sbjct  145  KDKKGSPIRQRNTDIAYLGLLARSII  170



>gb|AGX27452.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27453.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27454.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27455.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27456.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27457.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27458.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27459.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27460.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27461.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27462.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27463.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27464.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27465.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27466.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27467.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27468.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27469.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27470.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
 gb|AGX27471.1| cell wall and vascular inhibitor of beta-fructosidase [Populus 
angustifolia]
Length=175

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 76/148 (51%), Gaps = 7/148 (5%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNL--  280
             DLV   C++TP Y+LC  V+S  P +    D+ TLA  M + + +   +T   I  L  
Sbjct  28   GDLVGQICKKTPFYDLC--VLSLQPNS--GTDVKTLASKMANLVLSNVTDTLSFIQGLVK  83

Query  279  QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ  100
            Q+T   L+  L  CA  Y  ++  ++P+A ++L +G   FA       S  +  CE  F 
Sbjct  84   QETGTSLERPLADCAELYIPVVKYNLPQAIDSLIRGRYGFANYVFSDVSKQADACEKNFS  143

Query  99   -KAQSPLTALNTEVHDLSDVATAIIKIL  19
             + +SPLT  N  + +L DVA AII IL
Sbjct  144  GEDESPLTDRNKLISNLCDVAVAIINIL  171



>ref|XP_010024810.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Eucalyptus grandis]
 gb|KCW61320.1| hypothetical protein EUGRSUZ_H04067 [Eucalyptus grandis]
Length=179

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 77/148 (52%), Gaps = 5/148 (3%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DL++ TC++TP  +LC+  + S     GA  +  LA +M+    A + +T   +  L   
Sbjct  32   DLIKKTCKKTPYPDLCISSLRSHHIRSGAT-VHDLASMMLKLTLANATDTLSYMEALINQ  90

Query  270  RED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
             ED  L+  L+ CA  Y  ++  ++P+A  A  K    FAE GV  +   +  CE  F K
Sbjct  91   AEDPQLERPLDYCAELYIPVVKYTLPQAIVAFNKTQYGFAEYGVSDAGDQADTCENDFSK  150

Query  96   AQ--SPLTALNTEVHDLSDVATAIIKIL  19
            ++  SPL   N  V +L DVA AIIK+L
Sbjct  151  SKVSSPLGNRNKLVSELCDVAVAIIKML  178



>gb|AFK35451.1| unknown [Lotus japonicus]
Length=188

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 93/192 (48%), Gaps = 23/192 (12%)
 Frame = -3

Query  570  VPLHTTHNFKTKLKIKMMRNLVLAMMLLILTTSPII----NGGSDLVESTCRRTPNYELC  403
            VPLHT               L+++ +L  LT S  +      G DLV+  C++TP Y+LC
Sbjct  11   VPLHT---------------LLVSFLLFTLTHSSTLVKDGGDGGDLVDQICKKTPFYDLC  55

Query  402  VKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNL--QKTREDLKTALEQCAFD  229
              ++ S+P     D    +A+IMV+ I A + +T   I  L  Q + + L+  L  CA  
Sbjct  56   STILHSNPLTPKTDP-KGMALIMVNNILANATDTLNYIEMLIKQTSDQQLEQQLAFCAES  114

Query  228  YKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ-KAQSPLTALNTEVHDL  52
            Y  ++   +P+A +A+ +G   FA   +  +      C   F   A+SPL    + V  L
Sbjct  115  YIPVVKYILPQAADAINQGRFGFANYCIFDAEKELDACNKKFSGSAKSPLGDRTSIVQQL  174

Query  51   SDVATAIIKILL  16
             DVA AI+K+L+
Sbjct  175  VDVAEAIVKLLI  186



>gb|AFK44617.1| unknown [Lotus japonicus]
Length=184

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 79/151 (52%), Gaps = 5/151 (3%)
 Frame = -3

Query  456  GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQ  277
             SDL++  C++TP Y+LC+  + S P +    D+  LA++MV+ I A + +T   I  + 
Sbjct  32   SSDLIDQICKKTPFYDLCISTLHSSPLSPKT-DLKGLALLMVNQIVANASDTLSYIEGMI  90

Query  276  KTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF  103
            +  +D  ++ AL  CA  Y  ++   +P+A +A++     FA   V  +      C+  F
Sbjct  91   ENTKDPNMEQALAFCAELYIPVVKYILPQAADAISHNRFVFASYSVSEAMNELFSCDKKF  150

Query  102  --QKAQSPLTALNTEVHDLSDVATAIIKILL  16
                AQSPL    + V  L +V  AIIK+LL
Sbjct  151  LSGSAQSPLGDRTSIVQKLVEVGEAIIKLLL  181



>ref|XP_004508123.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=186

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 89/170 (52%), Gaps = 6/170 (4%)
 Frame = -3

Query  510  LVLAMMLLILTTSPII--NGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAII  337
            L+++  L  LT S  +  +  +DLV+  C++TP Y+LC  +++S+P    +D    +A+I
Sbjct  16   LLVSCFLFQLTQSFTLMRDEDNDLVDQICKKTPFYDLCSSILNSNPLTPKSDP-KGIALI  74

Query  336  MVDAIKAKSQETAIMINNLQK--TREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPK  163
            MV+ I A + +T   I  L K  T +DL+  L  CA  Y  ++   +P+A +A+ +    
Sbjct  75   MVNDILANATDTLDYIEELIKETTDKDLEQELAFCAESYIPVVKYILPQAADAINQSKFG  134

Query  162  FAEKGVVASSGSSQQC-ELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            FA   +V +      C +       SPL   N  +  L DVA AI+K+LL
Sbjct  135  FASYSIVDAEKEIDACSKKFSSSTSSPLGNRNNIMQKLVDVAAAIVKLLL  184



>ref|XP_007224999.1| hypothetical protein PRUPE_ppa020400mg, partial [Prunus persica]
 gb|EMJ26198.1| hypothetical protein PRUPE_ppa020400mg, partial [Prunus persica]
Length=140

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 60/105 (57%), Gaps = 12/105 (11%)
 Frame = -3

Query  444  VESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTRE  265
            ++ T ++TPNY++CV  ++SDPR+ GA D+  L +IMVDA+K K+         L K  E
Sbjct  34   IDKTRKQTPNYDVCVSSINSDPRSTGA-DVKGLGLIMVDAVKDKA------TGALNKADE  86

Query  264  DLK-----TALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGV  145
             LK      AL  C   Y  +L   +P+  +A T+G  K AE+G+
Sbjct  87   LLKQCPGDQALLSCVKIYNEVLQNDVPQGSQAFTQGDSKSAEQGM  131



>ref|XP_010052514.1| PREDICTED: putative invertase inhibitor [Eucalyptus grandis]
 gb|KCW76579.1| hypothetical protein EUGRSUZ_D00968 [Eucalyptus grandis]
Length=178

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 84/173 (49%), Gaps = 9/173 (5%)
 Frame = -3

Query  522  MMRNLVLAMMLL-ILTTSP-IINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITT  349
            +  NL   ++L  I   SP I    S LV+  C++TP+Y+ C   ++SDPR  GAD I T
Sbjct  9    LFCNLAFVVLLASIAAQSPRIAAADSGLVDKVCKQTPDYKFCSDALNSDPRTPGADQI-T  67

Query  348  LAIIMVDAIKAKSQETAIMINN-LQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKG  172
            LA +      +K+  T   I + L  +   +   LEQC  DY   + A I EA   L   
Sbjct  68   LARVAFSLANSKASSTQGEITSLLSNSTGPVHQHLEQCQGDYATAV-AKIQEALTNLDS-  125

Query  171  VPKFAEKGVVASSG--SSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKIL  19
               +A   V+A+    ++  CE  F+  +SPLT  N  +  LS++  A+  + 
Sbjct  126  -ETYAGLDVLATKAGDAADDCESAFKGTESPLTESNKVLKGLSEICVAVAHLF  177



>ref|XP_002304471.2| hypothetical protein POPTR_0003s12200g [Populus trichocarpa]
 gb|EEE79450.2| hypothetical protein POPTR_0003s12200g [Populus trichocarpa]
Length=182

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 92/177 (52%), Gaps = 9/177 (5%)
 Frame = -3

Query  522  MMRNLVLAMMLLILTT---SPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDIT  352
            M  +L L ++LLI T+   + + +   DL+E +C     YE CV+++ SDPRA  A ++ 
Sbjct  1    MAPSLFLVLVLLISTSQCSATLQDKQPDLIEKSCSIIVGYEDCVRILRSDPRAIKATNVK  60

Query  351  TLAIIMVDAIKAKSQETAIMINNLQ-KTRED--LKTALEQCAFDYKVILTASIPEAYEAL  181
             LA I++D   A + ET   I  LQ K ++D  ++ AL +CA +Y+        +A E L
Sbjct  61   ELAYIILDLCIANATETLREIPKLQEKYKKDGQIEEALRRCAVEYESADKVYFRKAVEQL  120

Query  180  TKGVPKFAEKG--VVASSGSSQQCELGFQKAQ-SPLTALNTEVHDLSDVATAIIKIL  19
                 + A+    V  + G+S + E  FQ  + SPL   N ++  L  VA  I+ +L
Sbjct  121  GTKSYREAQNSAHVGGALGTSCEQEFYFQAPEFSPLWLRNHDLAVLGTVAEGIVSLL  177



>ref|XP_004300864.1| PREDICTED: uncharacterized protein LOC101308973 [Fragaria vesca 
subsp. vesca]
Length=106

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 62/108 (57%), Gaps = 3/108 (3%)
 Frame = -3

Query  336  MVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFA  157
            MVD +KAK+ E A  I++L K R     AL  C   Y V+LTA +  A EALTKG  +FA
Sbjct  1    MVDVVKAKAIECANRIDHLLKHRPG-DQALRNCKRIYSVVLTADVTVAVEALTKGNLQFA  59

Query  156  EKGV-VASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
            E+ +   +   +  CE GF  A SP+T LN     L  VA AI+++LL
Sbjct  60   EQSMDDIAMFEAVLCEDGFIGA-SPMTDLNNASQKLGAVAAAIVRLLL  106



>ref|XP_004296224.1| PREDICTED: uncharacterized protein LOC101304956 [Fragaria vesca 
subsp. vesca]
Length=181

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 89/178 (50%), Gaps = 20/178 (11%)
 Frame = -3

Query  507  VLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVD  328
            +L + ++ +   PI +  +DL++ TC++TPNY LCV  +  +PR+  A ++  LA IMV+
Sbjct  10   LLTIFIIQIVLLPISHCRADLIDQTCKQTPNYNLCVSSLKPNPRSSAA-NVKGLATIMVE  68

Query  327  AIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALT-KGVPKFAEK  151
             + +K+ +T   I      +ED   A+  C   Y  ++ A IPE Y  LT +G   F  +
Sbjct  69   VLTSKANDTLNEIWAQLLRQED--PAVRNCYDHYGYMVAAFIPEIYGDLTSRG---FGGR  123

Query  150  GVVASSGSSQQ------------CELGFQKA-QSPLTALNTEVHDLSDVATAIIKILL  16
             V  +   +++            C  GF K  +SP         + + VA AI++IL+
Sbjct  124  FVRYNPAQAERRLHDDIIRRVDHCRHGFGKGRRSPFAKEIKATREAAVVAAAIVRILI  181



>gb|KDP45596.1| hypothetical protein JCGZ_17203 [Jatropha curcas]
Length=115

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -3

Query  336  MVDAIKAKSQETAIMINNLQKTREDL-----KTALEQCAFDYKVILTASIPEAYEALTKG  172
            M+  I AK+      INNL      L     +  L  CA  Y VI+   +P++ EAL  G
Sbjct  1    MIYTIDAKATNALERINNLLDQSSSLISLEERQELRVCADRYSVIIRGDVPQSIEALRTG  60

Query  171  VPKFAEKGVVASSGSSQQCELGFQK-AQSPLTALNTEVHDLSDVATAIIKILL  16
               FA +G   ++  +  CE GF +  +SP++ +N  VHD+S VA +I KI++
Sbjct  61   NYNFAYEGASDAAAEAMSCEEGFSRVGKSPISEINIAVHDVSVVAASINKIII  113



>ref|XP_004508256.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Cicer arietinum]
Length=175

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 85/174 (49%), Gaps = 7/174 (4%)
 Frame = -3

Query  519  MRNLVLAMMLLIL---TTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITT  349
            M+ + + + +LIL     S  +     L    C +T +++LC+ ++ SDP A  A DI  
Sbjct  1    MKRIWICIFILILEIVDVSCAVKRDDSLKTRVCEQTSSFDLCISIIDSDPNATTA-DIKG  59

Query  348  LAIIMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTK  175
            LA+IMV A+    Q    + N++ KT  D  LK  L  CA  +  +L + +P+A +A+ +
Sbjct  60   LALIMVTAVPPYVQNALSLTNSVIKTTTDATLKKKLFVCAKSFVPLLNSVLPQAAQAVNQ  119

Query  174  GVPKFAEKGVVASSGSSQQCELG-FQKAQSPLTALNTEVHDLSDVATAIIKILL  16
               K A   +  +    + C    F   QSP+    +  H + +VA  I+K +L
Sbjct  120  KRFKNASDSIFYADKVIEDCNSQFFTPTQSPIIEKTSLAHGVLNVAEDILKQIL  173



>ref|XP_006369713.1| hypothetical protein POPTR_0001s29550g [Populus trichocarpa]
 gb|ERP66282.1| hypothetical protein POPTR_0001s29550g [Populus trichocarpa]
Length=112

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 63/109 (58%), Gaps = 3/109 (3%)
 Frame = -3

Query  336  MVDAIKAKS--QETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPK  163
            M+  I A++    T  ++++  K   ++K AL+ CA  Y  I+   IP + +AL  G  K
Sbjct  1    MIRTINARACKPHTTPLLDHEYKDDTNMKQALQSCADQYDAIIKGDIPLSLKALRSGDYK  60

Query  162  FAEKGVVASSGSSQQCELGF-QKAQSPLTALNTEVHDLSDVATAIIKIL  19
            F+E+G + ++  +  CE  F  + +SPL+ +N  VHD+S VA +I+K +
Sbjct  61   FSERGTMDAAVEAGPCEKEFTTRCRSPLSDMNRVVHDVSVVAASIVKTM  109



>emb|CDY34999.1| BnaA01g27350D [Brassica napus]
Length=183

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 77/153 (50%), Gaps = 10/153 (7%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DL+++ C+ TP ++LC    S  P +    D  ++A  M + +     +T   I +L + 
Sbjct  30   DLIDTICKATPFFDLCE--ASLRPLSPSPPDTKSIASAMANVVLGNMTDTLGYIQSLIRH  87

Query  270  RED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
             +D   + AL QCA  Y+ ++  +IP+A EA+ +G   FA   +  +   S  C+     
Sbjct  88   SQDPAAERALAQCAEVYRPVVRFNIPQAIEAMGRGEFGFAMYVLGDAQKQSDSCQKWINS  147

Query  96   AQS------PLTALNTEVHDLSDVATAIIKILL  16
            A +      PLTA N  V +L DVA ++IK L+
Sbjct  148  AGADDESSVPLTARNKLVKNLCDVAISVIKSLM  180



>ref|XP_008808258.1| PREDICTED: putative invertase inhibitor [Phoenix dactylifera]
Length=175

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 88/178 (49%), Gaps = 14/178 (8%)
 Frame = -3

Query  522  MMRNLVLAMMLLILTTSPIINGGSDLVESTCR----RTPN--YELCVKVVSSDPRAQGAD  361
            M  ++ L   LLIL  S  +   S  V+ TC+    R+PN  Y  CV  +S+DP++ G+ 
Sbjct  1    MAASIALLCFLLILNQSSSLVSAS--VQQTCKTVAERSPNINYNFCVASLSADPKS-GSA  57

Query  360  DITTLAIIMVDAIKAKSQETAIMINN-LQKTRED-LKTALEQCAFDYKVILTASIPEAYE  187
            D   LA+I     KAK+  T   I+N L+KTR+   K  L  C+  Y   L  ++ +   
Sbjct  58   DTQGLAVIATKLAKAKATTTQSTISNLLKKTRDKATKECLSDCSTMYS-DLVDTLKDTVR  116

Query  186  ALTKGVPKFAEKGVVASSGSSQQCELGFQ--KAQSPLTALNTEVHDLSDVATAIIKIL  19
            A+T      A+  + A+      CE  F   K +SPLT  N +  +LS +A  I K+L
Sbjct  117  AITSKRYSDAKTYLSAALDVGDDCEHEFAELKVKSPLTKENNDSRELSTLALVITKLL  174



>ref|XP_007154402.1| hypothetical protein PHAVU_003G116500g [Phaseolus vulgaris]
 gb|ESW26396.1| hypothetical protein PHAVU_003G116500g [Phaseolus vulgaris]
Length=189

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 76/163 (47%), Gaps = 5/163 (3%)
 Frame = -3

Query  489  LILTTSPIIN--GGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKA  316
            LI   +PI++    + L+E  C ++PNY LCV  + S    +  +D+   A + ++ + +
Sbjct  18   LIFLITPILSILTHAGLLEQICHQSPNYHLCVMTLRSSIHHRSREDMAGFARLTLEIVNS  77

Query  315  KSQETAIMINNL--QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVV  142
             S  T   I+    + T   +K ALE C   Y  I+   + EA +A+ +   K A++ + 
Sbjct  78   NSSTTLEHIHKSYGETTNPKVKKALEYCLVSYNTIVDVHLREALDAMKESNYKIAQQKIY  137

Query  141  ASSGSSQQCELGFQK-AQSPLTALNTEVHDLSDVATAIIKILL  16
                  + C   F+    SPL   N  V +L  +  +II  L+
Sbjct  138  VIIIEVESCNNKFKNLVISPLRNTNRYVQNLCSITISIINNLI  180



>ref|XP_006431605.1| hypothetical protein CICLE_v10003542mg [Citrus clementina]
 gb|ESR44845.1| hypothetical protein CICLE_v10003542mg [Citrus clementina]
 gb|KDO40790.1| hypothetical protein CISIN_1g042545mg [Citrus sinensis]
Length=183

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 85/178 (48%), Gaps = 20/178 (11%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIING----GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLA  343
            + L M L  L+  P I G     +DL+E+TCR+T   +LC+K + S P + GA D+  LA
Sbjct  11   MFLLMTLCFLSNKPGIVGVRGEENDLIEATCRKTSYPDLCIKTLRSSPGSSGA-DVKALA  69

Query  342  IIMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKG-  172
             I++++  A   +T   +  L    +D  ++  L+ C F    +    IP A + L  G 
Sbjct  70   HIILESASAYCNDTYEQVKKLLNETKDKAMRNCLDVC-FQVYDLAIYEIPTAIKYLESGD  128

Query  171  ---VPKFAEKGVVASSGSSQQCELGFQK----AQSPLTALNTEVHDLSDVATAIIKIL  19
                 ++A  G++     S  CE  F +     +SPLT  N  + +L  +   +I +L
Sbjct  129  YDSAVQYANDGII----ESDTCESSFSEFPEIPKSPLTDRNNGLTNLCTIVLDMINLL  182



>ref|XP_003609804.1| hypothetical protein MTR_4g122660 [Medicago truncatula]
 gb|AES92001.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=185

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 76/152 (50%), Gaps = 4/152 (3%)
 Frame = -3

Query  459  GGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQET--AIMIN  286
              + L+E  CR++P+Y LC   + S    +  +DI   A + ++ +KA +  T   +   
Sbjct  25   SHTSLLEQICRQSPHYHLCTMTLRSSINHRSKEDIAGFARLTLEIVKANASLTLEHVQKG  84

Query  285  NLQKTRE-DLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCEL  109
             +Q+T   + K A+  C   Y +I+   + EA  A+ K   K  ++ V A+S  ++ CE 
Sbjct  85   YIQQTNGLEQKRAMRDCIALYNMIVNVHLREALNAMEKYDYKIVKQRVYAASIQAEICEN  144

Query  108  GFQKAQS-PLTALNTEVHDLSDVATAIIKILL  16
             F+ + + PL   N  V +L  +A +I+  LL
Sbjct  145  KFKNSLTKPLKDTNRYVQNLCIIAASIVNKLL  176



>ref|XP_006841650.1| hypothetical protein AMTR_s00003p00239480 [Amborella trichopoda]
 gb|ERN03325.1| hypothetical protein AMTR_s00003p00239480 [Amborella trichopoda]
Length=181

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 82/159 (52%), Gaps = 9/159 (6%)
 Frame = -3

Query  477  TSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETA  298
            T P+ +  S+LVE  C++T  Y+ CV+ + S+P A+   D+  L +I +D   AK++ T 
Sbjct  25   TEPL-SHSSNLVEKVCKQTKYYDFCVRQLDSNP-ARAKADLAGLGVIALDQAIAKAKSTY  82

Query  297  IMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSS  124
              I  LQ   E+  L  AL  C+  Y V     + ++  ++       A   V AS  +S
Sbjct  83   SYIQELQNKTENPSLLQALGDCSELY-VDAIDQLEDSKRSIELKDYADANMWVSASMAAS  141

Query  123  QQCELGFQKAQ----SPLTALNTEVHDLSDVATAIIKIL  19
              CE GF + +    SPL+  N+++  L  +A AI+K+L
Sbjct  142  DTCEEGFAEQEEALPSPLSKNNSQLSKLGSIALAILKLL  180



>gb|KHN03275.1| Pectinesterase inhibitor, partial [Glycine soja]
Length=170

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 67/148 (45%), Gaps = 3/148 (2%)
 Frame = -3

Query  465  INGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMIN  286
            I   + L+E  CR++P+Y LCV  + S    +   DI   A + ++ + A +  T   I 
Sbjct  22   ILSHTSLLEQICRQSPHYHLCVMTLRSSIHHRSKADIAGFAHLTLEIVNANASITLEHIP  81

Query  285  NLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCE  112
                  ED  LK AL+ C   Y  I+   + EA  A+  G  +  ++    +   ++ C 
Sbjct  82   KFHGQTEDPKLKMALKDCLVSYNTIVKVHLREALNAMDVGDYRAVQQKAYVTIIEAESCN  141

Query  111  LGFQK-AQSPLTALNTEVHDLSDVATAI  31
              F+  A SPL   N  V +L  +A +I
Sbjct  142  TKFRNLATSPLRDTNRYVQNLCAIAISI  169



>ref|XP_006492567.1| PREDICTED: pectinesterase inhibitor-like [Citrus sinensis]
Length=183

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 88/178 (49%), Gaps = 20/178 (11%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIING----GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLA  343
            + + +ML   +  P + G     +DL+E+ C++T   ++C+K + S P + GA D+  LA
Sbjct  11   MFIVIMLCFSSNRPGVEGVRGEENDLIEAICKKTSYPDVCIKTLRSSPGSSGA-DVKGLA  69

Query  342  IIMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKG-  172
             I+V++    S +T   I  L K  +D  ++  L+ C F    +    IP+A + L  G 
Sbjct  70   HIIVESASTYSNDTYEQIKKLLKETKDKAMRNCLDVC-FQVYDLTIHDIPKAIKYLESGD  128

Query  171  ---VPKFAEKGVVASSGSSQQCELGFQK----AQSPLTALNTEVHDLSDVATAIIKIL  19
                 ++A  G++     S  CE  F++     +SPLT  N  + +L  +A  +I +L
Sbjct  129  YDSATEYANDGII----DSDTCESSFKEFPEIPKSPLTDRNNGLTELCVIALDMINLL  182



>ref|XP_009114389.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Brassica rapa]
Length=183

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 76/153 (50%), Gaps = 10/153 (7%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DL+++ C+ TP ++LC    S  P +    D  ++A  M + +     +T   I +L + 
Sbjct  30   DLIDTICKATPFFDLCE--ASLRPLSPSPPDTKSIASAMANVVLGNMTDTLGYIQSLIRH  87

Query  270  RED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
             +D   + AL QCA  Y+ ++  +IP+A EA+ +G   FA   +  +   S  C+     
Sbjct  88   SQDPAAERALAQCAEVYRPVVRFNIPQAIEAMGRGEFGFAMYVLGDAQKQSDSCQKWINS  147

Query  96   AQS------PLTALNTEVHDLSDVATAIIKILL  16
            A +      PLTA N  V +L DV  ++IK L+
Sbjct  148  AGADDESSVPLTARNKLVKNLCDVEISVIKSLM  180



>ref|XP_006431609.1| hypothetical protein CICLE_v10002621mg [Citrus clementina]
 gb|ESR44849.1| hypothetical protein CICLE_v10002621mg [Citrus clementina]
Length=183

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 88/178 (49%), Gaps = 20/178 (11%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIING----GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLA  343
            + + +ML   +  P + G     +DL+E+ C++T   ++C+K + S P + GA D+  LA
Sbjct  11   MFIVIMLCFSSNRPGVEGVRGEENDLIEAICKKTSYPDVCIKTLRSSPGSSGA-DVKGLA  69

Query  342  IIMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKG-  172
             I+V++    S +T   I  L K  +D  ++  L+ C F    +    IP+A + L  G 
Sbjct  70   HIIVESASTYSNDTYEQIKKLLKETKDKAMRNCLDVC-FQVYDLTIHDIPKAIKYLESGD  128

Query  171  ---VPKFAEKGVVASSGSSQQCELGFQK----AQSPLTALNTEVHDLSDVATAIIKIL  19
                 ++A  G++     S  CE  F++     +SPLT  N  + +L  +A  +I +L
Sbjct  129  YDSATEYANDGII----DSDTCESSFKEFPEIPKSPLTDRNNGLTELCVIALDMIDLL  182



>gb|KDO71994.1| hypothetical protein CISIN_1g0317991mg, partial [Citrus sinensis]
Length=150

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 65/132 (49%), Gaps = 4/132 (3%)
 Frame = -3

Query  468  IINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMI  289
            II    +L+   CRRTP  +LC+  +  +  +  + D+  LA IM + +   + +T   I
Sbjct  20   IIQCDDNLINQICRRTPFRDLCIATLEPNTNSSSS-DVKGLASIMANIVLGNASDTLNYI  78

Query  288  NNLQKTREDLKT--ALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQC  115
              L K   D +   AL  CA  Y  ++   +P+A +AL+KG   FA   +  +   +  C
Sbjct  79   EGLIKQAPDPQQERALANCAELYIPVVRYELPQAIDALSKGHFGFANYCIADAGKQADAC  138

Query  114  ELGFQ-KAQSPL  82
            E GF   A+SPL
Sbjct  139  EKGFSGSAKSPL  150



>ref|XP_008368956.1| PREDICTED: uncharacterized protein LOC103432541 [Malus domestica]
Length=106

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 53/106 (50%), Gaps = 2/106 (2%)
 Frame = -3

Query  336  MVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFA  157
            MVDA+KAK+ E  + +  L   RE      + C F+Y  I    IP+  EA  KG  K A
Sbjct  1    MVDAVKAKAHEANLHLEEL-VNRETGNIPAQDCRFNYSDIFQLDIPQTVEAFPKGDYKSA  59

Query  156  EKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKIL  19
            E G+     ++  CE  F    +P    +  +HD++ VA AI K+L
Sbjct  60   ELGMTNVVANADSCERRFSGG-NPFKDESQALHDVAYVAAAIAKVL  104



>ref|XP_007221576.1| hypothetical protein PRUPE_ppa1027160mg [Prunus persica]
 gb|EMJ22775.1| hypothetical protein PRUPE_ppa1027160mg [Prunus persica]
Length=174

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 84/179 (47%), Gaps = 18/179 (10%)
 Frame = -3

Query  519  MRNL--VLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTL  346
            MR+L  ++A + L + +    +  +DLVE TC +T NY+LCV  + SDPR+  A D+  L
Sbjct  1    MRSLKWIIACLTLFVLSQSRGSVSTDLVEETCHKTTNYDLCVSSLKSDPRSSTA-DVKGL  59

Query  345  AIIMVDAIKAKSQETAIMINNL--QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKG  172
            A I +D     S +T   I  L  + + E ++  L  C  +Y + +   I EA    TK 
Sbjct  60   ARIALDQTLTNSVDTQARIARLFNETSDEYIRKGLGTCKDEYDLGV-GKITEA----TKN  114

Query  171  V--PKF--AEKGVVASSGSSQQCELGFQKA----QSPLTALNTEVHDLSDVATAIIKIL  19
            V   +F  A   V   +     CE  F +     QSPLT  N  +   +     II IL
Sbjct  115  VILSRFVDARNDVADVADEVNTCEESFSRGGRWRQSPLTDRNNVIVRFAKFTGEIIAIL  173



>ref|XP_002883047.1| enzyme inhibitor/ pectinesterase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59306.1| enzyme inhibitor/ pectinesterase [Arabidopsis lyrata subsp. lyrata]
Length=175

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 76/154 (49%), Gaps = 16/154 (10%)
 Frame = -3

Query  456  GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQ  277
            GS+LV+  C+R     LC+  ++ DPR++ ++ +  LA I +DA   K   T   + ++ 
Sbjct  30   GSNLVQQLCKRNRYQALCISTLNLDPRSKTSN-LQGLASISLDATTKKFNVTLTYLISVL  88

Query  276  KT---REDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAE-----KGVVASSGSSQ  121
            K    RE+ +T    C  +Y   +   +P     L     K++E     K VVA  G   
Sbjct  89   KNVTRREEFET-YGTCIEEYGAAVDRFLPAVVADLK--AKKYSEAMSEMKDVVAKPG---  142

Query  120  QCELGFQKAQSPLTALNTEVHDLSDVATAIIKIL  19
             CE  F   QSPLTA N  VHD++D+   IIK L
Sbjct  143  YCEDQF-AGQSPLTARNKAVHDIADMTAGIIKTL  175



>ref|XP_007051172.1| Uncharacterized protein TCM_004852 [Theobroma cacao]
 gb|EOX95329.1| Uncharacterized protein TCM_004852 [Theobroma cacao]
Length=219

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 10/151 (7%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNL--  280
            +D+++ TC RT + ELC+  + SDPR+  A D   LA I++D    K+++    I+ L  
Sbjct  24   ADMIDDTCNRTSDTELCLSTLRSDPRSSTA-DAKGLAHIVLDITLKKAKDNVAQIDQLLS  82

Query  279  QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF-  103
            + T   LK  L  C+ +Y       +P A + L       A   V  S+G ++ CE  F 
Sbjct  83   RTTDPALKDVLTICSQEYGNATVVILPRAIQKLESKFDAEATGNVEDSAGCAKTCEESFS  142

Query  102  ------QKAQSPLTALNTEVHDLSDVATAII  28
                  Q   SP T  N  V  L+ +A  II
Sbjct  143  DGPRPEQNRPSPFTDQNNAVLHLARLAEDII  173



>ref|XP_008340695.1| PREDICTED: uncharacterized protein LOC103403627 [Malus domestica]
Length=236

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            ++L++ TC++TPNY+LCV  + SDPR   A D+  L IIMVD +KA+  ET  +I  L+K
Sbjct  122  ANLIDQTCQQTPNYDLCVSSLQSDPRRADA-DVKGLGIIMVDVVKARVTETLNLIELLKK  180

Query  273  T  271
            +
Sbjct  181  S  181



>ref|XP_008227855.1| PREDICTED: putative invertase inhibitor [Prunus mume]
Length=173

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 82/175 (47%), Gaps = 8/175 (5%)
 Frame = -3

Query  528  IKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITT  349
            +K++R + + + LLI   S   + G+DL+E TC +T N++ CV  + S P +  A D+  
Sbjct  1    MKLLRWITIVLALLIFYQS-FTSVGADLIEDTCNKTSNFKFCVSFLRSKPGSATA-DVQG  58

Query  348  LAIIMVDAIKAKSQETAIMINNLQK--TREDLKTALEQCAFDYKVILTASIPEAYEALTK  175
            LA I+ D I+   ++T      L K  T   +K   + C+  Y V +           +K
Sbjct  59   LAQIVADQIQINLKDTFSEATKLYKEATERVIKECFQICSEVYAVAIDYMNGVLINLKSK  118

Query  174  GVPKFAEKGVVASSGSSQQCELGFQKA---QSPLTALNTEVHDLSDVATAIIKIL  19
                    G+    G +  CE  F +     SPLT  N +V +L+ + + I+ IL
Sbjct  119  NYSN-TRDGLSVVYGDADTCEESFHEEPVRPSPLTKNNNDVKNLALIGSEIVLIL  172



>ref|NP_188340.3| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
 dbj|BAF00369.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75910.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
Length=184

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 85/186 (46%), Gaps = 14/186 (8%)
 Frame = -3

Query  549  NFKTKLKIKMMRNLVLAMMLLILTTSPIINGGSDL--VESTCRRTPNYELCVKVVSSDPR  376
            +++ K  +K+    V+ M + +  +S  I   ++   ++  C+   N  LCV  ++ DPR
Sbjct  2    HYQIKTMMKLFSIFVVFMQIQVALSSQPIRYATEPKPIQELCKFNINPSLCVSTLNLDPR  61

Query  375  AQGADDITTLAIIMVDAIKAKSQETAIMINNLQ------KTREDLKTALEQCAFDYKVIL  214
            ++ ++ +  LA I +DA   K  +   M+N L       K REDLK   + C  DY    
Sbjct  62   SKNSN-LRELAWISIDATSNKVNK---MLNYLISVSKNIKDREDLKK-YKTCIDDYGTAA  116

Query  213  TASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATA  34
               +P A + L  G    A+  + +       CE  F    SPLT  N   HD++++   
Sbjct  117  RRFLPAALDDLKAGFFSLAKSDMESVVSIPDHCEAQF-GGSSPLTGRNKATHDIANMTAD  175

Query  33   IIKILL  16
            II+ L 
Sbjct  176  IIRYLF  181



>ref|XP_004310173.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Fragaria vesca subsp. vesca]
Length=149

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 77/149 (52%), Gaps = 9/149 (6%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMV-DAIKAKSQETAIMINNL--  280
            +L++ TC +TP   LCV+ ++  P++  A ++  LA IM  D ++AK+QE    I+ L  
Sbjct  4    NLIKETCSKTPKPALCVESITKVPQSARA-NVKGLAQIMNDDVLRAKAQEVHTQIDLLIK  62

Query  279  QKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ  100
            Q TR     +L +CA DY V++   I    E L       A + +  +      C  G +
Sbjct  63   QGTRPQ---SLLKCAQDYSVVINDKIKGVDEGLKDNQTSKAAQAMDDTVSLVSGCNSGLK  119

Query  99   KA--QSPLTALNTEVHDLSDVATAIIKIL  19
            ++   +PL  +NT V DL+ V  AI++ L
Sbjct  120  QSLPGTPLIGMNTNVADLATVTKAIVQQL  148



>ref|XP_008808257.1| PREDICTED: putative invertase inhibitor [Phoenix dactylifera]
Length=175

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 87/178 (49%), Gaps = 14/178 (8%)
 Frame = -3

Query  522  MMRNLVLAMMLLILTTSPIINGGSDLVESTCR----RTPN--YELCVKVVSSDPRAQGAD  361
            M  ++ L   LLIL  S  +   S  V+ TC+    R+PN  Y  CV  +S+DP++ G+ 
Sbjct  1    MAASIALLCFLLILNQSSSLVSAS--VQETCKTVAERSPNFSYNFCVASLSADPKS-GSA  57

Query  360  DITTLAIIMVDAIKAKSQETAIMINN-LQKTRED-LKTALEQCAFDYKVILTASIPEAYE  187
            D   LA+I    + A +  T   I+N L+KT +D  K  L  C+  Y  ++   + +   
Sbjct  58   DTQGLAVIATKLVNANATSTLSTISNLLKKTSDDATKECLGDCSTMYSDLVDM-LKDTVS  116

Query  186  ALTKGVPKFAEKGVVASSGSSQQCELGFQKAQ--SPLTALNTEVHDLSDVATAIIKIL  19
            A+T      A+  + A+      CE GF + Q  SPLT  N +  +LS +A  I  +L
Sbjct  117  AITSKRYSDAKTYLSAALDVGDNCEQGFAELQVKSPLTKENNDSRELSTLALIITNLL  174



>ref|XP_006431604.1| hypothetical protein CICLE_v10004017mg [Citrus clementina]
 gb|ESR44844.1| hypothetical protein CICLE_v10004017mg [Citrus clementina]
Length=178

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/179 (27%), Positives = 87/179 (49%), Gaps = 20/179 (11%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIING----GSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLA  343
            + + ++L   +  P + G     +DL+E+ C++T   ++C+K + S P + GA D+  LA
Sbjct  3    MFIVIILCFSSNRPGVEGVRGEENDLIEAICKKTSYPDVCIKTLRSSPGSSGA-DVKGLA  61

Query  342  IIMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKG-  172
             I++++    S +T   I  L K  +D  ++  L+ C F    +    IP+A + L  G 
Sbjct  62   HIILESASTYSNDTYEQIKKLLKETKDKAMRNCLDVC-FQVYDLTIHDIPKAIKYLESGH  120

Query  171  ---VPKFAEKGVVASSGSSQQCELGFQK----AQSPLTALNTEVHDLSDVATAIIKILL  16
                 ++A  G++     S  CE  F +     +SPLT  N  + +L  +A  II + L
Sbjct  121  YDSATEYANDGII----DSDTCESSFSEFPEIPKSPLTDRNNGLTELCTIALDIIAVQL  175



>emb|CDX82376.1| BnaA03g34450D [Brassica napus]
Length=182

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -3

Query  261  LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPL  82
             K  L++C   YK I+ A +  A  A+ KG PK AE  +V +   +  CE GF K QSPL
Sbjct  102  FKRVLDECNLRYKTIVEADVHTAIIAI-KGNPKLAEDAIVDAGLEASVCEGGFPKDQSPL  160

Query  81   TALNTEVHDLSDVATAIIKILL  16
            T L  ++  + DV  AI+++ L
Sbjct  161  TDLTQKMVKICDVTRAIVRMFL  182



>ref|XP_007221543.1| hypothetical protein PRUPE_ppa026414mg [Prunus persica]
 gb|EMJ22742.1| hypothetical protein PRUPE_ppa026414mg [Prunus persica]
Length=173

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 82/175 (47%), Gaps = 8/175 (5%)
 Frame = -3

Query  528  IKMMRNLVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITT  349
            +K++R   + + LLI   S   + G+DL+E TC +T N++ CV  + S P +  A D+  
Sbjct  1    MKLLRWATIVLALLIFDQS-FTSVGADLIEDTCNKTSNFKFCVSFLRSKPGSATA-DVQG  58

Query  348  LAIIMVDAIKAKSQETAIMINNLQK--TREDLKTALEQCAFDYKVILTASIPEAYEALTK  175
            LA I+ D I+   ++T    + L K  T   +K   + C+  Y V +           +K
Sbjct  59   LAQIVADQIQINLKDTFSEASKLYKEATERVIKECFQICSEMYGVAIDYMNGVLINLKSK  118

Query  174  GVPKFAEKGVVASSGSSQQCELGFQKA---QSPLTALNTEVHDLSDVATAIIKIL  19
                    G+    G +  CE  F +     SPLT  N +V +L+ + + I+ IL
Sbjct  119  NYSN-TRDGLSVVYGDADTCEESFHEEPVRPSPLTKNNDDVKNLALIGSEIVLIL  172



>ref|XP_010906022.1| PREDICTED: putative invertase inhibitor [Elaeis guineensis]
Length=175

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 67/138 (49%), Gaps = 8/138 (6%)
 Frame = -3

Query  417  NYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQC  238
            NY  C+  +S+DPR+  AD    LAII    IKA +  T + I+NL K   D   A  QC
Sbjct  40   NYNFCIATLSADPRSALAD-TQGLAIIATKLIKANATSTELTISNLLKKTTD--NATSQC  96

Query  237  AFDYKVI---LTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQ--KAQSPLTAL  73
              D   +   L  ++ +A  A+T      A   + A+   S  CE GF   K +SPLT  
Sbjct  97   LSDCSSMYSGLVDTLNDAISAITSKHYLDANSDLSAAIDVSITCETGFAELKVKSPLTKE  156

Query  72   NTEVHDLSDVATAIIKIL  19
            N +   LS +A AI  +L
Sbjct  157  NDDSRKLSTLALAITVLL  174



>dbj|BAA94992.1| invertase inhibitor-like protein [Arabidopsis thaliana]
Length=177

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 68/149 (46%), Gaps = 12/149 (8%)
 Frame = -3

Query  444  VESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQ----  277
            ++  C+   N  LCV  ++ DPR++ ++ +  LA I +DA   K  +   M+N L     
Sbjct  32   IQELCKFNINPSLCVSTLNLDPRSKNSN-LRELAWISIDATSNKVNK---MLNYLISVSK  87

Query  276  --KTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGF  103
              K REDLK   + C  DY       +P A + L  G    A+  + +       CE  F
Sbjct  88   NIKDREDLKK-YKTCIDDYGTAARRFLPAALDDLKAGFFSLAKSDMESVVSIPDHCEAQF  146

Query  102  QKAQSPLTALNTEVHDLSDVATAIIKILL  16
                SPLT  N   HD++++   II+ L 
Sbjct  147  G-GSSPLTGRNKATHDIANMTADIIRYLF  174



>ref|XP_008223468.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Prunus mume]
Length=127

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 59/112 (53%), Gaps = 6/112 (5%)
 Frame = -3

Query  336  MVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFA  157
            MV+ ++AK+  T   ++ L+  R   K+ L  C   Y  I  A IP+A EA  KG PK A
Sbjct  1    MVEIVQAKATVTLFKVSELRDQRPGDKS-LSSCPEFYSRISQADIPKASEAFNKGNPKVA  59

Query  156  EKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKILL*LKRQ  1
            E+G+      +  CE GF    SPLT  N  VH ++ VA AI + LL  K +
Sbjct  60   EQGM----NEADSCEHGFS-GSSPLTDYNKYVHGVAAVAAAIARTLLSYKHE  106



>ref|XP_003589451.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES92007.2| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=187

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 70/148 (47%), Gaps = 4/148 (3%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DLV+  C++TPN +LC  ++ S+P+A    D   +A IMV+ I   +  T   I  L   
Sbjct  39   DLVDDICKKTPNSDLCSSILHSNPQANTT-DAKGIAAIMVNDILENATNTLNYIQVLVNQ  97

Query  270  RED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
             +D  L+     CA  Y  ++   +P+A +++ +     A   +V        C   F  
Sbjct  98   TKDIELQRKFSICAETYIPLVKTVLPQAIDSINQNKYGLAAYSMVYVGKEIDSCNKKFSG  157

Query  96   A-QSPLTALNTEVHDLSDVATAIIKILL  16
            +  SPL      +H L D+A AI+K L+
Sbjct  158  STTSPLGDRTDILHKLLDIAAAILKQLI  185



>ref|XP_010524588.1| PREDICTED: pectinesterase inhibitor-like [Tarenaya hassleriana]
Length=180

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 85/179 (47%), Gaps = 12/179 (7%)
 Frame = -3

Query  528  IKMMRNLVLAMMLLILTTSPIIN------GGSDLVESTCRRTPNYELCVKVVSSDPRAQG  367
            +KM     +A++ + L  S  I+       G +L++  C  T   +LCV  +SSDP +  
Sbjct  2    MKMRSQYCVAVVAMFLQISTAISEPAMAPAGPNLIQQVCSHTSFPKLCVSSLSSDP-SNV  60

Query  366  ADDITTLAIIMVDAIKAKSQET-AIMINNLQKTRE--DLKTALEQCAFDYKVILTASIPE  196
            A ++  LA I +  +  K+ ET   ++  + K RE  D +     C  +Y  ++   +P 
Sbjct  61   ASNLQGLASISIGVVSKKANETMQYLVEEIAKIRERGDFER-YGSCIEEYAAVIDRFLPA  119

Query  195  AYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTALNTEVHDLSDVATAIIKIL  19
            A   L       A   ++  S SSQ CE  F   +SPL+  +  VHDL+  +  +IK+L
Sbjct  120  ASAHLKAQRYSDAITVMIDVSKSSQHCEEQF-AGKSPLSERDLTVHDLAVNSADVIKVL  177



>ref|XP_009146034.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1-like 
[Brassica rapa]
 emb|CDY69002.1| BnaAnng29070D [Brassica napus]
Length=183

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 72/153 (47%), Gaps = 10/153 (7%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DL++  CR TP  +LC    S  P      D  +LA  M   +     +T   I +L + 
Sbjct  30   DLIDKICRVTPFIDLCE--ASLRPLTPSPSDPKSLASAMASVVLGNMTDTLGYIQSLIRH  87

Query  270  RED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
              D   + AL QCA  Y+ ++  +IP+A EA+ +G   FA   +  +   +  C+     
Sbjct  88   SHDPAAERALAQCAELYRPVVKFNIPQAIEAMRRGEFGFATYVLGDAEKQTDTCQKWINS  147

Query  96   AQS------PLTALNTEVHDLSDVATAIIKILL  16
            A +       LTA N +V +L DVA ++IK L+
Sbjct  148  AGADDESSVALTARNKQVKNLCDVAISVIKSLM  180



>ref|XP_002885187.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH61446.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=182

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 76/159 (48%), Gaps = 10/159 (6%)
 Frame = -3

Query  468  IINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMI  289
            ++    DL++  C+ TP  +LC    S  P +    D  +LA+ M   +     +T   I
Sbjct  24   VVQSSDDLIDKICQATPFCDLCE--ASLRPLSPSPSDPKSLAVAMASVVLGNMTDTLGYI  81

Query  288  NNLQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQC  115
             +L K   D  ++ AL QCA  Y+ ++  +IP+A EA+  G   FA   +  +   +  C
Sbjct  82   QSLIKHSHDPAVERALAQCAELYRPVVKFNIPQAMEAMQGGKFGFAIYVLGDAEKQTDSC  141

Query  114  ELGF------QKAQSPLTALNTEVHDLSDVATAIIKILL  16
            + G        ++   +TA N  V +L DVA +++K L+
Sbjct  142  QKGITNTGADDESSVAVTARNKLVKNLCDVAISVLKSLM  180



>gb|KFK39049.1| hypothetical protein AALP_AA3G194100 [Arabis alpina]
Length=184

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 73/153 (48%), Gaps = 10/153 (7%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DL++  C+ TP  +LC    S  P A    D  +LA  M + +     +T   I +L K 
Sbjct  31   DLIDKICKATPFCDLCE--ASLRPLAPSPSDPKSLATAMANVVLGNITDTLGYIQSLVKH  88

Query  270  RED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
              +   + AL QCA  Y+ ++  +IP+A EA+ +G   FA   +  +   +  C+ G   
Sbjct  89   THEPAAERALAQCAELYRPVVKFNIPQAIEAMQRGEFGFATYVLGDAEKQTDSCQKGISS  148

Query  96   A------QSPLTALNTEVHDLSDVATAIIKILL  16
            A         +TA N  V +L DVA ++IK L+
Sbjct  149  AGVDDESSVAITARNKLVKNLCDVAISVIKCLM  181



>ref|XP_010549009.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 1 [Tarenaya 
hassleriana]
Length=176

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 78/154 (51%), Gaps = 13/154 (8%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMI-NNLQK  274
            DL++  C+ TP YE C   +    R    ++ T++A  M   +     +T   I + +++
Sbjct  24   DLIDKICKTTPFYEFCEASL----RPLSPENATSIAAAMATVVLRNMTDTLGFIQSQIRR  79

Query  273  TRED-LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
            +R+   + AL +CA  Y+ ++  +IP+A +A+ +G   FA   +  +   +  C+ GF  
Sbjct  80   SRDPAAERALAECAELYRPVVKFNIPQAIDAMRRGDLGFAVYVIGDAEKQADACQKGFSA  139

Query  96   A-------QSPLTALNTEVHDLSDVATAIIKILL  16
            A        + LTA N  + DL D+A A++K L+
Sbjct  140  AGDDDDGSTAALTARNKLLKDLCDLAIAVLKSLM  173



>ref|XP_006406763.1| hypothetical protein EUTSA_v10021610mg [Eutrema salsugineum]
 gb|ESQ48216.1| hypothetical protein EUTSA_v10021610mg [Eutrema salsugineum]
Length=183

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 72/153 (47%), Gaps = 10/153 (7%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DL++  C+ TP  +LC    S  P      D  +LA  M   +     +T   I +L + 
Sbjct  30   DLIDKICKATPFCDLCE--ASLRPLTPSPSDPKSLASAMATVVLGNMTDTLGYIKSLIRL  87

Query  270  RED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
              D   + AL QCA  Y+ ++  +IP+A EA+ +G   FA   +  +   +  C+ G   
Sbjct  88   SHDPAAERALAQCAELYRPVVKFNIPQAIEAMRRGEFGFAAYVLGDAEKQTDSCQKGINN  147

Query  96   AQS------PLTALNTEVHDLSDVATAIIKILL  16
            + +       LTA N  V +L DVA ++IK L+
Sbjct  148  SGADDDSSLALTARNKAVRNLCDVAISVIKSLM  180



>ref|XP_007052414.1| Plant invertase/pectin methylesterase inhibitor superfamily protein 
[Theobroma cacao]
 gb|EOX96571.1| Plant invertase/pectin methylesterase inhibitor superfamily protein 
[Theobroma cacao]
Length=189

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/158 (25%), Positives = 73/158 (46%), Gaps = 12/158 (8%)
 Frame = -3

Query  456  GSDLVESTCR----RTPN--YELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAI  295
             +DL+  TC+    R PN  Y  CV  + + P++  ADD+  L ++ +  ++     T  
Sbjct  29   STDLIRETCKKCAGRDPNLSYNFCVTSLQAAPKSHCADDLRDLGMVSIRLVRRNLTNTRS  88

Query  294  MINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKG---VVASSGSS  124
             +  L K ++ +   +  C  D   + + +IP   EA+     +  +     V A   ++
Sbjct  89   YVEELLKNKKLVDPFVRSCLHDCFNLYSDAIPSTKEAIEDYKSQHYDDANIDVSAVMDAA  148

Query  123  QQCELGFQKAQ---SPLTALNTEVHDLSDVATAIIKIL  19
              CE GF++ +   SPLT  N     LS ++ +I+ +L
Sbjct  149  TTCEDGFKEKEGVVSPLTKRNNNTFQLSAISISIVNML  186



>ref|XP_003604267.1| hypothetical protein MTR_4g007280 [Medicago truncatula]
 gb|AES86464.1| pectinesterase inhibitor domain protein [Medicago truncatula]
Length=112

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = -3

Query  252  ALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQKAQSPLTAL  73
            AL+  A +Y  I+  ++  A  AL KG PK AE+    ++  +  CE      +SPLT  
Sbjct  30   ALKTRAIEYNTIIIYNVSTAISALQKGNPKLAEELANDAANEADDCESQIFSGKSPLTTE  89

Query  72   NTEVHDLSDVATAIIKILL  16
            N  +HD S + +AI+KILL
Sbjct  90   NNVMHDASVITSAIVKILL  108



>ref|XP_008788715.1| PREDICTED: putative invertase inhibitor [Phoenix dactylifera]
Length=188

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 82/166 (49%), Gaps = 14/166 (8%)
 Frame = -3

Query  480  TTSPIING-GSDLVESTCRRTP------NYELCVKVVSSDPRAQGADDITTLAIIMVDAI  322
            T SP++     D++  TC+R        NY LCV+ ++S P++  +D +  LAI+ V   
Sbjct  24   TNSPMVAATHPDIILKTCKRCAKGDPKLNYTLCVESLASVPKSHHSD-VRGLAIVAVKLS  82

Query  321  KAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIP---EAYEALTKGVPKFAEK  151
            KAK+     M+  L K +  ++  ++ C    K + + SI    ++ +A+  G  K A  
Sbjct  83   KAKTMHAKSMVKKLLKAKP-MEGYMKNCLLTCKDVYSDSISDLKDSMKAIKSGQYKDANI  141

Query  150  GVVASSGSSQQCELGFQKA--QSPLTALNTEVHDLSDVATAIIKIL  19
             + ++  +   CE  FQ    +SPLT  N +V  L+ +A  I  +L
Sbjct  142  RISSAVDAPGNCEDSFQDGNIKSPLTEENKDVFGLAVIALGITTLL  187



>ref|XP_004501778.1| PREDICTED: pectinesterase inhibitor-like [Cicer arietinum]
Length=184

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/174 (25%), Positives = 89/174 (51%), Gaps = 13/174 (7%)
 Frame = -3

Query  510  LVLAMMLLILTTSPIINGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMV  331
            L+L   L++  +  + +  ++L+E TC +T N+ LC++ ++++P++  AD+   L +IM 
Sbjct  13   LILCTTLVVTQSRIMTSNDANLIEKTCNKTQNHTLCLQYLNANPKSSTADEY-GLGLIMF  71

Query  330  DAIKAKSQETAIMINNL------QKTREDLKTALEQCAFDYKVILTASIPEA-YEALTKG  172
            D I+ ++  T   I+ L      +K R+ +  AL+ C   YK +L   +  A Y  L++ 
Sbjct  72   DVIRLRALSTIKKIHELIAAGKFKKPRQPM--ALKSCYDKYKTLLEIDVGNANYYLLSRD  129

Query  171  V--PKFAEKGVVASSGSSQQCELG-FQKAQSPLTALNTEVHDLSDVATAIIKIL  19
                ++    ++A + + +    G F   +  LT  N  + D + +A  II+ +
Sbjct  130  AISAEYNAMDIIAKANTCENDFFGRFPYGKELLTDDNNLMIDAATIAYDIIRFI  183



>ref|XP_003609810.1| Pectinesterase inhibitor [Medicago truncatula]
Length=409

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 70/148 (47%), Gaps = 4/148 (3%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DLV+  C++TPN +LC  ++ S+P+A    D   +A IMV+ I   +  T   I  L   
Sbjct  39   DLVDDICKKTPNSDLCSSILHSNPQANTT-DAKGIAAIMVNDILENATNTLNYIQVLVNQ  97

Query  270  RED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
             +D  L+     CA  Y  ++   +P+A +++ +     A   +V        C   F  
Sbjct  98   TKDIELQRKFSICAETYIPLVKTVLPQAIDSINQNKYGLAAYSMVYVGKEIDSCNKKFSG  157

Query  96   A-QSPLTALNTEVHDLSDVATAIIKILL  16
            +  SPL      +H L D+A AI+K L+
Sbjct  158  STTSPLGDRTDILHKLLDIAAAILKQLI  185


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 68/143 (48%), Gaps = 5/143 (3%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DLV+  C++TPN +LC  ++ S P+A+   D   +A IMV  I   +  T   I  L   
Sbjct  189  DLVDDICKKTPNSDLCSSILHSSPQAKTT-DAKGIATIMVSDILQNATNTLNYIQVLVSQ  247

Query  270  RED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
             +D  L+  L  CA  Y  ++   +P+A +++ +     A   +V        C   F  
Sbjct  248  TKDLQLQRKLSICAETYIPLVKTVLPQAIDSINQKKYGLAAYSMVYIGKEIDSCNKQF--  305

Query  96   AQSPLTALNTEVHDLSDVATAII  28
            + SPL    + +H L D+A AI+
Sbjct  306  SSSPLGDRTSFLHKLLDIAAAIL  328



>emb|CDY72175.1| BnaCnng76330D [Brassica napus]
Length=183

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 72/153 (47%), Gaps = 10/153 (7%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DL++  CR TP  +LC    S  P      D  +LA  M   +     +T   I +L + 
Sbjct  30   DLIDKICRVTPFIDLCE--ASLRPLTPSPSDPKSLASAMASVVLGNMTDTLGYIQSLIRH  87

Query  270  RED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELGFQK  97
              D   + AL QCA  Y+ ++  +IP+A +A+ +G   FA   +  +   +  C+     
Sbjct  88   SHDPAAERALAQCAELYRPVVKFNIPQAIDAMRRGELGFATYVLGDAEKQTDTCQKWINS  147

Query  96   AQS------PLTALNTEVHDLSDVATAIIKILL  16
            A +       LTA N +V +L DVA ++IK L+
Sbjct  148  AGADDENSVALTARNKQVKNLCDVAISVIKSLM  180



>emb|CDX75904.1| BnaC03g39870D [Brassica napus]
Length=183

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 77/157 (49%), Gaps = 10/157 (6%)
 Frame = -3

Query  462  NGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINN  283
            +   DL+++ C+ TP  +LC    S  P      D  +LA  M + +     +    I +
Sbjct  26   HSSDDLIDTVCKETPFCDLCE--ASLRPLIPSPSDPKSLASAMANVVLGNMTDNLGYIQS  83

Query  282  LQKTRED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCE-  112
            L +  +D   + AL QCA  Y+ ++  +IP+A EA+ +G   FA+  +  +   +  C+ 
Sbjct  84   LIRHSKDPAAERALAQCAEMYRPVVRFNIPQAIEAMQRGEFGFAKYVLGDAEKQTDSCQK  143

Query  111  -----LGFQKAQSPLTALNTEVHDLSDVATAIIKILL  16
                 +   ++ + LTA N  V +L DVA ++IK L+
Sbjct  144  RINSTMADDESSAALTARNQLVKNLCDVAISVIKSLM  180



>ref|XP_008655849.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Zea mays]
 gb|AFW80613.1| hypothetical protein ZEAMMB73_023931 [Zea mays]
Length=195

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 77/152 (51%), Gaps = 12/152 (8%)
 Frame = -3

Query  444  VESTCRRTPNYE-LCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMI------N  286
            +E  C +T  +E LCV+ +S+DP ++ A D T LA + + A +  + ETA  +      +
Sbjct  41   LEEACEQTAGHEDLCVETLSADPSSKTA-DTTGLARLAIQAAQRNASETATYLSSIYDDD  99

Query  285  NLQKTREDLKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQQCELG  106
            +L+     L+  LE C   Y+  +   + +A  AL  G    +E+ VVAS    + C+ G
Sbjct  100  SLENKTAQLQQCLENCGERYESAVE-QLSDATSALDTGAYSESEELVVASQAEVRLCQRG  158

Query  105  FQ---KAQSPLTALNTEVHDLSDVATAIIKIL  19
             Q     ++ L+A N  V  L  +A AI K++
Sbjct  159  CQAVPNHRNILSARNRNVDQLCSIALAITKLI  190



>ref|XP_006299434.1| hypothetical protein CARUB_v10015597mg [Capsella rubella]
 gb|EOA32332.1| hypothetical protein CARUB_v10015597mg [Capsella rubella]
Length=183

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 72/155 (46%), Gaps = 14/155 (9%)
 Frame = -3

Query  450  DLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQKT  271
            DL++  C+ TP  +LC    S  P +    D  +LA  M   +     +T   I +L + 
Sbjct  30   DLIDKICQATPFCDLCE--ASLRPLSPSPSDPKSLAAAMASVVLGNMTDTLGYIQSLIRH  87

Query  270  RED--LKTALEQCAFDYKVILTASIPEAYEALTKGVPKFAEKGVVASSGSSQ--QCELGF  103
              D   + AL QCA  Y+ ++  +IP+A EA+ +G  KF     V      Q   C+ G 
Sbjct  88   SHDPAAERALAQCAELYRPVVKFNIPQAMEAMRRG--KFGLAIYVLGDAEKQTDSCQKGI  145

Query  102  QKAQS------PLTALNTEVHDLSDVATAIIKILL  16
              A +       LTA N  V +L DVA ++IK LL
Sbjct  146  TNAGADDESSVALTARNKLVKNLCDVAMSVIKSLL  180



>ref|XP_010054538.1| PREDICTED: putative invertase inhibitor [Eucalyptus grandis]
 gb|KCW76825.1| hypothetical protein EUGRSUZ_D01180 [Eucalyptus grandis]
Length=182

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 88/185 (48%), Gaps = 27/185 (15%)
 Frame = -3

Query  513  NLVLAMMLLILTTSPII----NGGSDLVESTCRRTP------NYELCVKVVSSDPRAQGA  364
            N  L  + L L +S I+    +  +D+V  TC+++       NY+ CVK + SDP+++ A
Sbjct  2    NSALCTLFLFLASSLILFHVESAANDIVSDTCQKSAASSPNVNYDYCVKALGSDPKSRTA  61

Query  363  DDITTLAIIMVDAIKAKSQETAIMINNLQKTREDLKTALEQCAFDYKVILTASIPEAYEA  184
             D+  L +I ++ +++    T   I  L K ++D    + QC  D   + +    +A E 
Sbjct  62   -DVQGLGLIALNLLESSVTSTGSDIQQLLKQKQD--PYVHQCLSDCSDLYS----DALET  114

Query  183  LTKGVPKFAEK-------GVVASSGSSQQCELGFQKAQ---SPLTALNTEVHDLSDVATA  34
              + V  + +K        V A S  +  CE  F++ +   SPLT  N +   LS +  A
Sbjct  115  TKEAVGAYQQKRFSDVQFSVSAVSTDATTCESQFKEKKGVTSPLTKQNGDATQLSYIELA  174

Query  33   IIKIL  19
            I+ I+
Sbjct  175  ILAIV  179



>ref|XP_011032948.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Populus euphratica]
Length=184

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 77/172 (45%), Gaps = 7/172 (4%)
 Frame = -3

Query  519  MRNLVLAMMLLILTTSPII-NGGSDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLA  343
               L   +  + +  SP   +  ++LV+  C +T NY  CV+ + SD R   AD  T   
Sbjct  11   YHTLTFLVCFIFIHASPAAADKPTELVDQVCNQTSNYTFCVEALYSDSRTPDADSYTLAF  70

Query  342  IIMVDAIKAKSQETAIMINNLQK--TREDLKTALEQCAFDYKVILTASIPEAYEAL-TKG  172
            I    A    +  T   I  L K  + +D    LE C+ DY +   + + EAY  L ++ 
Sbjct  71   ISFGLAYTNANNTTDYYIAELFKNTSSQDYHYRLETCSHDY-LRAVSKLEEAYNDLNSET  129

Query  171  VPKFAEKGVVASSGSSQQCELGFQKAQS-PLTALNTEVHDLSDVATAIIKIL  19
                AE   +AS+ +S  C+  F+   S PL + N ++  L ++   I K+ 
Sbjct  130  FFGLAELAGIASN-ASDHCQDTFKGISSPPLESRNGDLKRLCEIGATIAKLF  180



>gb|KDO41794.1| hypothetical protein CISIN_1g037300mg [Citrus sinensis]
Length=159

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 75/151 (50%), Gaps = 15/151 (10%)
 Frame = -3

Query  453  SDLVESTCRRTPNYELCVKVVSSDPRAQGADDITTLAIIMVDAIKAKSQETAIMINNLQK  274
            +DL+E+TCR+T   +LC+K + S P + GA D+  LA I++++  A   +T   +  L  
Sbjct  17   NDLIEATCRKTSYPDLCIKTLRSSPGSSGA-DVKGLAHIILESASAYCNDTYEQVKKLLN  75

Query  273  TRED--LKTALEQCAFDYKVILTASIPEAYEALTKG----VPKFAEKGVVASSGSSQQCE  112
              +D  ++  L+ C F    +    IP A + L  G      ++A  G++     S  CE
Sbjct  76   ETKDKTMRNCLDVC-FQVYDLAIYEIPTAIKYLESGDYDSAVQYANDGII----ESDTCE  130

Query  111  LGFQKAQSPLTALNTEVHDLSDVATAIIKIL  19
               +  +SPLT  N  + +L  +A  +I + 
Sbjct  131  ---KIPKSPLTDRNNGLTNLCTIALDMINLF  158



>ref|XP_010054537.1| PREDICTED: putative invertase inhibitor [Eucalyptus grandis]
 gb|KCW76824.1| hypothetical protein EUGRSUZ_D01179 [Eucalyptus grandis]
Length=182

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 86/180 (48%), Gaps = 17/180 (9%)
 Frame = -3

Query  513  NLVLAMMLLILTTSPII----NGGSDLVESTCRRTP------NYELCVKVVSSDPRAQGA  364
            N  L  + L L +S I+    +  +D+V  TC+++       NY+ CVK + SDP+++ A
Sbjct  2    NSALCTLFLFLASSLILFHAESAANDIVSDTCQKSAASSPNVNYDYCVKALGSDPKSRTA  61

Query  363  DDITTLAIIMVDAIKAKSQETAIMINNLQKTRED--LKTALEQCAFDYKVILTASIPEAY  190
             D+  L +I ++ +++    T   I +L K + D  ++  L  C+  Y   L  +  EA 
Sbjct  62   -DVQGLGLIALNLLESSVTSTGSDIQHLLKKKWDRYVQQCLSDCSDLYSDAL-ETTKEAV  119

Query  189  EALTKGVPKFAEKGVVASSGSSQQCELGFQKAQ---SPLTALNTEVHDLSDVATAIIKIL  19
             A  K      +  V A    +  CE  F++ +   SPLT  N +   LS +  AI+ I+
Sbjct  120  GAYQKKRFSDVQNSVSAVCTDATTCESQFKEKKGVTSPLTKQNGDATQLSYIELAILAIV  179



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897557564400