BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c39305_g1_i1 len=1149 path=[1:0-1148]

Length=1149
                                                                      Score     E

ref|XP_006346234.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    199   3e-57   
ref|XP_009781553.1|  PREDICTED: putative zinc finger protein CONS...    193   8e-55   
ref|XP_009608516.1|  PREDICTED: uncharacterized protein LOC104102504    191   5e-54   
ref|XP_010324210.1|  PREDICTED: zinc finger protein HD1                 173   3e-47   
ref|XP_010644911.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     164   6e-44   
emb|CBI21733.3|  unnamed protein product                                162   6e-44   
emb|CAN82490.1|  hypothetical protein VITISV_022419                     156   3e-41   Vitis vinifera
ref|XP_007022342.1|  Activator of spomin::LUC2, putative                156   7e-41   
ref|XP_006475538.1|  PREDICTED: uncharacterized protein LOC102608234    154   7e-40   
ref|XP_006422222.1|  hypothetical protein CICLE_v10005692mg             153   7e-40   
ref|XP_008383077.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    153   9e-40   
ref|XP_010274092.1|  PREDICTED: uncharacterized protein LOC104609465    151   3e-39   
ref|XP_004488804.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    152   5e-39   
ref|XP_006585412.1|  PREDICTED: uncharacterized protein LOC102670442    150   2e-38   
ref|XP_006598211.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    149   3e-38   
gb|KDP25102.1|  hypothetical protein JCGZ_22637                         149   4e-38   
ref|XP_009361816.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    149   5e-38   
gb|KHN48906.1|  Zinc finger protein CONSTANS-LIKE 3                     148   8e-38   
ref|XP_002513394.1|  conserved hypothetical protein                     148   1e-37   Ricinus communis
ref|XP_008364253.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    147   2e-37   
ref|XP_004488805.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    146   6e-37   
ref|XP_003596140.1|  CCT                                                144   1e-36   
emb|CDP13589.1|  unnamed protein product                                143   2e-36   
gb|KCW67729.1|  hypothetical protein EUGRSUZ_F01466                     136   4e-35   
ref|XP_002306413.1|  hypothetical protein POPTR_0005s10040g             140   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010064538.1|  PREDICTED: uncharacterized protein LOC104451621    139   1e-34   
ref|XP_009349169.1|  PREDICTED: uncharacterized protein LOC103940733    137   1e-34   
ref|XP_011095824.1|  PREDICTED: uncharacterized protein LOC105175174    137   3e-34   
ref|XP_011097636.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     134   2e-33   
ref|XP_008447123.1|  PREDICTED: uncharacterized protein LOC103489646    135   4e-33   
ref|XP_008226179.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 3     134   9e-33   
gb|KGN44270.1|  hypothetical protein Csa_7G237850                       134   1e-32   
ref|XP_010552403.1|  PREDICTED: uncharacterized protein LOC104822...    129   6e-31   
ref|XP_011014106.1|  PREDICTED: uncharacterized protein LOC105117974    129   1e-30   
ref|XP_011022118.1|  PREDICTED: uncharacterized protein LOC105123995    128   2e-30   
ref|XP_010552402.1|  PREDICTED: uncharacterized protein LOC104822...    126   5e-30   
ref|XP_010093048.1|  Zinc finger protein CONSTANS                       125   2e-29   
ref|XP_007214737.1|  hypothetical protein PRUPE_ppa025213mg             124   4e-29   
ref|XP_010499608.1|  PREDICTED: uncharacterized protein LOC104777...    124   4e-29   
ref|XP_009135259.1|  PREDICTED: two-component response regulator-...    122   7e-29   
ref|XP_010499619.1|  PREDICTED: uncharacterized protein LOC104777...    123   7e-29   
ref|XP_010499614.1|  PREDICTED: uncharacterized protein LOC104777...    122   1e-28   
ref|XP_010465068.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    122   1e-28   
ref|XP_004150045.1|  PREDICTED: uncharacterized protein LOC101221095    122   1e-28   
gb|KGN46811.1|  hypothetical protein Csa_6G138620                       122   1e-28   
ref|XP_010487015.1|  PREDICTED: two-component response regulator-...    122   1e-28   
ref|XP_010487014.1|  PREDICTED: two-component response regulator-...    122   1e-28   
ref|XP_010499625.1|  PREDICTED: uncharacterized protein LOC104777...    122   2e-28   
emb|CDY24240.1|  BnaC01g38200D                                          122   2e-28   
ref|XP_010465069.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    122   2e-28   
ref|XP_009135257.1|  PREDICTED: two-component response regulator-...    121   2e-28   
ref|XP_010487017.1|  PREDICTED: two-component response regulator-...    121   2e-28   
ref|XP_010487016.1|  PREDICTED: two-component response regulator-...    121   2e-28   
ref|XP_009135256.1|  PREDICTED: two-component response regulator-...    121   3e-28   
emb|CDY57298.1|  BnaC03g73330D                                          120   5e-28   
ref|XP_009135255.1|  PREDICTED: two-component response regulator-...    120   6e-28   
ref|XP_010670131.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     120   1e-27   
ref|XP_010534762.1|  PREDICTED: uncharacterized protein LOC104810...    120   1e-27   
ref|XP_006300038.1|  hypothetical protein CARUB_v10016264mg             119   1e-27   
gb|KFK38630.1|  hypothetical protein AALP_AA3G139100                    119   2e-27   
ref|XP_002882793.1|  hypothetical protein ARALYDRAFT_478650             119   2e-27   
gb|KFK38631.1|  hypothetical protein AALP_AA3G139100                    119   2e-27   
ref|XP_010534764.1|  PREDICTED: uncharacterized protein LOC104810...    119   3e-27   
ref|XP_006380530.1|  hypothetical protein POPTR_0007s08280g             117   4e-27   
ref|XP_006407285.1|  hypothetical protein EUTSA_v10022310mg             118   4e-27   
gb|EYU27549.1|  hypothetical protein MIMGU_mgv1a014146mg                116   5e-27   
ref|NP_566437.1|  protein activator of spomin::LUC2                     117   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124684.1|  PREDICTED: two-component response regulator-...    115   3e-26   
ref|XP_009124683.1|  PREDICTED: two-component response regulator-...    115   3e-26   
ref|XP_009124682.1|  PREDICTED: two-component response regulator-...    115   3e-26   
ref|XP_009124681.1|  PREDICTED: two-component response regulator-...    115   3e-26   
emb|CDY52882.1|  BnaCnng23700D                                          115   5e-26   
ref|XP_004294135.1|  PREDICTED: uncharacterized protein LOC101304258    115   6e-26   
ref|XP_009146574.1|  PREDICTED: uncharacterized protein LOC103870...    114   6e-26   
ref|XP_009146573.1|  PREDICTED: two-component response regulator-...    114   7e-26   
emb|CDY52883.1|  BnaCnng23710D                                          114   8e-26   
ref|XP_004174083.1|  PREDICTED: uncharacterized LOC101215766            101   4e-21   
ref|XP_004143978.1|  PREDICTED: uncharacterized protein LOC101215766    101   5e-21   
ref|XP_010255274.1|  PREDICTED: uncharacterized protein LOC104596005  99.8    3e-20   
emb|CDY08322.1|  BnaC09g12740D                                        99.0    3e-20   
gb|KGN50077.1|  hypothetical protein Csa_5G152920                     97.8    4e-20   
ref|XP_006580560.1|  PREDICTED: uncharacterized protein LOC102665661  99.0    4e-20   
ref|XP_006476521.1|  PREDICTED: zinc finger protein CONSTANS-like     99.0    5e-20   
ref|XP_006439500.1|  hypothetical protein CICLE_v10021189mg           98.6    6e-20   
ref|XP_009112772.1|  PREDICTED: putative zinc finger protein CONS...  98.2    6e-20   
emb|CDY38222.1|  BnaA09g11670D                                        98.2    6e-20   
emb|CDY33573.1|  BnaC06g29790D                                        97.1    7e-20   
ref|XP_006853390.1|  hypothetical protein AMTR_s00032p00143730        93.2    1e-19   
ref|XP_008437311.1|  PREDICTED: uncharacterized protein LOC103482...  97.8    1e-19   
ref|XP_009627496.1|  PREDICTED: zinc finger protein CONSTANS-like     97.8    1e-19   
ref|XP_007160092.1|  hypothetical protein PHAVU_002G291600g           97.4    1e-19   
ref|XP_010053230.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.1    2e-19   
ref|XP_010053229.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.1    2e-19   
emb|CDP12052.1|  unnamed protein product                              96.7    3e-19   
ref|XP_006391712.1|  hypothetical protein EUTSA_v10023638mg           95.5    3e-19   
ref|XP_010055677.1|  PREDICTED: two-component response regulator-...  96.3    4e-19   
ref|XP_006854474.1|  hypothetical protein AMTR_s00039p00236750        97.1    5e-19   
gb|EMS55508.1|  Zinc finger protein CONSTANS-LIKE 5                   97.1    5e-19   
ref|XP_002509836.1|  conserved hypothetical protein                   95.9    6e-19   Ricinus communis
ref|XP_008437312.1|  PREDICTED: uncharacterized protein LOC103482...  95.5    6e-19   
gb|KDP25406.1|  hypothetical protein JCGZ_20562                       95.5    6e-19   
gb|KEH21104.1|  CCT motif protein                                     95.5    7e-19   
ref|XP_006344020.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.7    8e-19   
ref|XP_004503688.1|  PREDICTED: uncharacterized protein LOC101491686  95.1    9e-19   
ref|XP_004245581.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  95.1    1e-18   
dbj|BAK07048.1|  predicted protein                                    95.9    1e-18   
ref|XP_006405357.1|  hypothetical protein EUTSA_v10028337mg           94.7    2e-18   
ref|XP_006584728.1|  PREDICTED: zinc finger protein HD1-like isof...  93.6    2e-18   
ref|NP_198954.2|  CCT motif family protein                            94.0    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264890.1|  PREDICTED: uncharacterized protein LOC104602777  95.5    2e-18   
ref|XP_010418417.1|  PREDICTED: two-component response regulator-...  94.0    2e-18   
ref|XP_010275690.1|  PREDICTED: uncharacterized protein LOC104610655  94.4    2e-18   
gb|KFK33014.1|  hypothetical protein AALP_AA6G319100                  92.0    2e-18   
ref|XP_009790429.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.4    2e-18   
dbj|BAB08510.1|  unnamed protein product                              94.0    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447443.1|  PREDICTED: two-component response regulator-...  94.0    2e-18   
ref|XP_003532419.1|  PREDICTED: zinc finger protein HD1-like isof...  94.0    2e-18   
ref|XP_007040306.1|  Zinc finger protein CONSTANS-LIKE 1, putativ...  94.4    2e-18   
ref|XP_002868599.1|  hypothetical protein ARALYDRAFT_493840           94.0    2e-18   
ref|XP_003517472.1|  PREDICTED: uncharacterized protein LOC100798...  93.2    2e-18   
ref|XP_006573784.1|  PREDICTED: uncharacterized protein LOC100798...  93.2    2e-18   
gb|KEH21105.1|  CCT motif protein                                     94.0    2e-18   
ref|XP_007040305.1|  Zinc finger protein CONSTANS-LIKE 1, putativ...  94.4    2e-18   
ref|XP_011080926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  93.6    2e-18   
ref|XP_009357979.1|  PREDICTED: uncharacterized protein LOC103948662  95.5    2e-18   
ref|XP_006418123.1|  hypothetical protein EUTSA_v10007843mg           95.1    3e-18   
ref|XP_006301601.1|  hypothetical protein CARUB_v10022040mg           93.2    3e-18   
gb|KHG02620.1|  Zinc finger CONSTANS-LIKE 3 -like protein             92.4    3e-18   
ref|XP_010473627.1|  PREDICTED: two-component response regulator-...  93.2    3e-18   
ref|XP_010920297.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.0    3e-18   
gb|AAG52458.1|AC010852_15  hypothetical protein; 56662-57962          92.8    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011073716.1|  PREDICTED: uncharacterized protein LOC105158605  95.1    4e-18   
ref|XP_002465890.1|  hypothetical protein SORBIDRAFT_01g047650        94.4    4e-18   Sorghum bicolor [broomcorn]
ref|XP_010934242.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  89.4    5e-18   
ref|XP_010436090.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.8    5e-18   
ref|XP_010556922.1|  PREDICTED: two-component response regulator-...  94.4    5e-18   
ref|XP_009334191.1|  PREDICTED: serine/threonine-protein kinase p...  94.4    5e-18   
ref|XP_010556923.1|  PREDICTED: two-component response regulator-...  94.0    5e-18   
ref|XP_004985764.1|  PREDICTED: uncharacterized protein LOC101783...  93.6    5e-18   
ref|XP_002886382.1|  hypothetical protein ARALYDRAFT_474973           92.4    5e-18   
ref|XP_010556921.1|  PREDICTED: serine/threonine-protein kinase p...  94.4    5e-18   
ref|XP_007158512.1|  hypothetical protein PHAVU_002G158500g           92.4    6e-18   
ref|XP_010545543.1|  PREDICTED: two-component response regulator-...  93.2    6e-18   
ref|XP_009334190.1|  PREDICTED: uncharacterized protein LOC103927...  94.4    6e-18   
ref|XP_009400175.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  89.4    6e-18   
ref|XP_011029325.1|  PREDICTED: uncharacterized protein LOC105129...  93.2    6e-18   
gb|ACG41702.1|  CCT motif family protein                              93.6    6e-18   Zea mays [maize]
ref|XP_004985763.1|  PREDICTED: uncharacterized protein LOC101783...  93.6    6e-18   
gb|KHG30422.1|  Zinc finger CONSTANS-LIKE 5 -like protein             92.8    7e-18   
ref|XP_010658185.1|  PREDICTED: uncharacterized protein LOC104881...  92.4    7e-18   
ref|XP_008658112.1|  PREDICTED: CCT motif family protein isoform X2   93.6    7e-18   
gb|EMS50724.1|  Zinc finger protein CONSTANS-LIKE 3                   89.7    7e-18   
ref|XP_006282952.1|  hypothetical protein CARUB_v10007619mg           92.4    8e-18   
gb|KFK31054.1|  hypothetical protein AALP_AA6G062400                  93.6    8e-18   
ref|NP_001132123.1|  CCT motif family protein                         93.6    8e-18   Zea mays [maize]
gb|ACG39058.1|  CCT motif family protein                              93.6    8e-18   Zea mays [maize]
gb|KCW60239.1|  hypothetical protein EUGRSUZ_H02954                   93.6    8e-18   
ref|XP_010658181.1|  PREDICTED: uncharacterized protein LOC104881...  92.4    8e-18   
ref|XP_010023849.1|  PREDICTED: uncharacterized protein LOC104414433  93.6    8e-18   
ref|XP_008658111.1|  PREDICTED: CCT motif family protein isoform X1   93.6    8e-18   
ref|XP_007226615.1|  hypothetical protein PRUPE_ppa023124mg           93.6    9e-18   
ref|XP_011074167.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2   91.3    9e-18   
ref|XP_008658113.1|  PREDICTED: CCT motif family protein isoform X3   93.2    9e-18   
gb|EMT31287.1|  hypothetical protein F775_18365                       93.2    9e-18   
ref|XP_010253413.1|  PREDICTED: two-component response regulator-...  91.3    9e-18   
gb|KCW60234.1|  hypothetical protein EUGRSUZ_H02948                   88.6    1e-17   
ref|XP_011029324.1|  PREDICTED: uncharacterized protein LOC105129...  92.8    1e-17   
gb|KFK31055.1|  hypothetical protein AALP_AA6G062400                  93.2    1e-17   
ref|XP_003558847.1|  PREDICTED: uncharacterized protein LOC100838223  93.2    1e-17   
ref|XP_008245265.1|  PREDICTED: transcription initiation factor T...  93.6    1e-17   
ref|XP_009381098.1|  PREDICTED: uncharacterized protein LOC103969324  91.7    1e-17   
ref|XP_010676451.1|  PREDICTED: zinc finger protein HD1 isoform X2    92.8    1e-17   
ref|XP_008650854.1|  PREDICTED: uncharacterized protein LOC103631...  93.2    1e-17   
ref|XP_010676450.1|  PREDICTED: uncharacterized protein DDB_G0283...  92.8    1e-17   
ref|XP_010533642.1|  PREDICTED: uncharacterized protein LOC104809375  92.0    1e-17   
ref|XP_004297849.1|  PREDICTED: uncharacterized protein LOC101302746  93.6    1e-17   
emb|CBI34368.3|  unnamed protein product                              90.9    1e-17   
ref|XP_008785333.1|  PREDICTED: uncharacterized protein LOC103703997  93.2    1e-17   
ref|XP_008245264.1|  PREDICTED: transcription initiation factor T...  93.6    1e-17   
ref|XP_008373296.1|  PREDICTED: uncharacterized protein LOC103436632  92.4    1e-17   
ref|XP_008650859.1|  PREDICTED: uncharacterized protein LOC103631...  92.8    1e-17   
ref|XP_008777489.1|  PREDICTED: uncharacterized protein LOC103697416  93.2    1e-17   
gb|KCW60233.1|  hypothetical protein EUGRSUZ_H02948                   89.0    1e-17   
ref|NP_176567.2|  CCT motif family protein                            91.3    1e-17   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA43289.1|  TPA: hypothetical protein ZEAMMB73_919411            92.8    1e-17   
ref|XP_009398894.1|  PREDICTED: uncharacterized protein LOC103983404  93.2    1e-17   
emb|CDY45387.1|  BnaC06g42420D                                        90.5    1e-17   
gb|ABR16285.1|  unknown                                               93.2    2e-17   Picea sitchensis
ref|XP_007210804.1|  hypothetical protein PRUPE_ppa017365mg           91.7    2e-17   
ref|XP_004169761.1|  PREDICTED: uncharacterized LOC101214336          92.8    2e-17   
ref|XP_004147186.1|  PREDICTED: uncharacterized protein LOC101214336  92.8    2e-17   
ref|XP_010025829.1|  PREDICTED: uncharacterized protein LOC104416089  91.7    2e-17   
ref|XP_010234805.1|  PREDICTED: two-component response regulator-...  92.4    2e-17   
dbj|BAC42809.1|  unknown protein                                      89.4    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008238935.1|  PREDICTED: uncharacterized protein LOC103337551  91.7    2e-17   
ref|XP_006661846.1|  PREDICTED: uncharacterized protein LOC102716903  90.1    3e-17   
gb|KEH41157.1|  CCT motif protein                                     89.7    3e-17   
ref|XP_002304512.1|  hypothetical protein POPTR_0003s13050g           91.3    3e-17   Populus trichocarpa [western balsam poplar]
gb|EYU23454.1|  hypothetical protein MIMGU_mgv1a010539mg              90.9    3e-17   
ref|XP_004497813.1|  PREDICTED: homeobox protein 5-like               92.0    3e-17   
ref|XP_008460688.1|  PREDICTED: uncharacterized protein LOC103499...  92.0    3e-17   
emb|CDP21666.1|  unnamed protein product                              91.7    3e-17   
emb|CDX86630.1|  BnaC08g00730D                                        91.7    3e-17   
emb|CDY70149.1|  BnaCnng66940D                                        90.5    3e-17   
gb|ABY56106.1|  zinc finger-like protein                              92.0    3e-17   Cucumis sativus [cucumbers]
ref|XP_009111098.1|  PREDICTED: two-component response regulator-...  91.7    3e-17   
ref|XP_009375042.1|  PREDICTED: uncharacterized protein LOC103963889  90.9    3e-17   
ref|XP_009140089.1|  PREDICTED: uncharacterized protein LOC103864078  90.5    3e-17   
ref|XP_009111099.1|  PREDICTED: two-component response regulator-...  91.7    3e-17   
ref|NP_001064805.1|  Os10g0466500                                     90.1    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001077999.1|  CCT motif-containing protein                     92.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413884.1|  PREDICTED: serine/threonine-protein kinase p...  92.0    4e-17   
ref|NP_180893.2|  CCT motif-containing protein                        91.7    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413883.1|  PREDICTED: two-component response regulator-...  91.7    4e-17   
ref|XP_010413885.1|  PREDICTED: two-component response regulator-...  91.7    4e-17   
ref|XP_004511566.1|  PREDICTED: zinc finger protein CONSTANS-like     89.7    4e-17   
ref|XP_002892221.1|  hypothetical protein ARALYDRAFT_887616           91.3    4e-17   
gb|KCW57338.1|  hypothetical protein EUGRSUZ_H00131                   91.7    4e-17   
ref|XP_008460686.1|  PREDICTED: uncharacterized protein LOC103499...  91.7    5e-17   
ref|XP_008460687.1|  PREDICTED: uncharacterized protein LOC103499...  91.7    5e-17   
ref|XP_009411394.1|  PREDICTED: two-component response regulator-...  87.4    5e-17   
ref|NP_171944.2|  CCT motif-containing protein                        91.3    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004247937.2|  PREDICTED: two-component response regulator-...  91.3    5e-17   
ref|XP_009400991.1|  PREDICTED: protein SCAF8-like                    91.7    5e-17   
ref|XP_002528360.1|  conserved hypothetical protein                   91.7    5e-17   Ricinus communis
ref|XP_010469487.1|  PREDICTED: two-component response regulator-...  91.3    6e-17   
gb|AAB80653.1|  hypothetical protein                                  91.7    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006590510.1|  PREDICTED: uncharacterized protein LOC100786...  89.0    6e-17   
ref|XP_010469486.1|  PREDICTED: two-component response regulator-...  91.3    6e-17   
ref|XP_006589074.1|  PREDICTED: protein DDB_G0276689-like             91.3    6e-17   
ref|XP_010469489.1|  PREDICTED: two-component response regulator-...  90.9    7e-17   
gb|KHN24670.1|  Zinc finger protein CONSTANS-LIKE 5                   90.9    7e-17   
ref|XP_002879446.1|  hypothetical protein ARALYDRAFT_482277           90.9    8e-17   
gb|EEC67132.1|  hypothetical protein OsI_33955                        90.9    9e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_006590509.1|  PREDICTED: uncharacterized protein LOC100786...  89.0    9e-17   
ref|XP_007145818.1|  hypothetical protein PHAVU_007G270600g           90.9    9e-17   
gb|AAK27800.1|AC022457_3  putative flowering-time gene protein        90.9    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006605759.1|  PREDICTED: uncharacterized protein LOC100793417  90.9    1e-16   
ref|XP_007145819.1|  hypothetical protein PHAVU_007G270600g           90.9    1e-16   
gb|EEE51105.1|  hypothetical protein OsJ_31832                        90.9    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KHN24880.1|  Zinc finger protein CONSTANS-LIKE 4                   90.9    1e-16   
ref|XP_004288744.1|  PREDICTED: uncharacterized protein LOC101299421  89.4    1e-16   
ref|XP_006294315.1|  hypothetical protein CARUB_v10023323mg           90.5    1e-16   
ref|XP_010936037.1|  PREDICTED: uncharacterized protein LOC105055764  90.1    1e-16   
ref|XP_010089070.1|  Zinc finger protein CONSTANS-LIKE 3              89.7    1e-16   
ref|XP_011022638.1|  PREDICTED: uncharacterized protein LOC105124351  89.4    1e-16   
ref|XP_010670943.1|  PREDICTED: uncharacterized protein LOC104887...  90.5    1e-16   
ref|XP_006354533.1|  PREDICTED: homeobox protein 5-like               90.5    1e-16   
gb|KCW60229.1|  hypothetical protein EUGRSUZ_H02941                   90.1    1e-16   
ref|XP_007144132.1|  hypothetical protein PHAVU_007G131300g           90.1    1e-16   
ref|XP_010026799.1|  PREDICTED: uncharacterized protein LOC104417184  90.1    2e-16   
ref|XP_006305045.1|  hypothetical protein CARUB_v10009410mg           89.7    2e-16   
emb|CBI23713.3|  unnamed protein product                              89.4    2e-16   
ref|XP_010475109.1|  PREDICTED: uncharacterized protein LOC104754...  89.7    2e-16   
ref|XP_010650149.1|  PREDICTED: uncharacterized protein LOC100242...  90.1    2e-16   
ref|XP_010483873.1|  PREDICTED: uncharacterized protein LOC104762...  89.4    2e-16   
ref|XP_010650150.1|  PREDICTED: uncharacterized protein LOC100242...  89.7    2e-16   
ref|XP_010259972.1|  PREDICTED: two-component response regulator-...  87.8    2e-16   
ref|XP_006420334.1|  hypothetical protein CICLE_v100049802mg          89.7    2e-16   
ref|XP_010259973.1|  PREDICTED: two-component response regulator-...  87.8    2e-16   
ref|XP_006489642.1|  PREDICTED: uncharacterized protein DDB_G0271...  90.1    2e-16   
gb|KHN30717.1|  Zinc finger protein CONSTANS-LIKE 4                   89.7    2e-16   
ref|XP_006589313.1|  PREDICTED: uncharacterized protein LOC100803778  89.7    2e-16   
ref|XP_006646458.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.4    2e-16   
ref|XP_010457498.1|  PREDICTED: uncharacterized protein LOC104738971  89.4    2e-16   
ref|XP_010475110.1|  PREDICTED: uncharacterized protein LOC104754...  89.4    2e-16   
ref|XP_006489641.1|  PREDICTED: uncharacterized protein DDB_G0271...  90.1    2e-16   
ref|XP_010483881.1|  PREDICTED: uncharacterized protein LOC104762...  89.4    2e-16   
ref|XP_001769257.1|  predicted protein                                90.5    2e-16   
ref|XP_003555500.1|  PREDICTED: transcription initiation factor T...  89.7    3e-16   
ref|XP_010651084.1|  PREDICTED: probable histone-lysine N-methylt...  87.0    3e-16   
gb|KHN01032.1|  Zinc finger protein CONSTANS-LIKE 3                   89.7    3e-16   
ref|XP_006489643.1|  PREDICTED: uncharacterized protein DDB_G0271...  89.7    3e-16   
gb|KFK42787.1|  hypothetical protein AALP_AA1G039300                  89.0    3e-16   
ref|XP_004501136.1|  PREDICTED: ras guanine nucleotide exchange f...  89.4    3e-16   
ref|XP_010089217.1|  Zinc finger protein CONSTANS-LIKE 4              89.4    3e-16   
ref|XP_010650147.1|  PREDICTED: uncharacterized protein LOC100242...  89.4    3e-16   
ref|XP_010522454.1|  PREDICTED: uncharacterized protein LOC104801068  89.4    3e-16   
ref|XP_006649379.1|  PREDICTED: uncharacterized protein LOC102720496  89.4    3e-16   
ref|XP_009358290.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.5    3e-16   
emb|CAN83004.1|  hypothetical protein VITISV_003698                   89.7    3e-16   
ref|XP_002315587.2|  hypothetical protein POPTR_0010s07670g           89.4    3e-16   
ref|XP_009402060.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.1    3e-16   
gb|KEH42657.1|  CCT motif protein                                     89.0    3e-16   
ref|XP_009119293.1|  PREDICTED: uncharacterized protein LOC103844...  88.2    3e-16   
gb|EPS73034.1|  hypothetical protein M569_01723                       90.1    4e-16   
ref|NP_001048916.1|  Os03g0139500                                     88.6    4e-16   
ref|XP_009119292.1|  PREDICTED: uncharacterized protein LOC103844...  88.2    4e-16   
gb|ABF93890.1|  CCT motif family protein, expressed                   89.0    4e-16   
gb|ABF93889.1|  CCT motif family protein, expressed                   88.6    4e-16   
ref|XP_008357963.1|  PREDICTED: uncharacterized protein LOC103421700  86.7    4e-16   
gb|EAY88473.1|  hypothetical protein OsI_09944                        88.6    4e-16   
ref|XP_007035245.1|  CCT motif family protein isoform 2               88.6    5e-16   
ref|XP_008385203.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 3   86.3    5e-16   
ref|XP_010093007.1|  Zinc finger protein CONSTANS-LIKE 1              86.3    5e-16   
ref|XP_010909226.1|  PREDICTED: two-component response regulator-...  86.3    6e-16   
ref|XP_007035244.1|  CCT motif family protein isoform 1               88.6    6e-16   
ref|XP_009354536.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.9    6e-16   
emb|CDY18238.1|  BnaC05g02610D                                        87.8    6e-16   
ref|XP_002967500.1|  hypothetical protein SELMODRAFT_439982           89.7    6e-16   
ref|XP_009119291.1|  PREDICTED: uncharacterized protein LOC103844...  88.2    6e-16   
ref|XP_002960208.1|  hypothetical protein SELMODRAFT_437336           89.7    6e-16   
emb|CDX89819.1|  BnaA10g02630D                                        87.8    6e-16   
ref|XP_008777903.1|  PREDICTED: two-component response regulator-...  86.3    7e-16   
ref|XP_009397492.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  86.3    7e-16   
ref|XP_001753312.1|  predicted protein                                89.0    7e-16   
ref|XP_011029752.1|  PREDICTED: uncharacterized protein LOC105129409  88.2    7e-16   
ref|XP_002312602.2|  hypothetical protein POPTR_0008s17130g           88.2    8e-16   
ref|XP_009409621.1|  PREDICTED: uncharacterized protein LOC103991802  89.0    9e-16   
ref|XP_009777512.1|  PREDICTED: two-component response regulator-...  85.5    1e-15   
gb|KDP33312.1|  hypothetical protein JCGZ_12861                       87.8    1e-15   
ref|XP_004982928.1|  PREDICTED: uncharacterized protein LOC101783...  87.8    1e-15   
gb|EAY76408.1|  hypothetical protein OsI_04338                        86.7    1e-15   
ref|NP_001044727.1|  Os01g0835700                                     86.7    1e-15   
ref|XP_004294631.1|  PREDICTED: uncharacterized protein LOC101311...  85.1    1e-15   
ref|XP_010685860.1|  PREDICTED: two-component response regulator-...  85.1    1e-15   
emb|CDY37728.1|  BnaA04g19400D                                        87.4    1e-15   
ref|XP_004982927.1|  PREDICTED: uncharacterized protein LOC101783...  87.4    1e-15   
ref|XP_004294630.1|  PREDICTED: uncharacterized protein LOC101311...  85.1    1e-15   
ref|XP_008674856.1|  PREDICTED: uncharacterized protein LOC103651041  86.3    1e-15   
ref|XP_009141307.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    1e-15   
ref|XP_001764814.1|  predicted protein                                88.2    1e-15   
ref|XP_009141308.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    1e-15   
gb|KHN20175.1|  Zinc finger protein CONSTANS-LIKE 3                   84.7    1e-15   
emb|CDY23745.1|  BnaC04g43770D                                        87.0    2e-15   
ref|XP_002458724.1|  hypothetical protein SORBIDRAFT_03g039060        86.7    2e-15   
ref|XP_002298019.1|  hypothetical protein POPTR_0001s09680g           86.3    2e-15   
ref|XP_008644804.1|  PREDICTED: uncharacterized protein LOC103626...  87.0    2e-15   
gb|EMT12578.1|  hypothetical protein F775_01709                       82.8    2e-15   
ref|XP_006829112.1|  hypothetical protein AMTR_s00001p00265770        85.5    2e-15   
ref|XP_011005012.1|  PREDICTED: uncharacterized protein LOC105111383  84.3    2e-15   
ref|XP_009144160.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 9   86.7    2e-15   
ref|XP_007150261.1|  hypothetical protein PHAVU_005G139300g           84.3    2e-15   
ref|XP_004961798.1|  PREDICTED: uncharacterized protein LOC101765645  84.3    3e-15   
gb|AFX97550.1|  CMF5                                                  84.0    3e-15   
ref|XP_006598034.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.3    3e-15   
ref|XP_008649725.1|  PREDICTED: uncharacterized protein LOC103630...  85.5    3e-15   
ref|XP_001771844.1|  predicted protein                                87.4    3e-15   
ref|XP_010509901.1|  PREDICTED: two-component response regulator-...  86.3    3e-15   
ref|XP_010509902.1|  PREDICTED: two-component response regulator-...  86.3    3e-15   
ref|XP_009396901.1|  PREDICTED: uncharacterized protein LOC103981869  84.7    3e-15   
ref|XP_008222642.1|  PREDICTED: uncharacterized protein LOC103322...  84.0    3e-15   
gb|AGI62026.1|  CONSTANS-like 2                                       84.3    3e-15   
ref|XP_008649724.1|  PREDICTED: uncharacterized protein LOC103630...  85.5    3e-15   
ref|XP_006410474.1|  hypothetical protein EUTSA_v10016744mg           86.3    3e-15   
ref|XP_010033184.1|  PREDICTED: uncharacterized protein LOC104422535  84.0    3e-15   
ref|XP_004970494.1|  PREDICTED: two-component response regulator-...  85.5    3e-15   
ref|XP_003566168.1|  PREDICTED: two-component response regulator-...  85.1    3e-15   
ref|XP_009599898.1|  PREDICTED: two-component response regulator-...  84.7    4e-15   
ref|XP_003611074.1|  Zinc finger protein CONSTANS-like protein        84.0    4e-15   
gb|KDP44160.1|  hypothetical protein JCGZ_05627                       83.6    4e-15   
ref|XP_002532810.1|  conserved hypothetical protein                   81.6    5e-15   
gb|EMS55744.1|  Zinc finger protein CONSTANS-LIKE 5                   84.3    5e-15   
ref|NP_001055784.1|  Os05g0466100                                     84.3    6e-15   
ref|NP_001150114.1|  CCT motif family protein                         85.5    6e-15   
ref|XP_008677712.1|  PREDICTED: CCT motif family protein isoform X1   85.5    7e-15   
ref|XP_008677715.1|  PREDICTED: CCT motif family protein isoform X2   85.5    7e-15   
ref|XP_009617221.1|  PREDICTED: uncharacterized protein LOC104109...  85.5    7e-15   
ref|XP_009617220.1|  PREDICTED: uncharacterized protein LOC104109...  85.5    8e-15   
ref|XP_009617219.1|  PREDICTED: uncharacterized protein LOC104109...  85.5    8e-15   
ref|XP_004487050.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  82.8    8e-15   
ref|XP_008644803.1|  PREDICTED: uncharacterized protein LOC103626...  85.5    9e-15   
ref|XP_008644802.1|  PREDICTED: uncharacterized protein LOC103626...  85.1    9e-15   
ref|XP_009617222.1|  PREDICTED: uncharacterized protein LOC104109...  85.1    9e-15   
ref|XP_009776466.1|  PREDICTED: uncharacterized protein LOC104226...  85.1    1e-14   
ref|XP_011041437.1|  PREDICTED: uncharacterized protein LOC105137412  84.7    1e-14   
ref|XP_007132138.1|  hypothetical protein PHAVU_011G069800g           82.8    1e-14   
ref|XP_009776465.1|  PREDICTED: uncharacterized protein LOC104226...  85.1    1e-14   
ref|XP_009776463.1|  PREDICTED: uncharacterized protein LOC104226...  85.1    1e-14   
ref|XP_009776462.1|  PREDICTED: uncharacterized protein LOC104226...  85.1    1e-14   
gb|KHN30219.1|  Zinc finger protein CONSTANS-LIKE 3                   81.3    1e-14   
ref|XP_010670945.1|  PREDICTED: uncharacterized protein LOC104887...  84.7    1e-14   
ref|XP_003564556.1|  PREDICTED: two-component response regulator-...  83.6    1e-14   
ref|XP_010670942.1|  PREDICTED: uncharacterized protein LOC104887...  84.7    1e-14   
ref|XP_003543491.2|  PREDICTED: myosin-G heavy chain-like             82.0    1e-14   
ref|XP_010232526.1|  PREDICTED: two-component response regulator-...  83.2    1e-14   
ref|XP_006664477.1|  PREDICTED: uncharacterized protein LOC102701320  85.1    2e-14   
ref|XP_010670944.1|  PREDICTED: uncharacterized protein LOC104887...  84.3    2e-14   
emb|CDP08971.1|  unnamed protein product                              80.5    2e-14   
ref|XP_011013444.1|  PREDICTED: uncharacterized protein LOC105117481  84.3    2e-14   
ref|XP_007206624.1|  hypothetical protein PRUPE_ppa021774mg           81.6    2e-14   
ref|XP_002467116.1|  hypothetical protein SORBIDRAFT_01g019780        84.3    2e-14   
gb|KDO73021.1|  hypothetical protein CISIN_1g042936mg                 81.3    2e-14   
ref|XP_006369499.1|  hypothetical protein POPTR_0001s24010g           81.3    2e-14   
ref|XP_004251291.1|  PREDICTED: two-component response regulator-...  81.6    2e-14   
gb|EMT31176.1|  hypothetical protein F775_06337                       82.4    2e-14   
ref|XP_006363341.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.6    2e-14   
ref|XP_011018703.1|  PREDICTED: uncharacterized protein LOC105121675  82.0    2e-14   
ref|XP_006424712.1|  hypothetical protein CICLE_v10029153mg           81.6    2e-14   
emb|CDM84893.1|  unnamed protein product                              82.4    2e-14   
emb|CDY19485.1|  BnaC04g11140D                                        83.6    3e-14   
gb|AFW84665.1|  hypothetical protein ZEAMMB73_182225                  84.0    4e-14   
gb|ABD32315.1|  CCT                                                   80.9    4e-14   
ref|XP_008783773.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5   81.3    4e-14   
ref|XP_009594668.1|  PREDICTED: myosin-G heavy chain-like isoform X4  82.8    4e-14   
ref|XP_010542960.1|  PREDICTED: uncharacterized protein LOC104816005  82.0    4e-14   
ref|XP_003597300.1|  Zinc finger protein CONSTANS-like protein        80.5    5e-14   
ref|XP_009776860.1|  PREDICTED: probable serine/threonine-protein...  82.8    5e-14   
ref|XP_009776853.1|  PREDICTED: probable serine/threonine-protein...  82.8    5e-14   
ref|XP_009594679.1|  PREDICTED: myosin-G heavy chain-like isoform X5  82.4    5e-14   
ref|XP_010314770.1|  PREDICTED: uncharacterized protein LOC104645...  82.8    5e-14   
ref|XP_009776859.1|  PREDICTED: probable serine/threonine-protein...  82.8    5e-14   
ref|XP_010314772.1|  PREDICTED: uncharacterized protein LOC104645...  82.8    5e-14   
ref|XP_006342682.1|  PREDICTED: histone-lysine N-methyltransferas...  82.8    5e-14   
ref|XP_009776856.1|  PREDICTED: probable serine/threonine-protein...  82.8    5e-14   
ref|XP_009776852.1|  PREDICTED: probable serine/threonine-protein...  82.8    6e-14   
ref|XP_009594627.1|  PREDICTED: myosin-G heavy chain-like isoform X1  82.8    6e-14   
ref|XP_009594660.1|  PREDICTED: myosin-G heavy chain-like isoform X3  82.4    6e-14   
ref|XP_002950263.1|  hypothetical protein VOLCADRAFT_90708            83.2    6e-14   
ref|XP_009594634.1|  PREDICTED: uncharacterized protein LOC104091...  82.8    6e-14   
ref|XP_009403455.1|  PREDICTED: uncharacterized protein LOC103987006  80.1    7e-14   
ref|XP_006368352.1|  hypothetical protein POPTR_0001s01940g           80.5    7e-14   
emb|CDY19486.1|  BnaC04g11130D                                        82.0    8e-14   
ref|XP_003606565.1|  Zinc finger protein CONSTANS-like protein        80.1    8e-14   
ref|XP_008463853.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.7    9e-14   
ref|XP_008463852.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.7    9e-14   
ref|XP_009383048.1|  PREDICTED: uncharacterized protein LOC103970845  82.0    9e-14   
ref|XP_011090052.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 1   79.7    1e-13   
ref|XP_008654940.1|  PREDICTED: CCT isoform X1                        80.5    1e-13   
ref|XP_007016581.1|  CCT motif family protein                         79.3    1e-13   
ref|NP_001148245.1|  CCT                                              80.5    1e-13   
gb|EEC68659.1|  hypothetical protein OsI_37104                        82.4    1e-13   
gb|EMT00898.1|  hypothetical protein F775_03508                       78.6    1e-13   
ref|XP_009392297.1|  PREDICTED: two-component response regulator-...  79.7    1e-13   
gb|AAB70424.1|  F19P19.3                                              81.3    2e-13   
ref|XP_009587734.1|  PREDICTED: putative zinc finger protein CONS...  79.0    2e-13   
ref|XP_008675154.1|  PREDICTED: uncharacterized protein LOC103651310  78.6    2e-13   
gb|EYU18903.1|  hypothetical protein MIMGU_mgv1a011899mg              79.3    2e-13   
gb|KHN22013.1|  Zinc finger protein CONSTANS-LIKE 3                   78.2    2e-13   
ref|XP_006591003.1|  PREDICTED: uncharacterized protein LOC102667349  79.7    2e-13   
ref|XP_002979464.1|  hypothetical protein SELMODRAFT_419178           79.0    2e-13   
tpg|DAA58011.1|  TPA: hypothetical protein ZEAMMB73_877657            78.2    2e-13   
ref|XP_010910000.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  76.6    3e-13   
gb|EAY97054.1|  hypothetical protein OsI_18976                        78.2    3e-13   
gb|ABA97352.1|  CCT motif family protein                              77.8    3e-13   
ref|XP_008659060.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  77.4    3e-13   
ref|XP_002448846.1|  hypothetical protein SORBIDRAFT_05g000230        77.8    4e-13   
gb|ACH59810.1|  hypothetical protein                                  75.5    4e-13   
ref|XP_008659054.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  77.4    4e-13   
ref|XP_008659050.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  78.2    5e-13   
gb|KGN47342.1|  hypothetical protein Csa_6G301610                     77.8    5e-13   
gb|ACH59800.1|  hypothetical protein                                  75.5    5e-13   
gb|KHN05695.1|  Zinc finger protein CONSTANS-LIKE 3                   77.0    5e-13   
gb|KFK27537.1|  hypothetical protein AALP_AA8G396100                  77.4    6e-13   
ref|XP_006592251.1|  PREDICTED: uncharacterized protein LOC102667...  77.8    7e-13   
ref|XP_002866360.1|  hypothetical protein ARALYDRAFT_919236           77.0    7e-13   
ref|XP_004980104.1|  PREDICTED: uncharacterized protein LOC101783073  80.1    7e-13   
ref|XP_004300805.1|  PREDICTED: uncharacterized protein LOC101313706  77.4    1e-12   
ref|XP_010535553.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  76.3    1e-12   
ref|XP_002441653.1|  hypothetical protein SORBIDRAFT_08g000240        75.5    1e-12   
gb|EMS65384.1|  Zinc finger protein CONSTANS                          75.5    2e-12   
tpg|DAA59127.1|  TPA: hypothetical protein ZEAMMB73_601202            75.9    2e-12   
ref|XP_004506003.1|  PREDICTED: zinc finger protein CONSTANS-like     76.3    2e-12   
ref|XP_003577180.1|  PREDICTED: uncharacterized protein LOC100830772  78.6    3e-12   
ref|XP_010520313.1|  PREDICTED: two-component response regulator-...  75.1    4e-12   
ref|XP_009779985.1|  PREDICTED: two-component response regulator-...  73.6    5e-12   
gb|ABA95566.1|  CCT motif family protein                              72.4    9e-12   
ref|XP_009389721.1|  PREDICTED: uncharacterized protein LOC103976234  75.5    1e-11   
gb|ABA91086.2|  RNase P subunit p30 family protein, expressed         75.9    1e-11   
ref|NP_001065223.1|  Os11g0101200                                     75.5    2e-11   
ref|XP_008672687.1|  PREDICTED: hypothetical protein isoform X1       75.9    2e-11   
gb|EPS67327.1|  hypothetical protein M569_07448                       70.1    2e-11   
ref|NP_001176743.1|  Os12g0101000                                     75.5    2e-11   
gb|EEC68661.1|  hypothetical protein OsI_37106                        75.5    2e-11   
ref|XP_010267643.1|  PREDICTED: uncharacterized protein LOC104604...  72.8    3e-11   
ref|XP_008222636.1|  PREDICTED: uncharacterized protein LOC103322...  72.0    4e-11   
ref|XP_008222631.1|  PREDICTED: uncharacterized protein LOC103322...  72.4    4e-11   
ref|XP_006852657.1|  hypothetical protein AMTR_s00021p00245010        72.4    5e-11   
ref|XP_010267642.1|  PREDICTED: uncharacterized protein LOC104604...  72.8    5e-11   
ref|XP_010924521.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  71.6    1e-10   
ref|XP_010922986.1|  PREDICTED: uncharacterized protein LOC105046161  73.2    1e-10   
ref|XP_010650148.1|  PREDICTED: uncharacterized protein LOC100242...  71.6    3e-10   
ref|XP_010266521.1|  PREDICTED: uncharacterized protein LOC104604011  70.1    3e-10   
ref|XP_004978392.1|  PREDICTED: uncharacterized protein LOC101756574  68.2    4e-10   
gb|AFW84661.1|  hypothetical protein ZEAMMB73_657600                  70.1    5e-10   
gb|KHN26846.1|  hypothetical protein glysoja_011438                   68.6    6e-10   
gb|KDP25405.1|  hypothetical protein JCGZ_20561                       68.9    6e-10   
ref|XP_002441238.1|  hypothetical protein SORBIDRAFT_09g022900        70.1    7e-10   
ref|XP_008354259.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  68.2    9e-10   
ref|XP_008354258.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  68.6    1e-09   
ref|XP_006478056.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  67.4    1e-09   
gb|EEC79371.1|  hypothetical protein OsI_20267                        69.3    1e-09   
ref|XP_006478055.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  67.8    1e-09   
ref|XP_009352001.1|  PREDICTED: uncharacterized protein LOC103943420  67.8    2e-09   
ref|XP_010100762.1|  Zinc finger protein CONSTANS-LIKE 5              67.8    2e-09   
ref|XP_006441070.1|  hypothetical protein CICLE_v10022287mg           66.6    2e-09   
ref|XP_009608629.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  67.0    2e-09   
ref|XP_009608630.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  66.6    2e-09   
ref|XP_007161506.1|  hypothetical protein PHAVU_001G074900g           67.0    2e-09   
ref|NP_001151864.1|  CCT motif family protein                         67.8    2e-09   
ref|XP_006478054.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  67.4    3e-09   
gb|ACL53435.1|  unknown                                               67.8    3e-09   
gb|EYU19638.1|  hypothetical protein MIMGU_mgv1a021380mg              67.0    3e-09   
ref|XP_004234958.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   67.4    3e-09   
ref|XP_009608628.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  67.4    3e-09   
gb|KDO47260.1|  hypothetical protein CISIN_1g036310mg                 67.0    3e-09   
ref|XP_008437593.1|  PREDICTED: uncharacterized protein LOC103482...  66.6    3e-09   
ref|XP_011075995.1|  PREDICTED: uncharacterized protein LOC105160363  67.0    3e-09   
ref|XP_007161505.1|  hypothetical protein PHAVU_001G074900g           67.0    3e-09   
ref|XP_010433294.1|  PREDICTED: zinc finger protein HD1-like isof...  66.6    3e-09   



>ref|XP_006346234.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Solanum 
tuberosum]
Length=282

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 126/174 (72%), Gaps = 15/174 (9%)
 Frame = +2

Query  347  GCLFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEE  526
            GC  ES DE  +   +SNFWS   + P ++ N  G Q E  SPK+KE PAMKIGRYSEEE
Sbjct  121  GC--ESWDENTDHGFESNFWS---SCPLATSNNWGAQRET-SPKIKETPAMKIGRYSEEE  174

Query  527  RKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKS  706
            RKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE C     D +++IK 
Sbjct  175  RKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEAC----DDHELLIKG  230

Query  707  RDNNIIVHQTKDLYYDH--PFQAKQDEEEEWLEEAITSLMYIPYIGGSYDAQFV  862
               N+  HQ KD+ YDH    Q K  ++E WLEEAIT+ MYIPYIG SYD  F+
Sbjct  231  ---NVNYHQDKDVCYDHNPQIQMKHGDQENWLEEAITNFMYIPYIGSSYDGNFI  281



>ref|XP_009781553.1| PREDICTED: putative zinc finger protein CONSTANS-LIKE 11 [Nicotiana 
sylvestris]
Length=287

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 139/301 (46%), Positives = 172/301 (57%), Gaps = 50/301 (17%)
 Frame = +2

Query  23   MAFIPPQHQYCSDHMFPSELRQLPTPMILSDGIAAARAGGTAYDTTNNALHLNMMDAA--  196
            MAF P   QY S H+F +E     +     +G++A +   T   T ++ L+ N ++A   
Sbjct  1    MAFTP---QYYS-HLFSNEFN---SSFPAGEGVSALQICNTQV-TPSSVLYDNNIEAQLL  52

Query  197  -ISTFPHHHNP---------------LGNVSEQLPTAMLLSPSPPAACGIIGSREFSRTP  328
             I++ P H+ P               LG VS+    A+L  P+P ++     S E+S   
Sbjct  53   NINSLPDHYVPPSISNSMMMPWFPERLGVVSDMTVPALL--PAPASSSDTFSS-EYSLNN  109

Query  329  APRGGY-GCLFESGDEC---NNGL-LDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQP  493
                 Y     E+ + C     GL   S+FWS  P    ++ N  G Q E  SPK+KE P
Sbjct  110  TTHHVYVADQHEACESCWDETTGLDHHSSFWSRCPV---ATSNNWGPQRET-SPKVKETP  165

Query  494  AMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgd  673
            AMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE+C  
Sbjct  166  AMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEVCD-  224

Query  674  gdgdddIVIKSRDNNIIVHQTKDLYYDHPFQAKQDE--EEEWLEEAITSLMYIPYIGGSY  847
                       +  N   H  KD+ YD+PFQ K  +  EE WLEEAIT+LMYIPYIG SY
Sbjct  225  ---------DEKGINDNYHGPKDVRYDNPFQIKHPDQCEENWLEEAITNLMYIPYIGSSY  275

Query  848  D  850
            D
Sbjct  276  D  276



>ref|XP_009608516.1| PREDICTED: uncharacterized protein LOC104102504 [Nicotiana tomentosiformis]
Length=293

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 138/307 (45%), Positives = 168/307 (55%), Gaps = 56/307 (18%)
 Frame = +2

Query  23   MAFIPPQHQYCSDHMFPSELRQLPTPMILSDGIAAARA-------GGTAYDTTNNALHLN  181
            MAF P   QY S H+F +E      P    +G++A +            YD  NN +   
Sbjct  1    MAFTP---QYYS-HIFSNEFNS-SLPAGEGEGVSALQICNSQVTPSSVLYD--NNNIEAQ  53

Query  182  MMDAAISTFPHHHNP--------------LGNVSEQLPTAMLLSPSPPAACGIIGSR-EF  316
            +++  I++ P H+ P              LG VS+    A+L  P+P ++     S   F
Sbjct  54   LLN--INSLPDHYVPPSISNSMMPWFPERLGVVSDMTVPALL--PAPASSSDTFSSDYSF  109

Query  317  SRTPAPRGGYGCLFESGDEC---NNGLLDS----NFWSLYPTRPPSSYNIEGIQGEAISP  475
            + T           E+ + C       LD     N WS  P    ++ N  G Q E  SP
Sbjct  110  NSTTTHHVYAADQHEACESCWDETTTRLDHHSSFNNWSRCPL---ATSNNWGPQRET-SP  165

Query  476  KLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKN  655
            K+KE PAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKN
Sbjct  166  KVKETPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKN  225

Query  656  NEICgdgdgdddIVIKSRDNNIIVHQTKDLYYDHPFQAKQDE--EEEWLEEAITSLMYIP  829
            NE+C             +  N I H +KD  YD+PFQ K  +  EE WLEEAIT+LMYIP
Sbjct  226  NEVCD----------DEKGINDICHGSKDARYDNPFQMKHPDQYEENWLEEAITNLMYIP  275

Query  830  YIGGSYD  850
            YIG SYD
Sbjct  276  YIGSSYD  282



>ref|XP_010324210.1| PREDICTED: zinc finger protein HD1 [Solanum lycopersicum]
Length=266

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 159/296 (54%), Gaps = 47/296 (16%)
 Frame = +2

Query  23   MAFIPPQHQY-CSDHMFPSE------LRQLPTPMILSDGIAAARAGGTAYDTTNNALHLN  181
            MAF P  H Y  +  +F +E      +   P P I +  I+        Y+     +++N
Sbjct  1    MAFTPHDHDYYTTQGLFSNEFINSSLVTTNPLPQICNSQISP-------YEHEQVVMNIN  53

Query  182  MMDA----AISTFPHHHNPLGNVSEQLPTAMLLSPSPPAACGIIGSREFSRTPAPRGGY-  346
             +D     +IS  P     LG     +P        PPA+         +      G + 
Sbjct  54   SLDHYVPPSISMMPWFPERLGVSDMTVPVL------PPASSTTYAVENNNNNKGCIGQHH  107

Query  347  -GCLFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEE  523
             GC  ES DE  +   +SNFWS   + P ++ N  G Q E  SPK+K  P+MKIGRYSEE
Sbjct  108  EGC--ESWDETTDHSFESNFWS---SCPLATSNNWGSQRET-SPKIKGTPSMKIGRYSEE  161

Query  524  ERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIK  703
            ERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE       D  ++I 
Sbjct  162  ERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE-------DHQLLIN  214

Query  704  SRDNNIIVHQTKDLYYDHPFQAKQDE---EEEWLEEAITSLMYIPYIGGSYDAQFV  862
               N +  HQ KD+ YD   Q K  +   E+ WLEEAIT+ MYIP    SY+  F+
Sbjct  215  G--NIVNYHQHKDVCYDQ-IQMKHGDHYNEDNWLEEAITNFMYIP--CSSYEGNFI  265



>ref|XP_010644911.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4 [Vitis vinifera]
Length=249

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 120/185 (65%), Gaps = 23/185 (12%)
 Frame = +2

Query  290  CGIIGSREFSRTPAPRGGYGC-LFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEA  466
            CGI G + F       GGY   + E GDEC   + D       P  P ++ +  GIQG  
Sbjct  87   CGIAGVQSFG------GGYQQDVCEFGDECGGFVPD-----FRPVYPATAGDNWGIQGNH  135

Query  467  ISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRF  646
            I+    E+   K+GRYS EERKDRILRYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRF
Sbjct  136  IAGI--EESNTKVGRYSVEERKDRILRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRF  193

Query  647  AKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYI  826
            A+N+E+C     ++++ +K  +N     + K+LYY+   Q K D EE+WL+EAI SLMY+
Sbjct  194  ARNSELC-----EEEMAVKKNEN---TQEEKELYYNDTVQMKHD-EEDWLQEAIASLMYM  244

Query  827  PYIGG  841
            PY  G
Sbjct  245  PYFSG  249



>emb|CBI21733.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 120/185 (65%), Gaps = 23/185 (12%)
 Frame = +2

Query  290  CGIIGSREFSRTPAPRGGYGC-LFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEA  466
            CGI G + F       GGY   + E GDEC   + D       P  P ++ +  GIQG  
Sbjct  53   CGIAGVQSFG------GGYQQDVCEFGDECGGFVPD-----FRPVYPATAGDNWGIQGNH  101

Query  467  ISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRF  646
            I+    E+   K+GRYS EERKDRILRYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRF
Sbjct  102  IAGI--EESNTKVGRYSVEERKDRILRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRF  159

Query  647  AKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYI  826
            A+N+E+C     ++++ +K  +N     + K+LYY+   Q K D EE+WL+EAI SLMY+
Sbjct  160  ARNSELC-----EEEMAVKKNEN---TQEEKELYYNDTVQMKHD-EEDWLQEAIASLMYM  210

Query  827  PYIGG  841
            PY  G
Sbjct  211  PYFSG  215



>emb|CAN82490.1| hypothetical protein VITISV_022419 [Vitis vinifera]
Length=240

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 119/185 (64%), Gaps = 24/185 (13%)
 Frame = +2

Query  290  CGIIGSREFSRTPAPRGGYGC-LFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEA  466
            CGI G + F       GGY   + E GDEC   + D       P  P ++ +  GIQG  
Sbjct  79   CGIAGVQSFG------GGYQQDVCEFGDECGGFVPD-----FRPVYPATAGDNWGIQGNH  127

Query  467  ISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRF  646
            I+    E+   K+GRYS EERKDRILRYLKKRNQRNFNKTIK ACRKTLAD+RVRVRGRF
Sbjct  128  IAGI--EESNTKVGRYSVEERKDRILRYLKKRNQRNFNKTIK-ACRKTLADRRVRVRGRF  184

Query  647  AKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYI  826
            A+N+E+C     ++++ +K  +N     + K+LYY+   Q K D EE+WL+EAI SLMY+
Sbjct  185  ARNSELC-----EEEMAVKKNEN---TQEEKELYYNDTVQMKHD-EEDWLQEAIASLMYM  235

Query  827  PYIGG  841
            PY  G
Sbjct  236  PYFSG  240



>ref|XP_007022342.1| Activator of spomin::LUC2, putative [Theobroma cacao]
 gb|EOY13867.1| Activator of spomin::LUC2, putative [Theobroma cacao]
Length=268

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 155/292 (53%), Gaps = 43/292 (15%)
 Frame = +2

Query  23   MAFIPPQHQYCSDHMFPSELRQLPTPMILSDGIAAARAG---GTAYDTTNNALHLNMMDA  193
            MA +P   Q+ S++ F ++  Q   P+++S       AG   G A+        + + + 
Sbjct  1    MASVP---QFYSNYSFSNDFSQFQNPLLISQDNYIGSAGAISGAAWGDQEIGFPMFLDNG  57

Query  194  AISTFPHHHNPLGNVSEQLPTAM---LLSPSPPAA-------------CGIIGSREFSRT  325
                 P       N+   +P A+   L+  S   A             CGI   + F   
Sbjct  58   GGLDVPQQEP---NIKSSVPAALFPELIGISSDLAVPTGFPDNNVAGFCGIGTIQNF---  111

Query  326  PAPRGGYGCLFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKI  505
               R     + E G+EC+ G +  +F  + PT   +     GIQG  + P + E   +K+
Sbjct  112  -GGRYQLQDVCEFGEECS-GFVHQDFKPVDPTVGETW----GIQGNRMQPAM-EDSNLKV  164

Query  506  GRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgd  685
            GRYS EERKDRILRYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+N E+C     +
Sbjct  165  GRYSVEERKDRILRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNTELC-----E  219

Query  686  ddIVIKSRDNNIIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYIPYIGG  841
            +++V+K  D+N      K+ Y     Q K D E+EWL+EA+ +LMY+PYI G
Sbjct  220  EEMVMKKEDDN--SPGEKNSYCWDSVQIKHD-EDEWLQEAMANLMYLPYIAG  268



>ref|XP_006475538.1| PREDICTED: uncharacterized protein LOC102608234 [Citrus sinensis]
 gb|KDO61633.1| hypothetical protein CISIN_1g023394mg [Citrus sinensis]
Length=283

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 112/162 (69%), Gaps = 17/162 (10%)
 Frame = +2

Query  359  ESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDR  538
            E GD+C   + D     L P  P +  N  GIQ   ++  +++   +K+GRYS EERKDR
Sbjct  136  EFGDDCCAFMHD-----LKPMHPATGENW-GIQNNQMA-SMEDANVIKVGRYSVEERKDR  188

Query  539  ILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNN  718
            ILRYLKK+NQRNFNKTIKYACRKTLAD+RVRVRGRFA+NNE+C     +D  V+K+ DN+
Sbjct  189  ILRYLKKKNQRNFNKTIKYACRKTLADRRVRVRGRFARNNELC----EEDQTVMKNDDNS  244

Query  719  IIVHQTKDLY-YDHPFQAKQDEEEEWLEEAITSLMYIPYIGG  841
               H+ K+ Y  D   Q KQD  EEWL+EA+ SLMY+PYI G
Sbjct  245  ---HKGKNPYCVDDDVQMKQD--EEWLQEAMASLMYLPYIAG  281



>ref|XP_006422222.1| hypothetical protein CICLE_v10005692mg [Citrus clementina]
 gb|ESR35462.1| hypothetical protein CICLE_v10005692mg [Citrus clementina]
Length=255

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 112/162 (69%), Gaps = 17/162 (10%)
 Frame = +2

Query  359  ESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDR  538
            E GD+C   + D     L P  P +  N  GIQ   ++  +++   +K+GRYS EERKDR
Sbjct  108  EFGDDCCAFMHD-----LKPMHPATGENW-GIQNNQMA-SMEDANVIKVGRYSVEERKDR  160

Query  539  ILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNN  718
            ILRYLKK+NQRNFNKTIKYACRKTLAD+RVRVRGRFA+NNE+C     +D  V+K+ DN+
Sbjct  161  ILRYLKKKNQRNFNKTIKYACRKTLADRRVRVRGRFARNNELC----EEDQTVMKNDDNS  216

Query  719  IIVHQTKDLY-YDHPFQAKQDEEEEWLEEAITSLMYIPYIGG  841
               H+ K+ Y  D   Q KQD  EEWL+EA+ SLMY+PYI G
Sbjct  217  ---HKGKNPYCVDDDVQMKQD--EEWLQEAMASLMYLPYIAG  253



>ref|XP_008383077.1| PREDICTED: zinc finger protein CONSTANS-LIKE 3-like [Malus domestica]
Length=280

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 111/306 (36%), Positives = 159/306 (52%), Gaps = 59/306 (19%)
 Frame = +2

Query  23   MAFIPPQHQYCSDHMFPSELRQLPTPMILSD-GIAAARAGGTAY--------------DT  157
            MA IP  HQ+ +DH  PS+    P P++  + G + A  GGT +              D+
Sbjct  1    MASIP--HQFYNDHSLPSDFYWYPIPVVNGENGCSTAVLGGTVWSASTNCEESLVPFCDS  58

Query  158  TNNALHLNMM----DAAISTFPHHHNPLGNVSEQLPTAMLLSPSPPAACGIIGSREFSRT  325
            +N A++ +++    D + S        L   SE +       P   +  G +G      T
Sbjct  59   SNAAINFDVVSPESDISSSVMAASFQELQGFSEDIAV-----PGTYSEYGNMGLHVIGGT  113

Query  326  PAPRGG----YGCLFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAIS------P  475
            P   G     Y C  + G++   G + S+F      +P   ++  G +  AI+      P
Sbjct  114  PNFGGELNLPYICE-QFGEDSFTGFMSSDF------KP---FSFAGQENWAINQDNQQVP  163

Query  476  KLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKN  655
             +++Q  MK+GRYSEEERK+RI RYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+N
Sbjct  164  TVEDQSTMKVGRYSEEERKERIDRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARN  223

Query  656  NEICgdgdgdddIVIKSRDNNIIVHQTKDLYYDHPF----QAKQDEEEEWLEEAITSLMY  823
             +        ++I  K   +NI   QT       PF      ++ +E++WL+EA+ SLMY
Sbjct  224  TD------HHEEIAQKKTQSNI---QTCKDQRSEPFCSSGAVQKYDEDDWLQEAVASLMY  274

Query  824  IPYIGG  841
             PY+ G
Sbjct  275  FPYVTG  280



>ref|XP_010274092.1| PREDICTED: uncharacterized protein LOC104609465 [Nelumbo nucifera]
Length=252

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 99/268 (37%), Positives = 146/268 (54%), Gaps = 26/268 (10%)
 Frame = +2

Query  50   YCSDHMFPSELRQLPTPMILSDGIAAARAGGTAYDTTNNALHLNMMDAAISTFPHHHNPL  229
            + SD++F ++ R + +P +  + +A A  G        +   +N    A    P  +   
Sbjct  7    FGSDYIFSTDFRGI-SPSLAGENVADAMWGDEISPFVGHGA-INTTPPASDVVPSFYGIP  64

Query  230  GNVSEQLPTAMLLSPSPP----AACGIIGSREFSRTPAPRGGYGCLFESGDECNNGLLDS  397
                  +P   +   + P      CGI G +       P      ++E GD   N    S
Sbjct  65   YPERLGVPAVDVAESALPEFDMGLCGITGIQSLGSGYQPD-----VYEFGDNKRNAFA-S  118

Query  398  NFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNF  577
            +F  ++     +  ++  IQG +I P ++E+  +K+GRY+ EERKDRIL+YLKKRNQRNF
Sbjct  119  DFRQVH-----TGGDVWAIQGNSI-PAVEER-NLKVGRYTVEERKDRILKYLKKRNQRNF  171

Query  578  NKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLYYDH  757
            NKTIKYACRKTLAD+RVRVRGRFA+NN++C +            +NN   HQ ++ YYD 
Sbjct  172  NKTIKYACRKTLADRRVRVRGRFARNNDVCEEATSM------KNNNNDSSHQDEEEYYDD  225

Query  758  PFQAKQDEEEEWLEEAITSLMYIPYIGG  841
              Q K + EE+WL+EA+T+LMY+P   G
Sbjct  226  GSQMKLN-EEDWLQEAVTNLMYLPIFSG  252



>ref|XP_004488804.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X1 
[Cicer arietinum]
Length=300

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 106/159 (67%), Gaps = 12/159 (8%)
 Frame = +2

Query  359  ESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDR  538
            E GDEC   + D    S YP     ++ I+G Q  A+     E+P +K+GRYSEEERK+R
Sbjct  147  EFGDECCAFVEDVKPPSAYPNAARENWGIQGNQIAAV-----EEPNIKVGRYSEEERKER  201

Query  539  ILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNN  718
            ILRYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+NNEIC +       +    D  
Sbjct  202  ILRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNNEICEEDHMATKKLENHHD--  259

Query  719  IIVHQTKDLYYDHPFQAK-QDEEEEWLEEAITSLMYIPY  832
                 ++D Y    FQ + ++EEE+WL+EA+ SL+Y+ +
Sbjct  260  ----HSEDFYASDSFQFQLKNEEEDWLQEAMASLVYLSH  294



>ref|XP_006585412.1| PREDICTED: uncharacterized protein LOC102670442 [Glycine max]
Length=284

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 111/293 (38%), Positives = 156/293 (53%), Gaps = 43/293 (15%)
 Frame = +2

Query  20   SMAFIPPQHQYCSDHMFPS-ELRQLPTPMILSDGIAAARAGGTAYDTTN----------N  166
            SMA IP   Q+  ++ F + +L   PTP++   G +      +  DTT           N
Sbjct  7    SMASIP---QFYQNYTFTTHDLSDYPTPLLNGGGGSNDIVNASVMDTTTVWGGGQDSLIN  63

Query  167  ALHLNMMDAAIS--------TFPHHHNPLGNVSEQLP--TAMLLSPSPPAACGIIGSREF  316
               L+M + A+         T     N + + SEQL   + + +S       G   S   
Sbjct  64   IPVLDMNNGALDHIVSLDCDTMACAANWMPSFSEQLGGFSDLAISDCKMGFYGGFQSFNN  123

Query  317  SRTPAPRGGYGCLFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPA  496
            SR+  P  G     E GDEC  G ++      YP     ++ I+G Q  AI     E+P 
Sbjct  124  SRSYQPHVG-----EFGDECC-GFVEDVKPPAYPNAARENWGIQGNQMAAI-----EEPN  172

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdg  676
            +K+GRYSEEERK+RILRYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+NNE+C + 
Sbjct  173  IKVGRYSEEERKERILRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNNELCEED  232

Query  677  dgdddIVIKSRDNNIIVHQTKDLYYDHPFQAK-QDEEEEWLEEAITSLMYIPY  832
                   + ++ +    H   D Y     Q + +++EE+WL+EA+ SL+Y+ +
Sbjct  233  -------MATKKHQNHHHHKGDFYGGDSIQFQLKNDEEDWLQEAMASLVYLSH  278



>ref|XP_006598211.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Glycine 
max]
Length=278

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 109/288 (38%), Positives = 156/288 (54%), Gaps = 39/288 (14%)
 Frame = +2

Query  20   SMAFIPPQHQYCSDHMFPS-ELRQLPTPMILSDGIAAARAGGTAYDTTNNALHLNMMDAA  196
            SMA IP   Q+  ++ F + +L + P P++   G A+     T +    ++L + ++D  
Sbjct  7    SMASIP---QFYPNYTFTTHDLSEYPVPLLNGGGNASVMDSTTMWGGGQDSLSIPVLDMN  63

Query  197  ISTFPH-----------HHNPLGNVSEQLPTAMLLSPSPPAACGIIG----SREFSRTPA  331
                 H             N + + SEQL     L+ S     G  G    S   SR+  
Sbjct  64   NGALDHIVSLDCDTMACAANWMPSFSEQLGGLSDLAISD-CKIGFYGGGFQSFNNSRSYQ  122

Query  332  PRGGYGCLFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGR  511
            P  G     E GDEC  G ++      YP     ++ IEG Q  A+     E+P +K+GR
Sbjct  123  PHVG-----EFGDECC-GFVEDLKPPPYPNAARENWGIEGNQMAAV-----EEPNIKVGR  171

Query  512  YSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgddd  691
            YSEEERK+RILRYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+NNE+C +      
Sbjct  172  YSEEERKERILRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNNELCEED-----  226

Query  692  IVIKSRDNNIIVHQTKDLYYDHPFQAK-QDEEEEWLEEAITSLMYIPY  832
              + ++ +    H  +D Y     Q + +++EE+WL+EA+ SL+Y+ +
Sbjct  227  --MATKKHENHHHHKEDFYGGDSIQFQLKNDEEDWLQEAMASLVYLSH  272



>gb|KDP25102.1| hypothetical protein JCGZ_22637 [Jatropha curcas]
Length=280

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 117/300 (39%), Positives = 156/300 (52%), Gaps = 47/300 (16%)
 Frame = +2

Query  23   MAFIPPQHQYCSDHMFPSELRQLPTPMILSDGIAAARAGGT----------AYDTTNN--  166
            MAF+P  H Y      P E   + + M   +    A AGG            ++  NN  
Sbjct  1    MAFVP--HFYTDYQFSPQEFSDINSVMAQENYGNNAFAGGAISTACAMMGREHNHRNNLP  58

Query  167  ALHLNMMD-AAISTFPHHHNPLGNVSEQLPT-----AMLLSPSPPAACGII-----GSRE  313
              + N+ D  A+  FP       +V  +LP      A  L  S  A   +I     G   
Sbjct  59   IFYDNINDNGALEGFPPEST---DVFSRLPAVTTSFADQLGVSDVAVPSLIDHYKMGFSS  115

Query  314  FSRTPAPRGGY---GCLFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLK  484
             ++     GG+      FE GD+C   L   NF S+ P     ++ I+  Q  AI     
Sbjct  116  IAKIQNLGGGFQYNSGPFEFGDDCCEFL--QNFKSICPD-SRETWGIQCNQMPAI-----  167

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E   +K+GRY+ EERKDRILRYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+NNE+
Sbjct  168  EHSNIKVGRYTVEERKDRILRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNNEL  227

Query  665  CgdgdgdddIVIKSRDNNIIVHQTKDLYYDHPFQAKQ-DEEEEWLEEAITSLMYIPYIGG  841
             G+ +       K  DN +   Q K+ Y++   Q K  D++++WL+EA+ SLMY+PYI G
Sbjct  228  IGEDETGS----KKNDNPL---QEKESYFNDALQMKNSDDDDDWLQEAVASLMYVPYIAG  280



>ref|XP_009361816.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Pyrus x 
bretschneideri]
Length=282

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 105/299 (35%), Positives = 152/299 (51%), Gaps = 48/299 (16%)
 Frame = +2

Query  23   MAFIPPQHQYCSDHMFPSELRQLPTPMILSD-GIAAARAGGTAY--------------DT  157
            MA IP  HQ+ +D+  PS     PTP++  + G + A  GGT +              D 
Sbjct  1    MASIP--HQFYNDYSLPSHFYGYPTPVVSGENGCSTAVLGGTMWGASTTCEESLVPFCDI  58

Query  158  TNNALHLNMMD--------AAISTFPHHHNPLGNVSEQLPTAMLLSPSPPAACGIIGSRE  313
            +N A +  ++           +++FP     L   SE +       P   +  G +G   
Sbjct  59   SNAAANFEVVSPESDISSSVMVASFPE----LLGFSEDIAV-----PGTYSEYGNMGMHG  109

Query  314  FSRTPAPRGGYGCLF---ESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLK  484
             + TP   G     +   + G++   GL+ +NF    P       N    Q     P ++
Sbjct  110  IAGTPNFGGELNLAYMNDQLGEDRCTGLMSANF---KPFSLAGQENWAINQANQQVPTIE  166

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +Q  MK+GRYSEEERK+RI RYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+N + 
Sbjct  167  DQSTMKVGRYSEEERKERIDRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNTD-  225

Query  665  CgdgdgdddIVIKSRDNNIIV--HQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYIPYI  835
                   +++  +  +NNI     Q  +LY        + ++++WL+EA+ SLMY PY+
Sbjct  226  -----HHEEMAQEKTENNIQTCKDQRSELYCSSGTVQMKYDDDDWLQEAMASLMYFPYV  279



>gb|KHN48906.1| Zinc finger protein CONSTANS-LIKE 3 [Glycine soja]
Length=271

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 108/287 (38%), Positives = 155/287 (54%), Gaps = 39/287 (14%)
 Frame = +2

Query  23   MAFIPPQHQYCSDHMFPS-ELRQLPTPMILSDGIAAARAGGTAYDTTNNALHLNMMDAAI  199
            MA IP   Q+  ++ F + +L + P P++   G A+     T +    ++L + ++D   
Sbjct  1    MASIP---QFYPNYTFTTHDLSEYPVPLLNGGGNASVMDSTTMWGGGQDSLSIPVLDMNN  57

Query  200  STFPH-----------HHNPLGNVSEQLPTAMLLSPSPPAACGIIG----SREFSRTPAP  334
                H             N + + SEQL     L+ S     G  G    S   SR+  P
Sbjct  58   GALDHIVSLDCDTMACAANWMPSFSEQLGGLSDLAISD-CKIGFYGGGFQSFNNSRSYQP  116

Query  335  RGGYGCLFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRY  514
              G     E GDEC  G ++      YP     ++ IEG Q  A+     E+P +K+GRY
Sbjct  117  HVG-----EFGDECC-GFVEDLKPPPYPNAARENWGIEGNQMAAV-----EEPNIKVGRY  165

Query  515  SEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddI  694
            SEEERK+RILRYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+NNE+C +       
Sbjct  166  SEEERKERILRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNNELCEED------  219

Query  695  VIKSRDNNIIVHQTKDLYYDHPFQAK-QDEEEEWLEEAITSLMYIPY  832
             + ++ +    H  +D Y     Q + +++EE+WL+EA+ SL+Y+ +
Sbjct  220  -MATKKHENHHHHKEDFYGGDSIQFQLKNDEEDWLQEAMASLVYLSH  265



>ref|XP_002513394.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48797.1| conserved hypothetical protein [Ricinus communis]
Length=277

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 144/288 (50%), Gaps = 30/288 (10%)
 Frame = +2

Query  23   MAFIPPQHQYCSDHMFPSELRQLPTPMILSDGIAAARAGGTAYDTTNNALHLNMMDAAIS  202
            MA I P H Y      P E  ++ + +   +    A    T   T + A    M+     
Sbjct  1    MASIDP-HFYSGYQFSPDEFSEITSVIAHQENYGTAT---TFVATNSTAAAGAMLSHEQI  56

Query  203  TFPHHHNPLGNVSEQLPT--AMLLSPSPPAACGIIGSR-EFSRTPAPR------------  337
              P  ++  G + E  PT  +  LS  P       G +   S    P             
Sbjct  57   NLPLFYDNNGGLVEGFPTTESDTLSRVPATTTSSFGEQLGVSDMSVPSLMDYKMGLGSIA  116

Query  338  --GGYGCLFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGR  511
                +G  F+  D C  G     F   + +  P +    GIQ   + P + E   MK+GR
Sbjct  117  KIQNFGGGFQFSDACEYGEDCCGFVQNFKSVCPETGEDWGIQYNQM-PAIHEHANMKVGR  175

Query  512  YSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgddd  691
            Y+ EERKDRILRYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+NNE+C     D++
Sbjct  176  YTVEERKDRILRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNNELC-----DEE  230

Query  692  IVIKSRDNNIIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYIPYI  835
            I  K  DN +   Q K+ +  +     ++++++WL+EA+ SLMY+PYI
Sbjct  231  IGRKKNDNPL---QEKESFCQNNALEMKNDDDDWLQEAVASLMYVPYI  275



>ref|XP_008364253.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Malus domestica]
Length=282

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/299 (35%), Positives = 153/299 (51%), Gaps = 48/299 (16%)
 Frame = +2

Query  23   MAFIPPQHQYCSDHMFPSELRQLPTPMILSD-GIAAARAGGTAY--------------DT  157
            MA IP  HQ+ +D+  PS     PTP++  + G + A  GGT +              D 
Sbjct  1    MASIP--HQFYNDYSLPSHFYGYPTPVVSGENGCSTAVLGGTMWSASTTCEESLVPFCDI  58

Query  158  TNNALHLNMMD--------AAISTFPHHHNPLGNVSEQLPTAMLLSPSPPAACGIIGSRE  313
            +N A ++ ++           +++FP     L   SE +       P   +  G +G   
Sbjct  59   SNAAANIEVVSPESBISSSVIVASFPE----LLGFSEDIAV-----PGTYSEYGNMGMHG  109

Query  314  FSRTPAPRGGYGCLF---ESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLK  484
             + TP   G     +   + G++   GL+ ++F    P       N    Q     P ++
Sbjct  110  IAGTPXFGGELNLPYMNDQLGEDHCTGLMSADF---KPFSLAGQENWAINQANQQVPTIE  166

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +Q  MK+GRYSEEERK+RI RYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+N + 
Sbjct  167  DQSTMKVGRYSEEERKERIDRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNTD-  225

Query  665  CgdgdgdddIVIKSRDNNIIV--HQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYIPYI  835
                   +++  +  +NNI     Q  +LY        + ++++WL+EA+ SLMY PY+
Sbjct  226  -----NHEEMAQEKTENNIQTCKDQRSELYCSSGTVQMKYDDDDWLQEAMASLMYFPYV  279



>ref|XP_004488805.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X2 
[Cicer arietinum]
Length=297

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 102/159 (64%), Gaps = 15/159 (9%)
 Frame = +2

Query  359  ESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDR  538
            E GDEC   + D         +PPS+Y     +         E+P +K+GRYSEEERK+R
Sbjct  147  EFGDECCAFVED--------VKPPSAYPNAARENWGNQIAAVEEPNIKVGRYSEEERKER  198

Query  539  ILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNN  718
            ILRYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+NNEIC +       +    D  
Sbjct  199  ILRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNNEICEEDHMATKKLENHHD--  256

Query  719  IIVHQTKDLYYDHPFQAK-QDEEEEWLEEAITSLMYIPY  832
                 ++D Y    FQ + ++EEE+WL+EA+ SL+Y+ +
Sbjct  257  ----HSEDFYASDSFQFQLKNEEEDWLQEAMASLVYLSH  291



>ref|XP_003596140.1| CCT [Medicago truncatula]
 gb|AES66391.1| CCT motif protein [Medicago truncatula]
Length=266

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 101/144 (70%), Gaps = 13/144 (9%)
 Frame = +2

Query  419  TRPPSSY-NIE----GIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNK  583
             +PP++Y N+     GIQG  ++    E+P +K+GRYSEEERK+RILRYLKKRNQRNFNK
Sbjct  124  VKPPTTYPNVARENWGIQGNQLAAV--EEPNIKVGRYSEEERKERILRYLKKRNQRNFNK  181

Query  584  TIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLYYDHPF  763
            TIKYACRKTLAD+RVRVRGRFA+NNE C +       +    D     H  +D Y    F
Sbjct  182  TIKYACRKTLADRRVRVRGRFARNNETCEEDHMATKKLENHHD-----HINEDFYGADSF  236

Query  764  QAK-QDEEEEWLEEAITSLMYIPY  832
            Q + ++EEE+WL+EA+ SL+Y+ +
Sbjct  237  QFQLKNEEEDWLQEAMASLVYLSH  260



>emb|CDP13589.1| unnamed protein product [Coffea canephora]
Length=248

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 110/158 (70%), Gaps = 15/158 (9%)
 Frame = +2

Query  356  FESGD-ECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERK  532
            ++ GD EC  G   SNFW LYP R  +S N E IQG  ++ ++ E+  +K+ RYS EERK
Sbjct  84   YDFGDQEC--GAPASNFWPLYP-RAMTSDNWE-IQG-GVAQRM-EEATLKVSRYSAEERK  137

Query  533  DRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRD  712
            DRILRYLKKR+QRNFNKTIKYACRKTLADKRVRVRGRFA+NNE C   + D  +V+   D
Sbjct  138  DRILRYLKKRSQRNFNKTIKYACRKTLADKRVRVRGRFARNNECC---EDDQTLVLVKTD  194

Query  713  NNIIVHQTKDLYYDHPF--QAKQDEEEEWLEEAITSLM  820
            +N+   Q  D  Y+ P   Q  +  +EEWL+EAI SLM
Sbjct  195  SNL---QQADSCYNIPADDQIMKSYDEEWLQEAIASLM  229



>gb|KCW67729.1| hypothetical protein EUGRSUZ_F01466 [Eucalyptus grandis]
Length=133

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (71%), Gaps = 12/127 (9%)
 Frame = +2

Query  476  KLKEQPA-----MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRG  640
            KL+E+P+     +K+GRYS EERK RILRYLKKRN+RNFNKTIKYACRK+LAD+RVRVRG
Sbjct  2    KLQEEPSPEECNLKVGRYSVEERKHRILRYLKKRNKRNFNKTIKYACRKSLADRRVRVRG  61

Query  641  RFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLM  820
            RFA+N++ C +        I +   N      KDL++    Q KQDEE+EW++EA+  L+
Sbjct  62   RFARNSDSCAEE-------IAAAKKNEYPQLEKDLFFGDDVQMKQDEEDEWVQEALADLL  114

Query  821  YIPYIGG  841
            Y+PY   
Sbjct  115  YLPYASA  121



>ref|XP_002306413.1| hypothetical protein POPTR_0005s10040g [Populus trichocarpa]
 gb|EEE93409.1| hypothetical protein POPTR_0005s10040g [Populus trichocarpa]
Length=283

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 108/304 (36%), Positives = 158/304 (52%), Gaps = 53/304 (17%)
 Frame = +2

Query  23   MAFIPPQHQYCSDHMF-PSELRQLPTPMILSDGIAAARAGG-TAYDTTNNALHLNMMDAA  196
            MA IP    + SD+ F P +  ++ +  +++     AR G  ++ + ++ A+  +  D +
Sbjct  1    MASIP---HFYSDYQFSPDKFSEISS--VMAQDHRYARTGSFSSTNMSSGAMFGDHQDYS  55

Query  197  ISTFPHHHNPLG------------------NVSEQLPTAMLLSPS-----PPAACGIIGS  307
              TF  H N                     ++ E+   + ++ P+       + CGI   
Sbjct  56   FPTFYDHENGCALDIFQGESEIMSPIPATKSLPERFGISNMVVPTLMDYKMGSNCGIAKI  115

Query  308  REFSRTPAPRGGYGC--LFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKL  481
            + F       GG+    + E G++C  G+L        P   P++     ++   I+ K 
Sbjct  116  QSFG------GGFQLSDVCEYGEDCC-GILPK----FTPATCPAAEENWRLEYNRITAK-  163

Query  482  KEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            +    +K+GRY+ EERKDRILRYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFAKNNE
Sbjct  164  ENTNMVKVGRYTVEERKDRILRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFAKNNE  223

Query  662  ICgdgdgdddIVIKSRDNNI-IVHQTKDLY-YDHPFQAK--QDEEEEWLEEAITSLMYIP  829
            I  +        +K  D+NI   H  KD Y      Q K   D+EE+WL+EA+ SLM++P
Sbjct  224  IFEEETE-----VKKNDDNIPHHHHEKDTYCTSDAVQIKNDDDDEEQWLQEALASLMFVP  278

Query  830  YIGG  841
            YI  
Sbjct  279  YIAA  282



>ref|XP_010064538.1| PREDICTED: uncharacterized protein LOC104451621 [Eucalyptus grandis]
Length=278

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 90/124 (73%), Gaps = 12/124 (10%)
 Frame = +2

Query  476  KLKEQPA-----MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRG  640
            KL+E+P+     +K+GRYS EERK RILRYLKKRN+RNFNKTIKYACRK+LAD+RVRVRG
Sbjct  147  KLQEEPSPEECNLKVGRYSVEERKHRILRYLKKRNKRNFNKTIKYACRKSLADRRVRVRG  206

Query  641  RFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLM  820
            RFA+N++ C +        I +   N      KDL++    Q KQDEE+EW++EA+  L+
Sbjct  207  RFARNSDSCAEE-------IAAAKKNEYPQLEKDLFFGDDVQMKQDEEDEWVQEALADLL  259

Query  821  YIPY  832
            Y+PY
Sbjct  260  YLPY  263



>ref|XP_009349169.1| PREDICTED: uncharacterized protein LOC103940733 [Pyrus x bretschneideri]
Length=202

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 108/169 (64%), Gaps = 28/169 (17%)
 Frame = +2

Query  365  GDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAIS------PKLKEQPAMKIGRYSEEE  526
            G++C  GL+ ++F      +P   ++  G +  AI+      P +++Q  MK+GRYSEEE
Sbjct  52   GEDCFTGLMSADF------KP---FSFAGQENRAINQENQQVPTVEDQSTMKVGRYSEEE  102

Query  527  RKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKS  706
            RK+RI RYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+N +        ++I  K 
Sbjct  103  RKERIDRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNTD------HHEEIAQKK  156

Query  707  RDNNIIVHQTKDLYYDHPF----QAKQDEEEEWLEEAITSLMYIPYIGG  841
              +NI   QT       PF      ++ +E++WL+EA+ SLMY PY+ G
Sbjct  157  TQSNI---QTCKDQRSEPFCSSGAVQKYDEDDWLQEAVASLMYFPYVTG  202



>ref|XP_011095824.1| PREDICTED: uncharacterized protein LOC105175174 [Sesamum indicum]
Length=236

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 110/162 (68%), Gaps = 18/162 (11%)
 Frame = +2

Query  353  LFESG-DECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEER  529
            +FE G D+C+   L  NFW  YP  P  ++   GIQG A++    E+  +K+GRYS EER
Sbjct  90   VFEPGEDQCSR--LVPNFWPAYPL-PAENW---GIQGRAVTKV--EETEVKVGRYSVEER  141

Query  530  KDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSR  709
            KDRILRYLKKRNQRNF KTIKYACRKTLADKRVR+RGRFAKNNE       +D+I + + 
Sbjct  142  KDRILRYLKKRNQRNFTKTIKYACRKTLADKRVRIRGRFAKNNE-----PSEDEIAMMNA  196

Query  710  DNNIIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYIPYI  835
             ++   ++   L YD   Q K D +++WL+ A+ +L+++PY 
Sbjct  197  SHDHTNYEQNSLVYD---QMKYD-DDDWLQAAMANLVHLPYF  234



>ref|XP_011097636.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Sesamum indicum]
Length=219

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 101/162 (62%), Gaps = 4/162 (2%)
 Frame = +2

Query  365  GDECNNGLLDSNFW--SLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDR  538
            G++C+  +  +  W  + Y T   + + +EG Q +       E+  +K+GRYS EERKDR
Sbjct  59   GEDCSGLMAVAESWPTTNYDTIADNIWQVEGAQDKKQLVPEVEESEVKVGRYSVEERKDR  118

Query  539  ILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE-ICgdgdgdddIVIKSRDN  715
            ILRYLKKRNQRNFNKTIKYACRKTLADKRVR+RGRFAK+NE  C      +  VI + DN
Sbjct  119  ILRYLKKRNQRNFNKTIKYACRKTLADKRVRIRGRFAKHNEPPCEHIHHQNCNVINTTDN  178

Query  716  NIIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYIPYIGG  841
            +   H +   Y           +++W++ A+  L+Y+PYI G
Sbjct  179  S-YQHNSSSFYGHDQSSQMMYGDDDWVQAAMGGLVYLPYIAG  219



>ref|XP_008447123.1| PREDICTED: uncharacterized protein LOC103489646 [Cucumis melo]
Length=284

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 108/166 (65%), Gaps = 13/166 (8%)
 Frame = +2

Query  353  LFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERK  532
             +E  D+C  GL+     S Y   P  ++N +  Q   +S  + E   MK+GRYSEE RK
Sbjct  129  FYEFQDDCF-GLVPEIKPSFYNNNPLPTHNGDN-QSNQVS--VAEDSNMKVGRYSEEVRK  184

Query  533  DRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRD  712
             RILRYLKKRNQRNFNKTIKYACRKTLAD+R+RVRGRFA+NNE       D ++   + +
Sbjct  185  QRILRYLKKRNQRNFNKTIKYACRKTLADRRIRVRGRFARNNEAI----SDQEVNPTTMN  240

Query  713  NNIIVHQTKDLYYDH---PFQAKQDEEEEWLEEAITSLMYIPYIGG  841
            N+  + +  +L Y+H     Q K+D EEEWL+E I+S+MY+PYI  
Sbjct  241  NDTTIQKDTELLYNHHDFGVQMKRD-EEEWLQE-ISSIMYLPYISS  284



>ref|XP_008226179.1| PREDICTED: zinc finger protein CONSTANS-LIKE 3 [Prunus mume]
Length=258

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 98/160 (61%), Gaps = 13/160 (8%)
 Frame = +2

Query  365  GDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKL-KEQPAMKIGRYSEEERKDRI  541
            G+EC  GL   N   + P       N  GIQG    P + ++Q  MK+GRYSEEERK+RI
Sbjct  105  GEECCTGL---NMSDIKPFGLAGQENW-GIQGNQQVPTIDQDQSNMKVGRYSEEERKERI  160

Query  542  LRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNNI  721
             RYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+N E+         I      N+ 
Sbjct  161  GRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNTELSDQEIEAKKI----DSNHT  216

Query  722  IVHQTKDLYYDHP---FQAKQDEEEEWLEEAITSLMYIPY  832
               Q  ++Y  +       K DE++ WL+EA+  LMY+PY
Sbjct  217  CKDQRSEMYCSNDAVQMMMKYDEDDYWLQEAM-GLMYLPY  255



>gb|KGN44270.1| hypothetical protein Csa_7G237850 [Cucumis sativus]
Length=274

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 99/153 (65%), Gaps = 13/153 (8%)
 Frame = +2

Query  404  WSLYPTRPPSSYN----IEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQR  571
            + L P   PS YN          ++    + E   MK+GRYSEE RK+RILRYLKKRNQR
Sbjct  128  FGLVPEIKPSFYNNPLPTHNWDNQSNQVSVAEDSNMKVGRYSEEVRKERILRYLKKRNQR  187

Query  572  NFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLYY  751
            NFNKTIKYACRKTLAD+R+RVRGRFA+ NE   D + +  I    ++N+  + +  +L Y
Sbjct  188  NFNKTIKYACRKTLADRRIRVRGRFARKNEAISDQELNPTI----KNNDTTIQKDTELLY  243

Query  752  DH---PFQAKQDEEEEWLEEAITSLMYIPYIGG  841
            +H     Q K D EEEWL++ I+SLMY+PYI  
Sbjct  244  NHHDFGVQMKGD-EEEWLQD-ISSLMYLPYISS  274



>ref|XP_010552403.1| PREDICTED: uncharacterized protein LOC104822755 isoform X2 [Tarenaya 
hassleriana]
Length=263

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 117/206 (57%), Gaps = 37/206 (18%)
 Frame = +2

Query  266  LSPSP----PAACGIIG-SREFSRTPAPRGGYGCLFES--------GDECNNGLLDSNFW  406
            +SP+P    P   GI   + EF+      G Y C F +        G+EC         +
Sbjct  60   VSPTPETFFPERLGIPDMAPEFNNNIGAFGSYVCDFNNTLYCHQINGEEC---------Y  110

Query  407  SLYPTRPPSSY---NIEGIQGEAISPKL--KEQPAMKIGRYSEEERKDRILRYLKKRNQR  571
            SL P   P S    +++   G A   ++   E+   KIGRYS EERKDRILRYLKK+NQR
Sbjct  111  SLSPELKPFSSPAPSLDQYWGAAGGRQIPATEETNTKIGRYSVEERKDRILRYLKKKNQR  170

Query  572  NFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLYY  751
            NFNKTIKY CRKTLAD+RVR+RGRFA+NNEIC         +  S++N     + +++Y 
Sbjct  171  NFNKTIKYVCRKTLADRRVRIRGRFARNNEICEQ-------LSPSKNN---TEKEEEIYS  220

Query  752  DHPFQAKQDEEEEWLEEAITSLMYIP  829
               + A+ + ++ WL+EA++ ++Y P
Sbjct  221  GDDYIAQMEHDDSWLQEAMSDMIYFP  246



>ref|XP_011014106.1| PREDICTED: uncharacterized protein LOC105117974 [Populus euphratica]
Length=295

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 84/116 (72%), Gaps = 9/116 (8%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdg  676
            +K+GRY+ EERKDRI RYLKKRNQRNF KTIKYACRKTLAD+RVRVRGRFA+NNEI  + 
Sbjct  182  IKVGRYTVEERKDRISRYLKKRNQRNFTKTIKYACRKTLADRRVRVRGRFARNNEIFEEE  241

Query  677  dgdddIVIKSRDNNI--IVHQTKDLYYDHPFQAK--QDEEEEWLEEAITSLMYIPY  832
                   +K  D+NI  + H  +     +  Q K   DE+E+WL+EA+ SL+Y+PY
Sbjct  242  TE-----VKKDDDNIPYLRHGKETYCTSNAVQIKNDDDEDEQWLQEALASLVYVPY  292



>ref|XP_011022118.1| PREDICTED: uncharacterized protein LOC105123995 [Populus euphratica]
Length=286

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 83/115 (72%), Gaps = 9/115 (8%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdg  676
            +K+GRY+ EERKDRILRYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFAKNNEI  + 
Sbjct  177  VKVGRYTVEERKDRILRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFAKNNEIFEEE  236

Query  677  dgdddIVIKSRDNNI-IVHQTKDLY-YDHPFQAK--QDEEEEWLEEAITSLMYIP  829
                   +K  D+NI   H  K  Y      Q K   D+EE+WL+EA+ SLM +P
Sbjct  237  TE-----VKKNDDNIPHPHHEKYTYCTSDAVQIKNDDDDEEQWLQEALASLMCVP  286



>ref|XP_010552402.1| PREDICTED: uncharacterized protein LOC104822755 isoform X1 [Tarenaya 
hassleriana]
Length=267

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 83/115 (72%), Gaps = 10/115 (9%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E+   KIGRYS EERKDRILRYLKK+NQRNFNKTIKY CRKTLAD+RVR+RGRFA+NNEI
Sbjct  146  EETNTKIGRYSVEERKDRILRYLKKKNQRNFNKTIKYVCRKTLADRRVRIRGRFARNNEI  205

Query  665  CgdgdgdddIVIKSRDNNIIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYIP  829
            C         +  S++N     + +++Y    + A+ + ++ WL+EA++ ++Y P
Sbjct  206  CEQ-------LSPSKNN---TEKEEEIYSGDDYIAQMEHDDSWLQEAMSDMIYFP  250



>ref|XP_010093048.1| Zinc finger protein CONSTANS [Morus notabilis]
 gb|EXB53376.1| Zinc finger protein CONSTANS [Morus notabilis]
Length=291

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 107/179 (60%), Gaps = 16/179 (9%)
 Frame = +2

Query  293  GIIGSREF------SRTPAPRGGYGCLFESGDECNNGLLDSNFWS--LYPTRPPSSYNIE  448
            GI+G++ F      S    P+      FE G+EC      ++F    + P    S+    
Sbjct  108  GIVGAQNFGGSYNTSCVNYPQYVNANGFEFGEEC----CATSFLPELIKPVGLVSAQKNW  163

Query  449  GIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRV  628
            G+Q       ++E   MK+GRYSEEERK+RI+RYLKKRNQRNFNKTIKYACRKTLAD+RV
Sbjct  164  GMQNNQNIHAIEESNMMKVGRYSEEERKERIVRYLKKRNQRNFNKTIKYACRKTLADRRV  223

Query  629  RVRGRFAKNNEICgdgdgdddIVIKSRDNNII-VHQTKDLYYDHPFQAKQDEEEEWLEE  802
            RVRGRFA+NNE+   GD   +     + NNI  V +  +L  D   Q K DE+E+WL +
Sbjct  224  RVRGRFARNNELMMCGDQQME---SQKINNIDPVFKDIELCCDDTVQIKYDEDEDWLRD  279



>ref|XP_007214737.1| hypothetical protein PRUPE_ppa025213mg, partial [Prunus persica]
 gb|EMJ15936.1| hypothetical protein PRUPE_ppa025213mg, partial [Prunus persica]
Length=257

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 117/226 (52%), Gaps = 24/226 (11%)
 Frame = +2

Query  44   HQYCSDHMFPSELRQLPTPMILSDGIAAARAGGTAYDTT---NNALHLNMMDAAIS---T  205
            HQ+ +D+  P      PTP +  +    +  GG  +  T   N     N+  AA++    
Sbjct  6    HQFYNDYSLPCGFYGYPTPEMAGENGCGSVFGGAMWGATCEENLVPFCNVSSAAVNFDVM  65

Query  206  FPHHHNPLGNVSEQLPTAMLLSP--SPPAAC-----GIIGSREFSRTPAPRGG-----YG  349
             P        ++   P  + +S   S PAA      G +G    +      GG     Y 
Sbjct  66   SPESDISSSVMAASFPELLKISEDLSVPAAAAFSDYGNMGLHGLAGINQNFGGEISQPYM  125

Query  350  CLFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKL-KEQPAMKIGRYSEEE  526
            C  + G+EC  GL   N   + P       N  GIQG    P + ++Q  MK+GRYSEEE
Sbjct  126  CD-QFGEECCTGL---NMSDIKPFGLAGQENW-GIQGNQQVPTIDQDQSNMKVGRYSEEE  180

Query  527  RKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            RK+RI RYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+N E+
Sbjct  181  RKERIGRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNTEL  226



>ref|XP_010499608.1| PREDICTED: uncharacterized protein LOC104777094 isoform X1 [Camelina 
sativa]
Length=255

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 87/130 (67%), Gaps = 8/130 (6%)
 Frame = +2

Query  446  EGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKR  625
            +  QG +      +QP +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+R
Sbjct  115  QSWQGNSEGGIQADQPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRR  174

Query  626  VRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLE  799
            VRVRGRFA+NNE C +          S+++N    + +D++   D     + + ++ WL 
Sbjct  175  VRVRGRFARNNETCEEQSHM------SKNHNNHSEKDEDMFSGSDDYLMQQMEHDDGWLH  228

Query  800  EAITSLMYIP  829
            EA+++L+  P
Sbjct  229  EAMSTLIPFP  238



>ref|XP_009135259.1| PREDICTED: two-component response regulator-like APRR1 isoform 
X4 [Brassica rapa]
Length=243

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 90/152 (59%), Gaps = 20/152 (13%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPK-LKEQPAMKIGRYSEEERKDRILRYLKKRNQ  568
            D  ++   P   P  Y   G Q    S   ++ +P  K+GRYS EERKDRI+RYLKK+NQ
Sbjct  90   DQEYYGYSPEIKPLFYQSTGEQSWGNSEGVIQAEPNTKVGRYSVEERKDRIMRYLKKKNQ  149

Query  569  RNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLY  748
            RNFNKTIKY CRKTLAD+RVRVRGRFA+NN+ C           +S D+N   H  KD  
Sbjct  150  RNFNKTIKYVCRKTLADRRVRVRGRFARNNDTCEQ---------QSHDHN---HSEKDEN  197

Query  749  Y-----DHPFQAKQDEEEEWLEEAITSLMYIP  829
                  D+  Q K D  + WL EA+ +L+Y P
Sbjct  198  MFSGSDDYLIQMKND--DGWLHEAMCNLIYFP  227



>ref|XP_010499619.1| PREDICTED: uncharacterized protein LOC104777094 isoform X3 [Camelina 
sativa]
Length=254

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 11/131 (8%)
 Frame = +2

Query  446  EGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKR  625
            +  QG +      +QP +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+R
Sbjct  115  QSWQGNSEGGIQADQPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRR  174

Query  626  VRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLYY---DHPFQAKQDEEEEWL  796
            VRVRGRFA+NNE C +          S+++N    + +D++    D+  Q + D  + WL
Sbjct  175  VRVRGRFARNNETCEEQSHM------SKNHNNHSEKDEDMFSGSDDYLMQMEHD--DGWL  226

Query  797  EEAITSLMYIP  829
             EA+++L+  P
Sbjct  227  HEAMSTLIPFP  237



>ref|XP_010499614.1| PREDICTED: uncharacterized protein LOC104777094 isoform X2 [Camelina 
sativa]
Length=254

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 8/117 (7%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +QP +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NNE 
Sbjct  127  DQPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNNET  186

Query  665  CgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAITSLMYIP  829
            C +          S+++N    + +D++   D     + + ++ WL EA+++L+  P
Sbjct  187  CEEQSHM------SKNHNNHSEKDEDMFSGSDDYLMQQMEHDDGWLHEAMSTLIPFP  237



>ref|XP_010465068.1| PREDICTED: zinc finger protein CONSTANS-LIKE 10-like isoform 
X1 [Camelina sativa]
Length=256

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 8/117 (7%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +QP +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NNE 
Sbjct  129  DQPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNNET  188

Query  665  CgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAITSLMYIP  829
            C +          S+++N    + +D++   D     + + ++ WL EA+++L+  P
Sbjct  189  CEEQSHM------SKNHNNHSEKDEDMFSGSDDYLMQQMEHDDGWLHEAMSNLIPFP  239



>ref|XP_004150045.1| PREDICTED: uncharacterized protein LOC101221095 [Cucumis sativus]
 ref|XP_004161664.1| PREDICTED: uncharacterized protein LOC101230503 [Cucumis sativus]
Length=245

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 88/125 (70%), Gaps = 17/125 (14%)
 Frame = +2

Query  485  EQPAMKIG-RYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAK-NN  658
            E+  +K+  RYSEEERK+RI+RYLKKRNQRNFNKTIKYACRKTLAD+R RVRGRFA+ NN
Sbjct  129  EETNIKVASRYSEEERKERIVRYLKKRNQRNFNKTIKYACRKTLADRRTRVRGRFARNNN  188

Query  659  EICgdgdgdddIVIKSRD----NNIIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYI  826
            E+C   D D +I +K+      N+ ++ Q          Q  ++EEE WL+E  TSLMY+
Sbjct  189  ELC---DNDHEIPLKTNQFSTPNHNLIKQID--------QTNKEEEESWLQELATSLMYL  237

Query  827  PYIGG  841
            PY+  
Sbjct  238  PYVAN  242



>gb|KGN46811.1| hypothetical protein Csa_6G138620 [Cucumis sativus]
Length=270

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 88/125 (70%), Gaps = 17/125 (14%)
 Frame = +2

Query  485  EQPAMKIG-RYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAK-NN  658
            E+  +K+  RYSEEERK+RI+RYLKKRNQRNFNKTIKYACRKTLAD+R RVRGRFA+ NN
Sbjct  154  EETNIKVASRYSEEERKERIVRYLKKRNQRNFNKTIKYACRKTLADRRTRVRGRFARNNN  213

Query  659  EICgdgdgdddIVIKSRD----NNIIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYI  826
            E+C   D D +I +K+      N+ ++ Q          Q  ++EEE WL+E  TSLMY+
Sbjct  214  ELC---DNDHEIPLKTNQFSTPNHNLIKQID--------QTNKEEEESWLQELATSLMYL  262

Query  827  PYIGG  841
            PY+  
Sbjct  263  PYVAN  267



>ref|XP_010487015.1| PREDICTED: two-component response regulator-like PRR37 isoform 
X2 [Camelina sativa]
Length=254

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 8/117 (7%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +QP +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NNE 
Sbjct  127  DQPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNNET  186

Query  665  CgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAITSLMYIP  829
            C +          S+++N    + +D++   D     + + ++ WL EA+++L+  P
Sbjct  187  CEEQSHM------SKNHNNHSEKDEDMFSGSDDYLMQQMEHDDGWLHEAMSNLIPFP  237



>ref|XP_010487014.1| PREDICTED: two-component response regulator-like PRR37 isoform 
X1 [Camelina sativa]
Length=255

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 8/117 (7%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +QP +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NNE 
Sbjct  128  DQPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNNET  187

Query  665  CgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAITSLMYIP  829
            C +          S+++N    + +D++   D     + + ++ WL EA+++L+  P
Sbjct  188  CEEQSHM------SKNHNNHSEKDEDMFSGSDDYLMQQMEHDDGWLHEAMSNLIPFP  238



>ref|XP_010499625.1| PREDICTED: uncharacterized protein LOC104777094 isoform X4 [Camelina 
sativa]
Length=253

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 11/118 (9%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +QP +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NNE 
Sbjct  127  DQPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNNET  186

Query  665  CgdgdgdddIVIKSRDNNIIVHQTKDLYY---DHPFQAKQDEEEEWLEEAITSLMYIP  829
            C +          S+++N    + +D++    D+  Q + D  + WL EA+++L+  P
Sbjct  187  CEEQSHM------SKNHNNHSEKDEDMFSGSDDYLMQMEHD--DGWLHEAMSTLIPFP  236



>emb|CDY24240.1| BnaC01g38200D [Brassica napus]
Length=250

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 81/116 (70%), Gaps = 8/116 (7%)
 Frame = +2

Query  488  QPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEIC  667
            +P  K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN+ C
Sbjct  124  EPNTKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNNDTC  183

Query  668  gdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAITSLMYIP  829
                        S+++N    + +D++   D     + + ++ WL+EA++SL+  P
Sbjct  184  EQQSHM------SKNHNNHSEKDEDVFSGSDDYLNQQMETDDRWLQEAMSSLISFP  233



>ref|XP_010465069.1| PREDICTED: zinc finger protein CONSTANS-LIKE 10-like isoform 
X2 [Camelina sativa]
Length=255

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 11/118 (9%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +QP +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NNE 
Sbjct  129  DQPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNNET  188

Query  665  CgdgdgdddIVIKSRDNNIIVHQTKDLYY---DHPFQAKQDEEEEWLEEAITSLMYIP  829
            C +          S+++N    + +D++    D+  Q + D  + WL EA+++L+  P
Sbjct  189  CEEQSHM------SKNHNNHSEKDEDMFSGSDDYLMQMEHD--DGWLHEAMSNLIPFP  238



>ref|XP_009135257.1| PREDICTED: two-component response regulator-like APRR1 isoform 
X3 [Brassica rapa]
 emb|CDX82571.1| BnaA03g32500D [Brassica napus]
Length=244

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 90/154 (58%), Gaps = 23/154 (15%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPK-LKEQPAMKIGRYSEEERKDRILRYLKKRNQ  568
            D  ++   P   P  Y   G Q    S   ++ +P  K+GRYS EERKDRI+RYLKK+NQ
Sbjct  90   DQEYYGYSPEIKPLFYQSTGEQSWGNSEGVIQAEPNTKVGRYSVEERKDRIMRYLKKKNQ  149

Query  569  RNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLY  748
            RNFNKTIKY CRKTLAD+RVRVRGRFA+NN+ C           +S D+N   H  KD  
Sbjct  150  RNFNKTIKYVCRKTLADRRVRVRGRFARNNDTCEQ---------QSHDHN---HSEKD--  195

Query  749  YDHPFQAKQD-------EEEEWLEEAITSLMYIP  829
             ++ F    D        ++ WL EA+ +L+Y P
Sbjct  196  -ENMFSGSDDYLIQQMKNDDGWLHEAMCNLIYFP  228



>ref|XP_010487017.1| PREDICTED: two-component response regulator-like PRR37 isoform 
X4 [Camelina sativa]
Length=253

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 11/118 (9%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +QP +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NNE 
Sbjct  127  DQPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNNET  186

Query  665  CgdgdgdddIVIKSRDNNIIVHQTKDLYY---DHPFQAKQDEEEEWLEEAITSLMYIP  829
            C +          S+++N    + +D++    D+  Q + D  + WL EA+++L+  P
Sbjct  187  CEEQSHM------SKNHNNHSEKDEDMFSGSDDYLMQMEHD--DGWLHEAMSNLIPFP  236



>ref|XP_010487016.1| PREDICTED: two-component response regulator-like PRR37 isoform 
X3 [Camelina sativa]
Length=254

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 84/118 (71%), Gaps = 11/118 (9%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +QP +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NNE 
Sbjct  128  DQPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNNET  187

Query  665  CgdgdgdddIVIKSRDNNIIVHQTKDLYY---DHPFQAKQDEEEEWLEEAITSLMYIP  829
            C +          S+++N    + +D++    D+  Q + D  + WL EA+++L+  P
Sbjct  188  CEEQSHM------SKNHNNHSEKDEDMFSGSDDYLMQMEHD--DGWLHEAMSNLIPFP  237



>ref|XP_009135256.1| PREDICTED: two-component response regulator-like APRR1 isoform 
X2 [Brassica rapa]
Length=244

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 91/153 (59%), Gaps = 21/153 (14%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPK--LKEQPAMKIGRYSEEERKDRILRYLKKRN  565
            D  ++   P   P  Y   G Q    + +  ++ +P  K+GRYS EERKDRI+RYLKK+N
Sbjct  90   DQEYYGYSPEIKPLFYQSTGEQSWQGNSEGVIQAEPNTKVGRYSVEERKDRIMRYLKKKN  149

Query  566  QRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDL  745
            QRNFNKTIKY CRKTLAD+RVRVRGRFA+NN+ C           +S D+N   H  KD 
Sbjct  150  QRNFNKTIKYVCRKTLADRRVRVRGRFARNNDTCEQ---------QSHDHN---HSEKDE  197

Query  746  YY-----DHPFQAKQDEEEEWLEEAITSLMYIP  829
                   D+  Q K D  + WL EA+ +L+Y P
Sbjct  198  NMFSGSDDYLIQMKND--DGWLHEAMCNLIYFP  228



>emb|CDY57298.1| BnaC03g73330D [Brassica napus]
Length=247

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 81/119 (68%), Gaps = 8/119 (7%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +P  K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  120  IQAEPNTKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYECRKTLADRRVRVRGRFARNN  179

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAITSLMYIP  829
            + C            S+++N    + +D++   D     +   ++ WL EA+ +L+Y P
Sbjct  180  DTCEQQSHA------SKNHNNHSEKDEDMFSGSDDYLIQQMKNDDGWLHEAMCNLIYFP  232



>ref|XP_009135255.1| PREDICTED: two-component response regulator-like APRR1 isoform 
X1 [Brassica rapa]
Length=245

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 91/155 (59%), Gaps = 24/155 (15%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPK--LKEQPAMKIGRYSEEERKDRILRYLKKRN  565
            D  ++   P   P  Y   G Q    + +  ++ +P  K+GRYS EERKDRI+RYLKK+N
Sbjct  90   DQEYYGYSPEIKPLFYQSTGEQSWQGNSEGVIQAEPNTKVGRYSVEERKDRIMRYLKKKN  149

Query  566  QRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDL  745
            QRNFNKTIKY CRKTLAD+RVRVRGRFA+NN+ C           +S D+N   H  KD 
Sbjct  150  QRNFNKTIKYVCRKTLADRRVRVRGRFARNNDTCEQ---------QSHDHN---HSEKD-  196

Query  746  YYDHPFQAKQD-------EEEEWLEEAITSLMYIP  829
              ++ F    D        ++ WL EA+ +L+Y P
Sbjct  197  --ENMFSGSDDYLIQQMKNDDGWLHEAMCNLIYFP  229



>ref|XP_010670131.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Beta vulgaris 
subsp. vulgaris]
Length=285

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 97/179 (54%), Gaps = 28/179 (16%)
 Frame = +2

Query  341  GYGCLFESGDECNNGLLDSNFWSLYPTRPPSSYNIE-------GIQGEAISPKLKEQPAM  499
            GY  L  +G    N L + N +S      PSS N         G Q  A      E  + 
Sbjct  107  GYTHLSVTGSTTYNEL-EGNAYSTLQNYVPSSNNYAATLPECWGFQSHATESSGSENSST  165

Query  500  KIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgd  679
            K+ +YS EE+KDRILRYLKKRNQRNF KTIKY CRKTLAD+RVR+RGRFAKN E      
Sbjct  166  KVRKYSAEEKKDRILRYLKKRNQRNFRKTIKYVCRKTLADRRVRIRGRFAKNQEEQSPTS  225

Query  680  gdddIVIKSRDNNIIVHQTKDLYYDHPFQAKQDEE-------EEWLEEAITSLMYIPYI  835
             +  I   +++N + +          PF     +        EEWL+EA++SL+Y+PYI
Sbjct  226  YNHFI---TQENGVPL----------PFHNAGSKSENYGEINEEWLQEAMSSLLYVPYI  271



>ref|XP_010534762.1| PREDICTED: uncharacterized protein LOC104810263 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010534763.1| PREDICTED: uncharacterized protein LOC104810263 isoform X2 [Tarenaya 
hassleriana]
Length=268

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 88/156 (56%), Gaps = 11/156 (7%)
 Frame = +2

Query  362  SGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRI  541
            +G+ECN       F   +          +G +G    P   E+   KIGRYS EERKDRI
Sbjct  108  AGEECN--AFSPEFKPFFSPASSGDLYWQGCEGGKQIPAT-EETNTKIGRYSVEERKDRI  164

Query  542  LRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNNI  721
            LRYLKK+NQRNFNKTIKY CRKTLAD+RVR+RGRFA+N E C               N+ 
Sbjct  165  LRYLKKKNQRNFNKTIKYVCRKTLADRRVRIRGRFARNKEPCEQQSPSM--------NHN  216

Query  722  IVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYIP  829
               +  ++Y    +Q + + ++ WL+EA+  + Y P
Sbjct  217  NTEKEGEIYSGDDYQVQMEHDDIWLQEAMPDITYFP  252



>ref|XP_006300038.1| hypothetical protein CARUB_v10016264mg [Capsella rubella]
 gb|EOA32936.1| hypothetical protein CARUB_v10016264mg [Capsella rubella]
Length=256

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 94/150 (63%), Gaps = 12/150 (8%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPK-LKEQPAMKIGRYSEEERKDRILRYLKKRNQ  568
            D  ++   P   PS     G Q    S   ++ +P +K+GRYS EERKDRI+RYLKK+NQ
Sbjct  98   DQEYYGFSPEIKPSFRPATGEQSWGNSEGGIQAEPNIKVGRYSVEERKDRIMRYLKKKNQ  157

Query  569  RNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLY  748
            RNFNKTIKY CRKTLAD+RVRVRGRFA+NN+ C +          S+++N    + +D++
Sbjct  158  RNFNKTIKYVCRKTLADRRVRVRGRFARNNDTCEEQSPM------SKNHNNHSEKEEDMF  211

Query  749  Y---DHPFQAKQDEEEEWLEEAITSLMYIP  829
                D+  Q + D  + WL EA+++L+  P
Sbjct  212  SGSDDYLIQMEHD--DGWLHEAMSNLIPFP  239



>gb|KFK38630.1| hypothetical protein AALP_AA3G139100 [Arabis alpina]
Length=249

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 11/120 (9%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +P  K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  121  IQAEPNTKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNN  180

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDLYY---DHPFQAKQDEEEEWLEEAITSLMYIP  829
            + C +          S+++N    + +DL+    D+  Q + D  + WL EA++ L+  P
Sbjct  181  DTCEEQSPM------SKNHNNHSEKEEDLFSGSDDYLIQMEND--DGWLHEAMSGLISFP  232



>ref|XP_002882793.1| hypothetical protein ARALYDRAFT_478650 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59052.1| hypothetical protein ARALYDRAFT_478650 [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 84/120 (70%), Gaps = 11/120 (9%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +P  K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  123  IQAEPNTKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNN  182

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDLYY---DHPFQAKQDEEEEWLEEAITSLMYIP  829
            + C +          S+++N    + +D++    D+  Q + D  + WL EA+++L+  P
Sbjct  183  DTCEEQSHM------SKNHNNHSEKEEDMFSGSDDYLIQMEHD--DGWLHEAMSNLIPFP  234



>gb|KFK38631.1| hypothetical protein AALP_AA3G139100 [Arabis alpina]
Length=250

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 82/119 (69%), Gaps = 8/119 (7%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +P  K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  121  IQAEPNTKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNN  180

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAITSLMYIP  829
            + C +          S+++N    + +DL+   D     + + ++ WL EA++ L+  P
Sbjct  181  DTCEEQSPM------SKNHNNHSEKEEDLFSGSDDYLIQQMENDDGWLHEAMSGLISFP  233



>ref|XP_010534764.1| PREDICTED: uncharacterized protein LOC104810263 isoform X3 [Tarenaya 
hassleriana]
Length=267

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 92/157 (59%), Gaps = 14/157 (9%)
 Frame = +2

Query  362  SGDECNNGLLDSNFWSLYPTRPPSSYNI-EGIQGEAISPKLKEQPAMKIGRYSEEERKDR  538
            +G+ECN       F   +   P SS ++  G +G    P   E+   KIGRYS EERKDR
Sbjct  108  AGEECN--AFSPEFKPFF--SPASSGDLYWGCEGGKQIPAT-EETNTKIGRYSVEERKDR  162

Query  539  ILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNN  718
            ILRYLKK+NQRNFNKTIKY CRKTLAD+RVR+RGRFA+N E C               N+
Sbjct  163  ILRYLKKKNQRNFNKTIKYVCRKTLADRRVRIRGRFARNKEPCEQQSPSM--------NH  214

Query  719  IIVHQTKDLYYDHPFQAKQDEEEEWLEEAITSLMYIP  829
                +  ++Y    +Q + + ++ WL+EA+  + Y P
Sbjct  215  NNTEKEGEIYSGDDYQVQMEHDDIWLQEAMPDITYFP  251



>ref|XP_006380530.1| hypothetical protein POPTR_0007s08280g [Populus trichocarpa]
 gb|ERP58327.1| hypothetical protein POPTR_0007s08280g [Populus trichocarpa]
Length=208

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 81/116 (70%), Gaps = 10/116 (9%)
 Frame = +2

Query  482  KEQPAM-KIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            KE   M K+GRY+ EERKDRI RYLKKRNQRNFNKTIKYACRKTLAD+RVRVRGRFA+NN
Sbjct  58   KESTDMAKVGRYTVEERKDRISRYLKKRNQRNFNKTIKYACRKTLADRRVRVRGRFARNN  117

Query  659  EICgdgdgdddIVIKSRDNNI--IVHQTKDLYYDHPFQAK--QDEEEEWLEEAITS  814
            EI  +        +K  D++I  + H  +     +  Q K   D++E+WL+EA+ S
Sbjct  118  EIFEEETE-----VKKDDDSIPYLRHGKETYCTSNAVQIKNDDDDDEQWLQEALAS  168



>ref|XP_006407285.1| hypothetical protein EUTSA_v10022310mg [Eutrema salsugineum]
 gb|ESQ48738.1| hypothetical protein EUTSA_v10022310mg [Eutrema salsugineum]
Length=266

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 84/127 (66%), Gaps = 10/127 (8%)
 Frame = +2

Query  458  GEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVR  637
            G +    ++ +P  K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVR
Sbjct  130  GNSEGGMIQAEPNTKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVR  189

Query  638  GRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAIT  811
            GRFA+NN+ C            S+++N    + +D++   D     K + ++ WL EA++
Sbjct  190  GRFARNNDTCEQQSPM------SKNHNNHCEKDEDMFSGSDDYLIQKMENDDGWLHEAMS  243

Query  812  SLMYIPY  832
             L  IP+
Sbjct  244  GL--IPF  248



>gb|EYU27549.1| hypothetical protein MIMGU_mgv1a014146mg [Erythranthe guttata]
Length=199

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +2

Query  425  PPSSYNIEGIQGEAISPKLKEQPA-MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYAC  601
            P ++ N   IQG+A++    E    +K+GRYS EERKDRILRYLKKRNQRNFNKTIKYAC
Sbjct  107  PAAAENWGIIQGKAVTKVEAETTTEVKVGRYSVEERKDRILRYLKKRNQRNFNKTIKYAC  166

Query  602  RKTLADKRVRVRGRFAKNNEIC  667
            RKTLADKRVR+RGRFAKN+E C
Sbjct  167  RKTLADKRVRIRGRFAKNSEPC  188



>ref|NP_566437.1| protein activator of spomin::LUC2 [Arabidopsis thaliana]
 gb|AAF34828.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAB01418.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM62815.1| unknown [Arabidopsis thaliana]
 gb|AAX11222.1| activator of sporamin LUC 2 [Arabidopsis thaliana]
 gb|AEE75257.1| protein activator of spomin::LUC2 [Arabidopsis thaliana]
Length=251

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 84/120 (70%), Gaps = 11/120 (9%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +P  K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  123  IQAEPNTKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNN  182

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDLYY---DHPFQAKQDEEEEWLEEAITSLMYIP  829
            + C +          S+++N    + +D++    D+  Q + D  + WL EA+++L+  P
Sbjct  183  DTCEEQPHM------SKNHNNHSEKEEDMFSGSDDYLIQMEHD--DGWLHEAMSNLIPFP  234



>ref|XP_009124684.1| PREDICTED: two-component response regulator-like APRR1 isoform 
X4 [Brassica rapa]
Length=249

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 11/120 (9%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +P +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  121  IQAEPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNN  180

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKD---LYYDHPFQAKQDEEEEWLEEAITSLMYIP  829
            +           + K+ +N    H  KD   L     +  + + ++ WL+EA+++L+  P
Sbjct  181  DTSEQQSH----MSKNHNN----HSEKDEDMLSGSDDYLIQMETDDGWLQEAMSNLISFP  232



>ref|XP_009124683.1| PREDICTED: two-component response regulator-like APRR1 isoform 
X3 [Brassica rapa]
Length=250

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 11/120 (9%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +P +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  122  IQAEPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNN  181

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKD---LYYDHPFQAKQDEEEEWLEEAITSLMYIP  829
            +           + K+ +N    H  KD   L     +  + + ++ WL+EA+++L+  P
Sbjct  182  DTSEQQSH----MSKNHNN----HSEKDEDMLSGSDDYLIQMETDDGWLQEAMSNLISFP  233



>ref|XP_009124682.1| PREDICTED: two-component response regulator-like APRR1 isoform 
X2 [Brassica rapa]
 emb|CDY43393.1| BnaA01g30240D [Brassica napus]
Length=250

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 82/119 (69%), Gaps = 8/119 (7%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +P +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  121  IQAEPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNN  180

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAITSLMYIP  829
            +              S+++N    + +D+    D     + + ++ WL+EA+++L+  P
Sbjct  181  DTSEQQSHM------SKNHNNHSEKDEDMLSGSDDYLIQQMETDDGWLQEAMSNLISFP  233



>ref|XP_009124681.1| PREDICTED: two-component response regulator-like APRR1 isoform 
X1 [Brassica rapa]
Length=251

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 82/119 (69%), Gaps = 8/119 (7%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +P +K+GRYS EERKDRI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  122  IQAEPNIKVGRYSVEERKDRIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNN  181

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAITSLMYIP  829
            +              S+++N    + +D+    D     + + ++ WL+EA+++L+  P
Sbjct  182  DTSEQQSHM------SKNHNNHSEKDEDMLSGSDDYLIQQMETDDGWLQEAMSNLISFP  234



>emb|CDY52882.1| BnaCnng23700D [Brassica napus]
Length=244

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 82/119 (69%), Gaps = 8/119 (7%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +   K+GRYS EERK+RI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  115  IQAEQTTKVGRYSVEERKERIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNN  174

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAITSLMYIP  829
            + C         + K+ +NN    + +D++   D     + + ++ WL EA+++L+  P
Sbjct  175  DTCEQQSH----MSKTHNNN--SEKEEDIFSGSDDYLIQQMENDDGWLNEAMSNLISFP  227



>ref|XP_004294135.1| PREDICTED: uncharacterized protein LOC101304258 [Fragaria vesca 
subsp. vesca]
Length=296

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 93/134 (69%), Gaps = 9/134 (7%)
 Frame = +2

Query  455  QGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRV  634
            QG  + P +++Q  MK+GRYSEEERK+RI RYLKKRNQRNFNKTIKYACRKTLADKRVRV
Sbjct  162  QGNQV-PAMEDQSNMKVGRYSEEERKERIERYLKKRNQRNFNKTIKYACRKTLADKRVRV  220

Query  635  RGRFAKNN--EICgdgdgdddIVIKSRDNNIIVHQTKD---LYY--DHPFQAKQDEEEEW  793
            RGRFA+N+  ++  +     ++  K  D +   H   D   L Y      Q K D EE+W
Sbjct  221  RGRFARNSNEQLTNEDSTHQEMAPKKIDTDCSNHACNDRSELMYCSGGAVQIKYD-EEDW  279

Query  794  LEEAITSLMYIPYI  835
            L+EA+ SL+Y+PY+
Sbjct  280  LQEAMASLVYLPYV  293



>ref|XP_009146574.1| PREDICTED: uncharacterized protein LOC103870213 isoform X2 [Brassica 
rapa]
Length=243

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 11/120 (9%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +   K+GRYS EERK+RI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  115  IQAEQNTKVGRYSVEERKERIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNN  174

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDLYY---DHPFQAKQDEEEEWLEEAITSLMYIP  829
            + C         + K+ +NN    + +D++    D+  Q + D  + WL EA+++L+  P
Sbjct  175  DTCEQQSH----MSKTHNNN--SEKEEDIFSGSDDYLIQMEND--DGWLNEAMSNLISFP  226



>ref|XP_009146573.1| PREDICTED: two-component response regulator-like PRR1 isoform 
X1 [Brassica rapa]
Length=244

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 82/119 (69%), Gaps = 8/119 (7%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +   K+GRYS EERK+RI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  115  IQAEQNTKVGRYSVEERKERIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNN  174

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAITSLMYIP  829
            + C         + K+ +NN    + +D++   D     + + ++ WL EA+++L+  P
Sbjct  175  DTCEQQSH----MSKTHNNN--SEKEEDIFSGSDDYLIQQMENDDGWLNEAMSNLISFP  227



>emb|CDY52883.1| BnaCnng23710D [Brassica napus]
 emb|CDY08395.1| BnaA05g26310D [Brassica napus]
Length=244

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 82/119 (69%), Gaps = 8/119 (7%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++ +   K+GRYS EERK+RI+RYLKK+NQRNFNKTIKY CRKTLAD+RVRVRGRFA+NN
Sbjct  115  IQAEQNTKVGRYSVEERKERIMRYLKKKNQRNFNKTIKYVCRKTLADRRVRVRGRFARNN  174

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDLY--YDHPFQAKQDEEEEWLEEAITSLMYIP  829
            + C         + K+ +NN    + +D++   D     + + ++ WL EA+++L+  P
Sbjct  175  DTCEQQSH----MSKTHNNN--SEKEEDIFSGSDDYLIQQMENDDGWLNEAMSNLISFP  227



>ref|XP_004174083.1| PREDICTED: uncharacterized LOC101215766, partial [Cucumis sativus]
Length=290

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQR  571
            +S+F+S    R  S+ +++   G   S  L E+   K+GRYS EERK+RIL+Y  KR QR
Sbjct  181  ESDFFSSQIRRVFSTGDLQQNSGNGRSSSLMEEGNFKVGRYSAEERKERILKYRAKRTQR  240

Query  572  NFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            NFNKTIKYACRKTLAD R R+RGRFA+N+E
Sbjct  241  NFNKTIKYACRKTLADNRPRIRGRFARNDE  270



>ref|XP_004143978.1| PREDICTED: uncharacterized protein LOC101215766 [Cucumis sativus]
Length=323

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQR  571
            +S+F+S    R  S+ +++   G   S  L E+   K+GRYS EERK+RIL+Y  KR QR
Sbjct  181  ESDFFSSQIRRVFSTGDLQQNSGNGRSSSLMEEGNFKVGRYSAEERKERILKYRAKRTQR  240

Query  572  NFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            NFNKTIKYACRKTLAD R R+RGRFA+N+E
Sbjct  241  NFNKTIKYACRKTLADNRPRIRGRFARNDE  270



>ref|XP_010255274.1| PREDICTED: uncharacterized protein LOC104596005 [Nelumbo nucifera]
Length=336

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            E+ ++K+GRYS EERK RILRY  KR QRNFNKTIKYACRKTLAD R RVRGRFA+N+E
Sbjct  229  EEASLKVGRYSAEERKQRILRYRSKRTQRNFNKTIKYACRKTLADSRPRVRGRFARNDE  287



>emb|CDY08322.1| BnaC09g12740D [Brassica napus]
Length=288

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +2

Query  449  GIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRV  628
            G++    +P   E+ ++K+GRYS EERK++I +Y  KR QRNF KTIKYACRKTLAD R 
Sbjct  163  GVESSWATPFPGEEQSLKVGRYSAEERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRP  222

Query  629  RVRGRFAKNNEICgdgdgdddIVIKSRDN  715
            RVRGRFA+N+E+  +        I+  D+
Sbjct  223  RVRGRFARNDEVLENPKIASSFTIQEDDD  251



>gb|KGN50077.1| hypothetical protein Csa_5G152920 [Cucumis sativus]
Length=239

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQR  571
            +S+F+S    R  S+ +++   G   S  L E+   K+GRYS EERK+RIL+Y  KR QR
Sbjct  98   ESDFFSSQIRRVFSTGDLQN-SGNGRSSSLMEEGNFKVGRYSAEERKERILKYRAKRTQR  156

Query  572  NFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            NFNKTIKYACRKTLAD R R+RGRFA+N+E
Sbjct  157  NFNKTIKYACRKTLADNRPRIRGRFARNDE  186



>ref|XP_006580560.1| PREDICTED: uncharacterized protein LOC102665661 [Glycine max]
 gb|KHM99956.1| Zinc finger protein CONSTANS-LIKE 3 [Glycine soja]
Length=311

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 3/83 (4%)
 Frame = +2

Query  422  RPPSSYNIEGIQGEAISPK---LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIK  592
            R  S+ +++ ++G  +SP    L E+   K+GRYS EERK+RI +Y  KR QRNFNKTIK
Sbjct  182  RVCSTGDLQNMKGNHMSPTEAPLLEESNFKVGRYSAEERKERISKYRAKRTQRNFNKTIK  241

Query  593  YACRKTLADKRVRVRGRFAKNNE  661
            YACRKTLAD R R+RGRFA+N+E
Sbjct  242  YACRKTLADNRPRIRGRFARNDE  264



>ref|XP_006476521.1| PREDICTED: zinc finger protein CONSTANS-like [Citrus sinensis]
Length=323

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +2

Query  464  AISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGR  643
            A      E+   K+GRYS EERK+RIL+Y  KRNQRNFNKTIKYACRKTLAD R R+RGR
Sbjct  203  ATESSFMEEANFKVGRYSAEERKERILKYRAKRNQRNFNKTIKYACRKTLADNRPRIRGR  262

Query  644  FAKNNE  661
            FA+N+E
Sbjct  263  FARNDE  268



>ref|XP_006439500.1| hypothetical protein CICLE_v10021189mg [Citrus clementina]
 gb|ESR52740.1| hypothetical protein CICLE_v10021189mg [Citrus clementina]
Length=321

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +2

Query  464  AISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGR  643
            A      E+   K+GRYS EERK+RIL+Y  KRNQRNFNKTIKYACRKTLAD R R+RGR
Sbjct  203  ATESSFMEEANFKVGRYSAEERKERILKYRAKRNQRNFNKTIKYACRKTLADNRPRIRGR  262

Query  644  FAKNNE  661
            FA+N+E
Sbjct  263  FARNDE  268



>ref|XP_009112772.1| PREDICTED: putative zinc finger protein CONSTANS-LIKE 11 [Brassica 
rapa]
Length=286

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +2

Query  449  GIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRV  628
            G++    +P   E+ ++K+GRYS EERK++I +Y  KR QRNF KTIKYACRKTLAD R 
Sbjct  161  GVENSWTTPFPGEEQSLKVGRYSAEERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRP  220

Query  629  RVRGRFAKNNEICgdgdgdddIVIKSRDN  715
            RVRGRFA+N+E+  +        I+  D+
Sbjct  221  RVRGRFARNDEVLENPKIASSFSIQEDDD  249



>emb|CDY38222.1| BnaA09g11670D [Brassica napus]
Length=288

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +2

Query  449  GIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRV  628
            G++    +P   E+ ++K+GRYS EERK++I +Y  KR QRNF KTIKYACRKTLAD R 
Sbjct  163  GVENSWTTPFPGEEQSLKVGRYSAEERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRP  222

Query  629  RVRGRFAKNNEICgdgdgdddIVIKSRDN  715
            RVRGRFA+N+E+  +        I+  D+
Sbjct  223  RVRGRFARNDEVLENPKIASSFSIQEDDD  251



>emb|CDY33573.1| BnaC06g29790D [Brassica napus]
Length=239

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +2

Query  449  GIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRV  628
            G++    +P   E+ ++K+GRYS EERK++I +Y  KR QRNF KTIKYACRKTLAD R 
Sbjct  114  GVENSWTTPFPGEEQSLKVGRYSAEERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRP  173

Query  629  RVRGRFAKNNEICgdgdgdddIVIKSRDN  715
            RVRGRFA+N+E+  +        I+  D+
Sbjct  174  RVRGRFARNDEVLENPKIASSFSIQEDDD  202



>ref|XP_006853390.1| hypothetical protein AMTR_s00032p00143730 [Amborella trichopoda]
 gb|ERN14857.1| hypothetical protein AMTR_s00032p00143730 [Amborella trichopoda]
Length=104

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            E+  +K+GRYS EE+++RI RYLKKR+ RNF KTIKYACRKTLAD R RVRGRFAKN++
Sbjct  20   EESGLKVGRYSVEEKRERIHRYLKKRSHRNFTKTIKYACRKTLADSRPRVRGRFAKNDD  78



>ref|XP_008437311.1| PREDICTED: uncharacterized protein LOC103482769 isoform X1 [Cucumis 
melo]
Length=322

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQR  571
            +S+F+S    R  S+ +++   G   S  L E+   K+GRYS EERK+RIL+Y  KR QR
Sbjct  181  ESDFFSSQIRRVFSTGDLQQNSGNGRS-SLMEEGNFKVGRYSAEERKERILKYRAKRTQR  239

Query  572  NFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            NFNKTIKYACRKTLAD R R+RGRFA+N+E
Sbjct  240  NFNKTIKYACRKTLADNRPRIRGRFARNDE  269



>ref|XP_009627496.1| PREDICTED: zinc finger protein CONSTANS-like [Nicotiana tomentosiformis]
Length=322

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++E   +K+GRYS EERK+RI RY  KR QRNFNKTIKYACRKTLAD R R+RGRFA+N+
Sbjct  203  IEEAANIKVGRYSAEERKERIHRYRAKRTQRNFNKTIKYACRKTLADNRPRIRGRFARND  262

Query  659  EIC  667
            E C
Sbjct  263  EAC  265



>ref|XP_007160092.1| hypothetical protein PHAVU_002G291600g [Phaseolus vulgaris]
 gb|ESW32086.1| hypothetical protein PHAVU_002G291600g [Phaseolus vulgaris]
Length=313

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 61/80 (76%), Gaps = 3/80 (4%)
 Frame = +2

Query  431  SSYNIEGIQGEAISPK---LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYAC  601
            S+ +++ ++   +SP    L E+   K+GRYS EERK+RI +Y  KRNQRNFNKTIKYAC
Sbjct  195  STGDLQNMKENRMSPTEAPLLEESNFKVGRYSAEERKERISKYRAKRNQRNFNKTIKYAC  254

Query  602  RKTLADKRVRVRGRFAKNNE  661
            RKTLAD R R+RGRFA+N+E
Sbjct  255  RKTLADNRPRIRGRFARNDE  274



>ref|XP_010053230.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X2 
[Eucalyptus grandis]
Length=330

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  464  AISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGR  643
            A    L E+   K+GRYS EERK+RIL+Y  KR QRNFNKTIKYACRKTLAD R R+RGR
Sbjct  210  AAESSLTEEANAKVGRYSAEERKERILKYRAKRTQRNFNKTIKYACRKTLADNRPRIRGR  269

Query  644  FAKNNEI  664
            FA+N+E 
Sbjct  270  FARNDET  276



>ref|XP_010053229.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X1 
[Eucalyptus grandis]
Length=331

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  464  AISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGR  643
            A    L E+   K+GRYS EERK+RIL+Y  KR QRNFNKTIKYACRKTLAD R R+RGR
Sbjct  211  AAESSLTEEANAKVGRYSAEERKERILKYRAKRTQRNFNKTIKYACRKTLADNRPRIRGR  270

Query  644  FAKNNEI  664
            FA+N+E 
Sbjct  271  FARNDET  277



>emb|CDP12052.1| unnamed protein product [Coffea canephora]
Length=339

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            E+   K+GRYS EERK+RI RY  KRNQRNFNKTIKYACRKTLAD R R+RGRFA+N+E
Sbjct  221  EEANFKVGRYSAEERKERIHRYRAKRNQRNFNKTIKYACRKTLADNRPRIRGRFARNDE  279



>ref|XP_006391712.1| hypothetical protein EUTSA_v10023638mg [Eutrema salsugineum]
 gb|ESQ28998.1| hypothetical protein EUTSA_v10023638mg [Eutrema salsugineum]
Length=269

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  455  QGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRV  634
            Q  + +P   E+  +K+GRYS EERK++I +Y  KR QRNF KTIKYACRKTLAD R RV
Sbjct  146  QSSSTTPFSGEEQNLKVGRYSAEERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRPRV  205

Query  635  RGRFAKNNEI  664
            RGRFA+N+E+
Sbjct  206  RGRFARNDEV  215



>ref|XP_010055677.1| PREDICTED: two-component response regulator-like PRR1 [Eucalyptus 
grandis]
 gb|KCW72189.1| hypothetical protein EUGRSUZ_E00639 [Eucalyptus grandis]
Length=321

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  467  ISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRF  646
             SP ++E  + ++GRYS EER+DRI +Y  KR QRNFNKTIKYACRKTLAD R R+RGRF
Sbjct  202  TSPFMEEASSCRVGRYSAEERRDRIQKYRAKRTQRNFNKTIKYACRKTLADSRPRIRGRF  261

Query  647  AKNNE  661
            A+N+E
Sbjct  262  ARNDE  266



>ref|XP_006854474.1| hypothetical protein AMTR_s00039p00236750 [Amborella trichopoda]
 gb|ERN15941.1| hypothetical protein AMTR_s00039p00236750 [Amborella trichopoda]
Length=398

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E+   K+GRYS EERK RI RY+KK+N+RNFNK IKYACRKTLAD R RVRGRFAKN+E 
Sbjct  306  EETNFKVGRYSVEERKQRINRYIKKKNERNFNKKIKYACRKTLADSRPRVRGRFAKNDEF  365



>gb|EMS55508.1| Zinc finger protein CONSTANS-LIKE 5 [Triticum urartu]
Length=397

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 72/121 (60%), Gaps = 12/121 (10%)
 Frame = +2

Query  305  SREFSRTPAPRGGYGCLFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLK  484
            +R +S T + +G Y    E  +  NN  L +      PT PP+     G+          
Sbjct  237  TRTYSDTDSMKGAYSNTAEMQNGGNNQDLINGCNGSPPTLPPT--ETSGL----------  284

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  285  EDSTFKVVRLSAEQRKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  344

Query  665  C  667
            C
Sbjct  345  C  345



>ref|XP_002509836.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51223.1| conserved hypothetical protein [Ricinus communis]
Length=349

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
              E+   K+GRYS EERKDRI +Y  KRNQRNF KTIKYACRKTLAD R R+RGRFA+N+
Sbjct  235  FTEEANFKVGRYSAEERKDRISKYRAKRNQRNFTKTIKYACRKTLADNRPRIRGRFARND  294

Query  659  EI  664
            E 
Sbjct  295  ET  296



>ref|XP_008437312.1| PREDICTED: uncharacterized protein LOC103482769 isoform X2 [Cucumis 
melo]
Length=321

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L E+   K+GRYS EERK+RIL+Y  KR QRNFNKTIKYACRKTLAD R R+RGRFA+N+
Sbjct  208  LMEEGNFKVGRYSAEERKERILKYRAKRTQRNFNKTIKYACRKTLADNRPRIRGRFARND  267

Query  659  E  661
            E
Sbjct  268  E  268



>gb|KDP25406.1| hypothetical protein JCGZ_20562 [Jatropha curcas]
Length=317

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  464  AISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGR  643
            A      E+   K+GRYS EERKDRI +Y  KRNQRNF KTIKYACRKTLAD R R+RGR
Sbjct  200  ASESSFTEEANFKVGRYSAEERKDRISKYRAKRNQRNFTKTIKYACRKTLADNRPRIRGR  259

Query  644  FAKNNEI  664
            FA+N+E 
Sbjct  260  FARNDET  266



>gb|KEH21104.1| CCT motif protein [Medicago truncatula]
Length=324

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 62/83 (75%), Gaps = 3/83 (4%)
 Frame = +2

Query  422  RPPSSYNIEGIQGEAISP---KLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIK  592
            R  S+ +++ ++   +SP    L+E+   K+GRYS EERK++I +Y  KR QRNFNKTIK
Sbjct  187  RVCSTGDLQNMKENNMSPTEGNLQEEQNFKVGRYSAEERKEKISKYRAKRTQRNFNKTIK  246

Query  593  YACRKTLADKRVRVRGRFAKNNE  661
            YACRKTLAD R RVRGRFA+N+E
Sbjct  247  YACRKTLADNRPRVRGRFARNDE  269



>ref|XP_006344020.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Solanum 
tuberosum]
Length=292

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++E   +K+GRY+ EERK+RI RY  KR QRNFNKTIKYACRKTLAD R RVRGRFA+N+
Sbjct  171  IEEASNIKVGRYTAEERKERIHRYRAKRTQRNFNKTIKYACRKTLADNRPRVRGRFARND  230

Query  659  EI  664
            E+
Sbjct  231  EV  232



>ref|XP_004503688.1| PREDICTED: uncharacterized protein LOC101491686 [Cicer arietinum]
Length=303

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  422  RPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYAC  601
            R  S+ +++ ++   +  +  E+  +K+GRYS EERK+RI +Y  KR QRNFNKTIKYAC
Sbjct  174  RVCSTGDLQKMKANDMCRREGEEANLKVGRYSAEERKERISKYKAKRTQRNFNKTIKYAC  233

Query  602  RKTLADKRVRVRGRFAKNNE  661
            RKTLAD R RVRGRFA+N+E
Sbjct  234  RKTLADNRPRVRGRFARNDE  253



>ref|XP_004245581.1| PREDICTED: zinc finger protein CONSTANS-LIKE 1-like [Solanum 
lycopersicum]
Length=326

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++E   +K+GRY+ EERK+RI RY  KR QRNFNKTIKYACRKTLAD R RVRGRFA+N+
Sbjct  205  IEEASNIKVGRYTAEERKERIHRYRAKRTQRNFNKTIKYACRKTLADNRPRVRGRFARND  264

Query  659  EI  664
            E+
Sbjct  265  EV  266



>dbj|BAK07048.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 72/121 (60%), Gaps = 12/121 (10%)
 Frame = +2

Query  305  SREFSRTPAPRGGYGCLFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLK  484
            +R +S T + +G Y    E  +  NN  L +      PT PP+   + G+          
Sbjct  228  TRTYSDTDSMQGAYSNTAEIQNGGNNQDLVNGCNGSPPTLPPTE--VSGL----------  275

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +    K+ R S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN E+
Sbjct  276  DDSTFKVVRLSAEQRKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNEEL  335

Query  665  C  667
            C
Sbjct  336  C  336



>ref|XP_006405357.1| hypothetical protein EUTSA_v10028337mg [Eutrema salsugineum]
 gb|ESQ46810.1| hypothetical protein EUTSA_v10028337mg [Eutrema salsugineum]
Length=325

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  446  EGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKR  625
            E I  E  S    ++   K+GRYS EERK++I +Y  KRN RNF KTIKYACRKTLAD R
Sbjct  204  EQISSENSSAPFSDEQNFKVGRYSAEERKEKISKYRAKRNHRNFTKTIKYACRKTLADSR  263

Query  626  VRVRGRFAKNNEIC  667
             R+RGRFA+N+E+ 
Sbjct  264  PRIRGRFARNDEVV  277



>ref|XP_006584728.1| PREDICTED: zinc finger protein HD1-like isoform X2 [Glycine max]
Length=270

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            ++   K+GRYS EERK+RI +Y  KRNQRNFNKTIKYACRKTLAD R R+RGRFA+N+E
Sbjct  192  QESNFKVGRYSAEERKERISKYRAKRNQRNFNKTIKYACRKTLADNRPRIRGRFARNDE  250



>ref|NP_198954.2| CCT motif family protein [Arabidopsis thaliana]
 gb|AAV68883.1| hypothetical protein AT5G41380 [Arabidopsis thaliana]
 gb|AAX23921.1| hypothetical protein At5g41380 [Arabidopsis thaliana]
 gb|AED94671.1| CCT motif family protein [Arabidopsis thaliana]
Length=307

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
              E+   K+GRYS EERK++I +Y  KRNQRNF KTIKYACRKTLAD R R+RGRFA+N+
Sbjct  199  FSEEQNFKVGRYSAEERKEKISKYRAKRNQRNFTKTIKYACRKTLADSRPRIRGRFARND  258

Query  659  EIC  667
            E+ 
Sbjct  259  EVV  261



>ref|XP_010264890.1| PREDICTED: uncharacterized protein LOC104602777 [Nelumbo nucifera]
Length=407

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +2

Query  431  SSYNIEGIQGEAISPKLK--EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACR  604
            S++ + G  G +++ ++   E+   K+GR S EERK++I RY+KKRN+RNF+K IKYACR
Sbjct  273  STHLVNGGGGASLTSEISAFEESTYKVGRLSVEERKEKIHRYMKKRNERNFSKKIKYACR  332

Query  605  KTLADKRVRVRGRFAKNNEI  664
            KTLAD R RVRGRFAKN+E+
Sbjct  333  KTLADSRPRVRGRFAKNDEL  352



>ref|XP_010418417.1| PREDICTED: two-component response regulator-like PRR95 [Camelina 
sativa]
Length=293

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  449  GIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRV  628
             ++  + +    E  ++K+GRYS EERK++I +Y  KR QRNF KTIKYACRKTLAD R 
Sbjct  169  AVESSSTTQFTGEDQSLKVGRYSSEERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRP  228

Query  629  RVRGRFAKNNEI  664
            RVRGRFA+N+E+
Sbjct  229  RVRGRFARNDEV  240



>ref|XP_010275690.1| PREDICTED: uncharacterized protein LOC104610655 [Nelumbo nucifera]
Length=323

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
              E+   K+GRYS EERK RI RY  KRNQRNFNK IKYACRKTLAD R+RVRGRFA+++
Sbjct  223  FTEEAGFKVGRYSAEERKQRIDRYRSKRNQRNFNKIIKYACRKTLADSRLRVRGRFARSD  282

Query  659  EIC  667
            E  
Sbjct  283  ETA  285



>gb|KFK33014.1| hypothetical protein AALP_AA6G319100 [Arabis alpina]
Length=197

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  470  SPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFA  649
            S    ++   K+GRYS EERK++I +Y  KRNQRNF KTIKYACRKTLAD R RVRGRFA
Sbjct  83   SSTFSDEQNFKVGRYSAEERKEKISKYRAKRNQRNFTKTIKYACRKTLADSRPRVRGRFA  142

Query  650  KNNEIC  667
            +N+E+ 
Sbjct  143  RNDEVV  148



>ref|XP_009790429.1| PREDICTED: zinc finger protein CONSTANS-LIKE 10-like [Nicotiana 
sylvestris]
Length=327

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            ++E   +K+GRYS EERK+RI RY  KR QRNFNKTIKYACRKTLAD R R+RGRFA+N+
Sbjct  208  IEEAANIKVGRYSAEERKERIHRYRAKRTQRNFNKTIKYACRKTLADNRPRIRGRFARND  267

Query  659  E  661
            E
Sbjct  268  E  268



>dbj|BAB08510.1| unnamed protein product [Arabidopsis thaliana]
Length=315

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
              E+   K+GRYS EERK++I +Y  KRNQRNF KTIKYACRKTLAD R R+RGRFA+N+
Sbjct  199  FSEEQNFKVGRYSAEERKEKISKYRAKRNQRNFTKTIKYACRKTLADSRPRIRGRFARND  258

Query  659  EIC  667
            E+ 
Sbjct  259  EVV  261



>ref|XP_010447443.1| PREDICTED: two-component response regulator-like APRR1 [Camelina 
sativa]
Length=307

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +2

Query  440  NIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLAD  619
            N E  +    S   +E    K+GRYS EERK++I +Y  KRNQRNF KTIKYACRKTLAD
Sbjct  183  NFEMQRSSENSTVSEEHNNFKVGRYSAEERKEKISKYRAKRNQRNFTKTIKYACRKTLAD  242

Query  620  KRVRVRGRFAKNNEIC  667
             R R+RGRFA+N+E+ 
Sbjct  243  SRPRIRGRFARNDEVV  258



>ref|XP_003532419.1| PREDICTED: zinc finger protein HD1-like isoform X1 [Glycine max]
 gb|KHN16802.1| Zinc finger protein CONSTANS-LIKE 3 [Glycine soja]
Length=304

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            ++   K+GRYS EERK+RI +Y  KRNQRNFNKTIKYACRKTLAD R R+RGRFA+N+E
Sbjct  192  QESNFKVGRYSAEERKERISKYRAKRNQRNFNKTIKYACRKTLADNRPRIRGRFARNDE  250



>ref|XP_007040306.1| Zinc finger protein CONSTANS-LIKE 1, putative isoform 2 [Theobroma 
cacao]
 gb|EOY24807.1| Zinc finger protein CONSTANS-LIKE 1, putative isoform 2 [Theobroma 
cacao]
Length=336

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  464  AISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGR  643
            AI     E+   K+GRYS EER++RI +Y  KRNQRNFNKTIKYACRKTLAD R R+RGR
Sbjct  209  AIENSYMEEAPFKVGRYSAEERQERISKYKAKRNQRNFNKTIKYACRKTLADNRPRIRGR  268

Query  644  FAKNNEIC  667
            FA+N++  
Sbjct  269  FARNDDTV  276



>ref|XP_002868599.1| hypothetical protein ARALYDRAFT_493840 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44858.1| hypothetical protein ARALYDRAFT_493840 [Arabidopsis lyrata subsp. 
lyrata]
Length=308

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
              E+   K+GRYS EERK++I +Y  KRNQRNF KTIKYACRKTLAD R R+RGRFA+N+
Sbjct  199  FSEEQNFKVGRYSAEERKEKISKYRAKRNQRNFTKTIKYACRKTLADSRPRIRGRFARND  258

Query  659  EIC  667
            E+ 
Sbjct  259  EVV  261



>ref|XP_003517472.1| PREDICTED: uncharacterized protein LOC100798428 isoform X1 [Glycine 
max]
 gb|KHN25690.1| Zinc finger protein CONSTANS-LIKE 4 [Glycine soja]
Length=279

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPK---LKEQPAMKIGRYSEEERKDRILRYLKKR  562
            ++ F++    R  S+ +++ ++   +S K   L E+   K+GRYS EERK++I +Y  KR
Sbjct  152  ENTFFAAQMRRVCSTGDLQNMKSTDMSQKGSPLLEEANFKVGRYSAEERKEKISKYRAKR  211

Query  563  NQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +QR FNK IKYACRKTLAD R R+RGRFA+N+EI
Sbjct  212  SQRKFNKIIKYACRKTLADNRTRIRGRFARNDEI  245



>ref|XP_006573784.1| PREDICTED: uncharacterized protein LOC100798428 isoform X2 [Glycine 
max]
Length=267

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPK---LKEQPAMKIGRYSEEERKDRILRYLKKR  562
            ++ F++    R  S+ +++ ++   +S K   L E+   K+GRYS EERK++I +Y  KR
Sbjct  152  ENTFFAAQMRRVCSTGDLQNMKSTDMSQKGSPLLEEANFKVGRYSAEERKEKISKYRAKR  211

Query  563  NQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +QR FNK IKYACRKTLAD R R+RGRFA+N+EI
Sbjct  212  SQRKFNKIIKYACRKTLADNRTRIRGRFARNDEI  245



>gb|KEH21105.1| CCT motif protein [Medicago truncatula]
Length=328

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L+E+   K+GRYS EERK++I +Y  KR QRNFNKTIKYACRKTLAD R RVRGRFA+N+
Sbjct  213  LQEEQNFKVGRYSAEERKEKISKYRAKRTQRNFNKTIKYACRKTLADNRPRVRGRFARND  272

Query  659  E  661
            E
Sbjct  273  E  273



>ref|XP_007040305.1| Zinc finger protein CONSTANS-LIKE 1, putative isoform 1 [Theobroma 
cacao]
 gb|EOY24806.1| Zinc finger protein CONSTANS-LIKE 1, putative isoform 1 [Theobroma 
cacao]
Length=344

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  464  AISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGR  643
            AI     E+   K+GRYS EER++RI +Y  KRNQRNFNKTIKYACRKTLAD R R+RGR
Sbjct  217  AIENSYMEEAPFKVGRYSAEERQERISKYKAKRNQRNFNKTIKYACRKTLADNRPRIRGR  276

Query  644  FAKNNEI  664
            FA+N++ 
Sbjct  277  FARNDDT  283



>ref|XP_011080926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 3-like [Sesamum 
indicum]
Length=301

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            E+   K+GRYS EERK+RI RY  KR QRNFNKTIKYACRKTLAD R R+RGRFA+N+E
Sbjct  190  EEANFKVGRYSAEERKERIDRYRAKRTQRNFNKTIKYACRKTLADNRPRIRGRFARNDE  248



>ref|XP_009357979.1| PREDICTED: uncharacterized protein LOC103948662 [Pyrus x bretschneideri]
Length=429

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            + E P  K+G+ S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+
Sbjct  315  IAEDPNFKVGKLSVEERKEKIHRYMKKRNERNFTKKIKYACRKTLADSRPRVRGRFAKND  374

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDL  745
            +                D+ + V + +DL
Sbjct  375  DFGETHRSAGSNHEDDEDDEVAVKEEEDL  403



>ref|XP_006418123.1| hypothetical protein EUTSA_v10007843mg [Eutrema salsugineum]
 gb|ESQ36476.1| hypothetical protein EUTSA_v10007843mg [Eutrema salsugineum]
Length=393

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 69/121 (57%), Gaps = 17/121 (14%)
 Frame = +2

Query  329  APRGGYGC------LFESGDECN--NGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLK  484
            A  GG  C      +F  GD     +G  + N     P  P     I G+   + +    
Sbjct  230  ADNGGMFCPDSIKPIFNPGDHLQALDGGENQNHLVATPVLPQLGTEITGLDDASFN----  285

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
                 K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  286  -----KVGKLSAEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  340

Query  665  C  667
            C
Sbjct  341  C  341



>ref|XP_006301601.1| hypothetical protein CARUB_v10022040mg [Capsella rubella]
 gb|EOA34499.1| hypothetical protein CARUB_v10022040mg [Capsella rubella]
Length=290

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E  ++K+GRYS EERK++I +Y  KR QRNF KTIKYACRKTLAD R RVRGRFA+N+E+
Sbjct  177  EDQSLKVGRYSSEERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRPRVRGRFARNDEV  236

Query  665  CgdgdgdddIVIKSRDNNI  721
              +         +  D+++
Sbjct  237  LENPKIASSFTGQENDDDL  255



>gb|KHG02620.1| Zinc finger CONSTANS-LIKE 3 -like protein [Gossypium arboreum]
Length=255

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +2

Query  488  QPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEIC  667
            Q   K+GRY+ EER++RI +Y  KRNQRNFNKTIKYACRKTLAD R R+RGRFA+N+E  
Sbjct  146  QTPFKVGRYNPEERQERISKYRAKRNQRNFNKTIKYACRKTLADSRPRIRGRFARNDEAI  205

Query  668  gdgdgdddIVIKSRDNNIIVHQTKD  742
                       +  D+  ++H+ +D
Sbjct  206  EIPKAACSTRDEEEDDLWVLHEVED  230



>ref|XP_010473627.1| PREDICTED: two-component response regulator-like APRR7 [Camelina 
sativa]
Length=294

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  449  GIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRV  628
             ++  + +    E  ++K+GRYS EERK++I +Y  KR QRNF KTIKYACRKTLAD R 
Sbjct  170  AVESSSTTQFSGEDQSLKVGRYSSEERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRP  229

Query  629  RVRGRFAKNNEI  664
            RVRGRFA+N+E+
Sbjct  230  RVRGRFARNDEV  241



>ref|XP_010920297.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Elaeis guineensis]
Length=224

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E+   K+GR S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R R+RGRFAKN+E 
Sbjct  113  EESTFKVGRLSMEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRIRGRFAKNDEF  172



>gb|AAG52458.1|AC010852_15 hypothetical protein; 56662-57962 [Arabidopsis thaliana]
Length=265

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            ++ ++++GRYS EERK++I +Y  KR QRNF KTIKYACRKTLAD R RVRGRFA+N+E+
Sbjct  178  DEQSLRVGRYSSEERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRPRVRGRFARNDEV  237

Query  665  CgdgdgdddIVIKSRDNNIIVHQTK  739
              +         +  D+++ V + +
Sbjct  238  FENPKIASSFTRQENDDDLWVSKIQ  262



>ref|XP_011073716.1| PREDICTED: uncharacterized protein LOC105158605 [Sesamum indicum]
Length=433

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 76/123 (62%), Gaps = 6/123 (5%)
 Frame = +2

Query  431  SSYNIEGIQGEAISPK---LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYAC  601
            S + + G  G +++ +   L++  A K+G+ S EERK +I RYLKKRN+RNF+K IK +C
Sbjct  290  SQHLVHGSGGSSLASEISSLEDPAAFKVGKLSVEERKRKIHRYLKKRNERNFSKKIKNSC  349

Query  602  RKTLADKRVRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDLYYDHPFQAKQDE  781
            RKTLAD R RVRGRFAKN E+      + +      D ++ +     + +DH  + K++E
Sbjct  350  RKTLADSRPRVRGRFAKNEELGRTSAANHE---DDTDEDVTLFSNATIPHDHHHKVKEEE  406

Query  782  EEE  790
            E E
Sbjct  407  EIE  409



>ref|XP_002465890.1| hypothetical protein SORBIDRAFT_01g047650 [Sorghum bicolor]
 gb|EER92888.1| hypothetical protein SORBIDRAFT_01g047650 [Sorghum bicolor]
Length=392

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  281  EDSTFKVVRLSPEERKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  340

Query  665  C  667
            C
Sbjct  341  C  341



>ref|XP_010934242.1| PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Elaeis guineensis]
Length=132

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            ++   K+GR S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E 
Sbjct  20   DESTFKVGRLSVEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEF  79



>ref|XP_010436090.1| PREDICTED: zinc finger protein CONSTANS-LIKE 1-like [Camelina 
sativa]
Length=304

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+GRYS EERK++I +Y  KRNQRNF KTIKYACRKTLAD R R+RGRFA+N+E+
Sbjct  195  EHNNFKVGRYSAEERKEKISKYRAKRNQRNFTKTIKYACRKTLADSRPRIRGRFARNDEV  254

Query  665  C  667
             
Sbjct  255  V  255



>ref|XP_010556922.1| PREDICTED: two-component response regulator-like APRR7 isoform 
X2 [Tarenaya hassleriana]
Length=401

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L E  + K+GR S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+
Sbjct  285  LDEATSSKVGRLSAEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKND  344

Query  659  EI  664
            E+
Sbjct  345  EL  346



>ref|XP_009334191.1| PREDICTED: serine/threonine-protein kinase phg2-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009334206.1| PREDICTED: serine/threonine-protein kinase phg2-like isoform 
X2 [Pyrus x bretschneideri]
Length=425

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            + E P  K+G+ S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+
Sbjct  314  IAEDPNFKVGKLSVEERKEKIHRYMKKRNERNFTKKIKYACRKTLADSRPRVRGRFAKND  373

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDL  745
            +                D+ ++V + +DL
Sbjct  374  DFGETHRPAGS---NHEDDEVVVKEEEDL  399



>ref|XP_010556923.1| PREDICTED: two-component response regulator-like APRR7 isoform 
X3 [Tarenaya hassleriana]
Length=398

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L E  + K+GR S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+
Sbjct  282  LDEATSSKVGRLSAEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKND  341

Query  659  EI  664
            E+
Sbjct  342  EL  343



>ref|XP_004985764.1| PREDICTED: uncharacterized protein LOC101783373 isoform X2 [Setaria 
italica]
Length=373

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  261  EDSTFKVVRLSPEERKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  320

Query  665  C  667
            C
Sbjct  321  C  321



>ref|XP_002886382.1| hypothetical protein ARALYDRAFT_474973 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62641.1| hypothetical protein ARALYDRAFT_474973 [Arabidopsis lyrata subsp. 
lyrata]
Length=293

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E+ ++++GRYS EERK++I +Y  KR QRNF KTIKYACRKTLAD R RVRGRFA+N+E+
Sbjct  178  EEQSLRVGRYSSEERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRPRVRGRFARNDEV  237



>ref|XP_010556921.1| PREDICTED: serine/threonine-protein kinase pakE-like isoform 
X1 [Tarenaya hassleriana]
Length=410

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L E  + K+GR S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+
Sbjct  294  LDEATSSKVGRLSAEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKND  353

Query  659  EI  664
            E+
Sbjct  354  EL  355



>ref|XP_007158512.1| hypothetical protein PHAVU_002G158500g [Phaseolus vulgaris]
 gb|ESW30506.1| hypothetical protein PHAVU_002G158500g [Phaseolus vulgaris]
Length=297

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +2

Query  440  NIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLAD  619
            N +      +   L E+   K+GRYS EERK++I +Y  KR+QR FNK IKYACRKTLAD
Sbjct  189  NTKATDMSQVESPLLEEAYFKVGRYSAEERKEKISKYRAKRSQRKFNKIIKYACRKTLAD  248

Query  620  KRVRVRGRFAKNNEI  664
             R R+RGRFA+N+EI
Sbjct  249  NRTRIRGRFARNDEI  263



>ref|XP_010545543.1| PREDICTED: two-component response regulator-like APRR1 isoform 
X1 [Tarenaya hassleriana]
Length=330

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
              E+P  +IGRYS EERK+RI +Y  KR QRNF KTIKYACRKTLAD R R+RGRFA+N+
Sbjct  227  FTEEPNFRIGRYSVEERKERISKYRAKRTQRNFTKTIKYACRKTLADNRPRIRGRFARND  286

Query  659  E  661
            E
Sbjct  287  E  287



>ref|XP_009334190.1| PREDICTED: uncharacterized protein LOC103927020 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009334205.1| PREDICTED: uncharacterized protein LOC103927030 isoform X1 [Pyrus 
x bretschneideri]
Length=440

 Score = 94.4 bits (233),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            + E P  K+G+ S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+
Sbjct  329  IAEDPNFKVGKLSVEERKEKIHRYMKKRNERNFTKKIKYACRKTLADSRPRVRGRFAKND  388

Query  659  EICgdgdgdddIVIKSRDNNIIVHQTKDL  745
            +                D+ ++V + +DL
Sbjct  389  DFGETHRPAGS---NHEDDEVVVKEEEDL  414



>ref|XP_009400175.1| PREDICTED: zinc finger protein CONSTANS-LIKE 1-like [Musa acuminata 
subsp. malaccensis]
Length=133

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +  A K+GR S EERK++I RY++KRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  22   DDSAYKVGRLSVEERKEKIHRYMRKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  81



>ref|XP_011029325.1| PREDICTED: uncharacterized protein LOC105129085 isoform X2 [Populus 
euphratica]
Length=338

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  464  AISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGR  643
            A      E+   K+GRYS EERK+RI +Y  KRNQRNF+KTIKYACRKTLAD R R+RGR
Sbjct  222  ATESSFIEESNFKVGRYSAEERKERISKYRAKRNQRNFSKTIKYACRKTLADNRPRIRGR  281

Query  644  FAKNNEICgdgdgdddIVIKSRDNN  718
            FA+N E          +   +RD+N
Sbjct  282  FARNEET----GETPKVACSTRDDN  302



>gb|ACG41702.1| CCT motif family protein [Zea mays]
Length=387

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  275  EDSTFKVVRLSPEERKEKIHRYIKKRNERNFRKKIKYACRKTLADSRPRVRGRFAKNDEL  334

Query  665  C  667
            C
Sbjct  335  C  335



>ref|XP_004985763.1| PREDICTED: uncharacterized protein LOC101783373 isoform X1 [Setaria 
italica]
Length=387

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  275  EDSTFKVVRLSPEERKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  334

Query  665  C  667
            C
Sbjct  335  C  335



>gb|KHG30422.1| Zinc finger CONSTANS-LIKE 5 -like protein [Gossypium arboreum]
Length=324

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  464  AISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGR  643
            A+     E+   K+GRY+ EER++RI +Y  KR+QRNFNKTIKYACRKTLAD R R+RGR
Sbjct  207  AMENTFMEESGFKVGRYNAEERQERISKYRAKRSQRNFNKTIKYACRKTLADTRPRIRGR  266

Query  644  FAKNNEI  664
            FA+N+E 
Sbjct  267  FARNDET  273



>ref|XP_010658185.1| PREDICTED: uncharacterized protein LOC104881088 isoform X2 [Vitis 
vinifera]
Length=318

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  494  AMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            + ++GRYS EERK+RI +Y  KR QRNFNKTIKYACRKTLAD R RVRGRFA+N+EI
Sbjct  209  SFRVGRYSAEERKERIDKYRAKRTQRNFNKTIKYACRKTLADSRPRVRGRFARNDEI  265



>ref|XP_008658112.1| PREDICTED: CCT motif family protein isoform X2 [Zea mays]
Length=398

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  286  EDSTFKVVRLSPEERKEKIHRYIKKRNERNFRKKIKYACRKTLADSRPRVRGRFAKNDEL  345

Query  665  C  667
            C
Sbjct  346  C  346



>gb|EMS50724.1| Zinc finger protein CONSTANS-LIKE 3 [Triticum urartu]
Length=166

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEIC  667
            M+  R S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E C
Sbjct  60   MQAARLSVEERKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEYC  116



>ref|XP_006282952.1| hypothetical protein CARUB_v10007619mg [Capsella rubella]
 gb|EOA15850.1| hypothetical protein CARUB_v10007619mg [Capsella rubella]
Length=319

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L ++   K+GRY+ EERK++I +Y  KRNQRNF KTIKYACRKTLAD R R+RGRFA+N+
Sbjct  209  LSDEHNFKVGRYNAEERKEKISKYRAKRNQRNFTKTIKYACRKTLADSRPRIRGRFARND  268

Query  659  EIC  667
            E+ 
Sbjct  269  EVV  271



>gb|KFK31054.1| hypothetical protein AALP_AA6G062400 [Arabis alpina]
Length=387

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 75/124 (60%), Gaps = 13/124 (10%)
 Frame = +2

Query  311  EFSRTPAPRGGYGC------LFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAIS  472
            +F    A  GG+ C      ++  GD   +G +++    + P   P+   +E I G    
Sbjct  217  QFMDFQADNGGFFCPDFIKRIYNPGDLQAHGGVENQSHLVSPQTHPTLGPVE-ITG----  271

Query  473  PKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAK  652
              L++    K+G+ S E+RK++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRFAK
Sbjct  272  --LEDSTLNKVGKLSPEQRKEKIHRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAK  329

Query  653  NNEI  664
            N+E 
Sbjct  330  NDEF  333



>ref|NP_001132123.1| CCT motif family protein [Zea mays]
 gb|ACF80827.1| unknown [Zea mays]
 gb|AFW89632.1| CCT motif family protein [Zea mays]
 gb|AIB05380.1| orphans transcription factor, partial [Zea mays]
Length=389

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  277  EDSTFKVVRLSPEERKEKIHRYIKKRNERNFRKKIKYACRKTLADSRPRVRGRFAKNDEL  336

Query  665  C  667
            C
Sbjct  337  C  337



>gb|ACG39058.1| CCT motif family protein [Zea mays]
Length=390

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  278  EDSTFKVVRLSPEERKEKIHRYIKKRNERNFRKKIKYACRKTLADSRPRVRGRFAKNDEL  337

Query  665  C  667
            C
Sbjct  338  C  338



>gb|KCW60239.1| hypothetical protein EUGRSUZ_H02954 [Eucalyptus grandis]
Length=397

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E P  K+G+ S E+RK++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN E 
Sbjct  288  EDPTYKVGKLSVEQRKEKIHRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKNEEF  347



>ref|XP_010658181.1| PREDICTED: uncharacterized protein LOC104881088 isoform X1 [Vitis 
vinifera]
Length=326

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  494  AMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            + ++GRYS EERK+RI +Y  KR QRNFNKTIKYACRKTLAD R RVRGRFA+N+EI
Sbjct  217  SFRVGRYSAEERKERIDKYRAKRTQRNFNKTIKYACRKTLADSRPRVRGRFARNDEI  273



>ref|XP_010023849.1| PREDICTED: uncharacterized protein LOC104414433 [Eucalyptus grandis]
Length=413

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E P  K+G+ S E+RK++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN E 
Sbjct  304  EDPTYKVGKLSVEQRKEKIHRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKNEEF  363



>ref|XP_008658111.1| PREDICTED: CCT motif family protein isoform X1 [Zea mays]
Length=402

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  286  EDSTFKVVRLSPEERKEKIHRYIKKRNERNFRKKIKYACRKTLADSRPRVRGRFAKNDEL  345

Query  665  C  667
            C
Sbjct  346  C  346



>ref|XP_007226615.1| hypothetical protein PRUPE_ppa023124mg, partial [Prunus persica]
 gb|EMJ27814.1| hypothetical protein PRUPE_ppa023124mg, partial [Prunus persica]
Length=396

 Score = 93.6 bits (231),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            + E P  K+G+ S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+
Sbjct  282  IAEDPNFKVGKLSVEERKEKIHRYMKKRNERNFTKKIKYACRKTLADSRPRVRGRFAKND  341

Query  659  EI  664
            + 
Sbjct  342  DF  343



>ref|XP_011074167.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Sesamum indicum]
Length=261

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  440  NIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLAD  619
            N+      +      E+   K  RYS EERK+RI RY  KRNQRNFNKTIKYACRKTLAD
Sbjct  142  NVSSTSPLSTDESFMEETNFKACRYSAEERKERIDRYRAKRNQRNFNKTIKYACRKTLAD  201

Query  620  KRVRVRGRFAKNNE  661
             R R+RGRFA+N+E
Sbjct  202  SRPRIRGRFARNDE  215



>ref|XP_008658113.1| PREDICTED: CCT motif family protein isoform X3 [Zea mays]
Length=393

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  277  EDSTFKVVRLSPEERKEKIHRYIKKRNERNFRKKIKYACRKTLADSRPRVRGRFAKNDEL  336

Query  665  C  667
            C
Sbjct  337  C  337



>gb|EMT31287.1| hypothetical protein F775_18365 [Aegilops tauschii]
Length=394

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E  + K  R S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E 
Sbjct  284  EDTSFKAARLSVEERKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEY  343

Query  665  C  667
            C
Sbjct  344  C  344



>ref|XP_010253413.1| PREDICTED: two-component response regulator-like APRR1 [Nelumbo 
nucifera]
Length=263

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 74/152 (49%), Gaps = 33/152 (22%)
 Frame = +2

Query  212  HHHNPL-GNVSEQLPTAMLLSPSPPAACGIIGSREFSRTPAPRGGYGCLFESGDECNNGL  388
            HHH P+   V E  P A+ L                  T A R     ++ SGD     L
Sbjct  106  HHHQPIFSTVDESCPEALDL-----------------ETSAMRK----MYSSGDLQQAIL  144

Query  389  LDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQ  568
                  S +   P S  N  G +G           + K  RYS EERKDRI RY  KRNQ
Sbjct  145  TMQQRQSHHSESPLSHENCCGGEG-----------SNKAVRYSAEERKDRIERYRSKRNQ  193

Query  569  RNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            RNFNK IKYACRKTLAD R R+RGRFA+N E+
Sbjct  194  RNFNKKIKYACRKTLADSRPRIRGRFARNEEV  225



>gb|KCW60234.1| hypothetical protein EUGRSUZ_H02948 [Eucalyptus grandis]
Length=127

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E P  K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN E 
Sbjct  18   EDPTYKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNEEF  77



>ref|XP_011029324.1| PREDICTED: uncharacterized protein LOC105129085 isoform X1 [Populus 
euphratica]
Length=356

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  464  AISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGR  643
            A      E+   K+GRYS EERK+RI +Y  KRNQRNF+KTIKYACRKTLAD R R+RGR
Sbjct  222  ATESSFIEESNFKVGRYSAEERKERISKYRAKRNQRNFSKTIKYACRKTLADNRPRIRGR  281

Query  644  FAKNNEICgdgdgdddIVIKSRDNN  718
            FA+N E          +   +RD+N
Sbjct  282  FARNEET----GETPKVACSTRDDN  302



>gb|KFK31055.1| hypothetical protein AALP_AA6G062400 [Arabis alpina]
Length=380

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 75/124 (60%), Gaps = 13/124 (10%)
 Frame = +2

Query  311  EFSRTPAPRGGYGC------LFESGDECNNGLLDSNFWSLYPTRPPSSYNIEGIQGEAIS  472
            +F    A  GG+ C      ++  GD   +G +++    + P   P+   +E I G    
Sbjct  210  QFMDFQADNGGFFCPDFIKRIYNPGDLQAHGGVENQSHLVSPQTHPTLGPVE-ITG----  264

Query  473  PKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAK  652
              L++    K+G+ S E+RK++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRFAK
Sbjct  265  --LEDSTLNKVGKLSPEQRKEKIHRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAK  322

Query  653  NNEI  664
            N+E 
Sbjct  323  NDEF  326



>ref|XP_003558847.1| PREDICTED: uncharacterized protein LOC100838223 [Brachypodium 
distachyon]
Length=389

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 13/84 (15%)
 Frame = +2

Query  416  PTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKY  595
            PT PP+   I G++            + K+ R S E+RK++I RY+KKRN+RNF+K IKY
Sbjct  267  PTLPPT--EISGLED-----------SFKVVRLSAEQRKEKIHRYIKKRNERNFSKKIKY  313

Query  596  ACRKTLADKRVRVRGRFAKNNEIC  667
            ACRKTLAD R RVRGRFAKN+E+C
Sbjct  314  ACRKTLADSRPRVRGRFAKNDELC  337



>ref|XP_008245265.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X2 [Prunus mume]
Length=432

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            + E P  K+G+ S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+
Sbjct  318  IAEDPNFKVGKLSVEERKEKIHRYMKKRNERNFTKKIKYACRKTLADSRPRVRGRFAKND  377

Query  659  EI  664
            + 
Sbjct  378  DF  379



>ref|XP_009381098.1| PREDICTED: uncharacterized protein LOC103969324 [Musa acuminata 
subsp. malaccensis]
Length=280

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  422  RPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYAC  601
            R  S+ +++G+ G   +   +   A ++GRYS EERK+RI RY  KRNQRNF+K I YAC
Sbjct  112  RVVSTGDLQGVDGVHENHSHEGGVAGRVGRYSAEERKERIERYKSKRNQRNFHKKITYAC  171

Query  602  RKTLADKRVRVRGRFAKNNEI  664
            RKTLAD R RVRGRFA+N E 
Sbjct  172  RKTLADSRPRVRGRFARNGET  192



>ref|XP_010676451.1| PREDICTED: zinc finger protein HD1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=363

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            + E+   K+G+YS EERK+RI RY  KR QRNFNKTIKYACRKTLAD R R+RGRFA+N+
Sbjct  248  MMEESNFKVGKYSAEERKERIDRYRAKRTQRNFNKTIKYACRKTLADNRPRIRGRFARND  307

Query  659  E  661
            E
Sbjct  308  E  308



>ref|XP_008650854.1| PREDICTED: uncharacterized protein LOC103631693 isoform X1 [Zea 
mays]
Length=392

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S EE+K++I RY KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  279  EDSTFKVVRLSPEEKKEKIHRYRKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKNDEL  338

Query  665  C  667
            C
Sbjct  339  C  339



>ref|XP_010676450.1| PREDICTED: uncharacterized protein DDB_G0283357 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=364

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            + E+   K+G+YS EERK+RI RY  KR QRNFNKTIKYACRKTLAD R R+RGRFA+N+
Sbjct  249  MMEESNFKVGKYSAEERKERIDRYRAKRTQRNFNKTIKYACRKTLADNRPRIRGRFARND  308

Query  659  E  661
            E
Sbjct  309  E  309



>ref|XP_010533642.1| PREDICTED: uncharacterized protein LOC104809375 [Tarenaya hassleriana]
Length=331

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEICgdg  676
            +K+GRYS EER++RI +Y  KR QRNF KTIKY CRKTLAD R R+RGRFA+N+E+    
Sbjct  227  LKVGRYSAEERRERISKYRAKRTQRNFTKTIKYGCRKTLADNRARIRGRFARNDEVVEIP  286

Query  677  dgdddIVIKSRDNNI  721
                    +  D+N+
Sbjct  287  KNSFSFATEDDDDNL  301



>ref|XP_004297849.1| PREDICTED: uncharacterized protein LOC101302746 [Fragaria vesca 
subsp. vesca]
Length=446

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            + E P  K+G+ S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+
Sbjct  332  MAEDPNFKVGKLSVEERKEKIHRYMKKRNERNFTKKIKYACRKTLADSRPRVRGRFAKND  391

Query  659  EI  664
            + 
Sbjct  392  DF  393



>emb|CBI34368.3| unnamed protein product [Vitis vinifera]
Length=262

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  494  AMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            + ++GRYS EERK+RI +Y  KR QRNFNKTIKYACRKTLAD R RVRGRFA+N+EI
Sbjct  151  SFRVGRYSAEERKERIDKYRAKRTQRNFNKTIKYACRKTLADSRPRVRGRFARNDEI  207



>ref|XP_008785333.1| PREDICTED: uncharacterized protein LOC103703997 [Phoenix dactylifera]
Length=415

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            ++   K+GR S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E 
Sbjct  303  DESTFKVGRLSAEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEF  362



>ref|XP_008245264.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
isoform X1 [Prunus mume]
Length=438

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            + E P  K+G+ S EERK++I RY+KKRN+RNF K IKYACRKTLAD R RVRGRFAKN+
Sbjct  324  IAEDPNFKVGKLSVEERKEKIHRYMKKRNERNFTKKIKYACRKTLADSRPRVRGRFAKND  383

Query  659  EI  664
            + 
Sbjct  384  DF  385



>ref|XP_008373296.1| PREDICTED: uncharacterized protein LOC103436632 [Malus domestica]
Length=348

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
             K GRYS EERK+RI +Y  KR+QRNFNKTIKYACRKTLADKR R+RGRFA+N+E 
Sbjct  235  FKTGRYSAEERKERISKYRAKRSQRNFNKTIKYACRKTLADKRPRIRGRFARNDET  290



>ref|XP_008650859.1| PREDICTED: uncharacterized protein LOC103631693 isoform X2 [Zea 
mays]
Length=379

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S EE+K++I RY KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  266  EDSTFKVVRLSPEEKKEKIHRYRKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKNDEL  325

Query  665  C  667
            C
Sbjct  326  C  326



>ref|XP_008777489.1| PREDICTED: uncharacterized protein LOC103697416, partial [Phoenix 
dactylifera]
Length=410

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E+   K+GR S EERK++I RYLKKRN+RNF+K IKYACRKTLAD R R+RGRFAKN+E 
Sbjct  299  EESTFKVGRLSMEERKEKIHRYLKKRNERNFSKKIKYACRKTLADSRPRIRGRFAKNDEF  358



>gb|KCW60233.1| hypothetical protein EUGRSUZ_H02948 [Eucalyptus grandis]
Length=163

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E P  K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN E 
Sbjct  54   EDPTYKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNEEF  113



>ref|NP_176567.2| CCT motif family protein [Arabidopsis thaliana]
 dbj|BAD43922.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34151.1| CCT motif family protein [Arabidopsis thaliana]
Length=293

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            ++ ++++GRYS EERK++I +Y  KR QRNF KTIKYACRKTLAD R RVRGRFA+N+E+
Sbjct  178  DEQSLRVGRYSSEERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRPRVRGRFARNDEV  237

Query  665  CgdgdgdddIVIKSRDNNI  721
              +         +  D+++
Sbjct  238  FENPKIASSFTRQENDDDL  256



>tpg|DAA43289.1| TPA: hypothetical protein ZEAMMB73_919411 [Zea mays]
Length=392

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+ R S EE+K++I RY KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  279  EDSTFKVVRLSPEEKKEKIHRYRKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKNDEL  338

Query  665  C  667
            C
Sbjct  339  C  339



>ref|XP_009398894.1| PREDICTED: uncharacterized protein LOC103983404 [Musa acuminata 
subsp. malaccensis]
Length=424

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E  + K+GR S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  313  EDSSYKVGRLSVEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  372



>emb|CDY45387.1| BnaC06g42420D [Brassica napus]
Length=233

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +2

Query  470  SPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFA  649
            S   +++  +K+GRYS EERK++I +Y  KRN RNF KTIKYACRKTLAD R R+RGRFA
Sbjct  149  SEPFQDEQNIKVGRYSAEERKEKISKYRAKRNHRNFTKTIKYACRKTLADSRPRIRGRFA  208

Query  650  KNNEIC  667
            +N+E+ 
Sbjct  209  RNDEVV  214



>gb|ABR16285.1| unknown [Picea sitchensis]
Length=447

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            E+   KIGRYS EERK RI RY KKR +RNFNK IKYACRKTLAD R RVRGRFA+N +
Sbjct  332  EEAGFKIGRYSAEERKQRIHRYRKKRTERNFNKKIKYACRKTLADSRPRVRGRFARNED  390



>ref|XP_007210804.1| hypothetical protein PRUPE_ppa017365mg [Prunus persica]
 gb|EMJ12003.1| hypothetical protein PRUPE_ppa017365mg [Prunus persica]
Length=344

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
             K+GRYS EERK+RI +Y  KR+QRNFNKTIKYACRKTLAD R R+RGRFA+N+E 
Sbjct  233  FKMGRYSAEERKERISKYRAKRSQRNFNKTIKYACRKTLADNRPRIRGRFARNDET  288



>ref|XP_004169761.1| PREDICTED: uncharacterized LOC101214336, partial [Cucumis sativus]
Length=409

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
             K+G+ S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  303  FKVGKLSTEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  358



>ref|XP_004147186.1| PREDICTED: uncharacterized protein LOC101214336 [Cucumis sativus]
 gb|KGN61564.1| hypothetical protein Csa_2G171860 [Cucumis sativus]
Length=411

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
             K+G+ S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  303  FKVGKLSTEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  358



>ref|XP_010025829.1| PREDICTED: uncharacterized protein LOC104416089 [Eucalyptus grandis]
Length=336

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E  + K+G+ S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  221  EDSSYKVGKLSIEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  280



>ref|XP_010234805.1| PREDICTED: two-component response regulator-like PRR73 [Brachypodium 
distachyon]
Length=408

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +2

Query  458  GEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVR  637
            GE     L E  + K  R S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVR
Sbjct  290  GETTGSSL-EDTSFKAARLSVEERKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVR  348

Query  638  GRFAKNNEIC  667
            GRFAKN++ C
Sbjct  349  GRFAKNDDYC  358



>dbj|BAC42809.1| unknown protein [Arabidopsis thaliana]
Length=203

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 62/101 (61%), Gaps = 16/101 (16%)
 Frame = +2

Query  410  LYPTRPPSSYNIEGIQGEAISPKLKEQPAM----------------KIGRYSEEERKDRI  541
            + P   P  ++++G+ G      +  QP +                K+G+ S E+RK++I
Sbjct  50   IKPIFNPGDHHLQGLDGVENQNHMVAQPVLPQLGTEITGLDDPSFNKVGKLSAEQRKEKI  109

Query  542  LRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
             RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E 
Sbjct  110  HRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEF  150



>ref|XP_008238935.1| PREDICTED: uncharacterized protein LOC103337551 [Prunus mume]
Length=345

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
             K+GRYS EERK+RI +Y  KR+QRNFNKTIKYACRKTLAD R R+RGRFA+N+E 
Sbjct  233  FKMGRYSAEERKERISKYRAKRSQRNFNKTIKYACRKTLADNRPRIRGRFARNDET  288



>ref|XP_006661846.1| PREDICTED: uncharacterized protein LOC102716903 [Oryza brachyantha]
Length=267

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E  + K  R S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN++ 
Sbjct  157  EDTSFKTVRLSNEERKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDY  216

Query  665  C  667
            C
Sbjct  217  C  217



>gb|KEH41157.1| CCT motif protein [Medicago truncatula]
Length=230

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E  ++K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN++ 
Sbjct  120  EDSSLKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDF  179



>ref|XP_002304512.1| hypothetical protein POPTR_0003s13050g [Populus trichocarpa]
 gb|EEE79491.1| hypothetical protein POPTR_0003s13050g [Populus trichocarpa]
Length=344

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  464  AISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGR  643
            A      E+   K+GRYS EERK+RI +Y  KR QRNF KTIKYACRKTLAD R R+RGR
Sbjct  224  ATESSFIEESNFKVGRYSAEERKERISKYRAKRTQRNFTKTIKYACRKTLADNRPRIRGR  283

Query  644  FAKNNEI  664
            FA+N+E 
Sbjct  284  FARNDET  290



>gb|EYU23454.1| hypothetical protein MIMGU_mgv1a010539mg [Erythranthe guttata]
Length=309

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L E+   K+G+YS EERK++I RY  KR QRNF+KTIKYACRKTLAD R R+RGRFA+N+
Sbjct  202  LMEEANFKVGKYSAEERKEKIDRYRAKRTQRNFHKTIKYACRKTLADNRPRIRGRFARND  261

Query  659  E  661
            E
Sbjct  262  E  262



>ref|XP_004497813.1| PREDICTED: homeobox protein 5-like [Cicer arietinum]
Length=415

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 62/86 (72%), Gaps = 7/86 (8%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E   +K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN++ 
Sbjct  305  EDSTLKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDF  364

Query  665  -------CgdgdgdddIVIKSRDNNI  721
                   C + + DD+I +K  D+ +
Sbjct  365  GETHRPTCSNHEDDDEIAVKEEDDMV  390



>ref|XP_008460688.1| PREDICTED: uncharacterized protein LOC103499454 isoform X3 [Cucumis 
melo]
Length=411

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  500  KIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            K+G+ S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  304  KVGKLSMEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  358



>emb|CDP21666.1| unnamed protein product, partial [Coffea canephora]
Length=379

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            + P  K+G+ + EER+++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  301  DDPTFKVGKLTVEERREKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  360



>emb|CDX86630.1| BnaC08g00730D [Brassica napus]
Length=388

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 62/96 (65%), Gaps = 9/96 (9%)
 Frame = +2

Query  380  NGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKK  559
            +G  + N     P  P    +I G+   +++         K+ + + E+RK++I RY+KK
Sbjct  250  DGGENQNHLVATPVLPQCGTDITGLDDGSVN---------KVAKLTAEQRKEKIHRYMKK  300

Query  560  RNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEIC  667
            RN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+C
Sbjct  301  RNERNFSKKIKYACRKTLADSRPRVRGRFAKNDELC  336



>emb|CDY70149.1| BnaCnng66940D [Brassica napus]
Length=308

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEIC  667
            +K+GRYS EERK++I +Y  KRNQRNF KTIKYACRKTLAD R R+RGRFA+N ++ 
Sbjct  204  LKVGRYSAEERKEKISKYRAKRNQRNFTKTIKYACRKTLADSRPRIRGRFARNEDVV  260



>gb|ABY56106.1| zinc finger-like protein [Cucumis sativus]
Length=419

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
             K+G+ S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  311  FKVGKLSTEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  366



>ref|XP_009111098.1| PREDICTED: two-component response regulator-like APRR5 isoform 
X1 [Brassica rapa]
 emb|CDY15509.1| BnaA08g27930D [Brassica napus]
Length=384

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 62/96 (65%), Gaps = 9/96 (9%)
 Frame = +2

Query  380  NGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKK  559
            +G  + N     P  P    +I G+   +++         K+ + + E+RK++I RY+KK
Sbjct  246  DGGENQNHLVATPVLPQCGTDITGLDDGSVN---------KVAKLTAEQRKEKIHRYMKK  296

Query  560  RNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEIC  667
            RN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+C
Sbjct  297  RNERNFSKKIKYACRKTLADSRPRVRGRFAKNDELC  332



>ref|XP_009375042.1| PREDICTED: uncharacterized protein LOC103963889 [Pyrus x bretschneideri]
 ref|XP_009375045.1| PREDICTED: uncharacterized protein LOC103963892 [Pyrus x bretschneideri]
Length=334

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
             K+GRYS EERK+RI +Y  KR+QRNFNKTIKYACRKTLAD R R+RGRFA+N+E 
Sbjct  220  FKMGRYSAEERKERISKYRAKRSQRNFNKTIKYACRKTLADNRPRIRGRFARNDET  275



>ref|XP_009140089.1| PREDICTED: uncharacterized protein LOC103864078 [Brassica rapa]
 emb|CDY39741.1| BnaA04g11120D [Brassica napus]
Length=308

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEIC  667
            +K+GRYS EERK++I +Y  KRNQRNF KTIKYACRKTLAD R R+RGRFA+N ++ 
Sbjct  204  LKVGRYSAEERKEKISKYRAKRNQRNFTKTIKYACRKTLADSRPRIRGRFARNEDVV  260



>ref|XP_009111099.1| PREDICTED: two-component response regulator-like APRR5 isoform 
X2 [Brassica rapa]
Length=375

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 62/96 (65%), Gaps = 9/96 (9%)
 Frame = +2

Query  380  NGLLDSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKK  559
            +G  + N     P  P    +I G+   +++         K+ + + E+RK++I RY+KK
Sbjct  237  DGGENQNHLVATPVLPQCGTDITGLDDGSVN---------KVAKLTAEQRKEKIHRYMKK  287

Query  560  RNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEIC  667
            RN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+C
Sbjct  288  RNERNFSKKIKYACRKTLADSRPRVRGRFAKNDELC  323



>ref|NP_001064805.1| Os10g0466500 [Oryza sativa Japonica Group]
 dbj|BAF26719.1| Os10g0466500 [Oryza sativa Japonica Group]
Length=283

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E  + K  R S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN++ 
Sbjct  173  EDTSFKTVRLSNEERKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDY  232

Query  665  C  667
            C
Sbjct  233  C  233



>ref|NP_001077999.1| CCT motif-containing protein [Arabidopsis thaliana]
 gb|AAX23831.1| hypothetical protein At2g33350 [Arabidopsis thaliana]
 gb|AEC08821.1| CCT motif-containing protein [Arabidopsis thaliana]
Length=409

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L++    K+G+ S E+RK++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN+
Sbjct  294  LEDSTLNKVGKLSPEQRKEKIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKND  353

Query  659  EI  664
            E 
Sbjct  354  EF  355



>ref|XP_010413884.1| PREDICTED: serine/threonine-protein kinase phg2-like isoform 
X2 [Camelina sativa]
Length=407

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  467  ISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRF  646
            I+  L++    K+G+ S E++K++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRF
Sbjct  288  INNALEDSTLSKVGKLSPEQKKEKIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRF  347

Query  647  AKNNEI  664
            AKN+E 
Sbjct  348  AKNDEF  353



>ref|NP_180893.2| CCT motif-containing protein [Arabidopsis thaliana]
 gb|AAT68355.1| hypothetical protein At2g33350 [Arabidopsis thaliana]
 gb|AEC08820.1| CCT motif-containing protein [Arabidopsis thaliana]
Length=410

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L++    K+G+ S E+RK++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN+
Sbjct  295  LEDSTLNKVGKLSPEQRKEKIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKND  354

Query  659  EI  664
            E 
Sbjct  355  EF  356



>ref|XP_010413883.1| PREDICTED: two-component response regulator-like APRR7 isoform 
X1 [Camelina sativa]
Length=408

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  467  ISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRF  646
            I+  L++    K+G+ S E++K++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRF
Sbjct  289  INNALEDSTLSKVGKLSPEQKKEKIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRF  348

Query  647  AKNNEI  664
            AKN+E 
Sbjct  349  AKNDEF  354



>ref|XP_010413885.1| PREDICTED: two-component response regulator-like APRR7 isoform 
X3 [Camelina sativa]
Length=399

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  467  ISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRF  646
            I+  L++    K+G+ S E++K++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRF
Sbjct  280  INNALEDSTLSKVGKLSPEQKKEKIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRF  339

Query  647  AKNNEI  664
            AKN+E 
Sbjct  340  AKNDEF  345



>ref|XP_004511566.1| PREDICTED: zinc finger protein CONSTANS-like [Cicer arietinum]
Length=261

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQR  571
            +++F+S    R  S+ +++ ++         E+   K+GRYS EERK++I +Y  KR+QR
Sbjct  139  ENSFFSGQMRRACSAGDLQNMKTIVTHESQTEEANFKVGRYSAEERKEKISKYRAKRSQR  198

Query  572  NFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
             FNK IKYACRKTLAD R R+RGRFA+N+E
Sbjct  199  KFNKIIKYACRKTLADNRTRIRGRFARNDE  228



>ref|XP_002892221.1| hypothetical protein ARALYDRAFT_887616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68480.1| hypothetical protein ARALYDRAFT_887616 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 62/101 (61%), Gaps = 16/101 (16%)
 Frame = +2

Query  410  LYPTRPPSSYNIEGIQGEAISPKLKEQPAM----------------KIGRYSEEERKDRI  541
            + P   P  ++++G+ G      +  QP +                K+G+ S E+RK++I
Sbjct  233  IKPIFNPGDHHLQGLDGGENQNHMVAQPVLPQLGTEITGLDDPSFNKVGKLSAEQRKEKI  292

Query  542  LRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
             RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E 
Sbjct  293  HRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEF  333



>gb|KCW57338.1| hypothetical protein EUGRSUZ_H00131 [Eucalyptus grandis]
Length=406

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E  + K+G+ S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  290  EDSSYKVGKLSIEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  349



>ref|XP_008460686.1| PREDICTED: uncharacterized protein LOC103499454 isoform X1 [Cucumis 
melo]
Length=421

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
             K+G+ S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  313  FKVGKLSMEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  368



>ref|XP_008460687.1| PREDICTED: uncharacterized protein LOC103499454 isoform X2 [Cucumis 
melo]
Length=419

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  497  MKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
             K+G+ S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E+
Sbjct  311  FKVGKLSMEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEL  366



>ref|XP_009411394.1| PREDICTED: two-component response regulator-like PRR95 [Musa 
acuminata subsp. malaccensis]
Length=165

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +    K+GR S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFA+N+E 
Sbjct  51   DDTTFKVGRLSVEERKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFARNDEF  110



>ref|NP_171944.2| CCT motif-containing protein [Arabidopsis thaliana]
 gb|ABE65597.1| zinc finger CONSTANS-like protein [Arabidopsis thaliana]
 dbj|BAH30269.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27705.1| CCT motif-containing protein [Arabidopsis thaliana]
Length=386

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 62/101 (61%), Gaps = 16/101 (16%)
 Frame = +2

Query  410  LYPTRPPSSYNIEGIQGEAISPKLKEQPAM----------------KIGRYSEEERKDRI  541
            + P   P  ++++G+ G      +  QP +                K+G+ S E+RK++I
Sbjct  233  IKPIFNPGDHHLQGLDGVENQNHMVAQPVLPQLGTEITGLDDPSFNKVGKLSAEQRKEKI  292

Query  542  LRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
             RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E 
Sbjct  293  HRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEF  333



>ref|XP_004247937.2| PREDICTED: two-component response regulator-like APRR9 [Solanum 
lycopersicum]
Length=390

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 70/125 (56%), Gaps = 7/125 (6%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E P  K GR S EER+++I RY+KKRN+RNF+K IKYACRKTLAD R RV+GRFA+N+E 
Sbjct  257  EDPNFKSGRCSVEERREKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVKGRFARNDEF  316

Query  665  CgdgdgdddIVIKSRDNNIIVHQT---KDLYYDHPFQAKQDEEEEWLEEAITSLMYIPYI  835
                  +    I+    + I H+     ++ Y HP         +      TS  ++P  
Sbjct  317  GEASKANSCGTIEE---DTISHEDVGLNNIMY-HPNMVTSSTHHDNNATIFTSNCHVPTT  372

Query  836  GGSYD  850
             G YD
Sbjct  373  NGPYD  377



>ref|XP_009400991.1| PREDICTED: protein SCAF8-like [Musa acuminata subsp. malaccensis]
Length=420

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 5/77 (6%)
 Frame = +2

Query  449  GIQGEAISPKLKEQPAM-----KIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTL  613
            G  G A+     + P +     K+GR S EERK++I RY+KKRN+RNF+K IKYACRKTL
Sbjct  292  GCSGNALPLPASDMPPLDESTYKVGRLSVEERKEKIHRYMKKRNERNFSKKIKYACRKTL  351

Query  614  ADKRVRVRGRFAKNNEI  664
            AD R RVRGRFAKN+E+
Sbjct  352  ADSRPRVRGRFAKNDEL  368



>ref|XP_002528360.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34032.1| conserved hypothetical protein [Ricinus communis]
Length=428

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E  A K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN++ 
Sbjct  316  EDSAFKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDF  375

Query  665  CgdgdgdddIVIKSRDNNIIVHQTKDL  745
              +            ++ IIV   +D+
Sbjct  376  GENNRAVCSNQEDDDEDEIIVKDEEDM  402



>ref|XP_010469487.1| PREDICTED: two-component response regulator-like APRR7 isoform 
X2 [Camelina sativa]
Length=407

 Score = 91.3 bits (225),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L++    K+G+ S E++K++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN+
Sbjct  292  LEDSTLSKVGKLSPEQKKEKIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKND  351

Query  659  EI  664
            E 
Sbjct  352  EF  353



>gb|AAB80653.1| hypothetical protein [Arabidopsis thaliana]
Length=440

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L++    K+G+ S E+RK++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN+
Sbjct  325  LEDSTLNKVGKLSPEQRKEKIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKND  384

Query  659  EI  664
            E 
Sbjct  385  EF  386



>ref|XP_006590510.1| PREDICTED: uncharacterized protein LOC100786853 isoform X2 [Glycine 
max]
Length=250

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +2

Query  392  DSNFWSLYPTRPPSSYNIEGIQGEAISPK---LKEQPAMKIGRYSEEERKDRILRYLKKR  562
            ++ F++    R  S+ +++ ++   +S     L E+   K+ RYS EERK++I +Y  KR
Sbjct  123  ENTFFAASMRRVCSTGDLQNMKAADMSQTESPLLEEGNFKVRRYSAEERKEKISKYRAKR  182

Query  563  NQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            +QR FNKTIKYACRKTLAD R R+RGRFA+N+EI
Sbjct  183  SQRKFNKTIKYACRKTLADNRTRIRGRFARNDEI  216



>ref|XP_010469486.1| PREDICTED: two-component response regulator-like APRR7 isoform 
X1 [Camelina sativa]
Length=408

 Score = 91.3 bits (225),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L++    K+G+ S E++K++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN+
Sbjct  293  LEDSTLSKVGKLSPEQKKEKIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKND  352

Query  659  EI  664
            E 
Sbjct  353  EF  354



>ref|XP_006589074.1| PREDICTED: protein DDB_G0276689-like [Glycine max]
Length=422

 Score = 91.3 bits (225),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            E   +K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E
Sbjct  311  EDSNLKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDE  369



>ref|XP_010469489.1| PREDICTED: two-component response regulator-like APRR7 isoform 
X3 [Camelina sativa]
Length=399

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L++    K+G+ S E++K++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN+
Sbjct  284  LEDSTLSKVGKLSPEQKKEKIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKND  343

Query  659  EI  664
            E 
Sbjct  344  EF  345



>gb|KHN24670.1| Zinc finger protein CONSTANS-LIKE 5 [Glycine soja]
Length=415

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E   +K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E 
Sbjct  304  EDSNLKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEF  363



>ref|XP_002879446.1| hypothetical protein ARALYDRAFT_482277 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55705.1| hypothetical protein ARALYDRAFT_482277 [Arabidopsis lyrata subsp. 
lyrata]
Length=406

 Score = 90.9 bits (224),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L++    K+G+ S E+RK++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN+
Sbjct  291  LEDSTMNKVGKLSPEQRKEKIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKND  350

Query  659  EI  664
            + 
Sbjct  351  DF  352



>gb|EEC67132.1| hypothetical protein OsI_33955 [Oryza sativa Indica Group]
Length=417

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E  + K  R S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN++ 
Sbjct  307  EDTSFKTVRLSNEERKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDY  366

Query  665  C  667
            C
Sbjct  367  C  367



>ref|XP_006590509.1| PREDICTED: uncharacterized protein LOC100786853 isoform X1 [Glycine 
max]
 gb|KHN35031.1| Zinc finger protein CONSTANS-LIKE 3 [Glycine soja]
Length=292

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  LKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNN  658
            L E+   K+ RYS EERK++I +Y  KR+QR FNKTIKYACRKTLAD R R+RGRFA+N+
Sbjct  197  LLEEGNFKVRRYSAEERKEKISKYRAKRSQRKFNKTIKYACRKTLADNRTRIRGRFARND  256

Query  659  EI  664
            EI
Sbjct  257  EI  258



>ref|XP_007145818.1| hypothetical protein PHAVU_007G270600g [Phaseolus vulgaris]
 gb|ESW17812.1| hypothetical protein PHAVU_007G270600g [Phaseolus vulgaris]
Length=422

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E   +K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN++ 
Sbjct  311  EDSTLKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDF  370



>gb|AAK27800.1|AC022457_3 putative flowering-time gene protein [Oryza sativa Japonica Group]
 gb|ABB47771.2| CCT motif family protein, expressed [Oryza sativa Japonica Group]
Length=449

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E  + K  R S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN++ 
Sbjct  339  EDTSFKTVRLSNEERKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDY  398

Query  665  C  667
            C
Sbjct  399  C  399



>ref|XP_006605759.1| PREDICTED: uncharacterized protein LOC100793417 [Glycine max]
Length=424

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E   +K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN++ 
Sbjct  313  EDSTLKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDF  372



>ref|XP_007145819.1| hypothetical protein PHAVU_007G270600g [Phaseolus vulgaris]
 gb|ESW17813.1| hypothetical protein PHAVU_007G270600g [Phaseolus vulgaris]
Length=418

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E   +K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN++ 
Sbjct  307  EDSTLKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDF  366



>gb|EEE51105.1| hypothetical protein OsJ_31832 [Oryza sativa Japonica Group]
Length=417

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E  + K  R S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN++ 
Sbjct  307  EDTSFKTVRLSNEERKEKIHRYIKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDY  366

Query  665  C  667
            C
Sbjct  367  C  367



>gb|KHN24880.1| Zinc finger protein CONSTANS-LIKE 4 [Glycine soja]
Length=423

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E   +K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN++ 
Sbjct  312  EDSTLKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDDF  371



>ref|XP_004288744.1| PREDICTED: uncharacterized protein LOC101299421 [Fragaria vesca 
subsp. vesca]
Length=337

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  470  SPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFA  649
            S  +++    K+ +Y+ EERK+RIL+Y  KR+QRNFNKTIKYACRKTLAD R R+RGRFA
Sbjct  216  SSAMEDAGNFKMSKYTAEERKERILKYRAKRSQRNFNKTIKYACRKTLADNRPRIRGRFA  275

Query  650  KNNE  661
            +N+E
Sbjct  276  RNDE  279



>ref|XP_006294315.1| hypothetical protein CARUB_v10023323mg [Capsella rubella]
 gb|EOA27213.1| hypothetical protein CARUB_v10023323mg [Capsella rubella]
Length=410

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 1/61 (2%)
 Frame = +2

Query  485  EQPAM-KIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            E P + K+G+ S E+RK++I RY+KKRN+RNFNK IKYACRKTLAD R RVRGRFAKN++
Sbjct  294  EDPTLSKVGKLSPEQRKEKIRRYMKKRNERNFNKKIKYACRKTLADSRPRVRGRFAKNDD  353

Query  662  I  664
             
Sbjct  354  F  354



>ref|XP_010936037.1| PREDICTED: uncharacterized protein LOC105055764 [Elaeis guineensis]
Length=371

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = +2

Query  467  ISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRF  646
            +S  L E    ++GR S EERK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRF
Sbjct  254  VSAALDES-CYRVGRLSVEERKEKIHRYMKKRNERNFHKKIKYACRKTLADNRPRVRGRF  312

Query  647  AKNNEI  664
            AKN+E 
Sbjct  313  AKNDEF  318



>ref|XP_010089070.1| Zinc finger protein CONSTANS-LIKE 3 [Morus notabilis]
 gb|EXB37317.1| Zinc finger protein CONSTANS-LIKE 3 [Morus notabilis]
Length=357

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNE  661
            E+   K+G+YS EERK+RI +Y  KR  RNFNKTIKYACRKTLAD R R+RGRFA+N+E
Sbjct  243  EEANFKVGKYSAEERKERISKYRAKRTLRNFNKTIKYACRKTLADNRPRIRGRFARNDE  301



>ref|XP_011022638.1| PREDICTED: uncharacterized protein LOC105124351 [Populus euphratica]
Length=343

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  464  AISPKLKEQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGR  643
            A      E+   K+GRYS EERK+RI +Y  KR++RNF KTIKYACRKTLAD R R+RGR
Sbjct  224  ATESSFIEESNFKVGRYSAEERKERISKYRAKRSRRNFTKTIKYACRKTLADNRPRIRGR  283

Query  644  FAKNNEI  664
            FA+N+E 
Sbjct  284  FARNDET  290



>ref|XP_010670943.1| PREDICTED: uncharacterized protein LOC104887875 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=455

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E    K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFAKN+E 
Sbjct  343  EDSTFKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKTLADSRPRVRGRFAKNDEF  402



>ref|XP_006354533.1| PREDICTED: homeobox protein 5-like [Solanum tuberosum]
Length=418

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 69/125 (55%), Gaps = 7/125 (6%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E P  K GR S EER+ +I RY+KKRN+RNF+K IKYACRKTLAD R RVRGRFA+N+E 
Sbjct  285  EDPTFKSGRCSVEERRKKIHRYMKKRNERNFSKRIKYACRKTLADSRPRVRGRFARNDEF  344

Query  665  CgdgdgdddIVIKSRDNNIIVHQT---KDLYYDHPFQAKQDEEEEWLEEAITSLMYIPYI  835
                  +    I+    + I H+     ++ Y HP         +      T+  ++P  
Sbjct  345  GEASKANSCGTIEE---DTISHEDVRLNNIMY-HPNMVTSSTHLDNNATIFTTNCHVPTT  400

Query  836  GGSYD  850
             G YD
Sbjct  401  NGPYD  405



>gb|KCW60229.1| hypothetical protein EUGRSUZ_H02941 [Eucalyptus grandis]
Length=397

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  485  EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADKRVRVRGRFAKNNEI  664
            E P  K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRK+LAD R RVRGRFAKN E 
Sbjct  288  EDPTYKVGKLSVEQRKEKIHRYMKKRNERNFSKKIKYACRKSLADSRPRVRGRFAKNEEF  347



>ref|XP_007144132.1| hypothetical protein PHAVU_007G131300g [Phaseolus vulgaris]
 gb|ESW16126.1| hypothetical protein PHAVU_007G131300g [Phaseolus vulgaris]
Length=405

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 63/101 (62%), Gaps = 2/101 (2%)
 Frame = +2

Query  449  GIQGEAISPKLK--EQPAMKIGRYSEEERKDRILRYLKKRNQRNFNKTIKYACRKTLADK  622
            G     ++P++   E  + K+G+ S E+RK++I RY+KKRN+RNF+K IKYACRKTLAD 
Sbjct  279  GGSSATLTPEISNLEDSSFKVGKLSVEQRKEKINRYMKKRNERNFSKKIKYACRKTLADS  338

Query  623  RVRVRGRFAKNNEICgdgdgdddIVIKSRDNNIIVHQTKDL  745
            R RVRGRFAKN++                ++ I+V    D+
Sbjct  339  RPRVRGRFAKNDDFGETNRTTSSNHEDDDEDEIVVKDEDDM  379



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2785043752688