BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c39193_g1_i1 len=740 path=[718:0-739]

Length=740
                                                                      Score     E

ref|XP_009766670.1|  PREDICTED: uncharacterized protein LOC104217992    102   1e-23   
ref|XP_011072685.1|  PREDICTED: uncharacterized protein LOC105157879  96.3    4e-21   
ref|XP_009601609.1|  PREDICTED: uncharacterized protein LOC104096...  94.4    4e-20   
ref|XP_009596387.1|  PREDICTED: uncharacterized protein LOC104092481  92.4    8e-20   
ref|XP_006342899.1|  PREDICTED: uncharacterized protein LOC102589409  90.5    4e-19   
ref|XP_009601610.1|  PREDICTED: uncharacterized protein LOC104096...  90.9    8e-19   
emb|CDO97795.1|  unnamed protein product                              88.2    3e-18   
ref|XP_006362101.1|  PREDICTED: uncharacterized protein LOC102588314  84.7    6e-17   
ref|XP_004252626.1|  PREDICTED: uncharacterized protein LOC101252260  83.2    2e-16   
ref|XP_006362100.1|  PREDICTED: uncharacterized protein LOC102587782  83.2    2e-16   
ref|XP_010542354.1|  PREDICTED: uncharacterized protein LOC104815...  82.0    5e-16   
ref|XP_004235531.1|  PREDICTED: uncharacterized protein LOC101247199  81.3    9e-16   
ref|XP_002265894.1|  PREDICTED: uncharacterized protein LOC100258290  81.6    9e-16   Vitis vinifera
ref|XP_004252627.1|  PREDICTED: uncharacterized protein LOC101252564  80.1    2e-15   
ref|XP_010552185.1|  PREDICTED: uncharacterized protein LOC104822615  79.7    4e-15   
gb|KHG15459.1|  LL-diaminopimelate aminotransferase                   79.0    7e-15   
ref|XP_010534980.1|  PREDICTED: uncharacterized protein LOC104810392  78.6    1e-14   
ref|XP_010033657.1|  PREDICTED: uncharacterized protein LOC104422...  78.2    1e-14   
emb|CBI35799.3|  unnamed protein product                              77.8    1e-14   
ref|XP_007024764.1|  Uncharacterized protein TCM_029245               79.0    1e-14   
ref|XP_004510568.1|  PREDICTED: uncharacterized protein LOC101515...  78.2    1e-14   
ref|XP_010033656.1|  PREDICTED: uncharacterized protein LOC104422...  77.8    2e-14   
ref|XP_003627446.1|  hypothetical protein MTR_8g023100                76.3    5e-14   
ref|XP_011048618.1|  PREDICTED: uncharacterized protein LOC105142607  76.3    6e-14   
ref|XP_004141732.1|  PREDICTED: uncharacterized protein LOC101211901  75.5    2e-13   
ref|XP_004155895.1|  PREDICTED: uncharacterized LOC101211901          75.1    2e-13   
gb|EYU21276.1|  hypothetical protein MIMGU_mgv1a018391mg              73.6    2e-13   
ref|XP_010096541.1|  hypothetical protein L484_017995                 73.9    4e-13   
ref|XP_006369086.1|  hypothetical protein POPTR_0001s16330g           73.9    5e-13   
ref|XP_004510567.1|  PREDICTED: uncharacterized protein LOC101515...  73.6    6e-13   
ref|XP_008462240.1|  PREDICTED: uncharacterized protein LOC103500644  73.2    9e-13   
ref|XP_010465320.1|  PREDICTED: uncharacterized protein LOC104745702  70.9    5e-12   
ref|XP_010542355.1|  PREDICTED: uncharacterized protein LOC104815...  70.5    6e-12   
gb|KDP40632.1|  hypothetical protein JCGZ_24631                       69.3    6e-12   
ref|XP_010487227.1|  PREDICTED: uncharacterized protein LOC104765242  70.5    8e-12   
ref|XP_002304254.1|  hypothetical protein POPTR_0003s07000g           69.7    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011036543.1|  PREDICTED: uncharacterized protein LOC105134011  69.7    1e-11   
ref|XP_007135366.1|  hypothetical protein PHAVU_010G123400g           68.9    2e-11   
ref|XP_002885030.1|  hypothetical protein ARALYDRAFT_478845           68.9    3e-11   
ref|NP_188045.1|  uncharacterized protein                             68.9    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501822.1|  PREDICTED: uncharacterized protein LOC104779131  68.9    3e-11   
ref|XP_006407096.1|  hypothetical protein EUTSA_v10021716mg           68.6    3e-11   
ref|NP_001237403.1|  uncharacterized protein LOC100306604             68.6    4e-11   
ref|XP_002532950.1|  conserved hypothetical protein                   68.2    4e-11   Ricinus communis
ref|XP_007139065.1|  hypothetical protein PHAVU_009G261900g           68.2    5e-11   
ref|NP_001057042.1|  Os06g0193300                                     67.4    6e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ36118.1|  hypothetical protein OsJ_20429                        67.8    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010542356.1|  PREDICTED: uncharacterized protein LOC104815...  66.2    1e-10   
ref|XP_006465808.1|  PREDICTED: uncharacterized protein LOC102621516  67.0    1e-10   
gb|KDO53775.1|  hypothetical protein CISIN_1g032725mg                 67.0    1e-10   
ref|XP_006426794.1|  hypothetical protein CICLE_v10026732mg           67.0    1e-10   
gb|KHN01472.1|  hypothetical protein glysoja_009678                   67.0    1e-10   
emb|CDY33236.1|  BnaC01g37090D                                        66.6    1e-10   
ref|XP_007215134.1|  hypothetical protein PRUPE_ppa013099mg           66.6    2e-10   
ref|XP_010685215.1|  PREDICTED: uncharacterized protein LOC104899...  66.2    2e-10   
ref|XP_010029510.1|  PREDICTED: uncharacterized protein LOC104419...  65.9    3e-10   
ref|XP_010029509.1|  PREDICTED: uncharacterized protein LOC104419...  65.9    3e-10   
ref|XP_004303753.1|  PREDICTED: uncharacterized protein LOC101293323  65.9    3e-10   
ref|XP_006298666.1|  hypothetical protein CARUB_v10014757mg           66.2    3e-10   
ref|XP_002438002.1|  hypothetical protein SORBIDRAFT_10g006240        66.2    3e-10   Sorghum bicolor [broomcorn]
ref|NP_001238687.1|  uncharacterized protein LOC100527099             65.5    4e-10   
ref|XP_009117044.1|  PREDICTED: uncharacterized protein LOC103842171  65.5    5e-10   
ref|XP_008380737.1|  PREDICTED: uncharacterized protein LOC103443...  65.5    5e-10   
gb|EAY99992.1|  hypothetical protein OsI_21995                        65.1    5e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_009357939.1|  PREDICTED: uncharacterized protein LOC103948619  64.7    7e-10   
ref|XP_009146387.1|  PREDICTED: uncharacterized protein LOC103870042  64.7    9e-10   
ref|XP_008649181.1|  PREDICTED: uncharacterized protein LOC103629869  65.1    1e-09   
ref|XP_009406683.1|  PREDICTED: uncharacterized protein LOC103989537  63.9    1e-09   
gb|AFK47958.1|  unknown                                               64.3    1e-09   
emb|CDX97563.1|  BnaA05g25160D                                        63.9    1e-09   
gb|KFK38795.1|  hypothetical protein AALP_AA3G161300                  63.5    2e-09   
ref|XP_008228109.1|  PREDICTED: uncharacterized protein LOC103327...  63.5    2e-09   
ref|XP_008380738.1|  PREDICTED: uncharacterized protein LOC103443...  62.8    5e-09   
ref|XP_004980535.1|  PREDICTED: uncharacterized protein LOC101765926  62.0    7e-09   
emb|CDX98440.1|  BnaC05g39350D                                        62.0    8e-09   
gb|KEH24665.1|  hypothetical protein MTR_7g117550                     62.0    9e-09   
ref|XP_010273818.1|  PREDICTED: uncharacterized protein LOC104609259  61.6    1e-08   
ref|XP_004959573.1|  PREDICTED: uncharacterized protein LOC101774676  61.6    2e-08   
ref|XP_010227912.1|  PREDICTED: uncharacterized protein LOC100841409  60.5    3e-08   
ref|XP_004964604.1|  PREDICTED: uncharacterized protein LOC101755809  60.8    3e-08   
ref|NP_001237677.1|  uncharacterized protein LOC100305853             60.1    3e-08   
gb|EMT02530.1|  hypothetical protein F775_26485                       60.1    4e-08   
dbj|BAH56984.1|  AT3G14280                                            58.9    5e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAK52112.1|AC079936_8  Unknown protein                             59.3    6e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452933.1|  hypothetical protein SORBIDRAFT_04g035190        58.5    9e-08   Sorghum bicolor [broomcorn]
dbj|BAJ92461.1|  predicted protein                                    58.9    1e-07   
ref|XP_004983102.1|  PREDICTED: uncharacterized protein LOC101785497  58.9    1e-07   
ref|XP_006655873.1|  PREDICTED: uncharacterized protein LOC102704708  58.5    1e-07   
ref|XP_006648017.1|  PREDICTED: uncharacterized protein LOC102714...  58.5    1e-07   
ref|XP_004954147.1|  PREDICTED: uncharacterized protein LOC101754780  58.2    1e-07   
ref|NP_001048321.1|  Os02g0782900                                     58.2    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003521838.1|  PREDICTED: uncharacterized protein LOC100798487  58.2    2e-07   
gb|EEC66878.1|  hypothetical protein OsI_33419                        57.4    2e-07   Oryza sativa Indica Group [Indian rice]
gb|KEH24666.1|  hypothetical protein MTR_7g117550                     57.8    2e-07   
gb|EEE50895.1|  hypothetical protein OsJ_31387                        57.4    2e-07   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ94274.1|  predicted protein                                    55.8    3e-07   
ref|XP_004964605.1|  PREDICTED: uncharacterized protein LOC101757283  57.0    3e-07   
dbj|BAD19538.1|  unknown protein                                      57.0    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008812395.1|  PREDICTED: uncharacterized protein LOC103723293  57.4    3e-07   
ref|NP_001176137.1|  Os10g0390650                                     57.4    3e-07   
gb|ABK22155.1|  unknown                                               57.0    6e-07   Picea sitchensis
ref|XP_009413992.1|  PREDICTED: uncharacterized protein LOC103995...  56.2    8e-07   
ref|XP_009413993.1|  PREDICTED: uncharacterized protein LOC103995...  55.8    8e-07   
ref|XP_010685216.1|  PREDICTED: uncharacterized protein LOC104899...  55.5    9e-07   
ref|NP_001145551.1|  uncharacterized protein LOC100279003             55.8    1e-06   Zea mays [maize]
gb|EMS66016.1|  hypothetical protein TRIUR3_07394                     55.5    1e-06   
gb|EMT08498.1|  hypothetical protein F775_20430                       55.5    2e-06   
ref|XP_006828630.1|  hypothetical protein AMTR_s00129p00089860        55.1    2e-06   
ref|XP_008228110.1|  PREDICTED: uncharacterized protein LOC103327...  55.1    2e-06   
dbj|BAK00366.1|  predicted protein                                    54.7    3e-06   
ref|XP_006661737.1|  PREDICTED: uncharacterized protein LOC102705562  55.1    3e-06   
ref|XP_004144478.1|  PREDICTED: uncharacterized protein LOC101216011  53.1    1e-05   
ref|XP_008797356.1|  PREDICTED: uncharacterized protein LOC103712576  52.4    2e-05   
ref|XP_010240360.1|  PREDICTED: uncharacterized protein LOC100823...  52.0    2e-05   
ref|XP_010932337.1|  PREDICTED: uncharacterized protein LOC105053035  52.0    3e-05   
ref|XP_003580496.2|  PREDICTED: uncharacterized protein LOC100823...  51.6    3e-05   
ref|XP_009407255.1|  PREDICTED: uncharacterized protein LOC103989994  52.4    3e-05   
ref|XP_010917374.1|  PREDICTED: uncharacterized protein LOC105041...  51.6    4e-05   
ref|XP_010917375.1|  PREDICTED: uncharacterized protein LOC105041...  50.8    4e-05   
ref|XP_004166922.1|  PREDICTED: uncharacterized protein LOC101225558  50.8    5e-05   
ref|XP_001779822.1|  predicted protein                                49.7    3e-04   
ref|XP_001780996.1|  predicted protein                                49.3    3e-04   
ref|XP_001762738.1|  predicted protein                                48.9    4e-04   
ref|XP_008460346.1|  PREDICTED: uncharacterized protein LOC103499...  48.5    5e-04   
ref|XP_008460345.1|  PREDICTED: uncharacterized protein LOC103499...  48.1    6e-04   



>ref|XP_009766670.1| PREDICTED: uncharacterized protein LOC104217992 [Nicotiana sylvestris]
Length=124

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 70/98 (71%), Gaps = 6/98 (6%)
 Frame = -2

Query  535  VMMRASNHHDSIN---SSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYD  365
            V++R+SNH  SI     +TSPL   GSPS++ ++KV+E+ S G+VCYRD NGEI CEGYD
Sbjct  28   VLVRSSNHKSSIKLARDTTSPLQI-GSPSNQ-KLKVFEDQSTGIVCYRDANGEITCEGYD  85

Query  364  EGPRLDCHQVSSFSCNSRVAEMVDLLERSWLKVEERKE  251
            EGPR  C Q+  FS NSR  E+++LL+R WL + +  E
Sbjct  86   EGPRF-CQQLPRFSSNSRDEEIIELLQRCWLHIADSAE  122



>ref|XP_011072685.1| PREDICTED: uncharacterized protein LOC105157879 [Sesamum indicum]
Length=140

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 63/95 (66%), Gaps = 6/95 (6%)
 Frame = -2

Query  535  VMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGP  356
            ++M A NHH S     S +H     S  +R KV+E+ S G+VCY+DENGEI CEGYDEGP
Sbjct  29   LVMCAGNHHIS-----SSVHLRIKSSDHHRTKVFEDRSAGIVCYKDENGEITCEGYDEGP  83

Query  355  RLDCHQVSSFSCNSRVAEMVDLLERSWLKVEERKE  251
            R    Q+S F+CNSR  E++D+L+R WL V +  E
Sbjct  84   RFH-QQISRFTCNSRDVEIIDMLQRCWLHVGDENE  117



>ref|XP_009601609.1| PREDICTED: uncharacterized protein LOC104096865 isoform X1 [Nicotiana 
tomentosiformis]
Length=164

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 78/139 (56%), Gaps = 13/139 (9%)
 Frame = -2

Query  637  MFLAAMSSLLPSPVSSIFSSTGFIRKGRSVGRA-----LVMMRASNHHDSINSST-----  488
             FL   SSL    V+   S+   I K  S  R       V +RAS H+ SI+ ST     
Sbjct  29   FFLPFFSSLGSMAVTYSLSAPILINKSSSTARTSLSAHRVEVRASCHNISIHVSTTTTTT  88

Query  487  SPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRV  308
            SPL    +  S+NR+ V+E+ S GV+CY+DENGEI CEGYDEGPR  C QV   S  SR 
Sbjct  89   SPLQIGST--SRNRLVVFEDKSTGVICYKDENGEITCEGYDEGPRF-CQQVPKSSYKSRD  145

Query  307  AEMVDLLERSWLKVEERKE  251
             E+++LL++ WL +    E
Sbjct  146  EEIIELLQKCWLHIAAAAE  164



>ref|XP_009596387.1| PREDICTED: uncharacterized protein LOC104092481 [Nicotiana tomentosiformis]
Length=124

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = -2

Query  535  VMMRASNHHDSIN-SSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEG  359
            V++R+SNH+ SI  +  +  H     SS  ++KV+E+ S G+VCYRD NGEI CEGYDEG
Sbjct  28   VLVRSSNHNPSIKLARDTSSHLQIRSSSNKKLKVFEDRSTGIVCYRDANGEITCEGYDEG  87

Query  358  PRLDCHQVSSFSCNSRVAEMVDLLERSWLKVEERKE  251
            PR  C Q+  FS NSR  E+++LL+  WL V +  E
Sbjct  88   PRY-CQQLPRFSSNSRDEEIIELLQICWLHVADSAE  122



>ref|XP_006342899.1| PREDICTED: uncharacterized protein LOC102589409 [Solanum tuberosum]
Length=124

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 63/96 (66%), Gaps = 5/96 (5%)
 Frame = -2

Query  538  LVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEG  359
            LV   AS+ + SI  +   + +  +P    ++K++E+ S G+VCYRDENGEI CEGYDEG
Sbjct  32   LVYSCASDQNISIKPTALQIRSTSTP----KLKIFEDESTGIVCYRDENGEITCEGYDEG  87

Query  358  PRLDCHQVSSFSCNSRVAEMVDLLERSWLKVEERKE  251
            PR  C Q++ F  NSR  E+++LL+R WL V +  E
Sbjct  88   PRY-CQQLTRFCSNSRDEEIIELLQRCWLHVTDSAE  122



>ref|XP_009601610.1| PREDICTED: uncharacterized protein LOC104096865 isoform X2 [Nicotiana 
tomentosiformis]
Length=163

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 78/139 (56%), Gaps = 14/139 (10%)
 Frame = -2

Query  637  MFLAAMSSLLPSPVSSIFSSTGFIRKGRSVGRA-----LVMMRASNHHDSINSST-----  488
             FL   SSL    V+   S+   I K  S  R       V +RAS H+ SI+ ST     
Sbjct  29   FFLPFFSSLGSMAVTYSLSAPILINKSSSTARTSLSAHRVEVRASCHNISIHVSTTTTTT  88

Query  487  SPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRV  308
            SPL    +  S+NR+ V+E+ S GV+CY+DENGEI CEGYDEGPR  C QV   S  SR 
Sbjct  89   SPLQIGST--SRNRL-VFEDKSTGVICYKDENGEITCEGYDEGPRF-CQQVPKSSYKSRD  144

Query  307  AEMVDLLERSWLKVEERKE  251
             E+++LL++ WL +    E
Sbjct  145  EEIIELLQKCWLHIAAAAE  163



>emb|CDO97795.1| unnamed protein product [Coffea canephora]
Length=122

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 6/95 (6%)
 Frame = -2

Query  541  ALVMMRASNHHDSINSSTSPLHTAG-SPSSKNRIKVYENLSEGVVCYRDENGEIICEGYD  365
            ++VMM A NH  S+NS+ S + T      S  R KV+E+ S G+VCYR+ENGEI CEG D
Sbjct  25   SIVMMSAENHI-SVNSTGSSISTTPFQIRSPTRNKVFEDPSNGIVCYREENGEITCEGID  83

Query  364  EGPRLDCHQVSS--FSCNSRVAEMVDLLERSWLKV  266
            EGPRL  H +SS   + N R AE++DLLERS L+V
Sbjct  84   EGPRL--HHLSSRFTAVNQREAEIIDLLERSLLQV  116



>ref|XP_006362101.1| PREDICTED: uncharacterized protein LOC102588314 [Solanum tuberosum]
Length=131

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -2

Query  460  SSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLER  281
            +SKN +KV+E+ S GVVCYRDE GEI CEGYDEGPR  CHQ       SR  E+V+LL+R
Sbjct  62   TSKNELKVFEDKSTGVVCYRDEYGEITCEGYDEGPRF-CHQPPKSPSKSRDEEIVELLQR  120

Query  280  SWLKV  266
             WL +
Sbjct  121  FWLHI  125



>ref|XP_004252626.1| PREDICTED: uncharacterized protein LOC101252260 [Solanum lycopersicum]
Length=120

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -2

Query  460  SSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLER  281
            +SKN +KV+E+ S GVVCYRDE GEI CEGYDEGPR  CHQ       SR  E+V+LL+R
Sbjct  51   TSKNGLKVFEDKSTGVVCYRDEYGEITCEGYDEGPRF-CHQPPKSPSKSRDEEIVELLQR  109

Query  280  SWLKVEE  260
            +W  + +
Sbjct  110  NWFHIAD  116



>ref|XP_006362100.1| PREDICTED: uncharacterized protein LOC102587782 [Solanum tuberosum]
Length=134

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -2

Query  460  SSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLER  281
            +SKN +KV+E+ S GVVCYRDE GEI CEGYDEGPR  CHQ       SR  E+V+LL+R
Sbjct  65   TSKNGLKVFEDRSTGVVCYRDEYGEITCEGYDEGPRF-CHQPPKSPSKSRDEEIVELLQR  123

Query  280  SWLKVEE  260
            +W  + +
Sbjct  124  NWFHIAD  130



>ref|XP_010542354.1| PREDICTED: uncharacterized protein LOC104815599 isoform X1 [Tarenaya 
hassleriana]
Length=136

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  460  SSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLER  281
            S KN  KV+E+L++GVVCYRDENGEIICEGYDEGPR    Q S  +C SR AE++DLL+R
Sbjct  47   SPKN--KVFEDLAQGVVCYRDENGEIICEGYDEGPRC-LPQSSRTACYSREAEILDLLQR  103

Query  280  SWLKV  266
            S+ ++
Sbjct  104  SYQEL  108



>ref|XP_004235531.1| PREDICTED: uncharacterized protein LOC101247199 [Solanum lycopersicum]
Length=126

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 71/116 (61%), Gaps = 8/116 (7%)
 Frame = -2

Query  619  SSLLPSPVSSIFSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIK  440
            SS   +P+  I+ S    R+  +    LV   AS+ + SI  +   + +    +S +++K
Sbjct  6    SSFGAAPL--IWKSCSNKREKHAQRVVLVYSCASDQYISIKPTALQIRS----TSTSKLK  59

Query  439  VYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSR-VAEMVDLLERSW  275
            ++E+ S G+VCYRDENGEI CEGYDEGPR  C Q++ F  NSR   E+++LL+R W
Sbjct  60   IFEDESTGIVCYRDENGEITCEGYDEGPRY-CQQLTRFCSNSRGDEEIIELLQRCW  114



>ref|XP_002265894.1| PREDICTED: uncharacterized protein LOC100258290 [Vitis vinifera]
 emb|CAN62135.1| hypothetical protein VITISV_043719 [Vitis vinifera]
Length=133

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 67/106 (63%), Gaps = 7/106 (7%)
 Frame = -2

Query  556  RSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIIC  377
            R VGR +VM+    H   ++        A    S  R KV+E+ S+G+VCYRD+ GEI+C
Sbjct  21   RPVGRIMVML---EHRSQVSVRKI---AALEIKSSFRNKVFEDQSKGIVCYRDDKGEIVC  74

Query  376  EGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSWLKVEERKEQLMG  239
            EGYDEGPRL  H++   + + R AE++DLL+++WL++ +  E  +G
Sbjct  75   EGYDEGPRLH-HELQRKNYHPRDAEIIDLLQQNWLQIVKGDEVAVG  119



>ref|XP_004252627.1| PREDICTED: uncharacterized protein LOC101252564 [Solanum lycopersicum]
Length=121

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -2

Query  460  SSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLER  281
            +SKN +KV+E+ S GVV YRDE GEI CEGYDEGPR  CHQ       SR  E+V+LL+R
Sbjct  52   TSKNGLKVFEDKSTGVVFYRDEYGEITCEGYDEGPRF-CHQTPKSPSKSRDEEIVELLQR  110

Query  280  SWLKVEE  260
            +W  + +
Sbjct  111  NWFHIAD  117



>ref|XP_010552185.1| PREDICTED: uncharacterized protein LOC104822615 [Tarenaya hassleriana]
Length=140

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 5/81 (6%)
 Frame = -2

Query  460  SSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLER  281
            S KN  KV+E+  +G+VCYRD+NGEIICEGYDEGPR    Q+S  +C SR AE++DLL+R
Sbjct  51   SPKN--KVFEDPVQGIVCYRDDNGEIICEGYDEGPRC-LPQISRIACYSREAEILDLLQR  107

Query  280  SWLKVEE--RKEQLMGEKMMG  224
            S+ ++ +  R  Q M     G
Sbjct  108  SYQQLIDSGRNHQQMPSPQQG  128



>gb|KHG15459.1| LL-diaminopimelate aminotransferase [Gossypium arboreum]
Length=131

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = -2

Query  535  VMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGP  356
            + M   NH     SST  + +     SKN   V+E+ SEGV+CYRDENGEI+CEGYDEGP
Sbjct  29   IFMLKHNHDPGKKSSTFQMRSF----SKN--TVFEDQSEGVICYRDENGEIVCEGYDEGP  82

Query  355  RLDCHQVSSFSCNSRVAEMVDLLERSWLKV  266
            R    Q+   S + R AE++D+L   WL++
Sbjct  83   RFP-RQIPGKSYHLRDAEILDILRHRWLQI  111



>ref|XP_010534980.1| PREDICTED: uncharacterized protein LOC104810392 [Tarenaya hassleriana]
Length=141

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 58/97 (60%), Gaps = 4/97 (4%)
 Frame = -2

Query  556  RSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIIC  377
            +SV R   M++ S       + + P     SP +K    V+E+  EG+VCYRD NGEI+C
Sbjct  21   KSVRRTTSMLQQSRLQVKKVAVSRPQSIRFSPKNK----VFEDPVEGIVCYRDGNGEIVC  76

Query  376  EGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSWLKV  266
            EGYDEGPR         +C SR AE++DLL+RS+ ++
Sbjct  77   EGYDEGPRYLPQSSRVIACYSREAEILDLLQRSYQQL  113



>ref|XP_010033657.1| PREDICTED: uncharacterized protein LOC104422895 isoform X2 [Eucalyptus 
grandis]
Length=130

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 71/118 (60%), Gaps = 16/118 (14%)
 Frame = -2

Query  604  SPVSSIFSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIK--VYE  431
            SP   ++ S+   R+   VG   + MR          S  P++   +  +++ +K  V+E
Sbjct  8    SPRIILWDSSQITRR---VGSVAMFMR----------SRIPVNRVTAVRTRSSLKNQVFE  54

Query  430  NLSEGVVCYRDENGEIICEGYDEGPRLDCHQV-SSFSCNSRVAEMVDLLERSWLKVEE  260
            +  EG+VCYRDE+GEIICEGYDEGPR     + +++   +R AE++DLL+R+WL++ E
Sbjct  55   DQCEGIVCYRDESGEIICEGYDEGPRFGRKILRTTYRYEARDAEIIDLLQRNWLQIAE  112



>emb|CBI35799.3| unnamed protein product [Vitis vinifera]
Length=105

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -2

Query  448  RIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSWLK  269
            R KV+E+ S+G+VCYRD+ GEI+CEGYDEGPRL  H++   + + R AE++DLL+++WL+
Sbjct  23   RNKVFEDQSKGIVCYRDDKGEIVCEGYDEGPRLH-HELQRKNYHPRDAEIIDLLQQNWLQ  81

Query  268  VEERKEQLMG  239
            + +  E  +G
Sbjct  82   IVKGDEVAVG  91



>ref|XP_007024764.1| Uncharacterized protein TCM_029245 [Theobroma cacao]
 gb|EOY27386.1| Uncharacterized protein TCM_029245 [Theobroma cacao]
Length=171

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -2

Query  457  SKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERS  278
            SKN  KV+E+ SEGV+CYRDENGEI+CEGYDEGPR    Q+    C+   AE++DLL+  
Sbjct  81   SKN--KVFEDQSEGVICYRDENGEIVCEGYDEGPRFP-RQIHGSFCHLSDAEILDLLQDR  137

Query  277  WLKV  266
            WL++
Sbjct  138  WLQI  141



>ref|XP_004510568.1| PREDICTED: uncharacterized protein LOC101515722 isoform X2 [Cicer 
arietinum]
Length=132

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 66/105 (63%), Gaps = 4/105 (4%)
 Frame = -2

Query  535  VMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGP  356
            ++M   ++     SS  P+    + S KN  KVYE+ S+G++CY+DE+GEIICEGYDEGP
Sbjct  26   LLMSKRSYAPHKKSSIGPVVLRITASIKN--KVYEDESQGIICYQDESGEIICEGYDEGP  83

Query  355  RLDCHQVSSFSCNSRVAEMVDLLERSWLKVEERKEQLMGEKMMGC  221
                 Q+S  + N R AE+++LL++SW ++  R E++      GC
Sbjct  84   SYK--QISRPTHNPRDAEIINLLKQSWSQIIARGEEIDHAIEDGC  126



>ref|XP_010033656.1| PREDICTED: uncharacterized protein LOC104422895 isoform X1 [Eucalyptus 
grandis]
Length=133

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = -2

Query  460  SSKNRI-KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQV-SSFSCNSRVAEMVDLL  287
            S KN++  V+E+  EG+VCYRDE+GEIICEGYDEGPR     + +++   +R AE++DLL
Sbjct  47   SLKNQVHTVFEDQCEGIVCYRDESGEIICEGYDEGPRFGRKILRTTYRYEARDAEIIDLL  106

Query  286  ERSWLKVEE  260
            +R+WL++ E
Sbjct  107  QRNWLQIAE  115



>ref|XP_003627446.1| hypothetical protein MTR_8g023100 [Medicago truncatula]
 gb|ACJ85936.1| unknown [Medicago truncatula]
 gb|AET01922.1| hypothetical protein MTR_8g023100 [Medicago truncatula]
 gb|AFK45628.1| unknown [Medicago truncatula]
Length=133

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 58/82 (71%), Gaps = 3/82 (4%)
 Frame = -2

Query  496  SSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCN  317
            S+  P+    + S KN++ VYE+ S+G++CY+DE+GEIICEGYDEGP     Q+S  + +
Sbjct  40   STVGPVLLKITASIKNKV-VYEDESQGIICYQDESGEIICEGYDEGPSY--RQISRPTHH  96

Query  316  SRVAEMVDLLERSWLKVEERKE  251
             R  E+V+LL++SW ++ + KE
Sbjct  97   QRDVEIVNLLKQSWFQIAKGKE  118



>ref|XP_011048618.1| PREDICTED: uncharacterized protein LOC105142607 [Populus euphratica]
Length=140

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = -2

Query  556  RSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIIC  377
            + V R L++ R S+H     + T P+ +    S K ++ V+EN +EG+VCYRDE+GEIIC
Sbjct  21   KPVSRILMLQRNSSHVPLKKAPTLPVRS----SLKAKL-VFENRAEGIVCYRDESGEIIC  75

Query  376  EGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSWLKV  266
            EG+DEGPR   H   S S + R AE+++LL++  L++
Sbjct  76   EGFDEGPRFHQHLRCS-SYHPRDAEIINLLQQRLLQI  111



>ref|XP_004141732.1| PREDICTED: uncharacterized protein LOC101211901 [Cucumis sativus]
 gb|KGN45439.1| hypothetical protein Csa_7G448010 [Cucumis sativus]
Length=144

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQ-VSSFSCNSRVAEMVD-LLERSWLK  269
            KV+E+ SEGV+CY DENGEIICEGYDEGPR   HQ VS    N R AE++D LL+++W++
Sbjct  56   KVFEDQSEGVICYADENGEIICEGYDEGPRF--HQNVSEKGNNQREAEIIDLLLKQTWIQ  113

Query  268  V  266
            +
Sbjct  114  L  114



>ref|XP_004155895.1| PREDICTED: uncharacterized LOC101211901 [Cucumis sativus]
Length=145

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 4/61 (7%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQ-VSSFSCNSRVAEMVD-LLERSWLK  269
            KV+E+ SEGV+CY DENGEIICEGYDEGPR   HQ VS    N R AE++D LL+++W++
Sbjct  57   KVFEDQSEGVICYADENGEIICEGYDEGPRF--HQNVSERGNNQREAEIIDLLLKQTWIQ  114

Query  268  V  266
            +
Sbjct  115  L  115



>gb|EYU21276.1| hypothetical protein MIMGU_mgv1a018391mg, partial [Erythranthe 
guttata]
Length=92

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 9/74 (12%)
 Frame = -2

Query  535  VMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGP  356
            ++M +SN+H S+N            S   + KV+E+ S G+VCY+DENGEI+CEGYDEGP
Sbjct  28   LLMCSSNNHVSVNLQIR--------SFDRKNKVFEDRSAGIVCYKDENGEIVCEGYDEGP  79

Query  355  RLDCHQVSSFSCNS  314
            R   HQ+S F+CNS
Sbjct  80   RFH-HQISRFTCNS  92



>ref|XP_010096541.1| hypothetical protein L484_017995 [Morus notabilis]
 gb|EXB64661.1| hypothetical protein L484_017995 [Morus notabilis]
Length=144

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 67/120 (56%), Gaps = 8/120 (7%)
 Frame = -2

Query  631  LAAMSSLLPSPVSSIFSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSK  452
            +A      P+ + S   S+  I+    + + L +    N+   +  + +PL      +S 
Sbjct  1    MALTCDFSPTKIISAEKSSLIIK---PISKVLRLKHRYNNIPVLKKTVTPLKI----TSS  53

Query  451  NRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSWL  272
             + KV+E+ S G++CY DE+GEI+CEGYDEGPR    Q+   S +SR +EM D+L++ W+
Sbjct  54   FKEKVFEDRSNGIICYADESGEIVCEGYDEGPRYH-QQIQRKSSHSRDSEMFDILQQRWI  112



>ref|XP_006369086.1| hypothetical protein POPTR_0001s16330g [Populus trichocarpa]
 gb|ERP65655.1| hypothetical protein POPTR_0001s16330g [Populus trichocarpa]
Length=140

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 6/97 (6%)
 Frame = -2

Query  556  RSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIIC  377
            +   R L++ R  +H     + T P+      SS     V+EN +EG+VCYRDE+GEIIC
Sbjct  21   KPASRILMLQRNRSHVPLKKAPTLPVR-----SSLQAKLVFENRAEGIVCYRDESGEIIC  75

Query  376  EGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSWLKV  266
            EG+DEGPR    Q+   S + R AE+++LL++  L++
Sbjct  76   EGFDEGPRFH-QQLQCSSYHPRDAEIINLLQQRLLQI  111



>ref|XP_004510567.1| PREDICTED: uncharacterized protein LOC101515722 isoform X1 [Cicer 
arietinum]
Length=134

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 66/107 (62%), Gaps = 6/107 (6%)
 Frame = -2

Query  535  VMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGP  356
            ++M   ++     SS  P+    + S KN  KVYE+ S+G++CY+DE+GEIICEGYDEGP
Sbjct  26   LLMSKRSYAPHKKSSIGPVVLRITASIKN--KVYEDESQGIICYQDESGEIICEGYDEGP  83

Query  355  RLDCHQVSSFSCNSRV--AEMVDLLERSWLKVEERKEQLMGEKMMGC  221
                 Q+S  + N  V  AE+++LL++SW ++  R E++      GC
Sbjct  84   SYK--QISRPTHNPSVRDAEIINLLKQSWSQIIARGEEIDHAIEDGC  128



>ref|XP_008462240.1| PREDICTED: uncharacterized protein LOC103500644 [Cucumis melo]
Length=146

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQ-VSSFSCNSRVAEMVD-LLERSWLK  269
            KV+E+ SEGV+CY DENGEIICEGYDEGPR   HQ VS    + R  E++D LL++SW++
Sbjct  58   KVFEDQSEGVICYADENGEIICEGYDEGPRF--HQNVSEKGNHQRETEIIDLLLKQSWIQ  115

Query  268  V  266
            +
Sbjct  116  L  116



>ref|XP_010465320.1| PREDICTED: uncharacterized protein LOC104745702 [Camelina sativa]
Length=143

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 58/82 (71%), Gaps = 11/82 (13%)
 Frame = -2

Query  460  SSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPR--LDCHQVSSFSCNSRVAEMVDLL  287
            S+KN   V+E+ ++G++CY D+NGE+ICEGYDEGPR    C  V+S+   SR  E++DLL
Sbjct  53   STKN--TVFEDPTQGIICYTDDNGEVICEGYDEGPRCPTQCPMVASY---SREVEILDLL  107

Query  286  ERSWLKV----EERKEQLMGEK  233
            +RS+ ++    ++ +EQ++  K
Sbjct  108  QRSYQELSGAEKDGQEQMIASK  129



>ref|XP_010542355.1| PREDICTED: uncharacterized protein LOC104815599 isoform X2 [Tarenaya 
hassleriana]
Length=125

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 3/56 (5%)
 Frame = -2

Query  460  SSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVD  293
            S KN  KV+E+L++GVVCYRDENGEIICEGYDEGPR    Q S  +C S   E++D
Sbjct  47   SPKN--KVFEDLAQGVVCYRDENGEIICEGYDEGPRC-LPQSSRTACYSSYQELID  99



>gb|KDP40632.1| hypothetical protein JCGZ_24631 [Jatropha curcas]
Length=89

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -2

Query  439  VYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSWLKV  266
            V+EN SEG++CYRD++GEIICEG+DEGPR   H +   + NSR AE+++LL++  + V
Sbjct  2    VFENKSEGIICYRDDSGEIICEGFDEGPRFH-HHLPRTAYNSRDAEIINLLQQRLIHV  58



>ref|XP_010487227.1| PREDICTED: uncharacterized protein LOC104765242 [Camelina sativa]
Length=143

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 54/75 (72%), Gaps = 9/75 (12%)
 Frame = -2

Query  439  VYENLSEGVVCYRDENGEIICEGYDEGPR--LDCHQVSSFSCNSRVAEMVDLLERSWLKV  266
            V+E+ ++G++CY D+NGE+ICEGYDEGPR    C  V+S+   SR  E++DLL+RS+ ++
Sbjct  58   VFEDPTQGIICYTDDNGEVICEGYDEGPRCPTQCPMVASY---SREVEILDLLQRSYQEL  114

Query  265  ----EERKEQLMGEK  233
                ++ +EQ++  K
Sbjct  115  SGAEKDGQEQIIASK  129



>ref|XP_002304254.1| hypothetical protein POPTR_0003s07000g [Populus trichocarpa]
 gb|EEE79233.1| hypothetical protein POPTR_0003s07000g [Populus trichocarpa]
Length=138

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQ-VSSFSCNSRVAEMVDLLERSWLKV  266
            KV+EN +EG+VCYRD++GEIICEG+DEGPR   HQ + S S +SR AE+++LL++   ++
Sbjct  52   KVFENQAEGIVCYRDDSGEIICEGFDEGPRF--HQPLPSSSYHSRDAEIINLLKQGLHQI  109



>ref|XP_011036543.1| PREDICTED: uncharacterized protein LOC105134011 [Populus euphratica]
 ref|XP_011015186.1| PREDICTED: uncharacterized protein LOC105118835 [Populus euphratica]
Length=138

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQ-VSSFSCNSRVAEMVDLLERSWLKV  266
            KV+EN +EG+VCYRD++GEIICEG+DEGPR   HQ + S + +SR AE+++LL++   ++
Sbjct  52   KVFENQAEGIVCYRDDSGEIICEGFDEGPRF--HQPLPSSAYHSRDAEIINLLQQGLHQI  109



>ref|XP_007135366.1| hypothetical protein PHAVU_010G123400g [Phaseolus vulgaris]
 gb|ESW07360.1| hypothetical protein PHAVU_010G123400g [Phaseolus vulgaris]
Length=138

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLL-ERSWLKV  266
            K+YE+ S+G++CY DE+GEIICEGYDEGPR   H++ S + + R  E+++L+ ++SWL++
Sbjct  55   KIYEDKSQGIICYEDESGEIICEGYDEGPRY--HRIPSPTHHPRDVEIMNLVQQQSWLQI  112



>ref|XP_002885030.1| hypothetical protein ARALYDRAFT_478845 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61289.1| hypothetical protein ARALYDRAFT_478845 [Arabidopsis lyrata subsp. 
lyrata]
Length=141

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 62/104 (60%), Gaps = 7/104 (7%)
 Frame = -2

Query  556  RSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIIC  377
            ++V     M++ S  H ++   T         S+KN   V+E+ ++G++CY D+NGE+IC
Sbjct  19   KTVRSKTWMLQQSQVHVNVKQVTVSQPQPIRYSTKN--TVFEDPTQGIICYTDDNGEVIC  76

Query  376  EGYDEGPRLDCH--QVSSFSCNSRVAEMVDLLERSWLKVEERKE  251
            EGYDEGPR       V+S+   SR  E++DLL+RS+ ++   K+
Sbjct  77   EGYDEGPRCPTQSPMVASY---SREVEILDLLQRSYQELSNSKK  117



>ref|NP_188045.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB01034.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAP37666.1| At3g14280 [Arabidopsis thaliana]
 dbj|BAE99662.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75497.1| uncharacterized protein AT3G14280 [Arabidopsis thaliana]
Length=141

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = -2

Query  556  RSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIIC  377
            ++V    +M++ S  H  +  +T         S+KN   V+E+  +G++CY D+NGE+IC
Sbjct  19   KTVRAKTLMLQQSQVHVKVKKATVSQPQPIRYSTKN--IVFEDPIQGIICYTDDNGEVIC  76

Query  376  EGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSW  275
            EGYDEGPR    Q    +  SR  E++DLL+RS+
Sbjct  77   EGYDEGPRCPT-QSPMVASYSREVEILDLLQRSY  109



>ref|XP_010501822.1| PREDICTED: uncharacterized protein LOC104779131 [Camelina sativa]
Length=144

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 66/111 (59%), Gaps = 11/111 (10%)
 Frame = -2

Query  547  GRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGY  368
             + L++++ S     I   T         S+KN   V+E+ ++G++CY D+NGE+ICEGY
Sbjct  25   SKTLMVLQQSQVQVKIKQVTVSQPQPIRYSTKN--TVFEDRTQGIICYTDDNGEVICEGY  82

Query  367  DEGPR--LDCHQVSSFSCNSRVAEMVDLLERSWLKV----EERKEQLMGEK  233
            DEGPR    C  V+S+   SR  E+++LL+RS+ ++    ++ +EQ+   K
Sbjct  83   DEGPRCPTQCPMVASY---SREVEILNLLQRSYQELSGADKDSQEQMSASK  130



>ref|XP_006407096.1| hypothetical protein EUTSA_v10021716mg [Eutrema salsugineum]
 gb|ESQ48549.1| hypothetical protein EUTSA_v10021716mg [Eutrema salsugineum]
Length=144

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 62/106 (58%), Gaps = 7/106 (7%)
 Frame = -2

Query  571  FIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDEN  392
            F+ K   +    +M++ S     +   T         S+KN +  +E+ ++G++CY D+N
Sbjct  16   FVPKTVRLRSKTLMLQQSQIQVKVKQVTDSQPQPIRYSTKNTL--FEDPTQGIICYTDDN  73

Query  391  GEIICEGYDEGPRL--DCHQVSSFSCNSRVAEMVDLLERSWLKVEE  260
            GE+ICEGYDEGPR   +   V+S+   SR  E++DLL+RS+L + +
Sbjct  74   GEVICEGYDEGPRCPPESPMVASY---SREVEILDLLQRSYLDLRD  116



>ref|NP_001237403.1| uncharacterized protein LOC100306604 [Glycine max]
 gb|ACU14867.1| unknown [Glycine max]
Length=139

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDL-LERSWLKV  266
            K+YE+ S+G++CY DE+GEIICEGYDEGPR   H++ S + + R  E+++L  ++SWL++
Sbjct  56   KIYEDQSQGIICYEDESGEIICEGYDEGPRY--HRIPSPTQHPRDVEIMNLQQQQSWLQI  113



>ref|XP_002532950.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29434.1| conserved hypothetical protein [Ricinus communis]
Length=143

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 66/115 (57%), Gaps = 19/115 (17%)
 Frame = -2

Query  589  IFSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVV  410
            +   +G + K RS    + M+R    H  I    +P     S   KN  KV+EN SEG++
Sbjct  12   LLQKSGPVIKPRS--NEIAMLR----HGQIPLKKTPALQVRS--FKN--KVFENQSEGII  61

Query  409  CYRDENGEIICEGYDEGPRLDCHQ-------VSSFSCNSRVAEMVDLLERSWLKV  266
            CYRDENGEIICEG+DEGPR   HQ        SS S +SR AE+++LL +  L+V
Sbjct  62   CYRDENGEIICEGFDEGPRF--HQQLSRTSSSSSPSYDSRDAEIINLLHQRLLQV  114



>ref|XP_007139065.1| hypothetical protein PHAVU_009G261900g [Phaseolus vulgaris]
 gb|ESW11059.1| hypothetical protein PHAVU_009G261900g [Phaseolus vulgaris]
Length=159

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 14/84 (17%)
 Frame = -2

Query  496  SSTSPLHTAGSPSSKNRI------KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQV  335
            S+  P   A S SS  RI      KVYE+ SEG+VCY+DE GEIICEGYDEGP   C Q 
Sbjct  53   STYVPPKRASSSSSVLRITASMKNKVYEDRSEGIVCYQDERGEIICEGYDEGP---CFQR  109

Query  334  SSFSCNSRVAEMVDLLER-SWLKV  266
            +    + R A++ +LL R SWL++
Sbjct  110  N----HPREAQITNLLLRQSWLQI  129



>ref|NP_001057042.1| Os06g0193300 [Oryza sativa Japonica Group]
 dbj|BAD35274.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18956.1| Os06g0193300 [Oryza sativa Japonica Group]
 dbj|BAG88362.1| unnamed protein product [Oryza sativa Japonica Group]
Length=127

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 71/131 (54%), Gaps = 16/131 (12%)
 Frame = -2

Query  631  LAAMSSLLPSPVSSIFSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSK  452
            +AA SSL PS ++SI    G         +A +  RA  H     +S+S L  A + ++K
Sbjct  1    MAARSSLHPSSMASIPRLIG-------TRKAALRFRAPAHG---GTSSSQLSIAAATANK  50

Query  451  NRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCH--QVSSFSCNSRVAEMVDLLERS  278
               KV+E+   G+VCYRD+ GE++CEGYDEGPRL     + + F     V ++ D +E +
Sbjct  51   ---KVFEDQLRGIVCYRDDKGEMVCEGYDEGPRLGMRLPEKACFPWPMEV-QITDFIELA  106

Query  277  WLKVEERKEQL  245
              +V E  + L
Sbjct  107  TFRVFEDADVL  117



>gb|EAZ36118.1| hypothetical protein OsJ_20429 [Oryza sativa Japonica Group]
Length=133

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 56/94 (60%), Gaps = 13/94 (14%)
 Frame = -2

Query  631  LAAMSSLLPSPVSSIFSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSK  452
            +AA SSL PS ++SI    G         +A +  RA  H     +S+S L  A + ++K
Sbjct  1    MAARSSLHPSSMASIPRLIG-------TRKAALRFRAPAHG---GTSSSQLSIAAATANK  50

Query  451  NRIKVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
               KV+E+   G+VCYRD+ GE++CEGYDEGPRL
Sbjct  51   ---KVFEDQLRGIVCYRDDKGEMVCEGYDEGPRL  81



>ref|XP_010542356.1| PREDICTED: uncharacterized protein LOC104815599 isoform X3 [Tarenaya 
hassleriana]
Length=98

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 2/36 (6%)
 Frame = -2

Query  460  SSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPR  353
            S KN  KV+E+L++GVVCYRDENGEIICEGYDEGPR
Sbjct  47   SPKN--KVFEDLAQGVVCYRDENGEIICEGYDEGPR  80



>ref|XP_006465808.1| PREDICTED: uncharacterized protein LOC102621516 [Citrus sinensis]
Length=138

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -2

Query  448  RIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSWLK  269
            + K +E+  EG++CYRDENGE+ICEGYDEGPR    Q+   + + R  E++++L + W +
Sbjct  48   KTKAFEDHFEGIICYRDENGEMICEGYDEGPRFH-QQIPRATFHPRDVEIMNILLQRWHE  106

Query  268  V  266
            +
Sbjct  107  I  107



>gb|KDO53775.1| hypothetical protein CISIN_1g032725mg [Citrus sinensis]
Length=135

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -2

Query  448  RIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSWLK  269
            + K +E+  EG++CYRDENGE+ICEGYDEGPR    Q+   + + R  E++++L + W +
Sbjct  45   KTKAFEDHFEGIICYRDENGEMICEGYDEGPRFH-QQIPRATFHPRDVEIMNILLQRWHE  103

Query  268  V  266
            +
Sbjct  104  I  104



>ref|XP_006426794.1| hypothetical protein CICLE_v10026732mg [Citrus clementina]
 gb|ESR40034.1| hypothetical protein CICLE_v10026732mg [Citrus clementina]
Length=138

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -2

Query  448  RIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSWLK  269
            + K +E+  EG++CYRDENGE+ICEGYDEGPR    Q+   + + R  E++++L + W +
Sbjct  48   KTKAFEDHFEGIICYRDENGEMICEGYDEGPRFH-QQIPRATFHPRDVEIMNILLQRWHE  106

Query  268  V  266
            +
Sbjct  107  I  107



>gb|KHN01472.1| hypothetical protein glysoja_009678 [Glycine soja]
Length=151

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 50/66 (76%), Gaps = 3/66 (5%)
 Frame = -2

Query  445  IKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDL-LERSWLK  269
            I +YE+ S+G++CY DE+GEIICEGYDEGPR   H++ S + + R  E+++L  ++SWL+
Sbjct  67   ILIYEDQSQGIICYEDESGEIICEGYDEGPRY--HRIPSPTQHPRDVEIMNLQQQQSWLQ  124

Query  268  VEERKE  251
            + + +E
Sbjct  125  IVKGEE  130



>emb|CDY33236.1| BnaC01g37090D [Brassica napus]
Length=140

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 7/65 (11%)
 Frame = -2

Query  439  VYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQ--VSSFSCNSRVAEMVDLLERSW--L  272
            VYE+  +G++CY D+NGE+ICEGYDEGPR       V+SF   SR  E++DLL+RS+  L
Sbjct  54   VYEDPVQGIICYTDDNGEVICEGYDEGPRCPPESPIVTSF---SREVEILDLLQRSYQEL  110

Query  271  KVEER  257
            +V E+
Sbjct  111  RVAEK  115



>ref|XP_007215134.1| hypothetical protein PRUPE_ppa013099mg [Prunus persica]
 gb|EMJ16333.1| hypothetical protein PRUPE_ppa013099mg [Prunus persica]
Length=140

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -2

Query  448  RIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERS-WL  272
            R +V+E+ S G++CY+D+ GEIICEG+DEGPR    Q     C  R AE+ DLL++  WL
Sbjct  50   REEVFEDRSNGIICYKDDRGEIICEGFDEGPRYYHQQNPRTGCQPRDAEIFDLLQQQRWL  109



>ref|XP_010685215.1| PREDICTED: uncharacterized protein LOC104899682 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=135

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSWLKV  266
            +V+E+ S G++CY+D+ GEIICEG+DEGPRL     S+   +   A ++DLL++ WL++
Sbjct  53   QVFEDHSTGIICYKDDRGEIICEGFDEGPRLHPQYPSTPLPSRDGAGILDLLQQRWLQI  111



>ref|XP_010029510.1| PREDICTED: uncharacterized protein LOC104419525 isoform X2 [Eucalyptus 
grandis]
 gb|KCW56434.1| hypothetical protein EUGRSUZ_I02161 [Eucalyptus grandis]
Length=136

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = -2

Query  502  INSSTSPLHTAGSPSSKNRIK--VYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSS  329
            + +S  PL  A +   ++ +K  V+E+ +EG++CYRDENGEIICEG DEGPR    ++  
Sbjct  29   LGNSQLPLRRAPAMRIRSSLKNQVFEDRAEGIICYRDENGEIICEGLDEGPRFQ-PKILR  87

Query  328  FSCNSRVAEMVDLLERSWLKVEERKE  251
               + R A+++  L+++W+++   +E
Sbjct  88   AEYHPRDAKIIGHLQQNWIQLVNGRE  113



>ref|XP_010029509.1| PREDICTED: uncharacterized protein LOC104419525 isoform X1 [Eucalyptus 
grandis]
Length=138

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 56/87 (64%), Gaps = 3/87 (3%)
 Frame = -2

Query  502  INSSTSPLHTAGSPSSKNRIK--VYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQV-S  332
            + +S  PL  A +   ++ +K  V+E+ +EG++CYRDENGEIICEG DEGPR     + +
Sbjct  29   LGNSQLPLRRAPAMRIRSSLKNQVFEDRAEGIICYRDENGEIICEGLDEGPRFQPKILRA  88

Query  331  SFSCNSRVAEMVDLLERSWLKVEERKE  251
             +    R A+++  L+++W+++   +E
Sbjct  89   EYHPRFRDAKIIGHLQQNWIQLVNGRE  115



>ref|XP_004303753.1| PREDICTED: uncharacterized protein LOC101293323 [Fragaria vesca 
subsp. vesca]
Length=140

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSW  275
            +V+E+   G++CY+D  GEIICEGYDEGPR   HQ       SR AE+ DLL+++W
Sbjct  55   EVFEDHFNGIICYKDARGEIICEGYDEGPRYH-HQNQRIVNQSRDAEIFDLLQQNW  109



>ref|XP_006298666.1| hypothetical protein CARUB_v10014757mg, partial [Capsella rubella]
 gb|EOA31564.1| hypothetical protein CARUB_v10014757mg, partial [Capsella rubella]
Length=177

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 7/64 (11%)
 Frame = -2

Query  460  SSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCH--QVSSFSCNSRVAEMVDLL  287
            S+KN   V+E+ ++G++CY D+NGE+ICEGYDEGPR       V+S+   SR  E++DLL
Sbjct  87   STKN--TVFEDPTQGIICYTDDNGEVICEGYDEGPRCPTQSPMVASY---SREVEILDLL  141

Query  286  ERSW  275
            +RS+
Sbjct  142  QRSY  145



>ref|XP_002438002.1| hypothetical protein SORBIDRAFT_10g006240 [Sorghum bicolor]
 gb|EER89369.1| hypothetical protein SORBIDRAFT_10g006240 [Sorghum bicolor]
Length=161

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 58/102 (57%), Gaps = 9/102 (9%)
 Frame = -2

Query  541  ALVMMRASNHHDSINSSTSPLHTAGSPS------SKNRIKVYENLSEGVVCYRDENGEII  380
            A++  R+S    S    TS   ++ SP       +  +++V+E+   G+VCYRDENGE+I
Sbjct  46   AMICPRSSTRQSSFRFRTSAHGSSASPHLSFTAVTDKKVQVFEDQLRGIVCYRDENGEMI  105

Query  379  CEGYDEGPRLDCH--QVSSFSCNSRVAEMVDLLERSWLKVEE  260
            CEGYDEGPRL     + +SF     V  + D ++ + L+V E
Sbjct  106  CEGYDEGPRLGMRLPEKASFPWPVGV-RVTDFIQLATLQVFE  146



>ref|NP_001238687.1| uncharacterized protein LOC100527099 [Glycine max]
 gb|ACU16143.1| unknown [Glycine max]
 gb|KHN39575.1| hypothetical protein glysoja_020653 [Glycine soja]
Length=139

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLL-ERSWLKV  266
            K+YE+ S+G++CY DE+GEIICEGYDEGPR    ++   + + R  E+++LL ++SWL++
Sbjct  56   KIYEDQSQGILCYEDESGEIICEGYDEGPRY--QRIPRPTHHPRDVEIMNLLQQQSWLQI  113



>ref|XP_009117044.1| PREDICTED: uncharacterized protein LOC103842171 [Brassica rapa]
 emb|CDY60693.1| BnaA01g37050D [Brassica napus]
Length=140

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 52/72 (72%), Gaps = 9/72 (13%)
 Frame = -2

Query  460  SSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRL--DCHQVSSFSCNSRVAEMVDLL  287
            S+KN   VYE+  +G++CY D+NGE+ICEGYDEGPR   +   V+S+   SR  E++DLL
Sbjct  49   STKN--TVYEDPVQGILCYTDDNGEVICEGYDEGPRCPPESPVVTSY---SREVEILDLL  103

Query  286  ERSW--LKVEER  257
            +RS+  L+V E+
Sbjct  104  QRSYQELRVAEK  115



>ref|XP_008380737.1| PREDICTED: uncharacterized protein LOC103443629 isoform X1 [Malus 
domestica]
Length=144

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 71/134 (53%), Gaps = 10/134 (7%)
 Frame = -2

Query  631  LAAMSSLLPSPVSSI-FSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSS  455
            +AA ++   SP +S+    +G + K  S    ++ +++S     I SST  +       S
Sbjct  1    MAAATACCFSPANSLSIQKSGPVLKPFS---RVLRLKSSQLTVKIKSSTLQIR------S  51

Query  454  KNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSW  275
              R +V+E+ S G++CY+D+ GEIICEG+DEGPR   H   +    SR  E+ D L++ W
Sbjct  52   SLREEVFEDRSNGIICYKDDRGEIICEGFDEGPRYHQHNPRTPWQPSRDTEIFDHLQQRW  111

Query  274  LKVEERKEQLMGEK  233
            +      E   G+K
Sbjct  112  INFITGTELSRGDK  125



>gb|EAY99992.1| hypothetical protein OsI_21995 [Oryza sativa Indica Group]
Length=128

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 70/131 (53%), Gaps = 15/131 (11%)
 Frame = -2

Query  631  LAAMSSLLPSPVSSIFSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSK  452
            +AA SSL PS      SS   I +     +A +  RA  H     +S+S L  A + ++K
Sbjct  1    MAARSSLHPS------SSMASIPRLIGTRKAALRFRAPAHG---GTSSSQLSIAAATANK  51

Query  451  NRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCH--QVSSFSCNSRVAEMVDLLERS  278
               KV+E+   G+VCYRD+ GE++CEGYDEGPRL     + + F     V ++ D +E +
Sbjct  52   ---KVFEDQLRGIVCYRDDKGEMVCEGYDEGPRLGMRLPEKACFPWPMEV-QITDFIELA  107

Query  277  WLKVEERKEQL  245
              +V E  + L
Sbjct  108  TFRVFEDADVL  118



>ref|XP_009357939.1| PREDICTED: uncharacterized protein LOC103948619 [Pyrus x bretschneideri]
Length=141

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -2

Query  448  RIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSWLK  269
            R +V+E+ + G++CY+D+ GEIICE +DEGPR   H   +    SR AE+ DLL++ W+ 
Sbjct  51   REEVFEDRANGIICYKDDGGEIICEAFDEGPRYHQHNPRTPWQPSRDAEIFDLLQQRWIN  110

Query  268  VEERKEQLMGEK  233
                 E   G++
Sbjct  111  FITDTELCRGDE  122



>ref|XP_009146387.1| PREDICTED: uncharacterized protein LOC103870042 [Brassica rapa]
Length=143

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = -2

Query  457  SKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSF-SCNSRVAEMVDLLER  281
            S  +  V+E+  +G++CY D+NGE+ICEGYDEGPR  C   SS  + +SR  E++DLL+R
Sbjct  51   STKKNTVFEDPIQGIICYTDDNGEVICEGYDEGPR--CPPDSSMVASHSREVEILDLLQR  108

Query  280  SW  275
            S+
Sbjct  109  SY  110



>ref|XP_008649181.1| PREDICTED: uncharacterized protein LOC103629869 [Zea mays]
 gb|AFW76607.1| hypothetical protein ZEAMMB73_928639 [Zea mays]
Length=171

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 8/103 (8%)
 Frame = -2

Query  529  MRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
             RAS H     S +SP  ++ +  +  ++KV+E+   G+VCYRDE+GE++CEGYDEGPRL
Sbjct  72   FRASAH----GSGSSPNLSSFTAVTGKKVKVFEDQLRGIVCYRDEDGEMVCEGYDEGPRL  127

Query  349  DCH--QVSSF--SCNSRVAEMVDLLERSWLKVEERKEQLMGEK  233
                 + +SF      R+ + + L        +    QL G++
Sbjct  128  GMRLPEKASFPWPVGVRITDFIQLATLQVFDDDVDVLQLTGDQ  170



>ref|XP_009406683.1| PREDICTED: uncharacterized protein LOC103989537 [Musa acuminata 
subsp. malaccensis]
Length=111

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  499  NSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLD  347
            NS  SP  +  S +S    KV+E+ + GV+C+RDE GEI+CEG+DEGPR D
Sbjct  30   NSKISPKVSVSSNTSGTDTKVFEDQALGVICFRDEKGEIVCEGFDEGPRFD  80



>gb|AFK47958.1| unknown [Lotus japonicus]
Length=144

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -2

Query  496  SSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLD-----CHQVS  332
            +   P+    + S KN  KVYE+ S+G++CYRD++GEIICEGYDEGP         +  S
Sbjct  39   TPVGPVVLRTTASIKN--KVYEDQSKGIICYRDKSGEIICEGYDEGPNYQRISRPIYHRS  96

Query  331  SFSCNSRVAEMVDLL-ERSWLKVEERKE  251
             F+  S  AE+++LL ++SWL++ + +E
Sbjct  97   GFAGFSD-AEIMNLLPKQSWLQIVKAEE  123



>emb|CDX97563.1| BnaA05g25160D [Brassica napus]
Length=143

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 5/63 (8%)
 Frame = -2

Query  457  SKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPR--LDCHQVSSFSCNSRVAEMVDLLE  284
            S  +  V+E+  +G++CY D+NGE+ICEGYDEGPR  LD   V+S   +SR  E+++LL+
Sbjct  51   STKKNTVFEDPIQGIICYTDDNGEVICEGYDEGPRCPLDSSMVAS---HSREVEILELLQ  107

Query  283  RSW  275
            RS+
Sbjct  108  RSY  110



>gb|KFK38795.1| hypothetical protein AALP_AA3G161300 [Arabis alpina]
Length=135

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 3/56 (5%)
 Frame = -2

Query  439  VYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCN-SRVAEMVDLLERSW  275
            V+E+  +G++CY D+NGE+ICEGYDEGPR  C Q S    + SR  E++DLL++S+
Sbjct  56   VFEDPIQGIICYTDDNGEVICEGYDEGPR--CPQESLMVASYSREVEILDLLQKSY  109



>ref|XP_008228109.1| PREDICTED: uncharacterized protein LOC103327556 isoform X1 [Prunus 
mume]
Length=141

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 2/61 (3%)
 Frame = -2

Query  448  RIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCN-SRVAEMVDLLERS-W  275
            R +V+E+ S G++CY+D+ GEIICEG+DEGPR    Q     C  SR AE+ DLL++  W
Sbjct  50   REEVFEDRSNGIICYKDDRGEIICEGFDEGPRYYHQQNPRTGCQPSRDAEIFDLLQQQRW  109

Query  274  L  272
            L
Sbjct  110  L  110



>ref|XP_008380738.1| PREDICTED: uncharacterized protein LOC103443629 isoform X2 [Malus 
domestica]
Length=143

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 70/134 (52%), Gaps = 11/134 (8%)
 Frame = -2

Query  631  LAAMSSLLPSPVSSI-FSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSS  455
            +AA ++   SP +S+    +G + K  S    ++ +++S     I SST  +       S
Sbjct  1    MAAATACCFSPANSLSIQKSGPVLKPFS---RVLRLKSSQLTVKIKSSTLQIR------S  51

Query  454  KNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERSW  275
              R +V+E+ S G++CY+D+ GEIICEG+DEGPR   H   +     R  E+ D L++ W
Sbjct  52   SLREEVFEDRSNGIICYKDDRGEIICEGFDEGPRYHQHNPRT-PWQPRDTEIFDHLQQRW  110

Query  274  LKVEERKEQLMGEK  233
            +      E   G+K
Sbjct  111  INFITGTELSRGDK  124



>ref|XP_004980535.1| PREDICTED: uncharacterized protein LOC101765926 [Setaria italica]
Length=140

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            KVYE+   G++CYRDENGE+ICEGYDEGPRL
Sbjct  64   KVYEDQLRGIICYRDENGEMICEGYDEGPRL  94



>emb|CDX98440.1| BnaC05g39350D [Brassica napus]
Length=143

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 56/96 (58%), Gaps = 6/96 (6%)
 Frame = -2

Query  556  RSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIIC  377
            ++V    +M++ S     +N  T         S+K    V+E+  +G++CY D+NGE+IC
Sbjct  19   KTVRSKTLMLQQSQVQVKVNQVTVSQPQPIRYSTKKN-TVFEDPIQGIICYTDDNGEVIC  77

Query  376  EGYDEGPRL--DCHQVSSFSCNSRVAEMVDLLERSW  275
            EGYDEGPR   D   V+S+   SR  E++DLL+ ++
Sbjct  78   EGYDEGPRCPPDNSMVASY---SREVEILDLLQINY  110



>gb|KEH24665.1| hypothetical protein MTR_7g117550 [Medicago truncatula]
Length=164

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 11/69 (16%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSC-------NSRVAEMVD-LL  287
            KVYE+  EGVVCY+DE+GEIICEGYDEGP   C Q  S           SR AE+ + LL
Sbjct  53   KVYESEPEGVVCYQDEHGEIICEGYDEGP---CFQRISKPIYYQYPIPPSRDAEITNILL  109

Query  286  ERSWLKVEE  260
             +SWL++ +
Sbjct  110  RQSWLQISD  118



>ref|XP_010273818.1| PREDICTED: uncharacterized protein LOC104609259 [Nelumbo nucifera]
Length=142

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 11/72 (15%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQ-------VSSFSCNSRVAEMVDLLE  284
            KV+E+ S G+VCYRD NGEIICEG DEGPR    +       +S+F    R  E+++LL+
Sbjct  57   KVFEDQSRGIVCYRDGNGEIICEGLDEGPRFQPAEAPKPAPSLSAF----RQIEIINLLQ  112

Query  283  RSWLKVEERKEQ  248
            R+  ++ E   Q
Sbjct  113  RNGFQIIEADGQ  124



>ref|XP_004959573.1| PREDICTED: uncharacterized protein LOC101774676 [Setaria italica]
Length=183

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            KVYE+   G++CYRDENGE+ICEGYDEGPRL
Sbjct  107  KVYEDQLRGIICYRDENGEMICEGYDEGPRL  137



>ref|XP_010227912.1| PREDICTED: uncharacterized protein LOC100841409 [Brachypodium 
distachyon]
 ref|XP_010227913.1| PREDICTED: uncharacterized protein LOC100841409 [Brachypodium 
distachyon]
Length=130

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 6/94 (6%)
 Frame = -2

Query  631  LAAMSSLLPSPVSSIFSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSK  452
            +A  SS  P   S + ++  F  +  +V  +     A+ H    N S S L  A + S+K
Sbjct  1    MAFRSSCYPHSSSPMAAAPRFGARKPAVALSFSACAAAAH--GCNPSPSNLSFAAATSNK  58

Query  451  NRIKVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
                V+E+   G+VCYRD+ GE++CEGYDEGPRL
Sbjct  59   ----VFEDQMRGIVCYRDDKGELVCEGYDEGPRL  88



>ref|XP_004964604.1| PREDICTED: uncharacterized protein LOC101755809 [Setaria italica]
Length=158

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  451  NRIKVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            ++ KVYE+   G++CYRD+NGE+ICEGYDEGPRL
Sbjct  79   DKKKVYEDQLRGIICYRDDNGEMICEGYDEGPRL  112



>ref|NP_001237677.1| uncharacterized protein LOC100305853 [Glycine max]
 gb|ACU13735.1| unknown [Glycine max]
 gb|KHN11354.1| hypothetical protein glysoja_036051 [Glycine soja]
Length=132

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 6/62 (10%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQ-VSSFSCNSRVAEMVD--LLERSWL  272
            KVYE+ S+G++CY+DE GEI+CEGYDEGP   C Q +   +   R A++    LL +SW+
Sbjct  51   KVYEDHSQGIICYQDEFGEIVCEGYDEGP---CFQRIPETTNRPRDAQITKNLLLRQSWI  107

Query  271  KV  266
            ++
Sbjct  108  QI  109



>gb|EMT02530.1| hypothetical protein F775_26485 [Aegilops tauschii]
Length=135

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 7/86 (8%)
 Frame = -2

Query  607  PSPVSSIFSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYEN  428
            P P SS+ ++TG     R    AL    ++ H    N  +S L  A +P+S    KV+E+
Sbjct  9    PHPSSSM-ATTGPRFGARRPAAALSFRTSAAH--GCNQPSSHLSFA-APTSN---KVFED  61

Query  427  LSEGVVCYRDENGEIICEGYDEGPRL  350
               G+VCYRD+ GE++CEGYDEGPRL
Sbjct  62   QVRGIVCYRDDKGEVVCEGYDEGPRL  87



>dbj|BAH56984.1| AT3G14280 [Arabidopsis thaliana]
Length=105

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -2

Query  556  RSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIIC  377
            ++V    +M++ S  H  +  +T         S+KN   V+E+  +G++CY D+NGE+IC
Sbjct  19   KTVRAKTLMLQQSQVHVKVKKATVSQPQPIRYSTKNI--VFEDPIQGIICYTDDNGEVIC  76

Query  376  EGYDEGPR  353
            EGYDEGPR
Sbjct  77   EGYDEGPR  84



>gb|AAK52112.1|AC079936_8 Unknown protein [Oryza sativa Japonica Group]
 gb|AAP53555.1| expressed protein [Oryza sativa Japonica Group]
Length=125

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 6/73 (8%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDL-----LERS  278
            KVYE+ S G++CY DE+GE+ICEG+DEGPRL    +   +  +R  +  +L     L   
Sbjct  25   KVYEDKSMGILCYTDESGELICEGFDEGPRLTWQDMEKINRENRRCKSSELTIPLALNNR  84

Query  277  WLKVEE-RKEQLM  242
             LK EE R+E++M
Sbjct  85   ELKAEEDRRERMM  97



>ref|XP_002452933.1| hypothetical protein SORBIDRAFT_04g035190 [Sorghum bicolor]
 gb|EES05909.1| hypothetical protein SORBIDRAFT_04g035190 [Sorghum bicolor]
Length=120

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -2

Query  478  HTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCH--QVSSFSCNSRVA  305
            H   S S+++   V+E+   GVVCYRD++GE+ICEG+DEGPRL     + + F     + 
Sbjct  41   HFPSSSSARSIKTVFEDQVRGVVCYRDDSGEVICEGFDEGPRLGMRLPEKACFPWPMGI-  99

Query  304  EMVDLLERSWLKVEERKEQL  245
             + D +E S L V E ++ L
Sbjct  100  RVTDFIELSTLGVLEDEDAL  119



>dbj|BAJ92461.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01002.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=137

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 5/72 (7%)
 Frame = -2

Query  565  RKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGE  386
            R G     A +  R+S  H    +S+SP H   S ++ N  KV+E+   G+VCYRD+ GE
Sbjct  23   RFGARKPAAALSFRSSASHGC--NSSSP-HLCSSAATGN--KVFEDQVRGIVCYRDDKGE  77

Query  385  IICEGYDEGPRL  350
            ++CEGYDEGPRL
Sbjct  78   LVCEGYDEGPRL  89



>ref|XP_004983102.1| PREDICTED: uncharacterized protein LOC101785497 [Setaria italica]
Length=153

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 7/116 (6%)
 Frame = -2

Query  613  LLPSPVSSI----FSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNR  446
            L+PS ++++      ST  I + R   R + M+RAS   D+  SS           +   
Sbjct  20   LIPSSMAALRCYCLQSTATIVQRRKSSRKM-MIRAS--MDACPSSELKKSPKSVSFTGKV  76

Query  445  IKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLERS  278
             KVYE+ + G++CY D+NGE++CEG DEGPRL    +   +         D ++R+
Sbjct  77   HKVYEDKNMGILCYTDKNGELVCEGLDEGPRLTWQDMEKLNMEKNAKNQGDQMQRT  132



>ref|XP_006655873.1| PREDICTED: uncharacterized protein LOC102704708 [Oryza brachyantha]
Length=138

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            KV+E+   G+VCYRDE GE++CEGYDEGPRL
Sbjct  62   KVFEDQLRGIVCYRDEKGELVCEGYDEGPRL  92



>ref|XP_006648017.1| PREDICTED: uncharacterized protein LOC102714154 isoform X1 [Oryza 
brachyantha]
 ref|XP_006648018.1| PREDICTED: uncharacterized protein LOC102714154 isoform X2 [Oryza 
brachyantha]
Length=132

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 55/104 (53%), Gaps = 9/104 (9%)
 Frame = -2

Query  565  RKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGE  386
            R G      +  +RA  H  S +SS + L    +P       V+E+   GVVCYRD+ GE
Sbjct  21   RFGTRKAAMIRFIRARVH--SCSSSNAHLPQPAAPVKM----VFEDQVRGVVCYRDDKGE  74

Query  385  IICEGYDEGPRLDCH--QVSSFSCNSRVAEMVDLLERSWLKVEE  260
            +ICEG+DEGPRL     + + F     V ++ D +E S L+V E
Sbjct  75   VICEGFDEGPRLGMRLPEKACFPWPMGV-QVTDFIELSTLRVFE  117



>ref|XP_004954147.1| PREDICTED: uncharacterized protein LOC101754780 [Setaria italica]
Length=114

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -2

Query  478  HTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCH--QVSSFSCNSRVA  305
            H   S S+++   V+E+   GVVCYRD+ GE+ICEGYDEGPRL     + + F     + 
Sbjct  35   HEHLSNSARSIKTVFEDQVRGVVCYRDDRGEVICEGYDEGPRLGMRLPEKACFPWPMGI-  93

Query  304  EMVDLLERSWLKVEERKEQL  245
             + D +E S L+V E ++ L
Sbjct  94   RVTDFIELSTLRVLEDEDAL  113



>ref|NP_001048321.1| Os02g0782900 [Oryza sativa Japonica Group]
 dbj|BAF10235.1| Os02g0782900 [Oryza sativa Japonica Group]
 dbj|BAG88292.1| unnamed protein product [Oryza sativa Japonica Group]
Length=132

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 70/135 (52%), Gaps = 14/135 (10%)
 Frame = -2

Query  631  LAAMSSLLPSPVSSIFSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSK  452
            +AAMSS     +SS  S+  F  +  ++ +    +RA  H  S + S + L    +P+  
Sbjct  4    MAAMSSC--HHLSSSISTPRFGTRKATMAK---FVRAPVH--SCSCSNAHLSQTAAPAKM  56

Query  451  NRIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCH--QVSSFSCNSRVAEMVDLLERS  278
                V+E+   GVVCYRD+ G +ICEGYDEGPRL     + + F     V ++ D +E S
Sbjct  57   ----VFEDQVRGVVCYRDDKGNMICEGYDEGPRLGMRLPEKACFPWPMGV-QVTDFIELS  111

Query  277  WLKVEERKEQLMGEK  233
             L+V E  + L   K
Sbjct  112  TLRVFEDVDSLQPRK  126



>ref|XP_003521838.1| PREDICTED: uncharacterized protein LOC100798487 [Glycine max]
 gb|KHN16383.1| hypothetical protein glysoja_033787 [Glycine soja]
Length=132

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 6/62 (10%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQ-VSSFSCNSRVAEMVD--LLERSWL  272
            KVYE+ S+G++CY+DE GEIICEGYDEG    C Q +   +   R A++    LL +SWL
Sbjct  51   KVYEDHSQGIICYQDEFGEIICEGYDEG---SCFQRIPEPTNRPRDAQITTNLLLRQSWL  107

Query  271  KV  266
            ++
Sbjct  108  QI  109



>gb|EEC66878.1| hypothetical protein OsI_33419 [Oryza sativa Indica Group]
Length=108

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLER  281
            KVYE+ S G++CY DE+GE+ICEG+DEGPRL    +   +    +    D  ER
Sbjct  25   KVYEDKSMGILCYTDESGELICEGFDEGPRLTWQDMEKINREKELKAEEDRRER  78



>gb|KEH24666.1| hypothetical protein MTR_7g117550 [Medicago truncatula]
Length=129

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 3/35 (9%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQ  338
            KVYE+  EGVVCY+DE+GEIICEGYDEGP   C Q
Sbjct  75   KVYESEPEGVVCYQDEHGEIICEGYDEGP---CFQ  106



>gb|EEE50895.1| hypothetical protein OsJ_31387 [Oryza sativa Japonica Group]
Length=108

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLER  281
            KVYE+ S G++CY DE+GE+ICEG+DEGPRL    +   +    +    D  ER
Sbjct  25   KVYEDKSMGILCYTDESGELICEGFDEGPRLTWQDMEKINREKELKAEEDRRER  78



>dbj|BAJ94274.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=42

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  439  VYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            V+E+   G+VCYRD+ GE++CEGYDEGPRL
Sbjct  1    VFEDQVRGIVCYRDDKGELVCEGYDEGPRL  30



>ref|XP_004964605.1| PREDICTED: uncharacterized protein LOC101757283 [Setaria italica]
Length=116

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            KV+E+   G+VCY+DE GE+ICEGYDEGPRL
Sbjct  54   KVFEDQLRGIVCYKDEKGEMICEGYDEGPRL  84



>dbj|BAD19538.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE57926.1| hypothetical protein OsJ_08627 [Oryza sativa Japonica Group]
Length=104

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 9/102 (9%)
 Frame = -2

Query  532  MMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEGPR  353
             +RA  H  S + S + L    +P+      V+E+   GVVCYRD+ G +ICEGYDEGPR
Sbjct  4    FVRAPVH--SCSCSNAHLSQTAAPAKM----VFEDQVRGVVCYRDDKGNMICEGYDEGPR  57

Query  352  LDCH--QVSSFSCNSRVAEMVDLLERSWLKVEERKEQLMGEK  233
            L     + + F     V ++ D +E S L+V E  + L   K
Sbjct  58   LGMRLPEKACFPWPMGV-QVTDFIELSTLRVFEDVDSLQPRK  98



>ref|XP_008812395.1| PREDICTED: uncharacterized protein LOC103723293 [Phoenix dactylifera]
Length=124

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = -2

Query  535  VMMRASNHHDS-INSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDEG  359
             M RAS  H+S I  S +   ++  P + N++ V+E+ + G+VCY D  GE+ICEGYDEG
Sbjct  20   AMPRASMLHNSHIQHSRAAATSSCKPFAANKV-VFEDQAMGIVCYIDGQGEVICEGYDEG  78

Query  358  PRL  350
            PR 
Sbjct  79   PRF  81



>ref|NP_001176137.1| Os10g0390650 [Oryza sativa Japonica Group]
 dbj|BAH94865.1| Os10g0390650 [Oryza sativa Japonica Group]
Length=135

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLLER  281
            KVYE+ S G++CY DE+GE+ICEG+DEGPRL    +   +    +    D  ER
Sbjct  52   KVYEDKSMGILCYTDESGELICEGFDEGPRLTWQDMEKINREKELKAEEDRRER  105



>gb|ABK22155.1| unknown [Picea sitchensis]
Length=141

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 13/68 (19%)
 Frame = -2

Query  553  SVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICE  374
            +VGR  +  RA+     + S    L+ A        +KVY++ S G+VCYR+E GE+ICE
Sbjct  36   TVGRKNITARAT-----VCSKKYKLYEA--------VKVYQDASRGIVCYRNEYGELICE  82

Query  373  GYDEGPRL  350
            GYDEGP L
Sbjct  83   GYDEGPHL  90



>ref|XP_009413992.1| PREDICTED: uncharacterized protein LOC103995183 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=131

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  445  IKVYENLSEGVVCYRDENGEIICEGYDEGPR  353
            IK+YE+ + G++CY+D  GE+ICEGYDEGPR
Sbjct  56   IKIYEDKAMGIICYKDAKGEVICEGYDEGPR  86



>ref|XP_009413993.1| PREDICTED: uncharacterized protein LOC103995183 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=122

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  445  IKVYENLSEGVVCYRDENGEIICEGYDEGPR  353
            IK+YE+ + G++CY+D  GE+ICEGYDEGPR
Sbjct  47   IKIYEDKAMGIICYKDAKGEVICEGYDEGPR  77



>ref|XP_010685216.1| PREDICTED: uncharacterized protein LOC104899682 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=95

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            +V+E+ S G++CY+D+ GEIICEG+DEGPRL
Sbjct  53   QVFEDHSTGIICYKDDRGEIICEGFDEGPRL  83



>ref|NP_001145551.1| uncharacterized protein LOC100279003 [Zea mays]
 gb|ACG48411.1| hypothetical protein [Zea mays]
Length=130

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = -2

Query  535  VMMRASNHHDSINSSTSPLHTAGSPSSKNRI-KVYENLSEGVVCYRDENGEIICEGYDEG  359
             M RAS   D   SS+ P   + S S   +  KVYE+   G++CY DENGE++CEG DEG
Sbjct  27   TMTRASISTDGC-SSSEPKKKSHSVSFAGKANKVYEDKDMGILCYTDENGELVCEGLDEG  85

Query  358  PRL  350
            PRL
Sbjct  86   PRL  88



>gb|EMS66016.1| hypothetical protein TRIUR3_07394 [Triticum urartu]
Length=126

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 49/89 (55%), Gaps = 7/89 (8%)
 Frame = -2

Query  586  FSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLHTAGSPSSKNRI-KVYENLSEGVV  410
            +SST  I     V R  +  RAS   D  +SS S    + S S   ++ KVYE+ + G++
Sbjct  7    YSSTAAI----IVPRRKICARAS--MDGCSSSESRRQASSSVSFTCKVNKVYEDKNMGIL  60

Query  409  CYRDENGEIICEGYDEGPRLDCHQVSSFS  323
            CY DE GE++CEG DEGPRL    +   +
Sbjct  61   CYTDETGELLCEGLDEGPRLTRQDIEKLT  89



>gb|EMT08498.1| hypothetical protein F775_20430 [Aegilops tauschii]
Length=126

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFS  323
            KVYE+ + G++CY DENGE++CEG DEGPRL    +   +
Sbjct  50   KVYEDKNMGILCYTDENGELVCEGLDEGPRLTWRDMEKLT  89



>ref|XP_006828630.1| hypothetical protein AMTR_s00129p00089860 [Amborella trichopoda]
 gb|ERM96046.1| hypothetical protein AMTR_s00129p00089860 [Amborella trichopoda]
Length=109

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRV-AEMVDLLERSWLKV  266
            KV+E+   G++CYRD++GE+ICEGYDEGP     +V+  S N  + A ++ +L +S L++
Sbjct  49   KVFEDRERGIICYRDDSGEVICEGYDEGPHFH-PRVTEKSANQSIEARILCILLQSRLRL  107



>ref|XP_008228110.1| PREDICTED: uncharacterized protein LOC103327556 isoform X2 [Prunus 
mume]
Length=119

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  448  RIKVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSRVAEMVDLL  287
            R +V+E+ S G++CY+D+ GEIICEG+DEGPR    Q     C    AE +  L
Sbjct  50   REEVFEDRSNGIICYKDDRGEIICEGFDEGPRYYHQQNPRTGCQPSSAETLRSL  103



>dbj|BAK00366.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=132

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            KVYE+ + G++CY DENGE++CEG DEGPRL
Sbjct  49   KVYEDKNMGILCYTDENGELVCEGLDEGPRL  79



>ref|XP_006661737.1| PREDICTED: uncharacterized protein LOC102705562 [Oryza brachyantha]
Length=159

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            KVYE+ S G++CY D +GE+ICEG+DEGPRL
Sbjct  75   KVYEDKSMGILCYTDNSGELICEGFDEGPRL  105



>ref|XP_004144478.1| PREDICTED: uncharacterized protein LOC101216011 [Cucumis sativus]
 gb|KGN58472.1| hypothetical protein Csa_3G646590 [Cucumis sativus]
Length=142

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 49/98 (50%), Gaps = 23/98 (23%)
 Frame = -2

Query  655  SHFVVCMFLAAMSSLLPSPVSSIFSSTGFIRKGRSVGRALVMMRASNHHDSINSSTSPLH  476
            +H    + L + +SL P P+ +IF                 M++         S   PL 
Sbjct  5    NHRSPLLPLKSFTSLQPKPLGNIF-----------------MLKTPKI-----SVNRPLA  42

Query  475  TAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDE  362
               + S KN + V+E+ S GV+CYRD++GEIICEGYD+
Sbjct  43   LQITSSLKNNL-VFEDRSNGVICYRDDDGEIICEGYDD  79



>ref|XP_008797356.1| PREDICTED: uncharacterized protein LOC103712576 [Phoenix dactylifera]
Length=114

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            KV+E+ + G+VCY D  GE++CEGYDEGPR 
Sbjct  49   KVFEDQAMGIVCYTDGKGEVVCEGYDEGPRF  79



>ref|XP_010240360.1| PREDICTED: uncharacterized protein LOC100823643 isoform X2 [Brachypodium 
distachyon]
Length=123

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFS  323
            KVYE+ ++G++CY D +GE++CEG DEGPRL    + + S
Sbjct  51   KVYEDKNKGILCYTDGSGELVCEGLDEGPRLTWQDMENLS  90



>ref|XP_010932337.1| PREDICTED: uncharacterized protein LOC105053035 [Elaeis guineensis]
Length=122

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 38/64 (59%), Gaps = 8/64 (13%)
 Frame = -2

Query  532  MMRASNHHDSINSSTSPLHTAGSPS---SKNRIKVYENLSEGVVCYRDENGEIICEGYDE  362
            M RAS  H   NS T   HT  S S   S    KV+E+ + G++CY DE  E+ICEGYDE
Sbjct  21   MPRASMLH---NSRTQ--HTRASTSLCKSFTANKVFEDQAMGILCYIDEKEEVICEGYDE  75

Query  361  GPRL  350
            GPR 
Sbjct  76   GPRF  79



>ref|XP_003580496.2| PREDICTED: uncharacterized protein LOC100823643 isoform X1 [Brachypodium 
distachyon]
Length=126

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  442  KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFS  323
            KVYE+ ++G++CY D +GE++CEG DEGPRL    + + S
Sbjct  54   KVYEDKNKGILCYTDGSGELVCEGLDEGPRLTWQDMENLS  93



>ref|XP_009407255.1| PREDICTED: uncharacterized protein LOC103989994 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 5/90 (6%)
 Frame = -2

Query  499  NSSTSPLHTAGSPSSKNRI--KVYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSF  326
            NS  SP  T+ S S+  RI  KVYE+   G++C RDE GEIICEGYDEG R   H++SS 
Sbjct  29   NSQISP-KTSVSLSNFFRINNKVYEDQVRGIICSRDERGEIICEGYDEGSRHS-HRLSSE  86

Query  325  SCNSRVAEMVDLLERSWLKVEERKEQLMGE  236
            +   R+ E  +   R  L+   + E+ + E
Sbjct  87   N-GKRICEGYNERPRYHLRSPAQVEETVCE  115



>ref|XP_010917374.1| PREDICTED: uncharacterized protein LOC105041984 isoform X1 [Elaeis 
guineensis]
Length=117

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 5/53 (9%)
 Frame = -2

Query  499  NSSTSPLHTAGSPSSKNRI---KVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            NS T P  +  S SS N     KV+E+ + G+VC+ D  GE++CEGYDEGPR 
Sbjct  29   NSQTQP--SRASTSSYNLFTANKVFEDQAMGIVCHIDGKGEVVCEGYDEGPRF  79



>ref|XP_010917375.1| PREDICTED: uncharacterized protein LOC105041984 isoform X2 [Elaeis 
guineensis]
Length=89

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 5/53 (9%)
 Frame = -2

Query  499  NSSTSPLHTAGSPSSKNRI---KVYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            NS T P  +  S SS N     KV+E+ + G+VC+ D  GE++CEGYDEGPR 
Sbjct  29   NSQTQP--SRASTSSYNLFTANKVFEDQAMGIVCHIDGKGEVVCEGYDEGPRF  79



>ref|XP_004166922.1| PREDICTED: uncharacterized protein LOC101225558 [Cucumis sativus]
Length=115

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = -2

Query  484  PLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDE  362
            PL    + S KN + V+E+ S GV+CYRD++GEIICEGYD+
Sbjct  40   PLALQITSSLKNNL-VFEDRSNGVICYRDDDGEIICEGYDD  79



>ref|XP_001779822.1| predicted protein [Physcomitrella patens]
 gb|EDQ55335.1| predicted protein [Physcomitrella patens]
Length=153

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  439  VYENLSEGVVCYRDENGEIICEGYDEGPRL  350
            ++++ S+G++CY DENG++ICEG+DEGP  
Sbjct  64   IFKDESQGIICYYDENGDLICEGWDEGPHF  93



>ref|XP_001780996.1| predicted protein [Physcomitrella patens]
 gb|EDQ54180.1| predicted protein [Physcomitrella patens]
Length=153

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -2

Query  541  ALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIKVYENLSEGVVCYRDENGEIICEGYDE  362
            A V M   +   SI  ++S +  AG    K    V+++ S+G++CY DENG+I CEG+DE
Sbjct  31   ATVKMVPKSLRLSICRASSEVGPAGVIPEKEST-VFKDESQGIICYYDENGDITCEGWDE  89

Query  361  GP  356
            GP
Sbjct  90   GP  91



>ref|XP_001762738.1| predicted protein [Physcomitrella patens]
 gb|EDQ72537.1| predicted protein [Physcomitrella patens]
Length=151

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 14/103 (14%)
 Frame = -2

Query  604  SPVSSIFSSTGFIRKGRSVG-----RALVMMRASNHHDSINSSTSPLHTAGSPSSKNRIK  440
            SPV  +  S+G ++K  +V      R  +  RAS++  S+ +S     T+  P       
Sbjct  14   SPV--VLVSSGVVKKSATVQLASQCRHSLACRASSNGSSVKASREEGSTSTPP-------  64

Query  439  VYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSCNSR  311
            V+E+ +EG+VCY  + GE+ CEG+DEG        + F+   R
Sbjct  65   VFEDSTEGIVCYISKEGEVTCEGWDEGGHFQPEPQNQFTLRKR  107



>ref|XP_008460346.1| PREDICTED: uncharacterized protein LOC103499196 isoform X2 [Cucumis 
melo]
Length=141

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 6/66 (9%)
 Frame = -2

Query  439  VYENLSEGVVCYRDENGEIICEGYDEGPRLDCHQVSSFSC---NSRVAEMVD---LLERS  278
            V+E+ S GV+CYRD++GEIICEGYD+       ++    C   + R  EM     LL+  
Sbjct  54   VFEDRSNGVICYRDDDGEIICEGYDDEEIHIEEEMEKLPCEKSDGRDGEMKTDRLLLQTI  113

Query  277  WLKVEE  260
            W K  E
Sbjct  114  WEKQLE  119



>ref|XP_008460345.1| PREDICTED: uncharacterized protein LOC103499196 isoform X1 [Cucumis 
melo]
Length=142

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  439  VYENLSEGVVCYRDENGEIICEGYDE  362
            V+E+ S GV+CYRD++GEIICEGYD+
Sbjct  54   VFEDRSNGVICYRDDDGEIICEGYDD  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1247512128634