BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c39081_g1_i1 len=593 path=[1:0-592]

Length=593
                                                                      Score     E

emb|CDP00317.1|  unnamed protein product                                259   8e-77   
ref|XP_009769888.1|  PREDICTED: uncharacterized protein LOC104220679    245   9e-72   
ref|XP_009598715.1|  PREDICTED: uncharacterized protein LOC104094479    243   3e-71   
ref|XP_004238788.1|  PREDICTED: uncharacterized protein LOC101262813    241   2e-70   
ref|XP_006363228.1|  PREDICTED: uncharacterized protein LOC102588539    238   3e-69   
gb|EYU28734.1|  hypothetical protein MIMGU_mgv1a000772mg                238   3e-69   
emb|CBI31979.3|  unnamed protein product                                228   3e-69   
ref|XP_006438667.1|  hypothetical protein CICLE_v10030553mg             236   4e-68   
ref|XP_006483182.1|  PREDICTED: uncharacterized protein LOC102623...    234   5e-68   
ref|XP_006483183.1|  PREDICTED: uncharacterized protein LOC102623...    234   5e-68   
ref|XP_006438666.1|  hypothetical protein CICLE_v10030553mg             234   6e-68   
ref|XP_006483185.1|  PREDICTED: uncharacterized protein LOC102623...    234   7e-68   
ref|XP_002273996.2|  PREDICTED: uncharacterized protein LOC100250...    231   9e-67   Vitis vinifera
ref|XP_011075488.1|  PREDICTED: uncharacterized protein LOC105159...    230   1e-66   
ref|XP_011075486.1|  PREDICTED: uncharacterized protein LOC105159...    229   3e-66   
gb|ABO93003.1|  putative regulator of chromosome condensation RCC1      227   2e-65   Solanum tuberosum [potatoes]
gb|AAU93591.2|  Zinc finger protein, putative                           227   4e-65   Solanum demissum
ref|XP_008221643.1|  PREDICTED: uncharacterized protein LOC103321597    223   8e-64   
ref|XP_007224988.1|  hypothetical protein PRUPE_ppa020628mg             221   2e-63   
ref|XP_008389492.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    221   3e-63   
ref|XP_010683221.1|  PREDICTED: uncharacterized protein LOC104897942    221   5e-63   
ref|XP_002522401.1|  Ran GTPase binding protein, putative               220   9e-63   Ricinus communis
ref|XP_004298436.1|  PREDICTED: uncharacterized protein LOC101307114    219   1e-62   
ref|XP_007046139.1|  Regulator of chromosome condensation (RCC1) ...    218   3e-62   
ref|XP_009360355.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    217   7e-62   
ref|XP_010091214.1|  putative E3 ubiquitin-protein ligase HERC1         216   2e-61   
gb|KCW64968.1|  hypothetical protein EUGRSUZ_G02511                     214   5e-61   
ref|XP_010066923.1|  PREDICTED: uncharacterized protein LOC104453...    214   9e-61   
ref|XP_010066924.1|  PREDICTED: uncharacterized protein LOC104453...    214   1e-60   
ref|XP_008389490.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    214   1e-60   
ref|XP_008339910.1|  PREDICTED: uncharacterized protein LOC103402905    213   2e-60   
ref|XP_010415627.1|  PREDICTED: uncharacterized protein LOC104701...    213   3e-60   
gb|EPS64081.1|  hypothetical protein M569_10696                         213   3e-60   
ref|XP_010415626.1|  PREDICTED: uncharacterized protein LOC104701...    213   3e-60   
ref|XP_010937079.1|  PREDICTED: uncharacterized protein LOC105056557    213   4e-60   
ref|XP_010470972.1|  PREDICTED: uncharacterized protein LOC104750821    212   4e-60   
ref|XP_009410388.1|  PREDICTED: uncharacterized protein LOC103992424    213   5e-60   
ref|XP_010512024.1|  PREDICTED: uncharacterized protein LOC104788044    212   6e-60   
gb|KHN06842.1|  Putative E3 ubiquitin-protein ligase HERC1              213   6e-60   
ref|XP_004511218.1|  PREDICTED: uncharacterized protein LOC101514...    212   7e-60   
gb|KHG24995.1|  E3 ubiquitin-protein ligase HERC2                       211   1e-59   
ref|XP_006362314.1|  PREDICTED: uncharacterized protein LOC102578724    211   2e-59   
ref|XP_008808052.1|  PREDICTED: uncharacterized protein LOC103720223    210   3e-59   
ref|XP_004250909.1|  PREDICTED: uncharacterized protein LOC101265608    210   5e-59   
ref|XP_004168499.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    208   5e-59   
ref|XP_004138993.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    209   6e-59   
gb|KGN61393.1|  hypothetical protein Csa_2G109700                       207   7e-59   
ref|XP_006300387.1|  hypothetical protein CARUB_v10019712mg             209   7e-59   
ref|XP_009767054.1|  PREDICTED: uncharacterized protein LOC104218296    209   1e-58   
ref|XP_008441693.1|  PREDICTED: uncharacterized protein LOC103485...    207   1e-58   
ref|XP_008441692.1|  PREDICTED: uncharacterized protein LOC103485...    208   1e-58   
gb|AAT77332.1|  unknown prtein                                          207   2e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568548.1|  PREDICTED: uncharacterized protein LOC100838586    208   2e-58   
ref|XP_010269341.1|  PREDICTED: uncharacterized protein LOC104606...    208   2e-58   
ref|XP_010242447.1|  PREDICTED: uncharacterized protein LOC104586793    208   2e-58   
ref|XP_009630183.1|  PREDICTED: uncharacterized protein LOC104120162    208   2e-58   
ref|XP_010276611.1|  PREDICTED: uncharacterized protein LOC104611308    208   3e-58   
ref|XP_006654344.1|  PREDICTED: uncharacterized protein LOC102712360    207   3e-58   
ref|XP_010645610.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    207   4e-58   
ref|XP_006854768.1|  hypothetical protein AMTR_s00063p00100200          207   5e-58   
ref|NP_001055416.1|  Os05g0384800                                       207   5e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010551527.1|  PREDICTED: uncharacterized protein LOC104822...    206   1e-57   
ref|XP_010917119.1|  PREDICTED: uncharacterized protein LOC105041789    206   1e-57   
gb|KDO49057.1|  hypothetical protein CISIN_1g0013612mg                  205   1e-57   
ref|XP_002313993.2|  zinc finger family protein                         206   2e-57   Populus trichocarpa [western balsam poplar]
ref|XP_009785512.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    204   2e-57   
ref|XP_009785513.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    204   2e-57   
ref|XP_007011054.1|  Regulator of chromosome condensation (RCC1) ...    205   2e-57   
ref|XP_008782005.1|  PREDICTED: uncharacterized protein LOC103701639    205   2e-57   
gb|KDP36001.1|  hypothetical protein JCGZ_08396                         205   2e-57   
ref|XP_009603792.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    204   3e-57   
gb|KDO76103.1|  hypothetical protein CISIN_1g0026021mg                  189   3e-57   
ref|XP_010539249.1|  PREDICTED: uncharacterized protein LOC104813389    205   3e-57   
ref|XP_003532065.2|  PREDICTED: uncharacterized protein LOC100797527    205   3e-57   
ref|XP_007015313.1|  Regulator of chromosome condensation (RCC1) ...    203   3e-57   
ref|XP_007015312.1|  Regulator of chromosome condensation (RCC1) ...    204   3e-57   
ref|XP_010673731.1|  PREDICTED: uncharacterized protein LOC104890071    205   3e-57   
ref|XP_006420722.1|  hypothetical protein CICLE_v10004216mg             205   3e-57   
ref|XP_010269344.1|  PREDICTED: uncharacterized protein LOC104606...    204   4e-57   
ref|XP_006470863.1|  PREDICTED: uncharacterized protein LOC102630...    204   4e-57   
emb|CBI40156.3|  unnamed protein product                                203   4e-57   
ref|XP_008385699.1|  PREDICTED: uncharacterized protein LOC103448227    204   4e-57   
ref|XP_010926966.1|  PREDICTED: uncharacterized protein LOC105049105    204   4e-57   
ref|XP_010269343.1|  PREDICTED: uncharacterized protein LOC104606...    203   5e-57   
ref|XP_006470568.1|  PREDICTED: uncharacterized protein LOC102612...    204   5e-57   
dbj|BAJ88383.1|  predicted protein                                      204   5e-57   
ref|XP_009603791.1|  PREDICTED: uncharacterized protein LOC104098...    204   6e-57   
ref|XP_006446270.1|  hypothetical protein CICLE_v10014100mg             204   6e-57   
ref|XP_009350077.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    204   6e-57   
ref|XP_009785511.1|  PREDICTED: uncharacterized protein LOC104233...    204   6e-57   
gb|KHG19721.1|  putative E3 ubiquitin-protein ligase HERC1              204   6e-57   
ref|XP_008348288.1|  PREDICTED: uncharacterized protein LOC103411430    204   6e-57   
ref|XP_004291740.1|  PREDICTED: uncharacterized protein LOC101306203    204   6e-57   
ref|XP_009395123.1|  PREDICTED: uncharacterized protein LOC103980429    204   7e-57   
emb|CBI24230.3|  unnamed protein product                                203   7e-57   
ref|XP_010269342.1|  PREDICTED: uncharacterized protein LOC104606...    204   7e-57   
ref|XP_009399981.1|  PREDICTED: uncharacterized protein LOC103984245    204   8e-57   
ref|XP_007015311.1|  Regulator of chromosome condensation (RCC1) ...    204   8e-57   
ref|XP_010938572.1|  PREDICTED: uncharacterized protein LOC105057618    204   8e-57   
ref|XP_010269339.1|  PREDICTED: uncharacterized protein LOC104606...    204   8e-57   
ref|XP_011090167.1|  PREDICTED: uncharacterized protein LOC105170925    204   9e-57   
ref|XP_002527043.1|  Ran GTPase binding protein, putative               204   9e-57   Ricinus communis
ref|XP_002279847.2|  PREDICTED: uncharacterized protein LOC100248282    203   1e-56   Vitis vinifera
ref|XP_003551961.1|  PREDICTED: uncharacterized protein LOC100791...    203   1e-56   
ref|XP_004252890.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    203   2e-56   
ref|XP_006349801.1|  PREDICTED: uncharacterized protein LOC102600493    203   2e-56   
ref|XP_009127757.1|  PREDICTED: uncharacterized protein LOC103852607    202   2e-56   
gb|AAG52535.1|AC013289_2  putative regulator of chromosome conden...    202   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177129.2|  regulator of chromosome condensation and FYVE z...    202   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006476624.1|  PREDICTED: probable E3 ubiquitin-protein lig...    201   2e-56   
gb|AET00240.2|  regulator of chromosome condensation (RCC1) famil...    203   2e-56   
ref|XP_006400502.1|  hypothetical protein EUTSA_v10012507mg             202   2e-56   
ref|XP_004491255.1|  PREDICTED: uncharacterized protein LOC101508617    202   2e-56   
ref|XP_006476622.1|  PREDICTED: probable E3 ubiquitin-protein lig...    201   2e-56   
ref|XP_008347000.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    199   3e-56   
ref|XP_004971285.1|  PREDICTED: uncharacterized protein LOC101782721    202   3e-56   
ref|XP_007141489.1|  hypothetical protein PHAVU_008G200300g             202   3e-56   
ref|XP_010420743.1|  PREDICTED: uncharacterized protein LOC104706266    202   4e-56   
ref|XP_008803202.1|  PREDICTED: uncharacterized protein LOC103716809    201   4e-56   
ref|XP_004513412.1|  PREDICTED: uncharacterized protein LOC101496615    202   4e-56   
ref|XP_002887252.1|  hypothetical protein ARALYDRAFT_476103             201   4e-56   
ref|XP_004307114.1|  PREDICTED: uncharacterized protein LOC101307830    201   4e-56   
gb|KHG00947.1|  putative E3 ubiquitin-protein ligase HERC1              202   5e-56   
gb|KFK26205.1|  hypothetical protein AALP_AA8G216200                    202   5e-56   
ref|XP_008799103.1|  PREDICTED: uncharacterized protein LOC103713841    201   5e-56   
ref|XP_011020389.1|  PREDICTED: uncharacterized protein LOC105122796    201   5e-56   
ref|XP_011080399.1|  PREDICTED: uncharacterized protein LOC105163660    201   5e-56   
ref|XP_010454214.1|  PREDICTED: uncharacterized protein LOC104736008    201   6e-56   
ref|XP_010493003.1|  PREDICTED: uncharacterized protein LOC104770301    201   6e-56   
ref|XP_006286943.1|  hypothetical protein CARUB_v10000090mg             201   6e-56   
dbj|BAD87854.1|  putative ZR1 protein                                   201   6e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006470569.1|  PREDICTED: uncharacterized protein LOC102612...    200   7e-56   
gb|EEE56014.1|  hypothetical protein OsJ_04782                          201   7e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72175.1|  hypothetical protein OsI_05225                          201   7e-56   Oryza sativa Indica Group [Indian rice]
ref|NP_001045419.2|  Os01g0952300                                       201   9e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009361965.1|  PREDICTED: uncharacterized protein LOC103952146    201   9e-56   
gb|EEC79138.1|  hypothetical protein OsI_19792                          202   9e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_002304793.1|  hypothetical protein POPTR_0003s19720g             201   9e-56   Populus trichocarpa [western balsam poplar]
ref|XP_010453304.1|  PREDICTED: uncharacterized protein LOC104735251    201   1e-55   
gb|KDO54854.1|  hypothetical protein CISIN_1g0026771mg                  199   1e-55   
gb|EEE63569.1|  hypothetical protein OsJ_18386                          201   1e-55   Oryza sativa Japonica Group [Japonica rice]
gb|KDO54855.1|  hypothetical protein CISIN_1g0026771mg                  199   1e-55   
ref|XP_006646687.1|  PREDICTED: uncharacterized protein LOC102710941    200   1e-55   
ref|XP_003565075.1|  PREDICTED: uncharacterized protein LOC100834588    200   1e-55   
gb|KHN12021.1|  Putative E3 ubiquitin-protein ligase HERC1              200   1e-55   
ref|XP_007221066.1|  hypothetical protein PRUPE_ppa016519mg             200   1e-55   
ref|XP_011000561.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    200   1e-55   
ref|XP_003545401.1|  PREDICTED: uncharacterized protein LOC100802...    200   2e-55   
ref|XP_006595771.1|  PREDICTED: uncharacterized protein LOC100802...    200   2e-55   
ref|XP_002873947.1|  hypothetical protein ARALYDRAFT_488831             200   2e-55   
emb|CDY44086.1|  BnaA02g14500D                                          199   2e-55   
ref|XP_006470567.1|  PREDICTED: uncharacterized protein LOC102612...    200   2e-55   
ref|XP_004511219.1|  PREDICTED: uncharacterized protein LOC101514...    199   2e-55   
ref|XP_006575629.1|  PREDICTED: uncharacterized protein LOC100806...    198   2e-55   
emb|CDP08456.1|  unnamed protein product                                199   3e-55   
ref|XP_010031729.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2       199   3e-55   
ref|XP_010536113.1|  PREDICTED: uncharacterized protein LOC104811189    199   3e-55   
ref|XP_007146313.1|  hypothetical protein PHAVU_006G030000g             199   3e-55   
ref|XP_007213716.1|  hypothetical protein PRUPE_ppa000548mg             199   4e-55   
ref|XP_008227676.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2       199   4e-55   
emb|CDY28580.1|  BnaC02g19490D                                          199   4e-55   
ref|XP_003519514.1|  PREDICTED: uncharacterized protein LOC100806...    199   4e-55   
ref|XP_010519782.1|  PREDICTED: bifunctional serine/threonine-pro...    199   4e-55   
gb|KHN38378.1|  Putative E3 ubiquitin-protein ligase HERC1              199   4e-55   
ref|XP_006575628.1|  PREDICTED: uncharacterized protein LOC100806...    199   4e-55   
ref|XP_006399751.1|  hypothetical protein EUTSA_v10012520mg             199   4e-55   
ref|XP_007153813.1|  hypothetical protein PHAVU_003G066900g             197   4e-55   
ref|XP_006575627.1|  PREDICTED: uncharacterized protein LOC100806...    199   5e-55   
ref|NP_197443.3|  regulator of chromosome condensation-like prote...    199   5e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85690.1|  BnaA02g01230D                                          198   5e-55   
ref|XP_002871523.1|  ran GTPase binding protein                         198   5e-55   
emb|CDP12338.1|  unnamed protein product                                197   6e-55   
ref|XP_008363119.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2       199   6e-55   
ref|XP_008449668.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    199   6e-55   
ref|NP_568268.3|  Regulator of chromosome condensation-like prote...    198   6e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424068.1|  PREDICTED: uncharacterized protein LOC104709101    198   6e-55   
ref|XP_010491996.1|  PREDICTED: uncharacterized protein LOC104769476    198   7e-55   
ref|XP_006286948.1|  hypothetical protein CARUB_v10000094mg             198   8e-55   
ref|XP_008656863.1|  PREDICTED: uncharacterized protein LOC103636281    198   8e-55   
ref|XP_008375471.1|  PREDICTED: uncharacterized protein LOC103438700    198   8e-55   
emb|CDX91165.1|  BnaC02g04320D                                          198   8e-55   
ref|XP_002513064.1|  Ran GTPase binding protein, putative               198   9e-55   Ricinus communis
emb|CDM86514.1|  unnamed protein product                                198   9e-55   
gb|EPS63615.1|  hypothetical protein M569_11169                         198   1e-54   
ref|XP_011004007.1|  PREDICTED: uncharacterized protein LOC105110613    197   1e-54   
gb|KCW51717.1|  hypothetical protein EUGRSUZ_J01184                     197   1e-54   
ref|XP_002511559.1|  Ran GTPase binding protein, putative               197   1e-54   Ricinus communis
ref|XP_009121854.1|  PREDICTED: uncharacterized protein LOC103846644    197   1e-54   
gb|KFK25508.1|  hypothetical protein AALP_AA8G123700                    197   1e-54   
ref|XP_011015114.1|  PREDICTED: uncharacterized protein LOC105118779    197   1e-54   
ref|XP_010032303.1|  PREDICTED: uncharacterized protein LOC104421...    197   1e-54   
ref|XP_010032302.1|  PREDICTED: uncharacterized protein LOC104421...    197   1e-54   
ref|XP_010032304.1|  PREDICTED: uncharacterized protein LOC104421...    197   2e-54   
ref|XP_004140201.1|  PREDICTED: uncharacterized protein LOC101207486    197   2e-54   
ref|XP_010555025.1|  PREDICTED: uncharacterized protein LOC104824622    197   2e-54   
emb|CDX97187.1|  BnaC09g44380D                                          197   2e-54   
ref|XP_009131736.1|  PREDICTED: uncharacterized protein LOC103856379    197   2e-54   
ref|XP_003617281.1|  Lateral signaling target protein-like protein      197   2e-54   
ref|XP_009125861.1|  PREDICTED: uncharacterized protein LOC103850825    197   2e-54   
gb|EYU35939.1|  hypothetical protein MIMGU_mgv1a019835mg                196   4e-54   
emb|CDX69686.1|  BnaA10g20350D                                          196   5e-54   
ref|XP_007037300.1|  Ran GTPase binding protein, putative isoform 3     194   1e-53   
ref|XP_007037299.1|  Ran GTPase binding protein, putative isoform 2     194   1e-53   
ref|XP_007037301.1|  Ran GTPase binding protein, putative isoform 4     194   1e-53   
ref|XP_008450356.1|  PREDICTED: uncharacterized protein LOC103491987    195   1e-53   
ref|XP_007037298.1|  Ran GTPase binding protein, putative isoform 1     194   1e-53   
ref|XP_004139058.1|  PREDICTED: uncharacterized protein LOC101219074    194   2e-53   
ref|XP_004154652.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    194   2e-53   
ref|XP_010670475.1|  PREDICTED: uncharacterized protein LOC104887522    194   3e-53   
ref|XP_006827182.1|  hypothetical protein AMTR_s00010p00256680          193   4e-53   
emb|CDX70876.1|  BnaC03g09600D                                          193   4e-53   
ref|XP_011024954.1|  PREDICTED: uncharacterized protein LOC105125...    193   4e-53   
emb|CDX88891.1|  BnaA03g07580D                                          193   4e-53   
ref|XP_002298476.2|  zinc finger family protein                         193   5e-53   Populus trichocarpa [western balsam poplar]
ref|XP_006390980.1|  hypothetical protein EUTSA_v10018063mg             192   5e-53   
ref|XP_010547351.1|  PREDICTED: uncharacterized protein LOC104819...    193   6e-53   
gb|EYU35847.1|  hypothetical protein MIMGU_mgv1a018189mg                191   1e-52   
ref|NP_001190338.1|  regulator of chromosome condensation-like pr...    192   1e-52   
ref|XP_011024953.1|  PREDICTED: uncharacterized protein LOC105125...    191   2e-52   
ref|XP_009620351.1|  PREDICTED: uncharacterized protein LOC104112201    190   2e-52   
ref|XP_010227829.1|  PREDICTED: uncharacterized protein LOC100836916    180   3e-52   
ref|XP_002980107.1|  hypothetical protein SELMODRAFT_112120             191   3e-52   
ref|XP_007146310.1|  hypothetical protein PHAVU_006G029700g             175   4e-52   
gb|EMT20664.1|  Putative E3 ubiquitin-protein ligase HERC1              190   6e-52   
ref|XP_004966829.1|  PREDICTED: uncharacterized protein LOC101764879    187   3e-51   
ref|XP_009770546.1|  PREDICTED: uncharacterized protein LOC104221...    187   4e-51   
emb|CBI15243.3|  unnamed protein product                                177   4e-51   
gb|EMT20640.1|  Putative E3 ubiquitin-protein ligase HERC1              188   4e-51   
ref|XP_009770543.1|  PREDICTED: uncharacterized protein LOC104221...    187   4e-51   
emb|CDY13998.1|  BnaC09g38280D                                          186   1e-50   
ref|XP_009120889.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    186   2e-50   
ref|XP_008356820.1|  PREDICTED: uncharacterized protein LOC103420538    186   2e-50   
emb|CDX92532.1|  BnaA10g15710D                                          186   2e-50   
ref|XP_002991915.1|  hypothetical protein SELMODRAFT_430200             174   4e-50   
ref|XP_011071628.1|  PREDICTED: uncharacterized protein LOC105157032    184   5e-50   
ref|XP_006364189.1|  PREDICTED: uncharacterized protein LOC102590844    183   1e-49   
ref|XP_010663866.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    182   2e-49   
ref|XP_010503375.1|  PREDICTED: uncharacterized protein LOC104780...    182   3e-49   
ref|XP_010547813.1|  PREDICTED: X-linked retinitis pigmentosa GTP...    181   5e-49   
ref|XP_010318794.1|  PREDICTED: uncharacterized protein LOC101257...    181   5e-49   
ref|XP_010426213.1|  PREDICTED: uncharacterized protein LOC104711231    178   4e-48   
ref|XP_001761845.1|  predicted protein                                  179   5e-48   
gb|AFW83944.1|  putative regulator of chromosome condensation (RC...    179   7e-48   
ref|XP_002992739.1|  hypothetical protein SELMODRAFT_430894             177   9e-48   
ref|XP_004290546.1|  PREDICTED: uncharacterized protein LOC101304637    177   3e-47   
ref|XP_009150226.1|  PREDICTED: uncharacterized protein LOC103873573    176   4e-47   
emb|CDY21795.1|  BnaA06g20640D                                          176   4e-47   
emb|CDX77871.1|  BnaC03g53480D                                          176   4e-47   
ref|XP_010095965.1|  putative E3 ubiquitin-protein ligase HERC1         176   5e-47   
ref|XP_007201762.1|  hypothetical protein PRUPE_ppa000526mg             176   7e-47   
ref|XP_010515074.1|  PREDICTED: uncharacterized protein LOC104790973    174   2e-46   
ref|XP_010263145.1|  PREDICTED: uncharacterized protein LOC104601...    174   2e-46   
emb|CAC42896.1|  putative protein                                       174   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411942.1|  PREDICTED: uncharacterized protein LOC103993562    174   3e-46   
ref|XP_008237622.1|  PREDICTED: uncharacterized protein LOC103336358    174   3e-46   
gb|KHG15510.1|  putative E3 ubiquitin-protein ligase HERC1              174   3e-46   
ref|XP_003556142.1|  PREDICTED: uncharacterized protein LOC100811999    174   4e-46   
ref|XP_006854588.1|  hypothetical protein AMTR_s00030p00120950          174   4e-46   
ref|XP_006856002.1|  hypothetical protein AMTR_s00059p00031410          173   5e-46   
ref|XP_002526126.1|  Ran GTPase binding protein, putative               172   1e-45   Ricinus communis
emb|CBI35500.3|  unnamed protein product                                171   1e-45   
ref|XP_006483184.1|  PREDICTED: uncharacterized protein LOC102623...    171   2e-45   
gb|KDO82890.1|  hypothetical protein CISIN_1g001953mg                   171   2e-45   
gb|KDO82891.1|  hypothetical protein CISIN_1g001953mg                   171   2e-45   
ref|XP_006855611.1|  hypothetical protein AMTR_s00044p00073920          171   2e-45   
ref|XP_002264093.1|  PREDICTED: uncharacterized protein LOC100246114    171   2e-45   Vitis vinifera
ref|XP_008441536.1|  PREDICTED: uncharacterized protein LOC103485640    171   2e-45   
ref|XP_004148808.1|  PREDICTED: uncharacterized protein LOC101222741    171   3e-45   
ref|XP_010062134.1|  PREDICTED: uncharacterized protein LOC104449612    171   4e-45   
ref|XP_007019446.1|  Regulator of chromosome condensation (RCC1) ...    169   4e-45   
emb|CDP18270.1|  unnamed protein product                                171   4e-45   
ref|XP_010687585.1|  PREDICTED: uncharacterized protein LOC104901687    171   4e-45   
ref|XP_007152065.1|  hypothetical protein PHAVU_004G099000g             171   5e-45   
gb|KDP43019.1|  hypothetical protein JCGZ_25205                         171   5e-45   
ref|XP_010069123.1|  PREDICTED: uncharacterized protein LOC104456095    170   5e-45   
ref|XP_002993711.1|  hypothetical protein SELMODRAFT_431761             170   5e-45   
gb|AES62396.2|  chromosome condensation regulator RCC1 repeat pro...    170   5e-45   
ref|XP_008356221.1|  PREDICTED: uncharacterized protein LOC103419911    170   5e-45   
gb|EPS59802.1|  hypothetical protein M569_15002                         170   6e-45   
ref|XP_004515120.1|  PREDICTED: uncharacterized protein LOC101511...    170   7e-45   
ref|XP_008339128.1|  PREDICTED: uncharacterized protein LOC103402168    170   8e-45   
ref|XP_007019444.1|  Regulator of chromosome condensation (RCC1) ...    170   8e-45   
ref|XP_007019445.1|  Regulator of chromosome condensation (RCC1) ...    170   8e-45   
ref|XP_003535575.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    170   9e-45   
ref|XP_009368253.1|  PREDICTED: uncharacterized protein LOC103957773    170   9e-45   
ref|XP_011074744.1|  PREDICTED: uncharacterized protein LOC105159392    169   2e-44   
ref|XP_010247275.1|  PREDICTED: uncharacterized protein LOC104590345    169   2e-44   
ref|XP_006292617.1|  hypothetical protein CARUB_v10018859mg             167   3e-44   
ref|XP_010533394.1|  PREDICTED: uncharacterized protein LOC104809...    168   3e-44   
gb|KEH25818.1|  chromosome condensation regulator RCC1 repeat pro...    168   4e-44   
ref|XP_003518608.1|  PREDICTED: uncharacterized protein LOC100805364    168   4e-44   
ref|XP_010482021.1|  PREDICTED: uncharacterized protein LOC104760...    167   4e-44   
ref|XP_010482022.1|  PREDICTED: uncharacterized protein LOC104760...    167   5e-44   
ref|XP_009616446.1|  PREDICTED: uncharacterized protein LOC104108984    167   5e-44   
ref|XP_010530240.1|  PREDICTED: uncharacterized protein LOC104806...    167   5e-44   
ref|XP_010482023.1|  PREDICTED: uncharacterized protein LOC104760...    167   5e-44   
ref|XP_010530239.1|  PREDICTED: uncharacterized protein LOC104806...    167   5e-44   
ref|XP_009368476.1|  PREDICTED: uncharacterized protein LOC103957979    167   7e-44   
ref|XP_011101424.1|  PREDICTED: uncharacterized protein LOC105179485    167   7e-44   
ref|XP_006599510.1|  PREDICTED: probable E3 ubiquitin-protein lig...    164   7e-44   
ref|XP_002863817.1|  hypothetical protein ARALYDRAFT_917597             167   8e-44   
ref|XP_006279937.1|  hypothetical protein CARUB_v10025795mg             167   8e-44   
ref|XP_006404354.1|  hypothetical protein EUTSA_v10011027mg             166   8e-44   
emb|CDY11586.1|  BnaC06g31530D                                          166   1e-43   
ref|XP_010652204.1|  PREDICTED: uncharacterized protein LOC100250...    166   1e-43   
ref|XP_011042822.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2       166   1e-43   
emb|CDY47138.1|  BnaA08g05450D                                          166   1e-43   
ref|XP_010533392.1|  PREDICTED: uncharacterized protein LOC104809...    166   1e-43   
ref|XP_002300931.1|  chromosome condensation regulator family pro...    166   1e-43   
ref|XP_004515119.1|  PREDICTED: uncharacterized protein LOC101511...    166   1e-43   
ref|XP_010445928.1|  PREDICTED: uncharacterized protein LOC104728670    167   1e-43   
ref|XP_007143519.1|  hypothetical protein PHAVU_007G078300g             166   1e-43   
ref|XP_009365985.1|  PREDICTED: uncharacterized protein LOC103955813    166   2e-43   
gb|KDO83669.1|  hypothetical protein CISIN_1g001236mg                   166   2e-43   
ref|XP_002281342.2|  PREDICTED: uncharacterized protein LOC100254552    166   2e-43   
gb|KHN15444.1|  Putative E3 ubiquitin-protein ligase HERC1              166   2e-43   
ref|XP_006472955.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    166   2e-43   
gb|KDO83668.1|  hypothetical protein CISIN_1g001236mg                   166   2e-43   
ref|XP_008382399.1|  PREDICTED: uncharacterized protein LOC103445186    166   2e-43   
ref|XP_009775743.1|  PREDICTED: uncharacterized protein LOC104225600    166   2e-43   
ref|XP_009105712.1|  PREDICTED: uncharacterized protein LOC103831580    166   2e-43   
ref|XP_008461940.1|  PREDICTED: uncharacterized protein LOC103500422    166   2e-43   
ref|XP_002307488.1|  chromosome condensation regulator family pro...    166   2e-43   
ref|NP_190350.4|  Regulator of chromosome condensation (RCC1) fam...    165   2e-43   
emb|CAB61992.1|  putative protein                                       165   3e-43   
ref|XP_004139677.1|  PREDICTED: uncharacterized protein LOC101214149    166   3e-43   
ref|XP_006600015.1|  PREDICTED: uncharacterized protein LOC102660152    165   3e-43   
ref|XP_010911949.1|  PREDICTED: uncharacterized protein LOC105037994    165   4e-43   
gb|KFK32945.1|  hypothetical protein AALP_AA6G309800                    165   5e-43   
ref|XP_010246209.1|  PREDICTED: uncharacterized protein LOC104589...    164   5e-43   
ref|XP_001770494.1|  predicted protein                                  165   5e-43   
ref|XP_009608585.1|  PREDICTED: uncharacterized protein LOC104102557    164   5e-43   
ref|XP_010245275.1|  PREDICTED: uncharacterized protein LOC104588850    164   6e-43   
ref|XP_002875858.1|  regulator of chromosome condensation family ...    164   6e-43   
ref|XP_010652202.1|  PREDICTED: uncharacterized protein LOC100250...    164   8e-43   
ref|XP_010999798.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2       164   9e-43   
ref|XP_008785790.1|  PREDICTED: uncharacterized protein LOC103704...    164   1e-42   
ref|XP_010246208.1|  PREDICTED: uncharacterized protein LOC104589...    164   1e-42   
ref|XP_010680417.1|  PREDICTED: uncharacterized protein LOC104895565    164   1e-42   
ref|XP_006362814.1|  PREDICTED: uncharacterized protein LOC102604257    163   2e-42   
ref|XP_004296374.1|  PREDICTED: uncharacterized protein LOC101302544    162   3e-42   
ref|XP_003636756.1|  Chromosome condensation regulator protein          163   3e-42   
ref|XP_010451525.1|  PREDICTED: 1-phosphatidylinositol 4,5-bispho...    150   3e-42   
gb|EYU26996.1|  hypothetical protein MIMGU_mgv1a022703mg                162   3e-42   
emb|CDY70949.1|  BnaC06g43200D                                          156   3e-42   
ref|XP_006434432.1|  hypothetical protein CICLE_v10000092mg             162   4e-42   
ref|XP_010935924.1|  PREDICTED: uncharacterized protein LOC105055696    162   5e-42   
ref|XP_004237767.1|  PREDICTED: uncharacterized protein LOC101260...    162   5e-42   
ref|XP_008784135.1|  PREDICTED: uncharacterized protein LOC103703...    162   5e-42   
ref|XP_008784134.1|  PREDICTED: uncharacterized protein LOC103703...    162   5e-42   
ref|XP_008784136.1|  PREDICTED: uncharacterized protein LOC103703...    162   6e-42   
ref|XP_010317406.1|  PREDICTED: uncharacterized protein LOC101263083    161   7e-42   
ref|XP_009765012.1|  PREDICTED: uncharacterized protein LOC104216614    161   8e-42   
ref|NP_199029.1|  Regulator of chromosome condensation (RCC1) fam...    161   9e-42   
ref|XP_004496492.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    160   2e-41   
ref|XP_009386434.1|  PREDICTED: uncharacterized protein LOC103973552    160   2e-41   
ref|XP_006356114.1|  PREDICTED: uncharacterized protein LOC102591374    160   2e-41   
ref|XP_004492532.1|  PREDICTED: uncharacterized protein LOC101515...    160   2e-41   
ref|XP_004492531.1|  PREDICTED: uncharacterized protein LOC101515...    160   2e-41   
ref|XP_006390883.1|  hypothetical protein EUTSA_v10019747mg             160   3e-41   
ref|XP_008464943.1|  PREDICTED: uncharacterized protein LOC103502691    160   3e-41   
ref|XP_011091308.1|  PREDICTED: uncharacterized protein LOC105171777    160   3e-41   
gb|KFK42089.1|  hypothetical protein AALP_AA2G209500                    159   4e-41   
gb|EYU36844.1|  hypothetical protein MIMGU_mgv1a000614mg                159   5e-41   
emb|CDO99240.1|  unnamed protein product                                159   6e-41   
ref|XP_002311672.2|  disease resistance family protein                  159   8e-41   
gb|KHG30704.1|  putative E3 ubiquitin-protein ligase HERC1              159   8e-41   
ref|XP_006390138.1|  hypothetical protein EUTSA_v10018039mg             158   8e-41   
ref|XP_006390139.1|  hypothetical protein EUTSA_v10018039mg             158   9e-41   
ref|XP_011029821.1|  PREDICTED: uncharacterized protein LOC105129442    158   9e-41   
ref|XP_004141119.1|  PREDICTED: uncharacterized protein LOC101220986    158   1e-40   
gb|KHG16531.1|  E3 ubiquitin-protein ligase HERC2                       157   1e-40   
gb|KGN59721.1|  hypothetical protein Csa_3G840960                       158   1e-40   
ref|XP_010416621.1|  PREDICTED: uncharacterized protein LOC104702461    158   1e-40   
ref|XP_010428763.1|  PREDICTED: uncharacterized protein LOC104713360    158   1e-40   
ref|XP_007035131.1|  Regulator of chromosome condensation (RCC1) ...    158   1e-40   
ref|XP_010471858.1|  PREDICTED: uncharacterized protein LOC104751587    158   1e-40   
gb|EYU17468.1|  hypothetical protein MIMGU_mgv1a000524mg                157   1e-40   
ref|XP_010108664.1|  putative E3 ubiquitin-protein ligase HERC1         158   1e-40   
ref|XP_010912400.1|  PREDICTED: uncharacterized protein LOC105038...    157   2e-40   
ref|XP_010912399.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    157   2e-40   
ref|XP_002887663.1|  zinc finger protein                                157   2e-40   
ref|XP_008810526.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    157   2e-40   
ref|XP_006653059.1|  PREDICTED: uncharacterized protein LOC102704416    157   3e-40   
ref|XP_009104646.1|  PREDICTED: uncharacterized protein LOC103830587    157   3e-40   
ref|XP_006301556.1|  hypothetical protein CARUB_v10021990mg             157   3e-40   
emb|CDX87557.1|  BnaA07g33160D                                          156   4e-40   
ref|XP_009106357.1|  PREDICTED: uncharacterized protein LOC103832150    156   4e-40   
ref|XP_002533468.1|  Ran GTPase binding protein, putative               156   4e-40   
ref|XP_008366257.1|  PREDICTED: probable E3 ubiquitin-protein lig...    156   5e-40   
gb|AAL58903.1|AF462811_1  At1g76950/F22K20_5                            156   5e-40   
ref|XP_009147090.1|  PREDICTED: uncharacterized protein LOC103870680    156   5e-40   
ref|NP_565144.1|  protein PRAF1                                         156   6e-40   
ref|XP_002526580.1|  Ran GTPase binding protein, putative               156   6e-40   
emb|CDY49416.1|  BnaCnng17260D                                          156   6e-40   
ref|XP_008227901.1|  PREDICTED: uncharacterized protein LOC103327368    155   8e-40   
ref|XP_003623558.1|  Chromosome condensation regulator-like protein     155   9e-40   
gb|EEC78290.1|  hypothetical protein OsI_18002                          155   9e-40   
ref|NP_001054325.1|  Os04g0686200                                       155   9e-40   
ref|XP_008224348.1|  PREDICTED: uncharacterized protein LOC103324...    155   1e-39   
ref|XP_008224347.1|  PREDICTED: uncharacterized protein LOC103324...    155   1e-39   
emb|CDX88324.1|  BnaC06g37680D                                          155   1e-39   
emb|CDX68076.1|  BnaA07g21160D                                          154   1e-39   
ref|XP_004959991.1|  PREDICTED: uncharacterized protein LOC101771832    154   2e-39   
emb|CDY12764.1|  BnaC04g28770D                                          154   2e-39   
gb|AAC00618.1|  Unknown protein, contains regulator of chromosome...    154   2e-39   
ref|XP_007224834.1|  hypothetical protein PRUPE_ppa023189mg             154   2e-39   
gb|KFK21924.1|  hypothetical protein AALP_AAs63887U000400               154   4e-39   
ref|XP_011074548.1|  PREDICTED: uncharacterized protein LOC105159...    153   8e-39   
ref|XP_010551689.1|  PREDICTED: uncharacterized protein LOC104822243    152   8e-39   
emb|CBI27342.3|  unnamed protein product                                152   8e-39   
ref|XP_010648895.1|  PREDICTED: uncharacterized protein LOC100253065    152   1e-38   
ref|XP_010440480.1|  PREDICTED: uncharacterized protein LOC104723774    152   1e-38   
ref|XP_001770491.1|  predicted protein                                  152   1e-38   
ref|XP_010436598.1|  PREDICTED: uncharacterized protein LOC104720387    152   1e-38   
ref|XP_006282803.1|  hypothetical protein CARUB_v10006456mg             152   1e-38   
ref|NP_001154232.2|  regulator of chromosome condensation repeat-...    152   1e-38   
emb|CAN82853.1|  hypothetical protein VITISV_028768                     152   1e-38   
gb|EMT05572.1|  Putative E3 ubiquitin-protein ligase HERC2              152   1e-38   
ref|XP_009400323.1|  PREDICTED: uncharacterized protein LOC103984534    152   1e-38   
ref|XP_007216689.1|  hypothetical protein PRUPE_ppa026859mg             151   2e-38   
gb|KFK39615.1|  hypothetical protein AALP_AA3G267000                    151   2e-38   
ref|XP_010105606.1|  putative E3 ubiquitin-protein ligase HERC1         151   3e-38   
ref|XP_008668206.1|  PREDICTED: uncharacterized protein LOC100304...    151   3e-38   
ref|XP_010532647.1|  PREDICTED: uncharacterized protein LOC104808625    151   4e-38   
ref|XP_008668207.1|  PREDICTED: uncharacterized protein LOC100304...    150   4e-38   
ref|XP_010908615.1|  PREDICTED: uncharacterized protein LOC105034955    150   5e-38   
ref|XP_003580861.1|  PREDICTED: uncharacterized protein LOC100835...    150   5e-38   
emb|CAJ86040.1|  H0723C07.10                                            150   6e-38   
ref|XP_010240645.1|  PREDICTED: uncharacterized protein LOC100835...    150   7e-38   
gb|AES60260.2|  chromosome condensation regulator RCC1 repeat pro...    150   8e-38   
ref|XP_006575771.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    150   9e-38   
ref|XP_010539720.1|  PREDICTED: uncharacterized protein LOC104813...    150   9e-38   
gb|KHN00263.1|  Putative E3 ubiquitin-protein ligase HERC1              150   9e-38   
ref|XP_006420243.1|  hypothetical protein CICLE_v10004207mg             150   9e-38   
ref|XP_006489723.1|  PREDICTED: uncharacterized protein LOC102629726    150   9e-38   
ref|XP_003536842.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    149   1e-37   
gb|KHN00291.1|  Putative E3 ubiquitin-protein ligase HERC1              149   1e-37   
gb|KFK40126.1|  hypothetical protein AALP_AA3G333600                    140   1e-37   
emb|CBI23652.3|  unnamed protein product                                149   2e-37   
ref|XP_003592145.1|  Lateral signaling target protein-like protein      149   2e-37   
ref|XP_006279150.1|  hypothetical protein CARUB_v100079710mg            137   2e-37   
ref|XP_006481958.1|  PREDICTED: uncharacterized protein LOC102629590    148   3e-37   
ref|XP_010909635.1|  PREDICTED: uncharacterized protein LOC105035685    147   4e-37   
ref|XP_008794532.1|  PREDICTED: uncharacterized protein LOC103710544    147   5e-37   
ref|XP_009390052.1|  PREDICTED: uncharacterized protein LOC103976537    147   6e-37   
gb|KHM99695.1|  Protein Brevis radix-like 1                             144   7e-37   
ref|XP_010314702.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    146   1e-36   
ref|XP_009110530.1|  PREDICTED: uncharacterized protein LOC103836061    146   1e-36   
ref|XP_010314701.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    146   1e-36   
dbj|BAA95740.1|  chromosome condensation regulator-like protein p...    146   1e-36   
ref|XP_007145857.1|  hypothetical protein PHAVU_007G273900g             146   2e-36   
emb|CDX85076.1|  BnaC07g08300D                                          145   2e-36   
gb|EMS64013.1|  E3 ubiquitin-protein ligase HERC2                       145   4e-36   
emb|CDY66504.1|  BnaAnng22340D                                          144   5e-36   
emb|CDX77534.1|  BnaA07g06720D                                          144   8e-36   
ref|XP_006300290.1|  hypothetical protein CARUB_v100164061mg            139   9e-36   
ref|XP_003590009.1|  Serine/threonine protein kinase Nek9               144   9e-36   
ref|XP_009102772.1|  PREDICTED: uncharacterized protein LOC103828885    144   1e-35   
ref|XP_008654599.1|  PREDICTED: uncharacterized protein LOC100273...    143   1e-35   
ref|XP_010106869.1|  E3 ubiquitin-protein ligase HERC2                  143   2e-35   
ref|XP_009410703.1|  PREDICTED: uncharacterized protein LOC103992609    142   3e-35   
emb|CDP01697.1|  unnamed protein product                                142   3e-35   
ref|XP_008802137.1|  PREDICTED: probable E3 ubiquitin-protein lig...    142   4e-35   
ref|XP_008802135.1|  PREDICTED: uncharacterized protein LOC103716...    142   4e-35   
gb|EMS48101.1|  E3 ubiquitin-protein ligase HERC2                       142   5e-35   
ref|XP_007145858.1|  hypothetical protein PHAVU_007G273900g             141   8e-35   
ref|XP_010227233.1|  PREDICTED: uncharacterized protein LOC100842512    140   2e-34   
ref|XP_006406056.1|  hypothetical protein EUTSA_v10019964mg             140   2e-34   
ref|XP_007146986.1|  hypothetical protein PHAVU_006G086900g             140   2e-34   
ref|XP_008649951.1|  PREDICTED: uncharacterized protein LOC103630677    139   3e-34   
gb|KHF97252.1|  putative E3 ubiquitin-protein ligase HERC1              139   4e-34   
ref|XP_010231070.1|  PREDICTED: uncharacterized protein LOC100827763    139   4e-34   
ref|XP_002456212.1|  hypothetical protein SORBIDRAFT_03g032200          138   1e-33   
ref|XP_010496080.1|  PREDICTED: uncharacterized protein LOC104773203    127   1e-33   
gb|EMS68323.1|  putative E3 ubiquitin-protein ligase HERC1              137   2e-33   
ref|XP_002883417.1|  regulator of chromosome condensation family ...    137   2e-33   
ref|XP_006654738.1|  PREDICTED: uncharacterized protein LOC102707400    137   3e-33   
gb|EMT17174.1|  Putative E3 ubiquitin-protein ligase HERC1              137   3e-33   
ref|XP_011043875.1|  PREDICTED: uncharacterized protein LOC105139209    137   3e-33   
ref|XP_007011055.1|  Regulator of chromosome condensation (RCC1) ...    137   3e-33   
ref|XP_004961333.1|  PREDICTED: uncharacterized protein LOC101786292    136   3e-33   
ref|XP_002441460.1|  hypothetical protein SORBIDRAFT_09g027250          136   3e-33   
ref|XP_002297742.1|  hypothetical protein POPTR_0001s06420g             135   7e-33   
gb|EEC71342.1|  hypothetical protein OsI_03406                          135   8e-33   
ref|XP_009367145.1|  PREDICTED: probable E3 ubiquitin-protein lig...    135   8e-33   
ref|XP_009367146.1|  PREDICTED: probable E3 ubiquitin-protein lig...    135   8e-33   
gb|EEE55253.1|  hypothetical protein OsJ_03147                          135   9e-33   
ref|XP_006372478.1|  regulator of chromosome condensation (RCC1) ...    135   1e-32   
ref|XP_010528597.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    135   1e-32   
gb|EEE64566.1|  hypothetical protein OsJ_19418                          135   1e-32   
gb|EEC79635.1|  hypothetical protein OsI_20852                          135   1e-32   
ref|XP_006602295.1|  PREDICTED: uncharacterized protein LOC100791...    135   1e-32   
ref|XP_009631453.1|  PREDICTED: uncharacterized protein LOC104121...    135   1e-32   
ref|XP_011038333.1|  PREDICTED: uncharacterized protein LOC105135...    135   1e-32   
gb|AAT44179.1|  putative regulator of chromosome condensation pro...    135   2e-32   
ref|XP_007140147.1|  hypothetical protein PHAVU_008G087700g             134   2e-32   
ref|NP_188968.1|  regulator of chromosome condensation-like prote...    134   3e-32   
ref|NP_001043984.1|  Os01g0700200                                       134   3e-32   
ref|XP_004976599.1|  PREDICTED: uncharacterized protein LOC101769145    134   3e-32   



>emb|CDP00317.1| unnamed protein product [Coffea canephora]
Length=1037

 Score =   259 bits (662),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 147/200 (74%), Gaps = 28/200 (14%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAIT LKKGAFLLKYGRRGKPKFCPFRLS DESAL+WYYGKEEKQLEL +VSRIIPG
Sbjct  13   DIDQAITALKKGAFLLKYGRRGKPKFCPFRLSTDESALIWYYGKEEKQLELRQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVW  GLKAL+++GSY K    
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWFFGLKALVAHGSYHKARID  132

Query  350  -----------------------DQEDTQRSKSLTQGGLGKAFADIVSYTASSKTHTFAD  460
                                   D  DT R++S+ Q  LGKAFAD+VSYTA+SK    A+
Sbjct  133  TKAETSSCDSPRSRRTSPPSLPFDHGDTPRAESIPQSRLGKAFADVVSYTATSKNSFLAE  192

Query  461  TNSYSVSPL-PTDVGSPNAR  517
             N+ + S L P    + N+R
Sbjct  193  INTSTASSLIPGAADNSNSR  212



>ref|XP_009769888.1| PREDICTED: uncharacterized protein LOC104220679 [Nicotiana sylvestris]
Length=1027

 Score =   245 bits (625),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 149/201 (74%), Gaps = 28/201 (14%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAI  LKKGA LLKYGRRGKPKFCPFRLS DESAL+WY+GKEEKQLEL  VSRIIPG
Sbjct  13   DIDQAIAALKKGANLLKYGRRGKPKFCPFRLSNDESALVWYHGKEEKQLELCHVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTAIFQRYPRPEKEYQSFSLI NDRSLD+ICKDKDEAEVW+ GLKA+I+ G  +K    
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLICNDRSLDLICKDKDEAEVWIAGLKAIITRGRSRKGRND  132

Query  350  -----------------------DQEDTQRSKSLTQGGLGKAFADIVSYTASSKTHTFAD  460
                                   DQ D QR+++L Q  LGKA+ADI+SYTA+SK+ T A+
Sbjct  133  ARSEPVFPDSPFGEQVTTSTSSIDQGDNQRTENLPQSRLGKAYADIISYTAASKSPTLAE  192

Query  461  TNSYSVSPLPTD-VGSPNARN  520
            T ++++S L +  V + NAR+
Sbjct  193  TVAFNLSSLSSGTVDNSNARS  213



>ref|XP_009598715.1| PREDICTED: uncharacterized protein LOC104094479 [Nicotiana tomentosiformis]
Length=1030

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 149/201 (74%), Gaps = 28/201 (14%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAI  LKKGA LLKYGRRGKPKFCPFRLS DESAL+WY+GKEEKQLEL  VSRIIPG
Sbjct  13   DIDQAIAALKKGANLLKYGRRGKPKFCPFRLSNDESALVWYHGKEEKQLELCHVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTAIFQRYPRPEKEYQSFSLI NDRSLD+ICKDKDEAEVW+ GLKA+I+ G  +K    
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLICNDRSLDLICKDKDEAEVWIAGLKAIITRGRSRKGRND  132

Query  350  -----------------------DQEDTQRSKSLTQGGLGKAFADIVSYTASSKTHTFAD  460
                                   +Q D QR++SL Q  LGKA+ADI+SYTA++K+ T A+
Sbjct  133  ARSEPVFPDSPHGERVTTSTSSIEQGDNQRTESLPQSRLGKAYADIISYTAAAKSPTLAE  192

Query  461  TNSYSVSPLPTD-VGSPNARN  520
            T ++++S L +  V + NAR+
Sbjct  193  TVAFNLSSLSSGTVDNSNARS  213



>ref|XP_004238788.1| PREDICTED: uncharacterized protein LOC101262813 [Solanum lycopersicum]
Length=1031

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 146/201 (73%), Gaps = 28/201 (14%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAI  LKKGA LLKYGRRGKPKFCPFRLS DESA++WY+ KEEKQLEL  VSRIIPG
Sbjct  13   DIDQAIAALKKGANLLKYGRRGKPKFCPFRLSNDESAVVWYHDKEEKQLELCHVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTAIFQRYPRPEKEYQSFSLI NDRSLD+ICKDKDEAEVW+TGLKA+I+ G  ++    
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLICNDRSLDLICKDKDEAEVWITGLKAIITRGRSRRGKYD  132

Query  350  -----------------------DQEDTQRSKSLTQGGLGKAFADIVSYTASSKTHTFAD  460
                                   DQ D QR++SL Q  LGKA+ADI+ YTA+ K+ T A+
Sbjct  133  ARSETMFSDSPLGQRVTTSTSSIDQGDNQRTESLPQSRLGKAYADIIQYTAAGKSPTLAE  192

Query  461  TNSYSVSPLPTD-VGSPNARN  520
            T S+++S L    + + NAR+
Sbjct  193  TGSFNLSSLSAGAIDNSNARS  213



>ref|XP_006363228.1| PREDICTED: uncharacterized protein LOC102588539 [Solanum tuberosum]
Length=1031

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 144/201 (72%), Gaps = 28/201 (14%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D DQAI  LKKGA LLKYGRRGKPKFCPFRLS DESA++WY+ KEEKQLEL  VSRIIPG
Sbjct  13   DTDQAIAALKKGANLLKYGRRGKPKFCPFRLSNDESAVVWYHDKEEKQLELCHVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTAIFQRYPRPEKEYQSFSLI NDRSLD+ICKDKDEAEVW+TGLKA+I+ G  ++    
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLICNDRSLDLICKDKDEAEVWITGLKAIITRGRSRRGKYD  132

Query  350  -----------------------DQEDTQRSKSLTQGGLGKAFADIVSYTASSKTHTFAD  460
                                   DQ D QR++SL Q  LGKA+ADI+ YTA+ K+ T  +
Sbjct  133  ARSETVFSDSPHGQRVTTSTSSIDQGDNQRTESLPQSRLGKAYADIIQYTAAGKSPTLVE  192

Query  461  TNSYSVSPLPTD-VGSPNARN  520
            T S+++S L    V + NAR+
Sbjct  193  TGSFNLSSLSAGAVDNSNARS  213



>gb|EYU28734.1| hypothetical protein MIMGU_mgv1a000772mg [Erythranthe guttata]
Length=990

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 140/190 (74%), Gaps = 27/190 (14%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+WYYGK+EKQLEL +VSRIIPG
Sbjct  13   DIDQAITALKKGAHLLKYGRRGKPKFCPFRLSNDESTLIWYYGKDEKQLELRQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRT+IFQRYPRPEKEYQSFSLIY+DRSLD+ICKDKDEAE W  GLKALI+ GSY+K    
Sbjct  73   QRTSIFQRYPRPEKEYQSFSLIYSDRSLDLICKDKDEAEAWFVGLKALIARGSYKKQRNE  132

Query  350  ----------------------DQEDT-QRSKSLTQGGLGKAFADIVSYTASSKTHTFAD  460
                                  DQ +T QRS++ +Q  LGKAFAD++S+TA++K     D
Sbjct  133  AKNETASSDTPRGCRVSPAISFDQAETQQRSENTSQSRLGKAFADVLSFTATTKNPQPPD  192

Query  461  TNSYSVSPLP  490
              SY  + LP
Sbjct  193  PLSYPSTLLP  202



>emb|CBI31979.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 135/186 (73%), Gaps = 33/186 (18%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAI  LKKGA+LLKYGRRGKPKFCPFRLS DES L+WY GKEEKQL+LN VSRIIPG
Sbjct  13   DVEQAIVALKKGAYLLKYGRRGKPKFCPFRLSNDESMLIWYSGKEEKQLKLNNVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRT IFQRYPRPEKEYQSFSLIY DRSLD+ICKDKDEAEVW  GLK LIS G+Y+K    
Sbjct  73   QRTPIFQRYPRPEKEYQSFSLIYGDRSLDLICKDKDEAEVWFIGLKGLISRGNYRKWRSE  132

Query  350  -------------------------DQEDTQRSK----SLTQGGLGKAFADIVSYTASSK  442
                                     D  DTQ+++    ++ Q GLGKAF+D++SYTAS+K
Sbjct  133  IRDDSISSESPHSRARRISPSLSSSDPGDTQQTQVTFENIPQSGLGKAFSDVISYTASTK  192

Query  443  THTFAD  460
            + T A+
Sbjct  193  SFTQAE  198



>ref|XP_006438667.1| hypothetical protein CICLE_v10030553mg [Citrus clementina]
 gb|ESR51907.1| hypothetical protein CICLE_v10030553mg [Citrus clementina]
Length=1164

 Score =   236 bits (601),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 142/195 (73%), Gaps = 33/195 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            +I+QAIT LKKGA+LLKYGRRGKPKFCPF LS DES L+WY GKEE+QL+LN+VSRIIPG
Sbjct  13   EIEQAITLLKKGAYLLKYGRRGKPKFCPFHLSNDESMLIWYSGKEERQLKLNQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA FQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVWL GLKALI+ G++ K    
Sbjct  73   QRTATFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWLVGLKALITRGTHSKWKLG  132

Query  350  -----DQEDTQRSK------------------------SLTQGGLGKAFADIVSYTASSK  442
                    D+ R++                        +++  GLGKAFADI+SYT ++ 
Sbjct  133  TINCSTSSDSPRARIRKTSPTVTPFDFGDIQGTQVPLDNVSNNGLGKAFADIISYTEAAN  192

Query  443  THTFADTNSYSVSPL  487
            T++ AD+ S+S SPL
Sbjct  193  TNSRADSVSFSPSPL  207



>ref|XP_006483182.1| PREDICTED: uncharacterized protein LOC102623949 isoform X1 [Citrus 
sinensis]
Length=1040

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 142/195 (73%), Gaps = 33/195 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            +I+QAIT LKKGA+LLKYGRRGKPKFCPF LS DES L+WY GKEE+QL+LN+VSRIIPG
Sbjct  13   EIEQAITLLKKGAYLLKYGRRGKPKFCPFHLSNDESMLIWYSGKEERQLKLNQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA FQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVWL GLKALI+ G++ K    
Sbjct  73   QRTATFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWLVGLKALITRGTHSKWKLG  132

Query  350  -----DQEDTQRSK------------------------SLTQGGLGKAFADIVSYTASSK  442
                    D+ R++                        +++  GLGKAFADI+SYT ++ 
Sbjct  133  TINCSTSSDSPRARIRKTSPTVTPFDFGDIQGTQVPLDNVSNNGLGKAFADIISYTEAAN  192

Query  443  THTFADTNSYSVSPL  487
            T++ AD+ S+S SPL
Sbjct  193  TNSRADSVSFSPSPL  207



>ref|XP_006483183.1| PREDICTED: uncharacterized protein LOC102623949 isoform X2 [Citrus 
sinensis]
Length=1040

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 142/195 (73%), Gaps = 33/195 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            +I+QAIT LKKGA+LLKYGRRGKPKFCPF LS DES L+WY GKEE+QL+LN+VSRIIPG
Sbjct  13   EIEQAITLLKKGAYLLKYGRRGKPKFCPFHLSNDESMLIWYSGKEERQLKLNQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA FQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVWL GLKALI+ G++ K    
Sbjct  73   QRTATFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWLVGLKALITRGTHSKWKLG  132

Query  350  -----DQEDTQRSK------------------------SLTQGGLGKAFADIVSYTASSK  442
                    D+ R++                        +++  GLGKAFADI+SYT ++ 
Sbjct  133  TINCSTSSDSPRARIRKTSPTVTPFDFGDIQGTQVPLDNVSNNGLGKAFADIISYTEAAN  192

Query  443  THTFADTNSYSVSPL  487
            T++ AD+ S+S SPL
Sbjct  193  TNSRADSVSFSPSPL  207



>ref|XP_006438666.1| hypothetical protein CICLE_v10030553mg [Citrus clementina]
 gb|ESR51906.1| hypothetical protein CICLE_v10030553mg [Citrus clementina]
Length=1040

 Score =   234 bits (597),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 142/195 (73%), Gaps = 33/195 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            +I+QAIT LKKGA+LLKYGRRGKPKFCPF LS DES L+WY GKEE+QL+LN+VSRIIPG
Sbjct  13   EIEQAITLLKKGAYLLKYGRRGKPKFCPFHLSNDESMLIWYSGKEERQLKLNQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA FQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVWL GLKALI+ G++ K    
Sbjct  73   QRTATFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWLVGLKALITRGTHSKWKLG  132

Query  350  -----DQEDTQRSK------------------------SLTQGGLGKAFADIVSYTASSK  442
                    D+ R++                        +++  GLGKAFADI+SYT ++ 
Sbjct  133  TINCSTSSDSPRARIRKTSPTVTPFDFGDIQGTQVPLDNVSNNGLGKAFADIISYTEAAN  192

Query  443  THTFADTNSYSVSPL  487
            T++ AD+ S+S SPL
Sbjct  193  TNSRADSVSFSPSPL  207



>ref|XP_006483185.1| PREDICTED: uncharacterized protein LOC102623949 isoform X4 [Citrus 
sinensis]
Length=948

 Score =   234 bits (596),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 142/195 (73%), Gaps = 33/195 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            +I+QAIT LKKGA+LLKYGRRGKPKFCPF LS DES L+WY GKEE+QL+LN+VSRIIPG
Sbjct  13   EIEQAITLLKKGAYLLKYGRRGKPKFCPFHLSNDESMLIWYSGKEERQLKLNQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA FQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVWL GLKALI+ G++ K    
Sbjct  73   QRTATFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWLVGLKALITRGTHSKWKLG  132

Query  350  -----DQEDTQRSK------------------------SLTQGGLGKAFADIVSYTASSK  442
                    D+ R++                        +++  GLGKAFADI+SYT ++ 
Sbjct  133  TINCSTSSDSPRARIRKTSPTVTPFDFGDIQGTQVPLDNVSNNGLGKAFADIISYTEAAN  192

Query  443  THTFADTNSYSVSPL  487
            T++ AD+ S+S SPL
Sbjct  193  TNSRADSVSFSPSPL  207



>ref|XP_002273996.2| PREDICTED: uncharacterized protein LOC100250008 isoform X1 [Vitis 
vinifera]
 ref|XP_010652192.1| PREDICTED: uncharacterized protein LOC100250008 isoform X1 [Vitis 
vinifera]
 ref|XP_010652196.1| PREDICTED: uncharacterized protein LOC100250008 isoform X1 [Vitis 
vinifera]
 ref|XP_010652200.1| PREDICTED: uncharacterized protein LOC100250008 isoform X1 [Vitis 
vinifera]
Length=1047

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 135/186 (73%), Gaps = 33/186 (18%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAI  LKKGA+LLKYGRRGKPKFCPFRLS DES L+WY GKEEKQL+LN VSRIIPG
Sbjct  13   DVEQAIVALKKGAYLLKYGRRGKPKFCPFRLSNDESMLIWYSGKEEKQLKLNNVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRT IFQRYPRPEKEYQSFSLIY DRSLD+ICKDKDEAEVW  GLK LIS G+Y+K    
Sbjct  73   QRTPIFQRYPRPEKEYQSFSLIYGDRSLDLICKDKDEAEVWFIGLKGLISRGNYRKWRSE  132

Query  350  -------------------------DQEDTQRSK----SLTQGGLGKAFADIVSYTASSK  442
                                     D  DTQ+++    ++ Q GLGKAF+D++SYTAS+K
Sbjct  133  IRDDSISSESPHSRARRISPSLSSSDPGDTQQTQVTFENIPQSGLGKAFSDVISYTASTK  192

Query  443  THTFAD  460
            + T A+
Sbjct  193  SFTQAE  198



>ref|XP_011075488.1| PREDICTED: uncharacterized protein LOC105159953 isoform X2 [Sesamum 
indicum]
Length=1031

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 138/207 (67%), Gaps = 37/207 (18%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+WYYGK+EKQLEL +VS+IIPG
Sbjct  13   DIDQAITALKKGAHLLKYGRRGKPKFCPFRLSSDESTLIWYYGKDEKQLELRQVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTAIFQRYPRPEKEYQSFSLIY+DRSLD+ICKDKDEAEVW  GLKALI+  +Y+K    
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLIYSDRSLDLICKDKDEAEVWFAGLKALIARANYKKVRNE  132

Query  350  -------------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTAS  436
                                           D  D QRS   +Q  LGKAFAD+VS TA+
Sbjct  133  ARHESASSDGLFGRRLSTSSSGRRAATSSFSDLGDNQRSDDTSQSRLGKAFADVVSITAT  192

Query  437  SKTHTFADTNSYSVSPLPTDVGSPNAR  517
             K      T+S+        V +PNAR
Sbjct  193  PKYPQL--TDSFPTFQPAGAVENPNAR  217



>ref|XP_011075486.1| PREDICTED: uncharacterized protein LOC105159953 isoform X1 [Sesamum 
indicum]
Length=1034

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 138/210 (66%), Gaps = 40/210 (19%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+WYYGK+EKQLEL +VS+IIPG
Sbjct  13   DIDQAITALKKGAHLLKYGRRGKPKFCPFRLSSDESTLIWYYGKDEKQLELRQVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTAIFQRYPRPEKEYQSFSLIY+DRSLD+ICKDKDEAEVW  GLKALI+  +Y+K    
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLIYSDRSLDLICKDKDEAEVWFAGLKALIARANYKKVRNE  132

Query  350  ----------------------------------DQEDTQRSKSLTQGGLGKAFADIVSY  427
                                              D  D QRS   +Q  LGKAFAD+VS 
Sbjct  133  ARHESASSDGLFGRRLSTSSSGRRAATSSFSFPQDLGDNQRSDDTSQSRLGKAFADVVSI  192

Query  428  TASSKTHTFADTNSYSVSPLPTDVGSPNAR  517
            TA+ K      T+S+        V +PNAR
Sbjct  193  TATPKYPQL--TDSFPTFQPAGAVENPNAR  220



>gb|ABO93003.1| putative regulator of chromosome condensation RCC1 [Solanum tuberosum]
Length=951

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 145/223 (65%), Gaps = 50/223 (22%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLS----------------------IDESAL  115
            DIDQAI  LKKGA LLKYGRRGKPKFCPFRLS                       DESA+
Sbjct  13   DIDQAIAALKKGANLLKYGRRGKPKFCPFRLSNYAVAEDRKNALKSLFSQNLDIKDESAV  72

Query  116  LWYYGKEEKQLELNRVSRIIPGQRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEA  295
            +WY+ KEEKQLEL  VSRIIPGQRTAIFQ+YPRPEKEYQSFSLI NDRSLD+ICKDKDEA
Sbjct  73   VWYHDKEEKQLELCHVSRIIPGQRTAIFQQYPRPEKEYQSFSLICNDRSLDLICKDKDEA  132

Query  296  EVWLTGLKALISNGSYQK---------------------------DQEDTQRSKSLTQGG  394
            EVW+TGLKA+I+ G  +K                           DQ D QR++SL Q  
Sbjct  133  EVWITGLKAIITRGRSRKGKYDARSETVFSDSPHGQRVTTSTSSIDQGDNQRTESLPQSR  192

Query  395  LGKAFADIVSYTASSKTHTFADTNSYSVSPLPTD-VGSPNARN  520
            LGKA+ADI+ YTA+ K+ T  +T S+++S L    V + NAR+
Sbjct  193  LGKAYADIIQYTAAGKSPTLVETGSFNLSSLSAGAVDNSNARS  235



>gb|AAU93591.2| Zinc finger protein, putative [Solanum demissum]
Length=1127

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 145/223 (65%), Gaps = 50/223 (22%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLS----------------------IDESAL  115
            DIDQAI  LKKGA LLKYGRRGKPKFCPFRLS                       DESA+
Sbjct  13   DIDQAIAALKKGANLLKYGRRGKPKFCPFRLSNYAVAEDRKNALKSLFSQNLDIKDESAV  72

Query  116  LWYYGKEEKQLELNRVSRIIPGQRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEA  295
            +WY+ KEEKQLEL  VSRIIPGQRTAIFQ+YPRPEKEYQSFSLI NDRSLD+ICKDKDEA
Sbjct  73   VWYHDKEEKQLELCHVSRIIPGQRTAIFQQYPRPEKEYQSFSLICNDRSLDLICKDKDEA  132

Query  296  EVWLTGLKALISNGSYQK---------------------------DQEDTQRSKSLTQGG  394
            EVW+TGLKA+I+ G  +K                           DQ D QR++SL Q  
Sbjct  133  EVWITGLKAIITRGRSRKGKYDARSETVFSDSPHGQRVTTSTSSIDQGDNQRTESLPQSR  192

Query  395  LGKAFADIVSYTASSKTHTFADTNSYSVSPLPTD-VGSPNARN  520
            LGKA+ADI+ YTA+ K+ T  +T S+++S L    V + NAR+
Sbjct  193  LGKAYADIIQYTAAGKSPTLVETGSFNLSSLSAGAVDNSNARS  235



>ref|XP_008221643.1| PREDICTED: uncharacterized protein LOC103321597 [Prunus mume]
Length=1031

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 142/204 (70%), Gaps = 32/204 (16%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GKEEK L+L+ VS IIPG
Sbjct  13   DIEQAITALKKGATLLKYGRRGKPKFCPFRLSNDESLLIWYSGKEEKHLKLSHVSTIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKEYQSFSL+YNDRSLD+ICKDKDEAEVW  GLKAL+S G+Y+  + +
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLLYNDRSLDLICKDKDEAEVWFVGLKALVSRGNYRNWRSE  132

Query  362  --------------TQRS-----------------KSLTQGGLGKAFADIVSYTASSKTH  448
                          T+RS                 +++ Q  LGKAFADI++YTA+ K+ 
Sbjct  133  SRLDSTSLDSPHTRTRRSSPSITPFDVGDTEGVPLENIPQSRLGKAFADIITYTATPKSA  192

Query  449  TFADTNSYSVSPLPTDVGSPNARN  520
            T  ++ S S S  P  V + N R+
Sbjct  193  TQVESVSNS-SLSPASVDNSNGRS  215



>ref|XP_007224988.1| hypothetical protein PRUPE_ppa020628mg [Prunus persica]
 gb|EMJ26187.1| hypothetical protein PRUPE_ppa020628mg [Prunus persica]
Length=1031

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 142/204 (70%), Gaps = 32/204 (16%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GKEEK L+L+ VS IIPG
Sbjct  13   DIEQAITALKKGATLLKYGRRGKPKFCPFRLSNDESLLIWYSGKEEKHLKLSHVSTIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKEYQSFSL+YNDRSLD+ICKDKDEAEVW  GLKAL+S G+Y+  + +
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLLYNDRSLDLICKDKDEAEVWFVGLKALMSRGNYRNWRSE  132

Query  362  --------------TQRS-----------------KSLTQGGLGKAFADIVSYTASSKTH  448
                          T+RS                 +++ Q  LGKAFADI++YTA+ K+ 
Sbjct  133  SRLDSTSLDSPHTRTRRSSPSVTPFDVGDTEGVPLENIPQSRLGKAFADIITYTATPKSA  192

Query  449  TFADTNSYSVSPLPTDVGSPNARN  520
            T  ++ S S S  P  V + N R+
Sbjct  193  TQIESVSNS-SLSPASVDNSNGRS  215



>ref|XP_008389492.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X2 
[Malus domestica]
Length=1031

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 138/207 (67%), Gaps = 35/207 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAIT LKKGA LLKYGRRGKPKFCPFRLS DE+ L+WY GKEEK L+L  VS IIPG
Sbjct  13   DIDQAITALKKGATLLKYGRRGKPKFCPFRLSNDEALLIWYSGKEEKHLKLCHVSTIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTAIFQRYPRPEKEYQSFSL+YNDRSLD+ICKDKDEAEVW  GLKA+I+ G+Y+     
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLLYNDRSLDLICKDKDEAEVWFVGLKAIITRGNYRNWRSE  132

Query  350  ----------------------------DQEDTQ--RSKSLTQGGLGKAFADIVSYTASS  439
                                        D  DT+    +++ Q  LG+AFADI+SYTA+ 
Sbjct  133  SRLEGTSIDSPHARTRRHSPTVTPFCIGDPRDTEGVSLENIPQSRLGRAFADIISYTATP  192

Query  440  KTHTFADTNSYSVSPLPTDVGSPNARN  520
            K    A++ S + S  P  V + N RN
Sbjct  193  KNAIQAESVS-NASLSPVSVDNSNGRN  218



>ref|XP_010683221.1| PREDICTED: uncharacterized protein LOC104897942 [Beta vulgaris 
subsp. vulgaris]
Length=1050

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 137/203 (67%), Gaps = 34/203 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI QA+T LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GKEEKQL+L++VSRIIPG
Sbjct  13   DIGQALTALKKGATLLKYGRRGKPKFCPFRLSNDESVLIWYSGKEEKQLKLSQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISN---------  334
            QRT IF+RYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW  GLKALISN         
Sbjct  73   QRTTIFKRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFVGLKALISNSGTSGWRKL  132

Query  335  ------GSYQKDQEDTQRS------------------KSLTQGGLGKAFADIVSYTASSK  442
                   S   D   T+R                   +S  Q G+GKAF+DI+ YTASS 
Sbjct  133  RNEARESSTSADGSITRRIHQPFTPLDAGNALCQVPLESPPQTGMGKAFSDIILYTASST  192

Query  443  THTFADTNSYSVSPLPTDVGSPN  511
            + +  + +SY+ S LP  V   N
Sbjct  193  SFSQIEASSYTAS-LPPSVSIEN  214



>ref|XP_002522401.1| Ran GTPase binding protein, putative [Ricinus communis]
 gb|EEF39893.1| Ran GTPase binding protein, putative [Ricinus communis]
Length=1042

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 137/201 (68%), Gaps = 39/201 (19%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT+LKKGA+LLKYGRRGKPKFCPF+LS DES L+WY GKEEKQL+L++VS+IIPG
Sbjct  13   DIEQAITSLKKGAYLLKYGRRGKPKFCPFQLSSDESMLIWYSGKEEKQLKLSQVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKEYQSFSLIY+DRSLD+ICKDKDEAEVW  GLKALI+ GSYQ     
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLIYSDRSLDLICKDKDEAEVWFVGLKALITRGSYQSKWRI  132

Query  362  TQRSKSLT----------------------------QGG-----------LGKAFADIVS  424
              RS+S +                            QG            LGKAF DI+S
Sbjct  133  EPRSESTSSDSPHIRTRRHSRSISPFVRSSLWHGDGQGSPVPFESIPSNRLGKAFCDIIS  192

Query  425  YTASSKTHTFADTNSYSVSPL  487
            YTA+ K+ + A+  S   S L
Sbjct  193  YTAAEKSPSRAELLSSPFSSL  213



>ref|XP_004298436.1| PREDICTED: uncharacterized protein LOC101307114 [Fragaria vesca 
subsp. vesca]
Length=1012

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 139/209 (67%), Gaps = 40/209 (19%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAI +LKKGA LLKYGRRGKPKFCPFRLS DE+ L+WY GK+EK + L+ VS IIPG
Sbjct  13   DIDQAIASLKKGATLLKYGRRGKPKFCPFRLSNDEALLIWYSGKDEKHIRLSHVSTIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKEYQSFSL+YNDRSLD+ICKDKDEAEVW  GLKALI+ GSY+  + +
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLLYNDRSLDLICKDKDEAEVWFVGLKALINRGSYRNLRIE  132

Query  362  TQRSKSL--------------------------TQGG---------LGKAFADIVSYTAS  436
            ++   S+                          T+G          LG+AFADI+SYT +
Sbjct  133  SRSDNSISTDTPPARTRRSSPSIAPFICDAAGDTEGASLENAPLNRLGRAFADIISYTDA  192

Query  437  SKTHTFADTNSYSVSPL-PTDVGSPNARN  520
            +KTH      S S+S L P  V   N R+
Sbjct  193  TKTH----AESPSISSLSPASVDHSNGRS  217



>ref|XP_007046139.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain, putative isoform 1 [Theobroma cacao]
 ref|XP_007046140.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain, putative isoform 1 [Theobroma cacao]
 gb|EOY01971.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain, putative isoform 1 [Theobroma cacao]
 gb|EOY01972.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain, putative isoform 1 [Theobroma cacao]
Length=1022

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 132/190 (69%), Gaps = 30/190 (16%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAIT LKKGA+LLKYGRRGKPKFCPF LS DES L+WY GKEEK L+L++VSRIIPG
Sbjct  13   DIDQAITALKKGAYLLKYGRRGKPKFCPFHLSNDESKLIWYSGKEEKHLKLSQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTAIFQRYPRPEKEYQSFSLIY+DRSLD+ICKDKDEAEVW  GLK LIS G+ +K    
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLIYSDRSLDLICKDKDEAEVWFIGLKGLISRGTTRKWRIE  132

Query  350  ------------------------DQEDTQ--RSKSLTQGGLGKAFADIVSYTASSKTHT  451
                                    D  D Q  ++    Q  LGKAFADI+++TA +KT +
Sbjct  133  VKSDSASLDSPQLRNRKTSPISPFDPGDAQGIQASYEAQNRLGKAFADIITHTAITKTAS  192

Query  452  FADTNSYSVS  481
              D   + +S
Sbjct  193  KPDLVDFGLS  202



>ref|XP_009360355.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103950839 
[Pyrus x bretschneideri]
Length=1033

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 138/207 (67%), Gaps = 35/207 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAIT LKKGA LLKYGRRGKPKFCPFRLS DE+ L+WY GKEEK L+L  VS IIPG
Sbjct  13   DIDQAITALKKGATLLKYGRRGKPKFCPFRLSNDEALLIWYSGKEEKHLKLCHVSTIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKEY SFSL+YNDRSLD+ICKDKDEAEVW  GLKA+I+ G+Y+  + +
Sbjct  73   QRTAIFQRYPRPEKEYXSFSLLYNDRSLDLICKDKDEAEVWFVGLKAIITRGNYRNWRSE  132

Query  362  T---------------QRSKSLT-------------------QGGLGKAFADIVSYTASS  439
                            +RS ++T                   Q  LG+AFADI+SYTA+ 
Sbjct  133  PRSEGTSIDSPHARTRRRSPTVTPFSIGDPRDTGGVSLENIPQSRLGRAFADIISYTATP  192

Query  440  KTHTFADTNSYSVSPLPTDVGSPNARN  520
            K    A++ S + S  P  V + N RN
Sbjct  193  KNAIQAESVS-NASLSPVSVDNSNGRN  218



>ref|XP_010091214.1| putative E3 ubiquitin-protein ligase HERC1 [Morus notabilis]
 gb|EXB43469.1| putative E3 ubiquitin-protein ligase HERC1 [Morus notabilis]
Length=1018

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 136/204 (67%), Gaps = 32/204 (16%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GKEEK ++L+ VSRIIPG
Sbjct  13   DIEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESLLIWYSGKEEKHVKLSHVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS----------  331
            QRTAIFQRYPRPEKEYQSFSLIY DRSLD+ICKDKDEAEVW  GL ALI+          
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLIYGDRSLDLICKDKDEAEVWFVGLNALITRDNYCKWRTE  132

Query  332  ----NGSYQKDQEDTQRS-----------------KSLTQGGLGKAFADIVSYTASSKTH  448
                NGS       T+R+                 ++++Q  LGKAFADIV+YTA +K  
Sbjct  133  LISDNGSVDSPNTRTRRNSPSITPFDPGDTDGVNFENVSQSRLGKAFADIVTYTAVTKRF  192

Query  449  TFADTNSYSVSPLPTDVGSPNARN  520
              A    ++ S  P  V + N R+
Sbjct  193  NQAGP-VFNPSLSPASVDNSNGRS  215



>gb|KCW64968.1| hypothetical protein EUGRSUZ_G02511 [Eucalyptus grandis]
Length=927

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 129/176 (73%), Gaps = 31/176 (18%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPF L+ DES L+WY GKE KQ++LN+VS+IIPG
Sbjct  14   DIEQAITALKKGAYLLKYGRRGKPKFCPFHLASDESTLIWYSGKEPKQVKLNQVSKIIPG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKEYQSFSLI +DRSLD+ICKDKDEAEVWL GLKALI+ G+++K + D
Sbjct  74   QRTAIFQRYPRPEKEYQSFSLICSDRSLDLICKDKDEAEVWLVGLKALITRGNFRKWRSD  133

Query  362  T-------------QRSKSLT------------------QGGLGKAFADIVSYTAS  436
            T             + S S+T                  Q  LGK F+DI+SYTA+
Sbjct  134  TISETASAESPLARRNSPSITLLDPGHIYGIQPPLESTSQTRLGKVFSDIISYTAA  189



>ref|XP_010066923.1| PREDICTED: uncharacterized protein LOC104453958 isoform X1 [Eucalyptus 
grandis]
Length=1031

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 129/176 (73%), Gaps = 31/176 (18%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPF L+ DES L+WY GKE KQ++LN+VS+IIPG
Sbjct  14   DIEQAITALKKGAYLLKYGRRGKPKFCPFHLASDESTLIWYSGKEPKQVKLNQVSKIIPG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKEYQSFSLI +DRSLD+ICKDKDEAEVWL GLKALI+ G+++K + D
Sbjct  74   QRTAIFQRYPRPEKEYQSFSLICSDRSLDLICKDKDEAEVWLVGLKALITRGNFRKWRSD  133

Query  362  T-------------QRSKSLT------------------QGGLGKAFADIVSYTAS  436
            T             + S S+T                  Q  LGK F+DI+SYTA+
Sbjct  134  TISETASAESPLARRNSPSITLLDPGHIYGIQPPLESTSQTRLGKVFSDIISYTAA  189



>ref|XP_010066924.1| PREDICTED: uncharacterized protein LOC104453958 isoform X2 [Eucalyptus 
grandis]
Length=1025

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 129/176 (73%), Gaps = 31/176 (18%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPF L+ DES L+WY GKE KQ++LN+VS+IIPG
Sbjct  14   DIEQAITALKKGAYLLKYGRRGKPKFCPFHLASDESTLIWYSGKEPKQVKLNQVSKIIPG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKEYQSFSLI +DRSLD+ICKDKDEAEVWL GLKALI+ G+++K + D
Sbjct  74   QRTAIFQRYPRPEKEYQSFSLICSDRSLDLICKDKDEAEVWLVGLKALITRGNFRKWRSD  133

Query  362  T-------------QRSKSLT------------------QGGLGKAFADIVSYTAS  436
            T             + S S+T                  Q  LGK F+DI+SYTA+
Sbjct  134  TISETASAESPLARRNSPSITLLDPGHIYGIQPPLESTSQTRLGKVFSDIISYTAA  189



>ref|XP_008389490.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X1 
[Malus domestica]
 ref|XP_008389491.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X1 
[Malus domestica]
Length=1038

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 138/214 (64%), Gaps = 42/214 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAIT LKKGA LLKYGRRGKPKFCPFRLS DE+ L+WY GKEEK L+L  VS IIPG
Sbjct  13   DIDQAITALKKGATLLKYGRRGKPKFCPFRLSNDEALLIWYSGKEEKHLKLCHVSTIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDV-------ICKDKDEAEVWLTGLKALISNGS  340
            QRTAIFQRYPRPEKEYQSFSL+YNDRSLD+       ICKDKDEAEVW  GLKA+I+ G+
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLLYNDRSLDLLPPPAGQICKDKDEAEVWFVGLKAIITRGN  132

Query  341  YQK--------------------------------DQEDTQ--RSKSLTQGGLGKAFADI  418
            Y+                                 D  DT+    +++ Q  LG+AFADI
Sbjct  133  YRNWRSESRLEGTSIDSPHARTRRHSPTVTPFCIGDPRDTEGVSLENIPQSRLGRAFADI  192

Query  419  VSYTASSKTHTFADTNSYSVSPLPTDVGSPNARN  520
            +SYTA+ K    A++ S + S  P  V + N RN
Sbjct  193  ISYTATPKNAIQAESVS-NASLSPVSVDNSNGRN  225



>ref|XP_008339910.1| PREDICTED: uncharacterized protein LOC103402905 [Malus domestica]
Length=1034

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 140/207 (68%), Gaps = 35/207 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAIT LKKGA LLKYGRRGKPKFC FRLS DE+ L+WY GK+EK L+L  VS I+PG
Sbjct  13   DIDQAITALKKGATLLKYGRRGKPKFCSFRLSNDEALLIWYSGKKEKHLKLGHVSTILPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTAIFQRYP+PEKEYQSFSL+YNDRSL++ICKDK+EAEVWL GLKA+I+ G+Y+     
Sbjct  73   QRTAIFQRYPQPEKEYQSFSLLYNDRSLNLICKDKNEAEVWLVGLKAIITRGNYRNWRSE  132

Query  350  ----------------------------DQEDTQRS--KSLTQGGLGKAFADIVSYTASS  439
                                        D  DT+    +++ Q  LG+AFADIVSYTA+ 
Sbjct  133  SRLEGTSIDSPHARTRRHSPSRTPFCIGDPGDTEGVPLENIHQSRLGQAFADIVSYTANP  192

Query  440  KTHTFADTNSYSVSPLPTDVGSPNARN  520
            K+ T A++ S + S  P  V + N RN
Sbjct  193  KSATQAESVS-NASLSPVSVDNSNGRN  218



>ref|XP_010415627.1| PREDICTED: uncharacterized protein LOC104701609 isoform X2 [Camelina 
sativa]
Length=983

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 138/203 (68%), Gaps = 31/203 (15%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT+LKKG++LLKYGRRGKPKFCPF+L+ DESAL+WY GKEEKQ++LN+V RI+PG
Sbjct  13   DVEQAITSLKKGSYLLKYGRRGKPKFCPFQLTSDESALVWYSGKEEKQIKLNQVQRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW+ GLKALI+     K    
Sbjct  73   QRTATFKRYPRPEKEYQSFSLICPDRSLDLICKDKDEAEVWVVGLKALITRVKVSKWKNT  132

Query  350  -------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTA-SSKTHT  451
                                     DQ     +++     LGK FADIVS TA +S   T
Sbjct  133  IKPEITSAECPTPHARRVSPFVTILDQVTQPSTETSAPNRLGKVFADIVSITAPASNNQT  192

Query  452  FADTNSYS-VSPLPTDVGSPNAR  517
             A+ N++S  SP P+ V + N+R
Sbjct  193  EANANTFSPFSPAPSIVENSNSR  215



>gb|EPS64081.1| hypothetical protein M569_10696 [Genlisea aurea]
Length=1013

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 138/212 (65%), Gaps = 45/212 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLS----------------IDESALLWYYGK  133
            DI+ AIT LKKGA LLKYGRRGKPKFCPFRLS                +DESALLWYYGK
Sbjct  13   DIELAITALKKGAQLLKYGRRGKPKFCPFRLSTVHFASWQLLDFHVDMMDESALLWYYGK  72

Query  134  EEKQLELNRVSRIIPGQRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTG  313
            +EK+LELN VSRIIPGQRT +FQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAE W  G
Sbjct  73   DEKRLELNLVSRIIPGQRTPVFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEAWFVG  132

Query  314  LKALISNGSYQKDQEDTQRSKSLTQGG----------------------LGKAFADIVSY  427
            LKALIS G Y++ + + ++  S  +                        LGK+FADI+SY
Sbjct  133  LKALISCGGYKRLRSEAKKDNSRPESPPCRSAASSSPSSSDQGIIPSRRLGKSFADILSY  192

Query  428  TASSKTHTFADTNSYSVSPL---PTDVGSPNA  514
            TA +        +S S++PL   P + G+  A
Sbjct  193  TAKNP----PPVDSISITPLTQQPVENGNTRA  220



>ref|XP_010415626.1| PREDICTED: uncharacterized protein LOC104701609 isoform X1 [Camelina 
sativa]
Length=1019

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 138/203 (68%), Gaps = 31/203 (15%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT+LKKG++LLKYGRRGKPKFCPF+L+ DESAL+WY GKEEKQ++LN+V RI+PG
Sbjct  13   DVEQAITSLKKGSYLLKYGRRGKPKFCPFQLTSDESALVWYSGKEEKQIKLNQVQRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW+ GLKALI+     K    
Sbjct  73   QRTATFKRYPRPEKEYQSFSLICPDRSLDLICKDKDEAEVWVVGLKALITRVKVSKWKNT  132

Query  350  -------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTA-SSKTHT  451
                                     DQ     +++     LGK FADIVS TA +S   T
Sbjct  133  IKPEITSAECPTPHARRVSPFVTILDQVTQPSTETSAPNRLGKVFADIVSITAPASNNQT  192

Query  452  FADTNSYS-VSPLPTDVGSPNAR  517
             A+ N++S  SP P+ V + N+R
Sbjct  193  EANANTFSPFSPAPSIVENSNSR  215



>ref|XP_010937079.1| PREDICTED: uncharacterized protein LOC105056557 [Elaeis guineensis]
Length=1071

 Score =   213 bits (542),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 136/201 (68%), Gaps = 41/201 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRL+ DES L+WY GK+EKQL+L++VS+IIPG
Sbjct  13   DVEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWYSGKDEKQLKLSQVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRP+KEYQSFSLIYNDRSLD+ICKDKDEAEVW  GLKALIS G+ +K + D
Sbjct  73   QRTAIFQRYPRPDKEYQSFSLIYNDRSLDLICKDKDEAEVWFVGLKALISRGNCRKLRLD  132

Query  362  --------------TQRSKSLTQ---------------------------GGLGKAFADI  418
                          TQ++  LT                             G GK  +D+
Sbjct  133  SKSDRASSDSPNSNTQKNSPLTSPFCNSDIFHKDSGDAQQVHIPYESHPVNGFGKVLSDV  192

Query  419  VSYTASSKTHTFADTNSYSVS  481
            V YTA +K+   +D+ + S+S
Sbjct  193  VLYTAPAKSSFHSDSINNSLS  213



>ref|XP_010470972.1| PREDICTED: uncharacterized protein LOC104750821 [Camelina sativa]
Length=1022

 Score =   212 bits (540),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 138/203 (68%), Gaps = 31/203 (15%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT+LKKG++LLKYGRRGKPKFCPF+L+ DESAL+WY GKEEKQ++LN+V RI+PG
Sbjct  13   DVEQAITSLKKGSYLLKYGRRGKPKFCPFQLTSDESALVWYSGKEEKQIKLNQVQRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW+ GLKALI+     K    
Sbjct  73   QRTATFKRYPRPEKEYQSFSLICPDRSLDLICKDKDEAEVWVVGLKALITRLKVSKWKNT  132

Query  350  -------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTA-SSKTHT  451
                                     DQ     +++     LGK FADIVS TA +S   T
Sbjct  133  IKPEITSAECPTPHARRMSPFVTILDQVTQPSTETSAPNRLGKVFADIVSITAPASNNQT  192

Query  452  FADTNSYS-VSPLPTDVGSPNAR  517
             A+ N++S  SP P+ V + N+R
Sbjct  193  EANANTFSPFSPAPSIVENSNSR  215



>ref|XP_009410388.1| PREDICTED: uncharacterized protein LOC103992424 [Musa acuminata 
subsp. malaccensis]
Length=1047

 Score =   213 bits (541),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GK+EKQL+L++VS+IIPG
Sbjct  13   DVEQAITALKKGAHLLKYGRRGKPKFCPFRLSNDESLLIWYSGKDEKQLKLSQVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRTAIFQRYPRP+KEYQSFSLIYNDRSLD+ICKDKDEAEVW  GLKALIS+GS+QK
Sbjct  73   QRTAIFQRYPRPDKEYQSFSLIYNDRSLDLICKDKDEAEVWFVGLKALISHGSHQK  128



>ref|XP_010512024.1| PREDICTED: uncharacterized protein LOC104788044 [Camelina sativa]
Length=1021

 Score =   212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 138/203 (68%), Gaps = 31/203 (15%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT+LKKG++LLKYGRRGKPKFCPF+L+ DESAL+WY GKEEKQ++LN+V RI+PG
Sbjct  13   DVEQAITSLKKGSYLLKYGRRGKPKFCPFQLTSDESALVWYSGKEEKQIKLNQVQRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW+ GLKALI+     K    
Sbjct  73   QRTATFKRYPRPEKEYQSFSLICPDRSLDLICKDKDEAEVWVVGLKALITRVKVSKWKNT  132

Query  350  -------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTA-SSKTHT  451
                                     DQ     +++     LGK FADIVS TA +S   T
Sbjct  133  IKPEITSAECPTPHARRVSPFVTILDQVIQPSTETSAPNRLGKVFADIVSITAPASNNQT  192

Query  452  FADTNSYS-VSPLPTDVGSPNAR  517
             A+ N++S  SP P+ V + N+R
Sbjct  193  EANANTFSPFSPAPSIVENSNSR  215



>gb|KHN06842.1| Putative E3 ubiquitin-protein ligase HERC1 [Glycine soja]
Length=1186

 Score =   213 bits (542),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 133/185 (72%), Gaps = 31/185 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            +I+QAIT+LKKG++LLKYGRRGKPKFCPFRLS DES LLWY GKEEKQL+L+ VSRIIPG
Sbjct  13   NIEQAITSLKKGSYLLKYGRRGKPKFCPFRLSNDESLLLWYSGKEEKQLKLSTVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGS-------  340
            QRTA FQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAE+W  GLKAL++ G+       
Sbjct  73   QRTATFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEIWFVGLKALVTRGNNCKWRLE  132

Query  341  --------YQKDQEDTQRSK-----SLTQGGLG-----------KAFADIVSYTASSKTH  448
                    Y      T+RS      ++  G  G           KAF++I+SYTA+SK+ 
Sbjct  133  SRTDDSLYYDSPNSGTRRSTPSFSVTMDPGDAGGGAFDLQNRWVKAFSEIISYTAASKSS  192

Query  449  TFADT  463
            + A++
Sbjct  193  SQAES  197



>ref|XP_004511218.1| PREDICTED: uncharacterized protein LOC101514207 isoform X1 [Cicer 
arietinum]
Length=1019

 Score =   212 bits (539),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 136/189 (72%), Gaps = 33/189 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QA+T+LKKG++LLKYGRRG+PKFCPFRLS DES L+WY GKEEKQ++L+ VS+IIPG
Sbjct  15   DIEQALTSLKKGSYLLKYGRRGRPKFCPFRLSNDESLLIWYSGKEEKQIKLSTVSKIIPG  74

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA FQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAE+W  GLKAL++ G+Y+K    
Sbjct  75   QRTATFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEIWFAGLKALVTRGNYRKWRFE  134

Query  350  -------------------------DQEDTQRS--KSLTQGGLGKAFADIVSYTASSKTH  448
                                     D  DT R   ++ +Q    KAF++I+SYTA SK+ 
Sbjct  135  SRPESLYSESPKSGTRRSTPSVAPFDPGDTDRVAFQNSSQNRWVKAFSEIISYTAPSKSS  194

Query  449  TFAD--TNS  469
            + A+  TNS
Sbjct  195  SQAESITNS  203



>gb|KHG24995.1| E3 ubiquitin-protein ligase HERC2 [Gossypium arboreum]
Length=1026

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 129/188 (69%), Gaps = 29/188 (15%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAITTLKKGA LLKYGRRGKPKFCPF+LS DES L+WY  K+ K ++L+ VS+IIPG
Sbjct  13   DIDQAITTLKKGASLLKYGRRGKPKFCPFQLSNDESKLIWYSRKKAKHIKLSEVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKEYQSFSLI NDRSLD+ICKDKDEAEVWL GLKALIS G+Y K + +
Sbjct  73   QRTAIFQRYPRPEKEYQSFSLICNDRSLDLICKDKDEAEVWLIGLKALISRGTYHKRRTE  132

Query  362  TQRSKSL-----------------------------TQGGLGKAFADIVSYTASSKTHTF  454
               S S+                                 LGKAFADI+++T+  K+ + 
Sbjct  133  VNGSASVDSSQPCNQKASPNSPLDPEDAQGIQAPYEAHNRLGKAFADIITHTSLVKSVSE  192

Query  455  ADTNSYSV  478
             D   +S+
Sbjct  193  PDLVGFSL  200



>ref|XP_006362314.1| PREDICTED: uncharacterized protein LOC102578724 [Solanum tuberosum]
Length=1107

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 130/205 (63%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DESAL+W+ GKEEK L+L+ VSRII G
Sbjct  21   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESALIWFSGKEEKHLKLSHVSRIISG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNG--------  337
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS G        
Sbjct  81   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRGHQRKWRTE  140

Query  338  -------------------------------SYQKDQEDTQR----SKSLTQGGLGKAFA  412
                                           S QKD  D  R     +S  + GL KAFA
Sbjct  141  SRSDGISSGATSPRTYTRRSSPLHSPFSSGDSLQKDGGDQLRLHSPYESPPKNGLDKAFA  200

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D++ Y    K    +D+ S SV  L
Sbjct  201  DVIMYAVPPKGFFPSDSASASVHSL  225



>ref|XP_008808052.1| PREDICTED: uncharacterized protein LOC103720223 [Phoenix dactylifera]
Length=1071

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 137/201 (68%), Gaps = 41/201 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRL+ DES L+WY GK+EKQL+L++VS+IIPG
Sbjct  13   DVEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWYSGKDEKQLKLSQVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRP+KEYQSFSL+Y+DRSLD+ICKDKDEAEVW  GLKALIS G+ +K + D
Sbjct  73   QRTAIFQRYPRPDKEYQSFSLMYSDRSLDLICKDKDEAEVWFVGLKALISRGNCRKLRLD  132

Query  362  --------------TQRSKSLTQ---------------------------GGLGKAFADI  418
                          TQ++  LT                             G GK  +D+
Sbjct  133  SKSDRTSSDSPNSNTQKNSPLTSPFCNSDIFHKDSGDAPQVHIPYESHPVNGFGKVLSDV  192

Query  419  VSYTASSKTHTFADTNSYSVS  481
            V YTA++K+   +D+ + S+S
Sbjct  193  VLYTAAAKSSFHSDSINNSLS  213



>ref|XP_004250909.1| PREDICTED: uncharacterized protein LOC101265608 [Solanum lycopersicum]
Length=1101

 Score =   210 bits (534),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 130/205 (63%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DESAL+W+ GKEEK L+L+ VSRII G
Sbjct  15   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESALIWFSGKEEKHLKLSHVSRIISG  74

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNG--------  337
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS G        
Sbjct  75   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRGHQRKWRTE  134

Query  338  -------------------------------SYQKDQEDTQR----SKSLTQGGLGKAFA  412
                                           S QKD  D  R     +S  + GL KAFA
Sbjct  135  SRSDGISSGATSPRTYTRRSSPLHSPFSSGDSLQKDGGDQLRLHSPYESPPKNGLDKAFA  194

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D++ Y    K    +D+ S SV  +
Sbjct  195  DVIMYAVPPKGFFPSDSASASVHSI  219



>ref|XP_004168499.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like, partial [Cucumis 
sativus]
Length=806

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 130/178 (73%), Gaps = 31/178 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GK+EKQL+L+ VS+IIPG
Sbjct  13   DIEQAIIALKKGAHLLKYGRRGKPKFCPFRLSSDESLLVWYSGKDEKQLKLSLVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQ+YP+PEKEYQSFSL+YNDRSLD+ICKDKDEAEVW  GLKALI+ G+++K + +
Sbjct  73   QRTAIFQQYPQPEKEYQSFSLLYNDRSLDLICKDKDEAEVWFVGLKALITRGNHRKWRVE  132

Query  362  T---------------QRSKSLT----------------QGGLGKAFADIVSYTASSK  442
            +               + S S+T                Q  LGKAF++++SYTA SK
Sbjct  133  SRCESVSSDSPHARLRRNSPSITPCDPGDLDGVSYENTGQNRLGKAFSELLSYTAVSK  190



>ref|XP_004138993.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101222790 
[Cucumis sativus]
Length=982

 Score =   209 bits (531),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 130/178 (73%), Gaps = 31/178 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GK+EKQL+L+ VS+IIPG
Sbjct  13   DIEQAIIALKKGAHLLKYGRRGKPKFCPFRLSSDESLLVWYSGKDEKQLKLSLVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQ+YP+PEKEYQSFSL+YNDRSLD+ICKDKDEAEVW  GLKALI+ G+++K + +
Sbjct  73   QRTAIFQQYPQPEKEYQSFSLLYNDRSLDLICKDKDEAEVWFVGLKALITRGNHRKWRVE  132

Query  362  T---------------QRSKSLT----------------QGGLGKAFADIVSYTASSK  442
            +               + S S+T                Q  LGKAF++++SYTA SK
Sbjct  133  SRCESVSSDSPHARLRRNSPSITPCDPGDLDGVSYENTGQNRLGKAFSELLSYTAVSK  190



>gb|KGN61393.1| hypothetical protein Csa_2G109700 [Cucumis sativus]
Length=828

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 130/178 (73%), Gaps = 31/178 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GK+EKQL+L+ VS+IIPG
Sbjct  13   DIEQAIIALKKGAHLLKYGRRGKPKFCPFRLSSDESLLVWYSGKDEKQLKLSLVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQ+YP+PEKEYQSFSL+YNDRSLD+ICKDKDEAEVW  GLKALI+ G+++K + +
Sbjct  73   QRTAIFQQYPQPEKEYQSFSLLYNDRSLDLICKDKDEAEVWFVGLKALITRGNHRKWRVE  132

Query  362  T---------------QRSKSLT----------------QGGLGKAFADIVSYTASSK  442
            +               + S S+T                Q  LGKAF++++SYTA SK
Sbjct  133  SRCESVSSDSPHARLRRNSPSITPCDPGDLDGVSYENTGQNRLGKAFSELLSYTAVSK  190



>ref|XP_006300387.1| hypothetical protein CARUB_v10019712mg [Capsella rubella]
 gb|EOA33285.1| hypothetical protein CARUB_v10019712mg [Capsella rubella]
Length=1019

 Score =   209 bits (531),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 135/203 (67%), Gaps = 31/203 (15%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT+LKKG++LLKYGRRGKPKFCPF+L+ DESAL+WY GKEEKQ++LN+V RI+PG
Sbjct  13   DVEQAITSLKKGSYLLKYGRRGKPKFCPFQLTSDESALVWYSGKEEKQIKLNQVQRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW+ GLKALI+     K    
Sbjct  73   QRTATFKRYPRPEKEYQSFSLICPDRSLDLICKDKDEAEVWVVGLKALITRVKVSKWKNT  132

Query  350  -------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTA-SSKTHT  451
                                     DQ     +++     LGK FADIVS TA +S   T
Sbjct  133  IKPEITSAECPTPHARRVSPFVTILDQVIQPSTETSAPNRLGKVFADIVSITAPASNNQT  192

Query  452  FADTNSYS-VSPLPTDVGSPNAR  517
             A+ N +   SP P  V + N+R
Sbjct  193  EANANPFCPFSPAPVIVENSNSR  215



>ref|XP_009767054.1| PREDICTED: uncharacterized protein LOC104218296 [Nicotiana sylvestris]
Length=1101

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 130/205 (63%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DESAL+W+ GKEEK L+L+ VSRII G
Sbjct  15   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESALIWFSGKEEKHLKLSHVSRIISG  74

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNG--------  337
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS G        
Sbjct  75   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRGHQRKWRTE  134

Query  338  -------------------------------SYQKDQEDTQR----SKSLTQGGLGKAFA  412
                                           S QKD  D  R     +S  + GL KAF+
Sbjct  135  SRSDGISSGATSPRTYTRRSSPLHSPFSSGDSLQKDGGDQLRLHSPYESPPKNGLDKAFS  194

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D++ Y    K    +D+ S SV  L
Sbjct  195  DVILYAVPPKGFFPSDSASASVHSL  219



>ref|XP_008441693.1| PREDICTED: uncharacterized protein LOC103485768 isoform X2 [Cucumis 
melo]
Length=864

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 130/178 (73%), Gaps = 31/178 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA LLKYGRRGKPKFCPFRLS DES LLWY GK+EKQL+L+ VS+IIPG
Sbjct  13   DIEQAIIALKKGAHLLKYGRRGKPKFCPFRLSSDESLLLWYSGKDEKQLKLSLVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQ++P+PEKEYQSFSL+YNDRSLD+ICKDKDEAEVW  GLKALI+ G+++K + +
Sbjct  73   QRTAIFQQHPQPEKEYQSFSLLYNDRSLDLICKDKDEAEVWFVGLKALITRGNHRKWRVE  132

Query  362  T---------------QRSKSLT----------------QGGLGKAFADIVSYTASSK  442
            +               + S S+T                Q  LGKAF+++++YTA SK
Sbjct  133  SRCESVSSDSPHARMRRNSPSITPCDPGDLDGVSYENTGQNRLGKAFSELLTYTAVSK  190



>ref|XP_008441692.1| PREDICTED: uncharacterized protein LOC103485768 isoform X1 [Cucumis 
melo]
Length=982

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 130/178 (73%), Gaps = 31/178 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA LLKYGRRGKPKFCPFRLS DES LLWY GK+EKQL+L+ VS+IIPG
Sbjct  13   DIEQAIIALKKGAHLLKYGRRGKPKFCPFRLSSDESLLLWYSGKDEKQLKLSLVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQ++P+PEKEYQSFSL+YNDRSLD+ICKDKDEAEVW  GLKALI+ G+++K + +
Sbjct  73   QRTAIFQQHPQPEKEYQSFSLLYNDRSLDLICKDKDEAEVWFVGLKALITRGNHRKWRVE  132

Query  362  T---------------QRSKSLT----------------QGGLGKAFADIVSYTASSK  442
            +               + S S+T                Q  LGKAF+++++YTA SK
Sbjct  133  SRCESVSSDSPHARMRRNSPSITPCDPGDLDGVSYENTGQNRLGKAFSELLTYTAVSK  190



>gb|AAT77332.1| unknown prtein [Oryza sativa Japonica Group]
Length=901

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 128/203 (63%), Gaps = 45/203 (22%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEKQL L+ VSRIIPG
Sbjct  19   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHVSRIIPG  78

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LI+  S+Q+    
Sbjct  79   QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLITR-SHQRKWRT  137

Query  362  TQRSKSLTQG--------------------------------------------GLGKAF  409
              RS  L+ G                                            GL KAF
Sbjct  138  ESRSDMLSSGTTSPRTYTRRSSPLSSPFSSNDSVHKDGVENYRLRSPFGSPPKVGLEKAF  197

Query  410  ADIVSYTASSKTHTFADTNSYSV  478
            +DIVSY A  K    +D+N+ SV
Sbjct  198  SDIVSYAAPPKPFFPSDSNAGSV  220



>ref|XP_003568548.1| PREDICTED: uncharacterized protein LOC100838586 [Brachypodium 
distachyon]
Length=1090

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 126/199 (63%), Gaps = 45/199 (23%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEKQL LN VSRIIPG
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLNHVSRIIPG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LIS  S+Q+    
Sbjct  80   QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISR-SHQRKWRT  138

Query  362  TQRSKSLTQG--------------------------------------------GLGKAF  409
              RS  L+ G                                            GL KAF
Sbjct  139  ESRSDMLSSGTTSPRTYTRRSSPLSSPFSSNDSVHKDGAENYRLRSPYGSPPKVGLEKAF  198

Query  410  ADIVSYTASSKTHTFADTN  466
            +DIVSYTA  +    +D+N
Sbjct  199  SDIVSYTAPPRPFFPSDSN  217



>ref|XP_010269341.1| PREDICTED: uncharacterized protein LOC104606031 isoform X2 [Nelumbo 
nucifera]
Length=1101

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRL+ DES L+W+ GKEEK L+L+ VSRIIPG
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVSRIIPG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW  GLKALIS   ++K + +
Sbjct  80   QRTAIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFIGLKALISRSHHRKWRTE  139

Query  362  TQRSKSLTQG  391
            + RS  ++ G
Sbjct  140  S-RSDGVSSG  148



>ref|XP_010242447.1| PREDICTED: uncharacterized protein LOC104586793, partial [Nelumbo 
nucifera]
Length=1049

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 130/196 (66%), Gaps = 41/196 (21%)
 Frame = +2

Query  14   AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTA  193
            AIT LKKGA+LLKYGRRGKPKFCPFRL+ DES L+WY GKEEK L+L+ VSRIIPGQRTA
Sbjct  1    AITALKKGAYLLKYGRRGKPKFCPFRLANDESLLIWYSGKEEKHLKLSHVSRIIPGQRTA  60

Query  194  IFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSY----------  343
            IF+RYPRPEKEYQSFSLIY+DRSLD+ICKDKDEAEVW  GLKALIS GSY          
Sbjct  61   IFKRYPRPEKEYQSFSLIYSDRSLDLICKDKDEAEVWFVGLKALISRGSYPNWRNESRID  120

Query  344  ---------------------------QKDQEDTQR----SKSLTQGGLGKAFADIVSYT  430
                                        KD   T+R     +S  + GL KAF+D++SYT
Sbjct  121  RISSDSPCGSTQRNSHNFFTCGSSDTFHKDPGVTERIQIPHESSPRSGLRKAFSDVISYT  180

Query  431  ASSKTHTFADTNSYSV  478
            A +K  T ++  + S+
Sbjct  181  AVAKGSTQSEAVANSL  196



>ref|XP_009630183.1| PREDICTED: uncharacterized protein LOC104120162 [Nicotiana tomentosiformis]
Length=1101

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DESAL+W+ GKEEK L+L+ VSRII G
Sbjct  15   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESALIWFSGKEEKHLKLSHVSRIISG  74

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS G +Q+    
Sbjct  75   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRG-HQRKWRI  133

Query  362  TQRSKSLTQG  391
              RS  ++ G
Sbjct  134  ESRSDGISSG  143



>ref|XP_010276611.1| PREDICTED: uncharacterized protein LOC104611308 [Nelumbo nucifera]
Length=1101

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRL+ DES L+W+ GKEEK L+L+ VSRIIPG
Sbjct  21   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVSRIIPG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRTAIFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW  GLKALIS   ++K
Sbjct  81   QRTAIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFIGLKALISRSHHRK  136



>ref|XP_006654344.1| PREDICTED: uncharacterized protein LOC102712360 [Oryza brachyantha]
Length=1085

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 128/203 (63%), Gaps = 45/203 (22%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEKQL L+ VSRIIPG
Sbjct  18   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHVSRIIPG  77

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LIS  S+Q+    
Sbjct  78   QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISR-SHQRKWRT  136

Query  362  TQRSKSLTQG--------------------------------------------GLGKAF  409
              RS  L+ G                                            GL KAF
Sbjct  137  ESRSDMLSSGTTSPRTYTRRSSPLSSPFSSNDSVHKDGSENYRLRSPFGSPPKIGLEKAF  196

Query  410  ADIVSYTASSKTHTFADTNSYSV  478
            +DIVSY A  K    +D+N+ S+
Sbjct  197  SDIVSYAAPPKPFFPSDSNAGSI  219



>ref|XP_010645610.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like [Vitis vinifera]
Length=1104

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+ AI  LKKGA LLKYGRRGKPKFCPFRLS DES L+W  GKEEK+L+L+ VSRIIPG
Sbjct  21   DIELAIIALKKGAHLLKYGRRGKPKFCPFRLSNDESVLIWLSGKEEKRLKLSHVSRIIPG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVWLTGLKALIS G +QK + +
Sbjct  81   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWLTGLKALISRGHHQKGRTE  140

Query  362  TQ  367
            ++
Sbjct  141  SR  142



>ref|XP_006854768.1| hypothetical protein AMTR_s00063p00100200 [Amborella trichopoda]
 gb|ERN16235.1| hypothetical protein AMTR_s00063p00100200 [Amborella trichopoda]
Length=1097

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRL+ DES L+WY GKEEK L+L+ VS+IIPG
Sbjct  16   DIEQAITALKKGAHLLKYGRRGKPKFCPFRLANDESVLIWYSGKEEKSLKLSHVSKIIPG  75

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW  GLKALIS G ++K
Sbjct  76   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFIGLKALISRGHHRK  131



>ref|NP_001055416.1| Os05g0384800 [Oryza sativa Japonica Group]
 dbj|BAF17330.1| Os05g0384800 [Oryza sativa Japonica Group]
Length=1086

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 128/203 (63%), Gaps = 45/203 (22%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEKQL L+ VSRIIPG
Sbjct  19   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHVSRIIPG  78

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LI+  S+Q+    
Sbjct  79   QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLITR-SHQRKWRT  137

Query  362  TQRSKSLTQG--------------------------------------------GLGKAF  409
              RS  L+ G                                            GL KAF
Sbjct  138  ESRSDMLSSGTTSPRTYTRRSSPLSSPFSSNDSVHKDGVENYRLRSPFGSPPKVGLEKAF  197

Query  410  ADIVSYTASSKTHTFADTNSYSV  478
            +DIVSY A  K    +D+N+ SV
Sbjct  198  SDIVSYAAPPKPFFPSDSNAGSV  220



>ref|XP_010551527.1| PREDICTED: uncharacterized protein LOC104822111 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010551528.1| PREDICTED: uncharacterized protein LOC104822111 isoform X2 [Tarenaya 
hassleriana]
Length=1005

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 137/200 (69%), Gaps = 29/200 (15%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKG++LLKYGRRGKPKFCPF LS DES L+WY GKEEKQ++L++V RI+PG
Sbjct  13   DVEQAITALKKGSYLLKYGRRGKPKFCPFHLSSDESGLVWYSGKEEKQVKLSQVLRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNG-------S  340
            QRTA F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW  GLKALI+ G       S
Sbjct  73   QRTATFKRYPRPEKEYQSFSLICVDRSLDLICKDKDEAEVWFVGLKALITRGKTGKWRNS  132

Query  341  YQKDQEDTQRSKSL--------------------TQGGLGKAFADIVSYTA-SSKTHTFA  457
             + + E++ R+ +                     +Q  LGK F+DIVS TA ++   T A
Sbjct  133  IKSETEESPRTVARRVSPFVTVLDQVIQPPPEIPSQNRLGKVFSDIVSLTAPTNNNQTEA  192

Query  458  DTNSYSVSPLPTDVGSPNAR  517
              N +S  P P ++ + N+R
Sbjct  193  PPNPFSALP-PLNLENSNSR  211



>ref|XP_010917119.1| PREDICTED: uncharacterized protein LOC105041789 [Elaeis guineensis]
Length=1059

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 123/189 (65%), Gaps = 35/189 (19%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GK EKQL LN VS+IIPG
Sbjct  13   DIEQAIIALKKGACLLKYGRRGKPKFCPFRLSNDESTLIWYSGKVEKQLILNHVSKIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRP+KEYQSFSLI  DRSLD+ICKDKDEAEVW  GLKALIS G+YQK  E 
Sbjct  73   QRTPIFQRYPRPDKEYQSFSLITKDRSLDLICKDKDEAEVWFVGLKALISCGNYQKKSES  132

Query  362  -----------TQRSKSLTQ------------------------GGLGKAFADIVSYTAS  436
                        QRS  L                              K F+D++ YTA+
Sbjct  133  KGQRISDPNTLAQRSLPLISPSCDTYTFQKDAGDAPRTYENPPVSSFAKVFSDVILYTAA  192

Query  437  SKTHTFADT  463
            +K+ T +++
Sbjct  193  TKSSTQSES  201



>gb|KDO49057.1| hypothetical protein CISIN_1g0013612mg, partial [Citrus sinensis]
Length=924

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+ AIT LKKGA LLKYGRRGKPKFCPFRL+ DES L+W  GKEEK L+L+ VSRIIPG
Sbjct  14   DIELAITALKKGAHLLKYGRRGKPKFCPFRLANDESILIWISGKEEKHLKLSHVSRIIPG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW TGLKALIS   Y+K + +
Sbjct  74   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFTGLKALISRSHYRKGRAE  133

Query  362  TQ  367
            ++
Sbjct  134  SR  135



>ref|XP_002313993.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE87948.2| zinc finger family protein [Populus trichocarpa]
Length=1104

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 130/206 (63%), Gaps = 42/206 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L+ VS+II G
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHVSKIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   +QK + +
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHQKWRTE  139

Query  362  ----------------TQRSKSLT--------------------------QGGLGKAFAD  415
                            T+RS  L                           + GL KAF+D
Sbjct  140  SRSDGIPSEANSPRTYTRRSSPLNSPFGSNDGSQKDADHHRLHSPYESPPKNGLDKAFSD  199

Query  416  IVSYTASSKTHTFADTNSYSVSPLPT  493
            +V Y    K    +D+ S SV  L +
Sbjct  200  VVLYAVPPKGFFPSDSASGSVHSLSS  225



>ref|XP_009785512.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X2 
[Nicotiana sylvestris]
Length=919

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRL+ DESAL+W+ GKEEK L+L+ VSRII G
Sbjct  15   DIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSHVSRIISG  74

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQR+PRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS G +Q+    
Sbjct  75   QRTPIFQRHPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRG-HQRKWRT  133

Query  362  TQRSKSLTQG  391
              RS  +  G
Sbjct  134  ESRSDGIPSG  143



>ref|XP_009785513.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X3 
[Nicotiana sylvestris]
Length=910

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRL+ DESAL+W+ GKEEK L+L+ VSRII G
Sbjct  15   DIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSHVSRIISG  74

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQR+PRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS G +Q+    
Sbjct  75   QRTPIFQRHPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRG-HQRKWRT  133

Query  362  TQRSKSLTQG  391
              RS  +  G
Sbjct  134  ESRSDGIPSG  143



>ref|XP_007011054.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 1 [Theobroma cacao]
 gb|EOY19864.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 1 [Theobroma cacao]
Length=1111

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+ AIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W  GKEEK L+L+ VSRIIPG
Sbjct  24   DIELAITALKKGAPLLKYGRRGKPKFCPFRLSNDESVLIWISGKEEKYLKLSHVSRIIPG  83

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW TGLKALIS G ++K + +
Sbjct  84   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFTGLKALISRGHHRKGRAE  143

Query  362  TQ  367
            ++
Sbjct  144  SR  145



>ref|XP_008782005.1| PREDICTED: uncharacterized protein LOC103701639 [Phoenix dactylifera]
Length=1101

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 127/171 (74%), Gaps = 19/171 (11%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK+L+L+ VSRI+PG
Sbjct  18   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKRLKLSHVSRIMPG  77

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTA+FQRYPRPEKE QSFSLIYNDRSLD+ICKDKDEAEVW  GLK LIS   +QK    
Sbjct  78   QRTAVFQRYPRPEKECQSFSLIYNDRSLDLICKDKDEAEVWFAGLKTLISQSHHQK----  133

Query  362  TQRSKSLTQGGLGKAFADIVSYTASSKTHTFADTNSYSVSPLPTDVGSPNA  514
              R++S + G        + S T S +T+T      +  SPL +  GS ++
Sbjct  134  -WRTESRSDG--------VSSGTNSPRTYT------HRSSPLSSPFGSSDS  169



>gb|KDP36001.1| hypothetical protein JCGZ_08396 [Jatropha curcas]
Length=1097

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 130/206 (63%), Gaps = 42/206 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L+ VSRII G
Sbjct  14   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHVSRIISG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K + +
Sbjct  74   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRKWRTE  133

Query  362  ----------------TQRSKSLT--------------------------QGGLGKAFAD  415
                            T+RS  L                           + GL KAF+D
Sbjct  134  SRSDGIPSGANSPRTYTRRSSPLNSPFGSNDSLQKDGDHLRLHSPYESPPKNGLDKAFSD  193

Query  416  IVSYTASSKTHTFADTNSYSVSPLPT  493
            ++ Y    K    +D+ S SV  L +
Sbjct  194  VILYAVPPKGFFPSDSASASVHSLSS  219



>ref|XP_009603792.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 isoform X2 [Nicotiana 
tomentosiformis]
Length=915

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 128/205 (62%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRL+ DESAL+W+ GKEEK L+L+ VSRII G
Sbjct  15   DIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSHVSRIISG  74

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNG--------  337
            QRT IFQR+PRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS G        
Sbjct  75   QRTPIFQRHPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRGHQRKWRTE  134

Query  338  -------------------------------SYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                           S QKD  D  R      S  + G+ KAF+
Sbjct  135  SRSDGVPSGATSPRTYTRRNSPLHSPFGSGDSSQKDGGDQLRLHSPYGSPPKNGVNKAFS  194

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            DI+ Y+   K    +D  S S+  L
Sbjct  195  DIIHYSLPPKGLFTSDAASASIHSL  219



>gb|KDO76103.1| hypothetical protein CISIN_1g0026021mg, partial [Citrus sinensis]
Length=161

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QA+  LKKG +LLKYGRRGKPKFCPFRLS DE  L+WY GKEEKQL+L+ VSRIIPG
Sbjct  13   DTEQAVRVLKKGTYLLKYGRRGKPKFCPFRLSSDEKLLIWYAGKEEKQLKLSHVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            QRTA+FQRYP+PEKEYQSFSLIY +RSLD+ICKDKDEAE+W T L+ALIS
Sbjct  73   QRTAVFQRYPQPEKEYQSFSLIYRNRSLDLICKDKDEAELWFTALRALIS  122



>ref|XP_010539249.1| PREDICTED: uncharacterized protein LOC104813389 [Tarenaya hassleriana]
Length=1069

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 121/156 (78%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W  GKEEK L+L+ +SRII G
Sbjct  14   DVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWISGKEEKHLKLSHISRIISG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW TGLKAL+S+  +++    
Sbjct  74   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFTGLKALVSSSHHRR----  129

Query  362  TQRSKSLTQGGLGKAFADIVSYTASSKTHTFADTNS  469
             +R++S + G + +A +       SS  H+    NS
Sbjct  130  -RRAQSRSDGAVSEASSPRTYTRRSSPLHSPFSNNS  164



>ref|XP_003532065.2| PREDICTED: uncharacterized protein LOC100797527 [Glycine max]
Length=1109

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK+L+L  VSRII G
Sbjct  24   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKRLKLTNVSRIISG  83

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS G + K
Sbjct  84   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRGHHWK  139



>ref|XP_007015313.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 3 [Theobroma cacao]
 gb|EOY32932.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 3 [Theobroma cacao]
Length=883

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS  S+Q+    
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISR-SHQRKWRT  138

Query  362  TQRSKSL  382
              RS  +
Sbjct  139  ESRSDGI  145



>ref|XP_007015312.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 2 [Theobroma cacao]
 gb|EOY32931.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 2 [Theobroma cacao]
Length=929

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS  S+Q+    
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISR-SHQRKWRT  138

Query  362  TQRSKSL  382
              RS  +
Sbjct  139  ESRSDGI  145



>ref|XP_010673731.1| PREDICTED: uncharacterized protein LOC104890071 [Beta vulgaris 
subsp. vulgaris]
Length=1100

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 109/127 (86%), Gaps = 1/127 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ GKEEK L+L+ +SRII G
Sbjct  17   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEKHLKLSHISRIISG  76

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS  S+QK    
Sbjct  77   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISR-SHQKKWRT  135

Query  362  TQRSKSL  382
              RS S+
Sbjct  136  ESRSDSI  142



>ref|XP_006420722.1| hypothetical protein CICLE_v10004216mg [Citrus clementina]
 gb|ESR33962.1| hypothetical protein CICLE_v10004216mg [Citrus clementina]
Length=1092

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+ AIT LKKGA LLKYGRRGKPKFCPFRL+ DES L+W  GKEEK L+L+ VSRIIPG
Sbjct  14   DIELAITALKKGAHLLKYGRRGKPKFCPFRLANDESILIWISGKEEKHLKLSHVSRIIPG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW TGLKALIS   Y+K + +
Sbjct  74   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFTGLKALISRSHYRKGRAE  133

Query  362  TQ  367
            ++
Sbjct  134  SR  135



>ref|XP_010269344.1| PREDICTED: uncharacterized protein LOC104606031 isoform X5 [Nelumbo 
nucifera]
Length=959

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    DIDQ-AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIP  178
            DI+Q AIT LKKGA+LLKYGRRGKPKFCPFRL+ DES L+W+ GKEEK L+L+ VSRIIP
Sbjct  20   DIEQQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVSRIIP  79

Query  179  GQRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQE  358
            GQRTAIFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW  GLKALIS   ++K + 
Sbjct  80   GQRTAIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFIGLKALISRSHHRKWRT  139

Query  359  DTQRSKSLTQG  391
            ++ RS  ++ G
Sbjct  140  ES-RSDGVSSG  149



>ref|XP_006470863.1| PREDICTED: uncharacterized protein LOC102630015 isoform X1 [Citrus 
sinensis]
Length=1092

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+ AIT LKKGA LLKYGRRGKPKFCPFRL+ DES L+W  GKEEK L+L+ VSRIIPG
Sbjct  14   DIELAITALKKGAHLLKYGRRGKPKFCPFRLANDESILIWISGKEEKHLKLSHVSRIIPG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW TGLKALIS   Y+K + +
Sbjct  74   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFTGLKALISRSHYRKGRAE  133

Query  362  TQ  367
            ++
Sbjct  134  SR  135



>emb|CBI40156.3| unnamed protein product [Vitis vinifera]
Length=905

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  14   AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTA  193
            AI  LKKGA LLKYGRRGKPKFCPFRLS DES L+W  GKEEK+L+L+ VSRIIPGQRT 
Sbjct  19   AIIALKKGAHLLKYGRRGKPKFCPFRLSNDESVLIWLSGKEEKRLKLSHVSRIIPGQRTP  78

Query  194  IFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQEDTQ  367
            IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVWLTGLKALIS G +QK + +++
Sbjct  79   IFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWLTGLKALISRGHHQKGRTESR  136



>ref|XP_008385699.1| PREDICTED: uncharacterized protein LOC103448227 [Malus domestica]
Length=1108

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+LN VSRII G
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLNHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYN+RSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNERSLDLICKDKDEAEVWFSGLKALISRSHHRK  135



>ref|XP_010926966.1| PREDICTED: uncharacterized protein LOC105049105 [Elaeis guineensis]
Length=1098

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRI+PG
Sbjct  18   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIMPG  77

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLIYNDRSLD+ICKDKDEAEVW  GLK LIS   ++K + +
Sbjct  78   QRTAIFQRYPRPEKECQSFSLIYNDRSLDLICKDKDEAEVWFAGLKTLISRSHHRKWRTE  137

Query  362  TQRSKSLTQG  391
            + RS  ++ G
Sbjct  138  S-RSDGVSSG  146



>ref|XP_010269343.1| PREDICTED: uncharacterized protein LOC104606031 isoform X4 [Nelumbo 
nucifera]
Length=964

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    DIDQ-AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIP  178
            DI+Q AIT LKKGA+LLKYGRRGKPKFCPFRL+ DES L+W+ GKEEK L+L+ VSRIIP
Sbjct  20   DIEQQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVSRIIP  79

Query  179  GQRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQE  358
            GQRTAIFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW  GLKALIS   ++K + 
Sbjct  80   GQRTAIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFIGLKALISRSHHRKWRT  139

Query  359  DTQRSKSLTQG  391
            ++ RS  ++ G
Sbjct  140  ES-RSDGVSSG  149



>ref|XP_006470568.1| PREDICTED: uncharacterized protein LOC102612328 isoform X2 [Citrus 
sinensis]
Length=1106

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 128/207 (62%), Gaps = 43/207 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  21   DTEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALI           
Sbjct  81   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRKWRTE  140

Query  329  ----------------------------SNGSYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                        SN S QKD  D  R      S  + GL K F+
Sbjct  141  SRSDGIPSEANSPRTYTRRSSPLNSPFGSNDSLQKDGGDHLRLHSPYDSPPKNGLDKTFS  200

Query  413  DIVSYTASSKTHTFADTNSYSVSPLPT  493
            D++ Y+  SK    +DT S SV  L +
Sbjct  201  DVLLYSVPSKAFFPSDTASGSVHSLSS  227



>dbj|BAJ88383.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1092

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 125/199 (63%), Gaps = 45/199 (23%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEKQL L+ VSRIIPG
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHVSRIIPG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LIS  S+Q+    
Sbjct  80   QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISR-SHQRKWRT  138

Query  362  TQRSKSLTQG--------------------------------------------GLGKAF  409
              RS  L+ G                                            GL KAF
Sbjct  139  ESRSDMLSSGTTSPRTYTRRSSPLSSPFSSNDSVHKDGSENYRLRSPYGSPPKAGLDKAF  198

Query  410  ADIVSYTASSKTHTFADTN  466
            +DIVSY A  +    +D+N
Sbjct  199  SDIVSYAAPPRPFFPSDSN  217



>ref|XP_009603791.1| PREDICTED: uncharacterized protein LOC104098693 isoform X1 [Nicotiana 
tomentosiformis]
Length=1101

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 128/205 (62%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRL+ DESAL+W+ GKEEK L+L+ VSRII G
Sbjct  15   DIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSHVSRIISG  74

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNG--------  337
            QRT IFQR+PRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS G        
Sbjct  75   QRTPIFQRHPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRGHQRKWRTE  134

Query  338  -------------------------------SYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                           S QKD  D  R      S  + G+ KAF+
Sbjct  135  SRSDGVPSGATSPRTYTRRNSPLHSPFGSGDSSQKDGGDQLRLHSPYGSPPKNGVNKAFS  194

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            DI+ Y+   K    +D  S S+  L
Sbjct  195  DIIHYSLPPKGLFTSDAASASIHSL  219



>ref|XP_006446270.1| hypothetical protein CICLE_v10014100mg [Citrus clementina]
 gb|ESR59510.1| hypothetical protein CICLE_v10014100mg [Citrus clementina]
Length=1106

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 128/207 (62%), Gaps = 43/207 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  21   DTEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALI           
Sbjct  81   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRKWRTE  140

Query  329  ----------------------------SNGSYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                        SN S QKD  D  R      S  + GL K F+
Sbjct  141  SRSDGIPSEANSPRTYTRRSSPLNSPFGSNDSLQKDGGDHLRLHSPYDSPPKNGLDKTFS  200

Query  413  DIVSYTASSKTHTFADTNSYSVSPLPT  493
            D++ Y+  SK    +DT S SV  L +
Sbjct  201  DVLLYSVPSKAFFPSDTASGSVHSLSS  227



>ref|XP_009350077.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like [Pyrus x bretschneideri]
Length=1108

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  135



>ref|XP_009785511.1| PREDICTED: uncharacterized protein LOC104233767 isoform X1 [Nicotiana 
sylvestris]
Length=1101

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRL+ DESAL+W+ GKEEK L+L+ VSRII G
Sbjct  15   DIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSHVSRIISG  74

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQR+PRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS G +Q+    
Sbjct  75   QRTPIFQRHPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRG-HQRKWRT  133

Query  362  TQRSKSLTQG  391
              RS  +  G
Sbjct  134  ESRSDGIPSG  143



>gb|KHG19721.1| putative E3 ubiquitin-protein ligase HERC1 [Gossypium arboreum]
 gb|KHG29805.1| putative E3 ubiquitin-protein ligase HERC1 [Gossypium arboreum]
Length=1106

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 127/205 (62%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W  GKEEK L+L+ VSRII G
Sbjct  20   DIEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWLSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALI           
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHQRKWRTE  139

Query  329  ----------------------------SNGSYQKDQEDTQR----SKSLTQGGLGKAFA  412
                                        SN S QKD  D  R     +S  + GLGKAF+
Sbjct  140  SRSDGIPSEVNSPRTYTRRSSPLHSPFGSNDSLQKDGGDHLRLHSPYESPPKNGLGKAFS  199

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D++ Y    K     ++ S SV  L
Sbjct  200  DVILYAVPPKGFFPPESASGSVHSL  224



>ref|XP_008348288.1| PREDICTED: uncharacterized protein LOC103411430 [Malus domestica]
Length=1078

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DID AIT LKKGA LLKYGRRGKPKFCPFRLS DES L+WY G EEK ++L +VSRI+PG
Sbjct  20   DIDLAITALKKGAQLLKYGRRGKPKFCPFRLSNDESXLIWYSGXEEKYVKLTQVSRIVPG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT  FQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW TGLKALIS G +QK + +
Sbjct  80   QRTQTFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFTGLKALISRGLHQKRRAE  139

Query  362  TQ  367
            ++
Sbjct  140  SR  141



>ref|XP_004291740.1| PREDICTED: uncharacterized protein LOC101306203 [Fragaria vesca 
subsp. vesca]
Length=1109

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QA+T LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK+L+L+ VSRII G
Sbjct  20   DIEQAVTALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKRLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  135



>ref|XP_009395123.1| PREDICTED: uncharacterized protein LOC103980429 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395124.1| PREDICTED: uncharacterized protein LOC103980429 [Musa acuminata 
subsp. malaccensis]
Length=1059

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRG+PKFCPFRLS DES L+WY G++EKQL+L++V +IIPG
Sbjct  23   DVEQAITALKKGAYLLKYGRRGRPKFCPFRLSNDESLLIWYSGRDEKQLKLSQVYKIIPG  82

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRP+KEYQSFSLIYN+RSLD+ICKDKDEAE W  GLKALIS G+Y+K + +
Sbjct  83   QRTAIFQRYPRPDKEYQSFSLIYNERSLDLICKDKDEAEAWFVGLKALISRGNYRKLRSE  142

Query  362  TQ  367
            ++
Sbjct  143  SK  144



>emb|CBI24230.3| unnamed protein product [Vitis vinifera]
Length=953

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QA+T LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  14   DTEQALTALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKLLKLSHVSRIISG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS G + +    
Sbjct  74   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRGGHHRKWRT  133

Query  362  TQRSKSL  382
              RS  +
Sbjct  134  ESRSDGI  140



>ref|XP_010269342.1| PREDICTED: uncharacterized protein LOC104606031 isoform X3 [Nelumbo 
nucifera]
Length=1068

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    DIDQ-AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIP  178
            DI+Q AIT LKKGA+LLKYGRRGKPKFCPFRL+ DES L+W+ GKEEK L+L+ VSRIIP
Sbjct  20   DIEQQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVSRIIP  79

Query  179  GQRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQE  358
            GQRTAIFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW  GLKALIS   ++K + 
Sbjct  80   GQRTAIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFIGLKALISRSHHRKWRT  139

Query  359  DTQRSKSLTQG  391
            ++ RS  ++ G
Sbjct  140  ES-RSDGVSSG  149



>ref|XP_009399981.1| PREDICTED: uncharacterized protein LOC103984245 [Musa acuminata 
subsp. malaccensis]
Length=1100

 Score =   204 bits (518),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 132/205 (64%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRI+PG
Sbjct  19   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESTLIWFSGKEEKHLKLSHVSRIMPG  78

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRTAIFQRYP+PEKE QSFSLIY+DRSLD+ICKDKDEAEVW  GLK LI           
Sbjct  79   QRTAIFQRYPQPEKECQSFSLIYSDRSLDLICKDKDEAEVWFAGLKTLIPRSHHRSWRTE  138

Query  329  ----------------------------SNGSYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                        S+ S QKD  DT R +    S T+ GL K+F+
Sbjct  139  SRSDGASSGTNSPRTYTRRSSPLNSPFGSSDSMQKDGSDTFRVRSPYGSPTKNGLDKSFS  198

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            ++VSY    K+   +D+ + S+  L
Sbjct  199  EVVSYAVPPKSFFPSDSATGSLHSL  223



>ref|XP_007015311.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 1 [Theobroma cacao]
 gb|EOY32930.1| Regulator of chromosome condensation (RCC1) family with FYVE 
zinc finger domain isoform 1 [Theobroma cacao]
Length=1105

 Score =   204 bits (518),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 128/204 (63%), Gaps = 42/204 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALI           
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHQRKWRTE  139

Query  329  ----------------------------SNGSYQKDQEDTQRS---KSLTQGGLGKAFAD  415
                                        SN S QKD +  +     +S  + GL KAF+D
Sbjct  140  SRSDGIPSEANSPRTYTRRSSPLNSPFGSNDSLQKDGDHLRLHSPYESPPKNGLDKAFSD  199

Query  416  IVSYTASSKTHTFADTNSYSVSPL  487
            ++ Y    K     D+ S SV  L
Sbjct  200  VILYAVPPKGFFPPDSASGSVHSL  223



>ref|XP_010938572.1| PREDICTED: uncharacterized protein LOC105057618 [Elaeis guineensis]
Length=1100

 Score =   204 bits (518),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 126/171 (74%), Gaps = 19/171 (11%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK+L+L+ VSRI+PG
Sbjct  18   DVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKRLKLSHVSRIMPG  77

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTA+FQRYPRPEKE QSFSLIYNDRSLD+ICKDKDEAEVW  GLK LIS    QK    
Sbjct  78   QRTAVFQRYPRPEKECQSFSLIYNDRSLDLICKDKDEAEVWFAGLKTLISQSHNQK----  133

Query  362  TQRSKSLTQGGLGKAFADIVSYTASSKTHTFADTNSYSVSPLPTDVGSPNA  514
              R++S + G        + S T S +T+T      +  SPL +  GS ++
Sbjct  134  -WRTESRSDG--------VSSGTNSPRTYT------HRSSPLSSPFGSSDS  169



>ref|XP_010269339.1| PREDICTED: uncharacterized protein LOC104606031 isoform X1 [Nelumbo 
nucifera]
Length=1102

 Score =   204 bits (518),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    DIDQ-AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIP  178
            DI+Q AIT LKKGA+LLKYGRRGKPKFCPFRL+ DES L+W+ GKEEK L+L+ VSRIIP
Sbjct  20   DIEQQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVSRIIP  79

Query  179  GQRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQE  358
            GQRTAIFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW  GLKALIS   ++K + 
Sbjct  80   GQRTAIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFIGLKALISRSHHRKWRT  139

Query  359  DTQRSKSLTQG  391
            ++ RS  ++ G
Sbjct  140  ES-RSDGVSSG  149



>ref|XP_011090167.1| PREDICTED: uncharacterized protein LOC105170925 [Sesamum indicum]
Length=1108

 Score =   204 bits (518),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  23   DIEQAITALKKGAHLLKYGRRGKPKFCPFRLSNDESLLIWFSGKEEKHLKLSHVSRIISG  82

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDK+EAEVW +GLKALIS G +Q+    
Sbjct  83   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKEEAEVWFSGLKALISRG-HQRKWRT  141

Query  362  TQRSKSLTQG  391
              RS  ++ G
Sbjct  142  ESRSDGISSG  151



>ref|XP_002527043.1| Ran GTPase binding protein, putative [Ricinus communis]
 gb|EEF35343.1| Ran GTPase binding protein, putative [Ricinus communis]
Length=1100

 Score =   204 bits (518),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 134/214 (63%), Gaps = 43/214 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  14   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIYN+RSLD+ICKDKDEAEVW +GLKALI           
Sbjct  74   QRTPIFQRYPRPEKEYQSFSLIYNERSLDLICKDKDEAEVWFSGLKALITRSHQRKWRTE  133

Query  329  ----------------------------SNGSYQKDQEDTQRS---KSLTQGGLGKAFAD  415
                                        SN S QKD +  +     +S  + GL KAF+D
Sbjct  134  SRSDGIPSEANSPRTYTRRSSPLNSPFGSNDSLQKDGDQLRLHSPYESPPKNGLDKAFSD  193

Query  416  IVSYTASSKTHTFADTNSYSVSPLPTDVGSPNAR  517
            ++ Y    K    +D+ S SV  L +  GS + R
Sbjct  194  VILYAVPPKGFFPSDSASASVHSLSSG-GSDSVR  226



>ref|XP_002279847.2| PREDICTED: uncharacterized protein LOC100248282 [Vitis vinifera]
Length=1107

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QA+T LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DTEQALTALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKLLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS G + +    
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRGGHHRKWRT  139

Query  362  TQRSKSL  382
              RS  +
Sbjct  140  ESRSDGI  146



>ref|XP_003551961.1| PREDICTED: uncharacterized protein LOC100791947 isoform X1 [Glycine 
max]
Length=1106

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK+L+L  VSRII G
Sbjct  21   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKRLKLTNVSRIISG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  81   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  136



>ref|XP_004252890.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 isoform X2 [Solanum 
lycopersicum]
Length=1107

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRL+ DESAL+W+ GKEEK L+L+ VSRII G
Sbjct  21   DIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSHVSRIISG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQR+PRPEKEYQSFSLIYNDRSLD+ICKDK+EAEVW +GLKALIS G  +K + D
Sbjct  81   QRTPIFQRHPRPEKEYQSFSLIYNDRSLDLICKDKEEAEVWFSGLKALISRGHQRKWRTD  140

Query  362  TQRSKSLTQG  391
            + RS  +  G
Sbjct  141  S-RSDGIPSG  149



>ref|XP_006349801.1| PREDICTED: uncharacterized protein LOC102600493 [Solanum tuberosum]
Length=1106

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRL+ DESAL+W+ GKEEK L+L+ VSRII G
Sbjct  21   DIEQAITALKKGACLLKYGRRGKPKFCPFRLANDESALIWFSGKEEKHLKLSHVSRIISG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQR+PRPEKEYQSFSLIYNDRSLD+ICKDK+EAEVW +GLKALIS G  +K + D
Sbjct  81   QRTPIFQRHPRPEKEYQSFSLIYNDRSLDLICKDKEEAEVWFSGLKALISRGHQRKWRTD  140

Query  362  TQRSKSLTQG  391
            + RS  +  G
Sbjct  141  S-RSDGIPSG  149



>ref|XP_009127757.1| PREDICTED: uncharacterized protein LOC103852607 [Brassica rapa]
Length=1016

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 137/204 (67%), Gaps = 32/204 (16%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT+LKKG++LLKYGRRGKPKFCPF+L+ DES L+WY GKEEKQ++L++V RI+PG
Sbjct  5    DVEQAITSLKKGSYLLKYGRRGKPKFCPFQLTSDESTLVWYSGKEEKQIKLSQVLRIVPG  64

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW+ GLKALI+     K    
Sbjct  65   QRTATFKRYPRPEKEYQSFSLICPDRSLDLICKDKDEAEVWVVGLKALITRVKISKWKNT  124

Query  350  -------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTA-SSKTHT  451
                                     DQ     +++ T   LGK F+DIVS TA ++   T
Sbjct  125  IKPEITSPECPTPQARRVSPFVSILDQVTQPSTETSTPNRLGKVFSDIVSITAPANNNQT  184

Query  452  FADT-NSYSVSPL-PTDVGSPNAR  517
             A+T N     P+ P +V +PN+R
Sbjct  185  EANTLNPNLYCPISPGNVENPNSR  208



>gb|AAG52535.1|AC013289_2 putative regulator of chromosome condensation; 48393-44372 [Arabidopsis 
thaliana]
Length=1028

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 135/204 (66%), Gaps = 32/204 (16%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT+LKKG++LLKYGRRGKPKFCPF+L+ DESAL+WY GKEEKQ++L++V RI+PG
Sbjct  13   DVEQAITSLKKGSYLLKYGRRGKPKFCPFQLTSDESALVWYSGKEEKQIKLSQVLRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRT  F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW+ GLK+LI+     K    
Sbjct  73   QRTPTFKRYPRPEKEYQSFSLICPDRSLDLICKDKDEAEVWVVGLKSLITRVKVSKWKTT  132

Query  350  -------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTA--SSKTH  448
                                     DQ     +++ TQ  LGK F+DIV+ TA  S+   
Sbjct  133  IKPEITSAECPTPHARRVSPFVTILDQVIQPSNETSTQTRLGKVFSDIVAITAPPSNNNQ  192

Query  449  TFADTNSYS-VSPLPTDVGSPNAR  517
            T A  N +   SP P +V + N R
Sbjct  193  TEASGNLFCPFSPTPANVENSNLR  216



>ref|NP_177129.2| regulator of chromosome condensation and FYVE zinc finger domain-containing 
protein [Arabidopsis thaliana]
 gb|AEE34965.1| regulator of chromosome condensation and FYVE zinc finger domain-containing 
protein [Arabidopsis thaliana]
Length=1041

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 135/204 (66%), Gaps = 32/204 (16%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT+LKKG++LLKYGRRGKPKFCPF+L+ DESAL+WY GKEEKQ++L++V RI+PG
Sbjct  26   DVEQAITSLKKGSYLLKYGRRGKPKFCPFQLTSDESALVWYSGKEEKQIKLSQVLRIVPG  85

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRT  F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW+ GLK+LI+     K    
Sbjct  86   QRTPTFKRYPRPEKEYQSFSLICPDRSLDLICKDKDEAEVWVVGLKSLITRVKVSKWKTT  145

Query  350  -------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTA--SSKTH  448
                                     DQ     +++ TQ  LGK F+DIV+ TA  S+   
Sbjct  146  IKPEITSAECPTPHARRVSPFVTILDQVIQPSNETSTQTRLGKVFSDIVAITAPPSNNNQ  205

Query  449  TFADTNSYS-VSPLPTDVGSPNAR  517
            T A  N +   SP P +V + N R
Sbjct  206  TEASGNLFCPFSPTPANVENSNLR  229



>ref|XP_006476624.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X3 [Citrus sinensis]
Length=931

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 132/197 (67%), Gaps = 37/197 (19%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QA+  LKKG +LLKYGRRGKPKFCPFRLS DE  L+WY GKEEKQL+L+ VSRIIPG
Sbjct  13   DTEQAVRVLKKGTYLLKYGRRGKPKFCPFRLSSDEKLLIWYAGKEEKQLKLSHVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGS-------  340
            QRTA+FQRYP+PEKEYQSFSLIY +RSLD+ICKDKDEAE+W T L+ALIS  +       
Sbjct  73   QRTAVFQRYPQPEKEYQSFSLIYRNRSLDLICKDKDEAELWFTALRALISEDNRCKSRSD  132

Query  341  --------------------------YQKDQEDTQ----RSKSLTQGGLGKAFADIVSYT  430
                                        KD  DTQ      ++  Q  LGKAF++++S+T
Sbjct  133  SISSDSPRSHTQKNSPSHVSSISSDLTNKDSGDTQPILVAYENSPQNRLGKAFSEVLSFT  192

Query  431  ASSKTHTFADTNSYSVS  481
            A++K +T A++ S S++
Sbjct  193  AAAKAYTRAESVSKSLN  209



>gb|AET00240.2| regulator of chromosome condensation (RCC1) family protein [Medicago 
truncatula]
Length=1117

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  35   DIEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  94

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  95   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  150



>ref|XP_006400502.1| hypothetical protein EUTSA_v10012507mg [Eutrema salsugineum]
 gb|ESQ41955.1| hypothetical protein EUTSA_v10012507mg [Eutrema salsugineum]
Length=1104

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 129/205 (63%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT+LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAITSLKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIYN+RSLD+ICKDKDEAEVW +GLKALI           
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNERSLDLICKDKDEAEVWFSGLKALISRCHQRRWRAE  139

Query  329  ----------------------------SNGSYQKDQEDTQR----SKSLTQGGLGKAFA  412
                                        SN S+QKD  +  R     +S  + G+ KAF+
Sbjct  140  SRSDGTPSEANSPRTYTRRSSPLHSPFSSNESFQKDGSNHHRLHSPYESPPENGIDKAFS  199

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D+  Y    K    +D  + SV  L
Sbjct  200  DMSLYALPPKGFFSSDPATISVHSL  224



>ref|XP_004491255.1| PREDICTED: uncharacterized protein LOC101508617 [Cicer arietinum]
Length=1101

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  19   DIEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  78

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  79   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  134



>ref|XP_006476622.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476623.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X2 [Citrus sinensis]
Length=937

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 132/197 (67%), Gaps = 37/197 (19%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QA+  LKKG +LLKYGRRGKPKFCPFRLS DE  L+WY GKEEKQL+L+ VSRIIPG
Sbjct  13   DTEQAVRVLKKGTYLLKYGRRGKPKFCPFRLSSDEKLLIWYAGKEEKQLKLSHVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGS-------  340
            QRTA+FQRYP+PEKEYQSFSLIY +RSLD+ICKDKDEAE+W T L+ALIS  +       
Sbjct  73   QRTAVFQRYPQPEKEYQSFSLIYRNRSLDLICKDKDEAELWFTALRALISEDNRCKSRSD  132

Query  341  --------------------------YQKDQEDTQ----RSKSLTQGGLGKAFADIVSYT  430
                                        KD  DTQ      ++  Q  LGKAF++++S+T
Sbjct  133  SISSDSPRSHTQKNSPSHVSSISSDLTNKDSGDTQPILVAYENSPQNRLGKAFSEVLSFT  192

Query  431  ASSKTHTFADTNSYSVS  481
            A++K +T A++ S S++
Sbjct  193  AAAKAYTRAESVSKSLN  209



>ref|XP_008347000.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like [Malus domestica]
Length=709

 Score =   199 bits (507),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 92/118 (78%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  14   AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTA  193
            AIT+LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GKEEK L+L++VSRI+PGQRT 
Sbjct  44   AITSLKKGAQLLKYGRRGKPKFCPFRLSNDESVLIWYSGKEEKYLKLSQVSRIVPGQRTQ  103

Query  194  IFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQEDTQ  367
             FQRYPRPEKEYQSFSLI +DRSLD+ICKDKDEAEVW TGLKALIS G +QK + +++
Sbjct  104  TFQRYPRPEKEYQSFSLICBDRSLDLICKDKDEAEVWFTGLKALISRGLHQKGRPESR  161



>ref|XP_004971285.1| PREDICTED: uncharacterized protein LOC101782721 [Setaria italica]
Length=1092

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 126/205 (61%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L+ VSRIIPG
Sbjct  19   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHVSRIIPG  78

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS----------  331
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LIS          
Sbjct  79   QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISRSHQRKWRTE  138

Query  332  -----------------------------NGSYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                         N S  KD  D  R +    S  + GL KAF+
Sbjct  139  SRSDILSSGATSPRTYTRRSSPLSSPFSSNDSIHKDGSDNYRLRTPYGSPPKNGLEKAFS  198

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D++ Y    K    +D+N+ SV  +
Sbjct  199  DVMLYAVPPKGFLPSDSNAGSVHSM  223



>ref|XP_007141489.1| hypothetical protein PHAVU_008G200300g [Phaseolus vulgaris]
 gb|ESW13483.1| hypothetical protein PHAVU_008G200300g [Phaseolus vulgaris]
Length=1106

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  19   DIEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  78

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  79   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  134



>ref|XP_010420743.1| PREDICTED: uncharacterized protein LOC104706266 [Camelina sativa]
Length=1108

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 130/205 (63%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  24   DVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  83

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIY++RSLD+ICKDKDEAEVW +GLKALI           
Sbjct  84   QRTPIFQRYPRPEKEYQSFSLIYDERSLDLICKDKDEAEVWFSGLKALISRCHQRKWRTE  143

Query  329  ----------------------------SNGSYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                        SN S+QKD  +  R +    S  + G+ KAF+
Sbjct  144  SRSDGTPSEANSPRTYTRRSSPLHSPFSSNDSFQKDGSNHHRLQSPYESPPKNGMDKAFS  203

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D+  Y    K+   +D+ + SV  L
Sbjct  204  DMSLYAVPPKSFFPSDSATISVHSL  228



>ref|XP_008803202.1| PREDICTED: uncharacterized protein LOC103716809 [Phoenix dactylifera]
Length=1047

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GK EKQL L+ VS+IIPG
Sbjct  46   DIEQAIIALKKGACLLKYGRRGKPKFCPFRLSNDESTLIWYSGKVEKQLILSHVSKIIPG  105

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQE  358
            QRT IFQRYPRP+KEYQSFSLI  DRSLD+ICKDKDEAEVW  GLKALIS G+YQK  E
Sbjct  106  QRTPIFQRYPRPDKEYQSFSLITKDRSLDLICKDKDEAEVWFVGLKALISRGNYQKKSE  164



>ref|XP_004513412.1| PREDICTED: uncharacterized protein LOC101496615 [Cicer arietinum]
Length=1110

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  26   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  85

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRP KEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  86   QRTPIFQRYPRPAKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  141



>ref|XP_002887252.1| hypothetical protein ARALYDRAFT_476103 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63511.1| hypothetical protein ARALYDRAFT_476103 [Arabidopsis lyrata subsp. 
lyrata]
Length=1027

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 135/204 (66%), Gaps = 32/204 (16%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT+LKKG++LLKYGRRGKPKFCPF+L+ DESAL+WY GKEEKQ++L++V RI+PG
Sbjct  13   DVEQAITSLKKGSYLLKYGRRGKPKFCPFQLTSDESALVWYSGKEEKQIKLSQVLRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRT+ F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW+ GLK+LI+     K    
Sbjct  73   QRTSTFKRYPRPEKEYQSFSLICPDRSLDLICKDKDEAEVWVVGLKSLITRVKVSKWKNT  132

Query  350  -------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTA--SSKTH  448
                                     DQ     +++ TQ  LGK F+DIVS TA  S+   
Sbjct  133  IKPEITSAECPTPHARRVSPFVTILDQVIQPSNETSTQTRLGKVFSDIVSITAPPSNNNQ  192

Query  449  TFADTNSYS-VSPLPTDVGSPNAR  517
            T    N +   SP P +V + + R
Sbjct  193  TETSANLFCPFSPTPVNVENSSLR  216



>ref|XP_004307114.1| PREDICTED: uncharacterized protein LOC101307830 [Fragaria vesca 
subsp. vesca]
Length=1083

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI  AIT LKKG+ LLKYGRRGKPKFCPFRLS DES L+WY GK+EK ++L+ VSRIIPG
Sbjct  20   DIHLAITALKKGSQLLKYGRRGKPKFCPFRLSNDESVLIWYSGKDEKYVKLSHVSRIIPG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY+DRSLD+ICKDKDEAEVW TGLKALIS G  QK + +
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYDDRSLDLICKDKDEAEVWFTGLKALISRGLQQKGRAE  139

Query  362  TQ  367
            T+
Sbjct  140  TK  141



>gb|KHG00947.1| putative E3 ubiquitin-protein ligase HERC1 [Gossypium arboreum]
 gb|KHG25966.1| putative E3 ubiquitin-protein ligase HERC1 [Gossypium arboreum]
Length=1105

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYN+RSLD+ICKDKDEAEVW +GLKALIS  S+Q+    
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNERSLDLICKDKDEAEVWFSGLKALISR-SHQRKWRT  138

Query  362  TQRSKSL  382
              RS  +
Sbjct  139  ESRSDGI  145



>gb|KFK26205.1| hypothetical protein AALP_AA8G216200 [Arabis alpina]
Length=1104

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  21   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYN+RSLD+ICKDKDEAEVW +GLKAL+S   YQ+    
Sbjct  81   QRTPIFQRYPRPEKEYQSFSLIYNERSLDLICKDKDEAEVWFSGLKALVSR-CYQRKWRT  139

Query  362  TQRS  373
              RS
Sbjct  140  ESRS  143



>ref|XP_008799103.1| PREDICTED: uncharacterized protein LOC103713841 [Phoenix dactylifera]
Length=1100

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GK+EK L+L+ VSRI+PG
Sbjct  16   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKDEKHLKLSHVSRIMPG  75

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLIY+DRSLD+ICKDKDEAEVW  GLK LIS   ++K + +
Sbjct  76   QRTAIFQRYPRPEKECQSFSLIYDDRSLDLICKDKDEAEVWFAGLKTLISRSHHRKWRTE  135

Query  362  TQRSKSLTQG  391
            + RS  ++ G
Sbjct  136  S-RSDGMSSG  144



>ref|XP_011020389.1| PREDICTED: uncharacterized protein LOC105122796 [Populus euphratica]
Length=1098

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+ AIT LK+G  LLKYGRRGKPKFCPFRLS DES L+W  GKEEK L+L+ VSRIIPG
Sbjct  16   DIELAITALKRGTQLLKYGRRGKPKFCPFRLSNDESVLIWISGKEEKHLKLSHVSRIIPG  75

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY+DRSLD+ICKDK+EAEVW TGLKALISN    K +E+
Sbjct  76   QRTPIFQRYPRPEKEYQSFSLIYSDRSLDLICKDKEEAEVWFTGLKALISNRQIWKKREE  135

Query  362  TQRSKSLTQGGLGKAF  409
            T+    L++    +A+
Sbjct  136  TRNDGLLSEANSPRAY  151



>ref|XP_011080399.1| PREDICTED: uncharacterized protein LOC105163660 [Sesamum indicum]
Length=1101

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRL+ DES L+W+ GKEEK L+L  VSRII G
Sbjct  16   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLTHVSRIISG  75

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYN+RSLD+ICKDK+EAEVW +GLKALIS  S+Q+    
Sbjct  76   QRTPIFQRYPRPEKEYQSFSLIYNERSLDLICKDKEEAEVWFSGLKALISR-SHQRKWRT  134

Query  362  TQRSKSLTQG  391
              RS  ++ G
Sbjct  135  ESRSDGISSG  144



>ref|XP_010454214.1| PREDICTED: uncharacterized protein LOC104736008 [Camelina sativa]
Length=1108

 Score =   201 bits (512),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 130/205 (63%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  24   DVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  83

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIY++RSLD+ICKDKDEAEVW +GLKALI           
Sbjct  84   QRTPIFQRYPRPEKEYQSFSLIYDERSLDLICKDKDEAEVWFSGLKALISRCHQRKWRTE  143

Query  329  ----------------------------SNGSYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                        SN S+QKD  +  R +    S  + G+ KAF+
Sbjct  144  SRSDGTPSEANSPRTYTRRSSPLHSPFSSNDSFQKDGSNHHRLQSPYESPPKNGMDKAFS  203

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D+  Y    K+   +D+ + SV  L
Sbjct  204  DMSLYAVPPKSLFPSDSATISVHSL  228



>ref|XP_010493003.1| PREDICTED: uncharacterized protein LOC104770301 [Camelina sativa]
Length=1108

 Score =   201 bits (512),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 130/205 (63%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  24   DVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  83

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIY++RSLD+ICKDKDEAEVW +GLKALI           
Sbjct  84   QRTPIFQRYPRPEKEYQSFSLIYDERSLDLICKDKDEAEVWFSGLKALISRCHQRKWRTE  143

Query  329  ----------------------------SNGSYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                        SN S+QKD  +  R +    S  + G+ KAF+
Sbjct  144  SRSDGTPSEANSPRTYTRRSSPLHSPFSSNDSFQKDGSNHHRLQSPYDSPPKNGMDKAFS  203

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D+  Y    K+   +D+ + SV  L
Sbjct  204  DMSLYAVPPKSLFPSDSATISVHSL  228



>ref|XP_006286943.1| hypothetical protein CARUB_v10000090mg [Capsella rubella]
 gb|EOA19841.1| hypothetical protein CARUB_v10000090mg [Capsella rubella]
Length=1102

 Score =   201 bits (512),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 129/205 (63%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  22   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  81

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIY++RSLD+ICKDKDEAEVW +GLKALI           
Sbjct  82   QRTPIFQRYPRPEKEYQSFSLIYDERSLDLICKDKDEAEVWFSGLKALISRCHQRNWRTE  141

Query  329  ----------------------------SNGSYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                        SN S+QKD  +  R      S  + G+ KAF+
Sbjct  142  SRSDGTPSEANSPRTYTRRSSPLHSPFSSNDSFQKDGSNHHRLHSPYDSPPKDGIDKAFS  201

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D+  Y    K+   +D+ + SV  L
Sbjct  202  DMSLYAVPPKSFFPSDSATISVHSL  226



>dbj|BAD87854.1| putative ZR1 protein [Oryza sativa Japonica Group]
Length=1091

 Score =   201 bits (511),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L++VSRI+PG
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSQVSRIVPG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LIS+ S+Q+    
Sbjct  80   QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISH-SHQRKWRT  138

Query  362  TQRSKSLTQG  391
              RS  ++ G
Sbjct  139  ESRSDIISSG  148



>ref|XP_006470569.1| PREDICTED: uncharacterized protein LOC102612328 isoform X3 [Citrus 
sinensis]
Length=918

 Score =   200 bits (508),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 126/204 (62%), Gaps = 43/204 (21%)
 Frame = +2

Query  11   QAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRT  190
            +AIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII GQRT
Sbjct  41   KAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRT  100

Query  191  AIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI--------------  328
             IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALI              
Sbjct  101  PIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRKWRTESRS  160

Query  329  -------------------------SNGSYQKDQEDTQRSK----SLTQGGLGKAFADIV  421
                                     SN S QKD  D  R      S  + GL K F+D++
Sbjct  161  DGIPSEANSPRTYTRRSSPLNSPFGSNDSLQKDGGDHLRLHSPYDSPPKNGLDKTFSDVL  220

Query  422  SYTASSKTHTFADTNSYSVSPLPT  493
             Y+  SK    +DT S SV  L +
Sbjct  221  LYSVPSKAFFPSDTASGSVHSLSS  244



>gb|EEE56014.1| hypothetical protein OsJ_04782 [Oryza sativa Japonica Group]
Length=1093

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L++VSRI+PG
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSQVSRIVPG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LIS+ S+Q+    
Sbjct  80   QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISH-SHQRKWRT  138

Query  362  TQRSKSLTQG  391
              RS  ++ G
Sbjct  139  ESRSDIISSG  148



>gb|EEC72175.1| hypothetical protein OsI_05225 [Oryza sativa Indica Group]
Length=1093

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L++VSRI+PG
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSQVSRIVPG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LIS+ S+Q+    
Sbjct  80   QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISH-SHQRKWRT  138

Query  362  TQRSKSLTQG  391
              RS  ++ G
Sbjct  139  ESRSDIISSG  148



>ref|NP_001045419.2| Os01g0952300 [Oryza sativa Japonica Group]
 dbj|BAF07333.2| Os01g0952300 [Oryza sativa Japonica Group]
Length=1133

 Score =   201 bits (511),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L++VSRI+PG
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSQVSRIVPG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LIS+ S+Q+    
Sbjct  80   QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISH-SHQRKWRT  138

Query  362  TQRSKSLTQG  391
              RS  ++ G
Sbjct  139  ESRSDIISSG  148



>ref|XP_009361965.1| PREDICTED: uncharacterized protein LOC103952146 [Pyrus x bretschneideri]
Length=1078

 Score =   201 bits (510),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DID AIT LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GKEEK ++L++V RI+PG
Sbjct  20   DIDLAITALKKGAQLLKYGRRGKPKFCPFRLSNDESVLIWYSGKEEKCVKLSQVLRIVPG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT  FQRYPRPEKEYQSFSLI NDRSLD+ICKDKDEAEVW TGLKALIS G +QK + +
Sbjct  80   QRTQTFQRYPRPEKEYQSFSLICNDRSLDLICKDKDEAEVWFTGLKALISRGLHQKGRPE  139

Query  362  TQ  367
            ++
Sbjct  140  SR  141



>gb|EEC79138.1| hypothetical protein OsI_19792 [Oryza sativa Indica Group]
Length=1385

 Score =   202 bits (513),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 126/203 (62%), Gaps = 45/203 (22%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            ++  AIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEKQL L+ VSRIIPG
Sbjct  65   ELGVAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHVSRIIPG  124

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LI+  S+Q+    
Sbjct  125  QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLITR-SHQRKWRT  183

Query  362  TQRSKSLTQG--------------------------------------------GLGKAF  409
              RS  L+ G                                            GL KAF
Sbjct  184  ESRSDMLSSGTTSPRTYTRRSSPLSSPFSSNDSVHKDGGENYRLRSPFGSPPKVGLEKAF  243

Query  410  ADIVSYTASSKTHTFADTNSYSV  478
            +DIVSY A  K    +D+N+ SV
Sbjct  244  SDIVSYAAPPKPFFPSDSNAGSV  266



>ref|XP_002304793.1| hypothetical protein POPTR_0003s19720g [Populus trichocarpa]
 gb|EEE79772.1| hypothetical protein POPTR_0003s19720g [Populus trichocarpa]
Length=1099

 Score =   201 bits (510),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+ AIT LK+G  LLKYGRRGKPKFCPFRLS DES L+W  GKEEK L+L+ VSRIIPG
Sbjct  16   DIELAITALKRGTQLLKYGRRGKPKFCPFRLSNDESVLIWISGKEEKHLKLSHVSRIIPG  75

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY+DRSLD+ICKDK+EAEVW TGLKALISN    K +E+
Sbjct  76   QRTPIFQRYPRPEKEYQSFSLIYSDRSLDLICKDKEEAEVWFTGLKALISNRQIWKKREE  135

Query  362  TQRSKSLTQGGLGKAF  409
            T     L++    +A+
Sbjct  136  TTNDGLLSEANSPRAY  151



>ref|XP_010453304.1| PREDICTED: uncharacterized protein LOC104735251 [Camelina sativa]
 ref|XP_010453305.1| PREDICTED: uncharacterized protein LOC104735251 [Camelina sativa]
Length=1075

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 126/202 (62%), Gaps = 43/202 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ G EEK L+L+ VSRII G
Sbjct  20   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIY+DRSLDVICKDKDEAEVW TGLKAL+           
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYSDRSLDVICKDKDEAEVWFTGLKALVSHCHQRNRRTE  139

Query  329  ----------------------------SNGSYQKDQEDTQRS----KSLTQGGLGKAFA  412
                                        SN S+QKD  +  R     +S  + GL KAF+
Sbjct  140  SRSDGTPSEANSPRTYTRRTSPLHSPFSSNDSFQKDGSNHHRIHSPFESPPKNGLDKAFS  199

Query  413  DIVSYTASSKTHTFADTNSYSV  478
            D+  Y    K    +D+ + SV
Sbjct  200  DMALYAVPPKGFYPSDSATISV  221



>gb|KDO54854.1| hypothetical protein CISIN_1g0026771mg [Citrus sinensis]
Length=885

 Score =   199 bits (506),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 112/204 (55%), Positives = 126/204 (62%), Gaps = 43/204 (21%)
 Frame = +2

Query  11   QAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRT  190
            +AIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII GQRT
Sbjct  16   RAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRT  75

Query  191  AIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI--------------  328
             IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALI              
Sbjct  76   PIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRKWRTESRS  135

Query  329  -------------------------SNGSYQKDQEDTQR----SKSLTQGGLGKAFADIV  421
                                     SN S QKD  D  R      S  + GL K F+D++
Sbjct  136  DGIPSEANSPRTYTRRSSPLNSPFGSNDSLQKDGGDHLRLHSPYDSPPKNGLDKTFSDVL  195

Query  422  SYTASSKTHTFADTNSYSVSPLPT  493
             Y+  SK    +DT S SV  L +
Sbjct  196  LYSVPSKAFFPSDTASGSVHSLSS  219



>gb|EEE63569.1| hypothetical protein OsJ_18386 [Oryza sativa Japonica Group]
Length=1132

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 126/203 (62%), Gaps = 45/203 (22%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            ++  AIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEKQL L+ VSRIIPG
Sbjct  65   ELGVAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHVSRIIPG  124

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LI+  S+Q+    
Sbjct  125  QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLITR-SHQRKWRT  183

Query  362  TQRSKSLTQG--------------------------------------------GLGKAF  409
              RS  L+ G                                            GL KAF
Sbjct  184  ESRSDMLSSGTTSPRTYTRRSSPLSSPFSSNDSVHKDGVENYRLRSPFGSPPKVGLEKAF  243

Query  410  ADIVSYTASSKTHTFADTNSYSV  478
            +DIVSY A  K    +D+N+ SV
Sbjct  244  SDIVSYAAPPKPFFPSDSNAGSV  266



>gb|KDO54855.1| hypothetical protein CISIN_1g0026771mg, partial [Citrus sinensis]
Length=869

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 124/201 (62%), Gaps = 43/201 (21%)
 Frame = +2

Query  14   AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTA  193
            AIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII GQRT 
Sbjct  1    AITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRTP  60

Query  194  IFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI---------------  328
            IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALI               
Sbjct  61   IFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRKWRTESRSD  120

Query  329  ------------------------SNGSYQKDQEDTQRSK----SLTQGGLGKAFADIVS  424
                                    SN S QKD  D  R      S  + GL K F+D++ 
Sbjct  121  GIPSEANSPRTYTRRSSPLNSPFGSNDSLQKDGGDHLRLHSPYDSPPKNGLDKTFSDVLL  180

Query  425  YTASSKTHTFADTNSYSVSPL  487
            Y+  SK    +DT S SV  L
Sbjct  181  YSVPSKAFFPSDTASGSVHSL  201



>ref|XP_006646687.1| PREDICTED: uncharacterized protein LOC102710941 [Oryza brachyantha]
Length=1090

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L++VSRI+PG
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSQVSRIVPG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LIS  S+Q+    
Sbjct  80   QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISR-SHQRKWRT  138

Query  362  TQRSKSLTQG  391
              RS  ++ G
Sbjct  139  ESRSDIISSG  148



>ref|XP_003565075.1| PREDICTED: uncharacterized protein LOC100834588 [Brachypodium 
distachyon]
Length=1092

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 126/205 (61%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L+ VSRI+PG
Sbjct  22   DLEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHVSRIMPG  81

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS----------  331
            QRTAIFQRYPRPEKE QSFSLI  DRSLD+ICKDKDEAEVW  GLK LIS          
Sbjct  82   QRTAIFQRYPRPEKECQSFSLISQDRSLDIICKDKDEAEVWFAGLKTLISRSHQRKWRTE  141

Query  332  -----------------------------NGSYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                         N S  KD  +  R +    S  + GL KAF+
Sbjct  142  SRSDTISSAATSPRIYTRRSSPLSSPFSSNDSLHKDGNENYRFRSPYGSPQKNGLDKAFS  201

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D+V Y    K+   +D+N+ SV  +
Sbjct  202  DVVLYAVPPKSFFPSDSNARSVHSM  226



>gb|KHN12021.1| Putative E3 ubiquitin-protein ligase HERC1 [Glycine soja]
Length=1101

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRG PKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  14   DIEQAITALKKGACLLKYGRRGTPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  74   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  129



>ref|XP_007221066.1| hypothetical protein PRUPE_ppa016519mg, partial [Prunus persica]
 gb|EMJ22265.1| hypothetical protein PRUPE_ppa016519mg, partial [Prunus persica]
Length=1061

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  14   AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTA  193
            AIT LKKGA LLKYGRRGKPKFCPFRLS DES+L+WY GKEEK ++L+ VSRIIPGQRT 
Sbjct  1    AITALKKGAQLLKYGRRGKPKFCPFRLSNDESSLIWYSGKEEKYVKLSHVSRIIPGQRTQ  60

Query  194  IFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQEDTQ  367
             FQRYPRPEKEYQSFSL+YNDRSLD+ICKDKDEAEVW TGLKALIS G +QK + +++
Sbjct  61   TFQRYPRPEKEYQSFSLMYNDRSLDLICKDKDEAEVWFTGLKALISRGLHQKGRAESR  118



>ref|XP_011000561.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105108096 
[Populus euphratica]
Length=1095

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++ AIT LK+GA LLKYGRRG+PKFCPFRLS DESAL+W  GKE K L+L+ VSRIIPG
Sbjct  16   DVELAITALKRGAQLLKYGRRGRPKFCPFRLSNDESALIWISGKEVKDLKLSHVSRIIPG  75

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDK+EAEVW TGLKALIS+    K +E+
Sbjct  76   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKEEAEVWFTGLKALISHHQLWKKREE  135

Query  362  TQRSKSLTQGGLGKAF  409
            T+    L++    +A+
Sbjct  136  TRSDGLLSEANSPRAY  151



>ref|XP_003545401.1| PREDICTED: uncharacterized protein LOC100802464 isoform X1 [Glycine 
max]
Length=1106

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRG PKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  19   DIEQAITALKKGACLLKYGRRGTPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  78

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  79   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  134



>ref|XP_006595771.1| PREDICTED: uncharacterized protein LOC100802464 isoform X2 [Glycine 
max]
Length=1107

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRG PKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAITALKKGACLLKYGRRGTPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  135



>ref|XP_002873947.1| hypothetical protein ARALYDRAFT_488831 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50206.1| hypothetical protein ARALYDRAFT_488831 [Arabidopsis lyrata subsp. 
lyrata]
Length=1100

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  16   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  75

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            QRT IFQRYPRPEKEYQSFSLIY++RSLDVICKDKDEAEVW +GLKALIS
Sbjct  76   QRTPIFQRYPRPEKEYQSFSLIYDERSLDVICKDKDEAEVWFSGLKALIS  125



>emb|CDY44086.1| BnaA02g14500D [Brassica napus]
Length=1052

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 135/203 (67%), Gaps = 32/203 (16%)
 Frame = +2

Query  5    IDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQ  184
            I QAIT+LKKG++LLKYGRRGKPKFCPF+L+ DES L+WY GKEEKQ++L++V RI+PGQ
Sbjct  42   IQQAITSLKKGSYLLKYGRRGKPKFCPFQLTSDESTLVWYSGKEEKQIKLSQVLRIVPGQ  101

Query  185  RTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK-----  349
            RTA F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW+ GLKALI+     K     
Sbjct  102  RTATFKRYPRPEKEYQSFSLICPDRSLDLICKDKDEAEVWVVGLKALITRVKISKWKNTI  161

Query  350  ------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTA-SSKTHTF  454
                                    DQ     +++ T   LGK F+DIVS TA ++   T 
Sbjct  162  KPEITSPECPTPQARRVSPFVSILDQVTQPSTETSTPNRLGKVFSDIVSITAPANNNQTE  221

Query  455  ADT-NSYSVSPL-PTDVGSPNAR  517
            A+T N     P+ P +V +PN+R
Sbjct  222  ANTLNPNLYCPISPGNVENPNSR  244



>ref|XP_006470567.1| PREDICTED: uncharacterized protein LOC102612328 isoform X1 [Citrus 
sinensis]
Length=1123

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 126/204 (62%), Gaps = 43/204 (21%)
 Frame = +2

Query  11   QAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRT  190
            +AIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII GQRT
Sbjct  41   KAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRT  100

Query  191  AIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI--------------  328
             IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALI              
Sbjct  101  PIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRKWRTESRS  160

Query  329  -------------------------SNGSYQKDQEDTQRSK----SLTQGGLGKAFADIV  421
                                     SN S QKD  D  R      S  + GL K F+D++
Sbjct  161  DGIPSEANSPRTYTRRSSPLNSPFGSNDSLQKDGGDHLRLHSPYDSPPKNGLDKTFSDVL  220

Query  422  SYTASSKTHTFADTNSYSVSPLPT  493
             Y+  SK    +DT S SV  L +
Sbjct  221  LYSVPSKAFFPSDTASGSVHSLSS  244



>ref|XP_004511219.1| PREDICTED: uncharacterized protein LOC101514207 isoform X2 [Cicer 
arietinum]
Length=1016

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 133/189 (70%), Gaps = 36/189 (19%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QA+T+LKKG++LLKYGRRG+PKFCPFRLS DES L+WY GKEEKQ++L+ VS+IIPG
Sbjct  15   DIEQALTSLKKGSYLLKYGRRGRPKFCPFRLSNDESLLIWYSGKEEKQIKLSTVSKIIPG  74

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA FQRYPRPEKEYQSFSLIYNDRSLD+   DKDEAE+W  GLKAL++ G+Y+K    
Sbjct  75   QRTATFQRYPRPEKEYQSFSLIYNDRSLDL---DKDEAEIWFAGLKALVTRGNYRKWRFE  131

Query  350  -------------------------DQEDTQRS--KSLTQGGLGKAFADIVSYTASSKTH  448
                                     D  DT R   ++ +Q    KAF++I+SYTA SK+ 
Sbjct  132  SRPESLYSESPKSGTRRSTPSVAPFDPGDTDRVAFQNSSQNRWVKAFSEIISYTAPSKSS  191

Query  449  TFAD--TNS  469
            + A+  TNS
Sbjct  192  SQAESITNS  200



>ref|XP_006575629.1| PREDICTED: uncharacterized protein LOC100806439 isoform X4 [Glycine 
max]
Length=908

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRG+PK CPFRLS DES L+W+ GKEEK L+L++VSRII G
Sbjct  20   DIEQAITALKKGACLLKYGRRGRPKICPFRLSNDESVLIWFSGKEEKHLKLSQVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  135



>emb|CDP08456.1| unnamed protein product [Coffea canephora]
Length=1103

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 127/205 (62%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRL+ DES L+W  GKEEK L+L+ VSRII G
Sbjct  21   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLMWLSGKEEKHLKLSHVSRIISG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNG--------  337
            QRT IFQRYPRPEKEYQSFSLIY+DRSLD+ICKDKDEAEVW +GLKALIS          
Sbjct  81   QRTPIFQRYPRPEKEYQSFSLIYSDRSLDLICKDKDEAEVWFSGLKALISRSHQRKWRTE  140

Query  338  -------------------------------SYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                           S QKD  D  R      S  + G+ KAF+
Sbjct  141  SRSDGVSSEANSPRTYTRRSSPLHSPFGSGDSLQKDGNDQFRLHSPYDSPPKNGMDKAFS  200

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D++ YT   +    +D+ S SV  L
Sbjct  201  DVILYTMPPRGFFPSDSASGSVHSL  225



>ref|XP_010031729.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 [Eucalyptus grandis]
 gb|KCW51099.1| hypothetical protein EUGRSUZ_J00702 [Eucalyptus grandis]
Length=1102

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 125/204 (61%), Gaps = 42/204 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRL+ DES L+W+ GKEEK L+L+ V RII G
Sbjct  21   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVDRIISG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIY DRSLD+ICKDKDEAE W +GLKALI           
Sbjct  81   QRTPIFQRYPRPEKEYQSFSLIYGDRSLDLICKDKDEAEAWFSGLKALISRCRHRKGRTE  140

Query  329  ---------------------------SNGSYQKDQEDTQRSK----SLTQGGLGKAFAD  415
                                       SN   QKD  D  R +    S  + GL KAF+D
Sbjct  141  SRSDGIPSEATSPRTYTRSSPLNSPFGSNDGMQKDSGDQLRLQSPFGSPPKNGLNKAFSD  200

Query  416  IVSYTASSKTHTFADTNSYSVSPL  487
            ++ Y    K+    D+ + SV  L
Sbjct  201  VILYAVPPKSFFPPDSATESVHSL  224



>ref|XP_010536113.1| PREDICTED: uncharacterized protein LOC104811189 [Tarenaya hassleriana]
Length=1095

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            QRT IFQRYPRPEKEYQSFSLIYN+RSLD+ICKDKDEAEVW +GLKALIS
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNERSLDLICKDKDEAEVWFSGLKALIS  129



>ref|XP_007146313.1| hypothetical protein PHAVU_006G030000g [Phaseolus vulgaris]
 ref|XP_007146314.1| hypothetical protein PHAVU_006G030000g [Phaseolus vulgaris]
 gb|ESW18307.1| hypothetical protein PHAVU_006G030000g [Phaseolus vulgaris]
 gb|ESW18308.1| hypothetical protein PHAVU_006G030000g [Phaseolus vulgaris]
Length=1121

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRI  G
Sbjct  23   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSNVSRIKSG  82

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSL YNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  83   QRTPIFQRYPRPEKEYQSFSLFYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  138



>ref|XP_007213716.1| hypothetical protein PRUPE_ppa000548mg [Prunus persica]
 gb|EMJ14915.1| hypothetical protein PRUPE_ppa000548mg [Prunus persica]
Length=1102

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  14   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIITG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPR EKEYQSFSLIYNDRSLD+ICKDKDEA+VW +GLKALIS   ++K
Sbjct  74   QRTPIFQRYPRLEKEYQSFSLIYNDRSLDLICKDKDEADVWFSGLKALISRSHHRK  129



>ref|XP_008227676.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 [Prunus mume]
Length=1108

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIITG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPR EKEYQSFSLIYNDRSLD+ICKDKDEA+VW +GLKALIS   ++K
Sbjct  80   QRTPIFQRYPRLEKEYQSFSLIYNDRSLDLICKDKDEADVWFSGLKALISRSHHRK  135



>emb|CDY28580.1| BnaC02g19490D [Brassica napus]
Length=1044

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 134/203 (66%), Gaps = 32/203 (16%)
 Frame = +2

Query  5    IDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQ  184
            I QAIT+LKKG++LLKYGRRGKPKFCPF+L+ DES L+WY GKEEKQ++L++V RI+PGQ
Sbjct  35   IQQAITSLKKGSYLLKYGRRGKPKFCPFQLTSDESTLVWYSGKEEKQIKLSQVLRIVPGQ  94

Query  185  RTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK-----  349
            RTA F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW+ GLKALI+     K     
Sbjct  95   RTATFKRYPRPEKEYQSFSLICPDRSLDLICKDKDEAEVWVVGLKALITRVKISKWKNTI  154

Query  350  ------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTA-SSKTHTF  454
                                    DQ     +++ T   LGK F+DIVS TA  +   T 
Sbjct  155  KPEITSPECPTPHARRVSPFVSILDQVTQPSTETSTPNRLGKVFSDIVSITAPDNNNQTE  214

Query  455  ADT-NSYSVSPL-PTDVGSPNAR  517
            A+T N     P+ P +V +PN+R
Sbjct  215  ANTLNPNLYCPISPGNVENPNSR  237



>ref|XP_003519514.1| PREDICTED: uncharacterized protein LOC100806439 isoform X1 [Glycine 
max]
Length=1109

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRG+PK CPFRLS DES L+W+ GKEEK L+L++VSRII G
Sbjct  20   DIEQAITALKKGACLLKYGRRGRPKICPFRLSNDESVLIWFSGKEEKHLKLSQVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  135



>ref|XP_010519782.1| PREDICTED: bifunctional serine/threonine-protein kinase/NEDD4-like 
E3 ubiquitin-protein ligase [Tarenaya hassleriana]
 ref|XP_010519784.1| PREDICTED: bifunctional serine/threonine-protein kinase/NEDD4-like 
E3 ubiquitin-protein ligase [Tarenaya hassleriana]
Length=1092

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ GKEEK L+L+ VSRII G
Sbjct  14   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEKHLKLSHVSRIISG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            QRT IFQRYPRPEKEYQSFSLIYN+RSLD+ICKDKDEAEVW +GLKALIS
Sbjct  74   QRTPIFQRYPRPEKEYQSFSLIYNERSLDLICKDKDEAEVWFSGLKALIS  123



>gb|KHN38378.1| Putative E3 ubiquitin-protein ligase HERC1 [Glycine soja]
Length=1103

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRG+PK CPFRLS DES L+W+ GKEEK L+L++VSRII G
Sbjct  14   DIEQAITALKKGACLLKYGRRGRPKICPFRLSNDESVLIWFSGKEEKHLKLSQVSRIISG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  74   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  129



>ref|XP_006575628.1| PREDICTED: uncharacterized protein LOC100806439 isoform X3 [Glycine 
max]
Length=1108

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRG+PK CPFRLS DES L+W+ GKEEK L+L++VSRII G
Sbjct  19   DIEQAITALKKGACLLKYGRRGRPKICPFRLSNDESVLIWFSGKEEKHLKLSQVSRIISG  78

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  79   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  134



>ref|XP_006399751.1| hypothetical protein EUTSA_v10012520mg [Eutrema salsugineum]
 gb|ESQ41204.1| hypothetical protein EUTSA_v10012520mg [Eutrema salsugineum]
Length=1074

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W  GKEEK L+L+ VSRII G
Sbjct  20   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWISGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY++RSLDVICKDKDEAEVW TGLKALIS+  +Q+++  
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYSERSLDVICKDKDEAEVWFTGLKALISH-CHQRNRRT  138

Query  362  TQRS  373
              RS
Sbjct  139  ESRS  142



>ref|XP_007153813.1| hypothetical protein PHAVU_003G066900g [Phaseolus vulgaris]
 gb|ESW25807.1| hypothetical protein PHAVU_003G066900g [Phaseolus vulgaris]
Length=900

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 128/184 (70%), Gaps = 30/184 (16%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKG++LLKYGRRGKPKFCPFRLS DES LLWY  KEEKQL+L+ VSRIIPG
Sbjct  13   DIEQAIAFLKKGSYLLKYGRRGKPKFCPFRLSNDESILLWYSDKEEKQLKLSTVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA FQRYPRPEKEYQSFSLIY+DRSLD+ICKDK+EAE+W  GLKAL++  + +K    
Sbjct  73   QRTATFQRYPRPEKEYQSFSLIYSDRSLDLICKDKEEAEIWFVGLKALVTRANNRKWFES  132

Query  350  ---DQEDTQRSKSLTQ---------------GGLG--------KAFADIVSYTASSKTHT  451
               D   +   KS T+               GG          KAF++I+S  A+SK+ +
Sbjct  133  RTDDSHCSDSPKSSTRRSTPSNTPFSDPGDAGGAAFDVKNRWVKAFSEIISSNAASKSTS  192

Query  452  FADT  463
             A++
Sbjct  193  QAES  196



>ref|XP_006575627.1| PREDICTED: uncharacterized protein LOC100806439 isoform X2 [Glycine 
max]
Length=1109

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRG+PK CPFRLS DES L+W+ GKEEK L+L++VSRII G
Sbjct  20   DIEQAITALKKGACLLKYGRRGRPKICPFRLSNDESVLIWFSGKEEKHLKLSQVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  135



>ref|NP_197443.3| regulator of chromosome condensation-like protein with FYVE zinc 
finger domain [Arabidopsis thaliana]
 gb|AED92703.1| regulator of chromosome condensation-like protein with FYVE zinc 
finger domain [Arabidopsis thaliana]
Length=1105

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  21   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            QRT IFQRYPRPEKEYQSFSLIY++RSLD+ICKDKDEAEVW +GLKALIS
Sbjct  81   QRTPIFQRYPRPEKEYQSFSLIYDERSLDLICKDKDEAEVWFSGLKALIS  130



>emb|CDX85690.1| BnaA02g01230D [Brassica napus]
Length=1070

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 122/155 (79%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ GKEEK+L+L+ VSRII G
Sbjct  14   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEKRLKLSHVSRIISG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY++RSLDVICKDKDEAEVW +GLKALIS+      ++ 
Sbjct  74   QRTPIFQRYPRPEKEYQSFSLIYSERSLDVICKDKDEAEVWFSGLKALISHF-----RQR  128

Query  362  TQRSKSLTQGGLGKAFADIVSYTASSKTHTFADTN  466
            T+R++S + G   +A + +     SS  H+   +N
Sbjct  129  TRRTESRSDGTPSEANSPMTYTRRSSPLHSPFSSN  163



>ref|XP_002871523.1| ran GTPase binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47782.1| ran GTPase binding protein [Arabidopsis lyrata subsp. lyrata]
Length=1075

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ G EEK L+L+ VSRII G
Sbjct  20   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY++RSLDVICKDKDEAEVW TGLKALIS+  +Q+++  
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYSERSLDVICKDKDEAEVWFTGLKALISH-CHQRNRRT  138

Query  362  TQRS  373
              RS
Sbjct  139  ESRS  142



>emb|CDP12338.1| unnamed protein product [Coffea canephora]
Length=962

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            +IDQAIT LK+G++LLKYGRRGKPKFCPF+LS DE+ L+W+ GKEEKQL LN VSRIIPG
Sbjct  13   NIDQAITALKRGSYLLKYGRRGKPKFCPFQLSNDETTLIWFVGKEEKQLRLNHVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT +FQR+PRPEKEYQSFSLIY  RSLD++CKDKDEAE+W   L+ALIS G+YQ+
Sbjct  73   QRTDVFQRFPRPEKEYQSFSLIYGKRSLDLMCKDKDEAEIWFIALQALISKGNYQR  128



>ref|XP_008363119.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 [Malus domestica]
Length=1109

 Score =   199 bits (505),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAITALKKGACLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKLLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIY+DRSLD+ICKDKDEAEVW +GLKALIS   ++K
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYSDRSLDLICKDKDEAEVWFSGLKALISRSHHRK  135



>ref|XP_008449668.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103491479 
[Cucumis melo]
Length=1103

 Score =   199 bits (505),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+Q+I  LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQSIIALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW  GLK LIS   ++K
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFNGLKTLISRSHHRK  135



>ref|NP_568268.3| Regulator of chromosome condensation-like protein with FYVE zinc 
finger domain-containing protein [Arabidopsis thaliana]
 gb|AED91798.1| Regulator of chromosome condensation-like protein with FYVE zinc 
finger domain-containing protein [Arabidopsis thaliana]
Length=1075

 Score =   198 bits (504),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ G EEK L+L+ VSRII G
Sbjct  20   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY++RSLDVICKDKDEAEVW TGLKALIS+  +Q+++  
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYSERSLDVICKDKDEAEVWFTGLKALISH-CHQRNRRT  138

Query  362  TQRS  373
              RS
Sbjct  139  ESRS  142



>ref|XP_010424068.1| PREDICTED: uncharacterized protein LOC104709101 [Camelina sativa]
Length=1027

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ G EEK L+L+ VSRII G
Sbjct  21   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNEEKHLKLSHVSRIISG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY++RSLDVICKDKDEAEVW TGLKAL+S+  +Q+++  
Sbjct  81   QRTPIFQRYPRPEKEYQSFSLIYSERSLDVICKDKDEAEVWFTGLKALVSH-CHQRNRRT  139

Query  362  TQRS  373
              RS
Sbjct  140  ESRS  143



>ref|XP_010491996.1| PREDICTED: uncharacterized protein LOC104769476 [Camelina sativa]
Length=1075

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ G EEK L+L+ VSRII G
Sbjct  20   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY++RSLDVICKDKDEAEVW TGLKAL+S+  +Q+++  
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYSERSLDVICKDKDEAEVWFTGLKALVSH-CHQRNRRT  138

Query  362  TQRS  373
              RS
Sbjct  139  ESRS  142



>ref|XP_006286948.1| hypothetical protein CARUB_v10000094mg [Capsella rubella]
 gb|EOA19846.1| hypothetical protein CARUB_v10000094mg [Capsella rubella]
Length=1075

 Score =   198 bits (503),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ G EEK L+L+ VSRII G
Sbjct  20   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGNEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY++RSLDVICKDKDEAEVW TGLKAL+S+  +Q+++  
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYSERSLDVICKDKDEAEVWFTGLKALVSH-CHQRNRRT  138

Query  362  TQRS  373
              RS
Sbjct  139  ESRS  142



>ref|XP_008656863.1| PREDICTED: uncharacterized protein LOC103636281 [Zea mays]
Length=1092

 Score =   198 bits (504),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 126/205 (61%), Gaps = 43/205 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L+ +S+IIPG
Sbjct  19   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHISKIIPG  78

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS----------  331
            QRT+IFQRYPRPEKE QSFSLI +DRSLDVICKDKDEAEVW  GLK LIS          
Sbjct  79   QRTSIFQRYPRPEKECQSFSLISHDRSLDVICKDKDEAEVWFAGLKTLISRCHQRKWRTE  138

Query  332  -----------------------------NGSYQKDQEDTQRSK----SLTQGGLGKAFA  412
                                         N S  KD  D  R +    S  + GL KAF+
Sbjct  139  SRSDLLSSGATSPRTYTRRSSPLSSPFSSNDSIHKDGSDNYRLRTPYGSPPKNGLEKAFS  198

Query  413  DIVSYTASSKTHTFADTNSYSVSPL  487
            D++ Y    +    +D+N+ SV  +
Sbjct  199  DVMLYAVPPRGFFPSDSNAGSVHSM  223



>ref|XP_008375471.1| PREDICTED: uncharacterized protein LOC103438700 [Malus domestica]
Length=1053

 Score =   198 bits (503),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  14   AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTA  193
            AIT+LKKGA LLKYGRRGKPKFCPFRLS DES L+WY GKEEK L+L++VSRI+PGQRT 
Sbjct  20   AITSLKKGAQLLKYGRRGKPKFCPFRLSNDESVLIWYSGKEEKYLKLSQVSRIVPGQRTQ  79

Query  194  IFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQEDTQ  367
             FQRYPRPEKEYQSFSLI +DRSLD+ICKDKDEAEVW TGLKALIS G +QK + +++
Sbjct  80   TFQRYPRPEKEYQSFSLICBDRSLDLICKDKDEAEVWFTGLKALISRGLHQKGRPESR  137



>emb|CDX91165.1| BnaC02g04320D [Brassica napus]
Length=1073

 Score =   198 bits (503),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY++RSLDVICKDKDEAEVW +GLKALIS   +Q+++  
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYSERSLDVICKDKDEAEVWFSGLKALISR-CHQRNRRT  138

Query  362  TQRS  373
              RS
Sbjct  139  ESRS  142



>ref|XP_002513064.1| Ran GTPase binding protein, putative [Ricinus communis]
 gb|EEF49567.1| Ran GTPase binding protein, putative [Ricinus communis]
Length=1096

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 122/169 (72%), Gaps = 21/169 (12%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+ AIT LKKGA LLKYGRRGKPKFCPFRL+ DESAL+W  GKEEK L+L+ VSRII G
Sbjct  15   DIELAITALKKGAQLLKYGRRGKPKFCPFRLANDESALVWLSGKEEKHLKLSHVSRIISG  74

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY+DRSLD+ICKDKDEAEVW+TGLKALIS    +K    
Sbjct  75   QRTPIFQRYPRPEKEYQSFSLIYDDRSLDLICKDKDEAEVWITGLKALISRNHMRK----  130

Query  362  TQRSKSLTQGGLGKAFADIVSYTASS-KTHTFADTNSYSVSPLPTDVGS  505
                      G G++ +D +S  A+S + HT         SPL +  GS
Sbjct  131  ----------GRGESRSDGISSEATSPRAHT------QRSSPLSSAFGS  163



>emb|CDM86514.1| unnamed protein product [Triticum aestivum]
Length=1089

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 107/128 (84%), Gaps = 1/128 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L+ VSRI+PG
Sbjct  22   DLEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHVSRIMPG  81

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LIS  S+Q+    
Sbjct  82   QRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISR-SHQRKWRT  140

Query  362  TQRSKSLT  385
              RS +++
Sbjct  141  GSRSDTIS  148



>gb|EPS63615.1| hypothetical protein M569_11169, partial [Genlisea aurea]
Length=1084

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA LLKYGRRGKPKFCPFRL+ DES L+W+ GKEEK L+L+ VSRII G
Sbjct  14   DIEQAIIALKKGAHLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVSRIISG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IF RYPRPEKEYQSFSLIYNDRSLD+ICKDK+EAEVW +GLKALI+  S+Q+    
Sbjct  74   QRTPIFHRYPRPEKEYQSFSLIYNDRSLDLICKDKEEAEVWFSGLKALITR-SHQRKWRT  132

Query  362  TQRSKSLTQG  391
              RS  ++ G
Sbjct  133  ESRSDGISSG  142



>ref|XP_011004007.1| PREDICTED: uncharacterized protein LOC105110613 [Populus euphratica]
Length=1096

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 126/206 (61%), Gaps = 42/206 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GK+EK L+L  VSRII G
Sbjct  19   DTEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKQEKFLQLIHVSRIISG  78

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISN---------  334
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS          
Sbjct  79   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHNRKWRTE  138

Query  335  ---------------------------GSYQKDQEDTQRSK------SLTQGGLGKAFAD  415
                                       GS    Q+D    +      S  + GL KAF+D
Sbjct  139  SRSDGIPSEANSPRTYTRRSSPLNSPFGSNDGSQKDADHHRLHSPYESPPKNGLDKAFSD  198

Query  416  IVSYTASSKTHTFADTNSYSVSPLPT  493
            +V Y    K    +D+ S SV  L +
Sbjct  199  VVLYAVPPKGIFPSDSASGSVHSLSS  224



>gb|KCW51717.1| hypothetical protein EUGRSUZ_J01184 [Eucalyptus grandis]
Length=1075

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++ AIT LKKGA LLKYGRRGKPKFCPFRL+ DES L+W  GKEEK L++N +S+IIPG
Sbjct  21   DVELAITALKKGACLLKYGRRGKPKFCPFRLANDESVLIWLSGKEEKHLKINHISKIIPG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYP+PEKEYQSFSLIY+DRSLD+ICKDKDEAEVW TGLKALI+  ++QK
Sbjct  81   QRTPIFQRYPQPEKEYQSFSLIYDDRSLDLICKDKDEAEVWFTGLKALITRRNHQK  136



>ref|XP_002511559.1| Ran GTPase binding protein, putative [Ricinus communis]
 gb|EEF52161.1| Ran GTPase binding protein, putative [Ricinus communis]
Length=1028

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 134/204 (66%), Gaps = 38/204 (19%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI QAIT +KKGA+LLKYGR GKPKFCPFRLS DE  L+WY GK EKQL+L+ VS+I+PG
Sbjct  14   DILQAITAIKKGAYLLKYGRWGKPKFCPFRLSNDERFLIWYAGKLEKQLKLSHVSKIMPG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            Q TAIFQRYP+PEKEYQSFSLIY++RSLDVICKDK EAEVW+  L+ALIS  S  K   D
Sbjct  74   QHTAIFQRYPQPEKEYQSFSLIYSNRSLDVICKDKVEAEVWIVALRALISQNSCCKRIGD  133

Query  362  TQ----------RSKSLT----------------------------QGGLGKAFADIVSY  427
             Q          R  SL+                            Q  LGKAF++++S+
Sbjct  134  PQSDANSPRSHARKSSLSNVSCTSSDIIYKDPEDTHPILVPYETSPQNRLGKAFSEVLSF  193

Query  428  TASSKTHTFADTNSYSVSPLPTDV  499
            TA++K +T A++ + S+S L + +
Sbjct  194  TAAAKAYTQAESVARSLSNLSSGI  217



>ref|XP_009121854.1| PREDICTED: uncharacterized protein LOC103846644 [Brassica rapa]
Length=1070

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY++RSLDVICKDKDEAEVW +GLKALIS   +Q+++  
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYSERSLDVICKDKDEAEVWFSGLKALISR-YHQRNRRT  138

Query  362  TQRS  373
              RS
Sbjct  139  ESRS  142



>gb|KFK25508.1| hypothetical protein AALP_AA8G123700 [Arabis alpina]
Length=1069

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 127/202 (63%), Gaps = 43/202 (21%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ GKEEK L+L+ VSRII G
Sbjct  14   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEKHLKLSHVSRIISG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIY++RSLD+ICKDKDEAEVW +GLKAL+           
Sbjct  74   QRTPIFQRYPRPEKEYQSFSLIYSERSLDLICKDKDEAEVWFSGLKALVSHCHQRNRRTE  133

Query  329  ----------------------------SNGSYQKDQEDTQRS----KSLTQGGLGKAFA  412
                                        SN S+QKD  +  R     +S  + GL KAF+
Sbjct  134  SRSDGTPSEANSPRTYTRRSSPLHSPFSSNDSFQKDGSNHHRIHSPFESPPKNGLDKAFS  193

Query  413  DIVSYTASSKTHTFADTNSYSV  478
            D+  Y    K    +D+ + SV
Sbjct  194  DMSLYAVPPKGFYPSDSATMSV  215



>ref|XP_011015114.1| PREDICTED: uncharacterized protein LOC105118779 [Populus euphratica]
Length=1096

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 126/206 (61%), Gaps = 42/206 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GK+EK L+L  VSRII G
Sbjct  19   DTEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKQEKFLQLIHVSRIISG  78

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISN---------  334
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS          
Sbjct  79   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHNRKWRTE  138

Query  335  ---------------------------GSYQKDQEDTQRSK------SLTQGGLGKAFAD  415
                                       GS    Q+D    +      S  + GL KAF+D
Sbjct  139  SRSDGIPSEANSPRTYTRRSSPLNSPFGSNDGSQKDADHHRLHSPYESPPKNGLDKAFSD  198

Query  416  IVSYTASSKTHTFADTNSYSVSPLPT  493
            +V Y    K    +D+ S SV  L +
Sbjct  199  VVLYAVPPKGIFPSDSASGSVHSLSS  224



>ref|XP_010032303.1| PREDICTED: uncharacterized protein LOC104421870 isoform X2 [Eucalyptus 
grandis]
Length=1104

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +2

Query  5    IDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQ  184
            I QAIT LKKGA LLKYGRRGKPKFCPFRL+ DES L+W  GKEEK L++N +S+IIPGQ
Sbjct  30   IQQAITALKKGACLLKYGRRGKPKFCPFRLANDESVLIWLSGKEEKHLKINHISKIIPGQ  89

Query  185  RTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            RT IFQRYP+PEKEYQSFSLIY+DRSLD+ICKDKDEAEVW TGLKALI+  ++QK
Sbjct  90   RTPIFQRYPQPEKEYQSFSLIYDDRSLDLICKDKDEAEVWFTGLKALITRRNHQK  144



>ref|XP_010032302.1| PREDICTED: uncharacterized protein LOC104421870 isoform X1 [Eucalyptus 
grandis]
Length=1106

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +2

Query  5    IDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQ  184
            I QAIT LKKGA LLKYGRRGKPKFCPFRL+ DES L+W  GKEEK L++N +S+IIPGQ
Sbjct  30   IQQAITALKKGACLLKYGRRGKPKFCPFRLANDESVLIWLSGKEEKHLKINHISKIIPGQ  89

Query  185  RTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            RT IFQRYP+PEKEYQSFSLIY+DRSLD+ICKDKDEAEVW TGLKALI+  ++QK
Sbjct  90   RTPIFQRYPQPEKEYQSFSLIYDDRSLDLICKDKDEAEVWFTGLKALITRRNHQK  144



>ref|XP_010032304.1| PREDICTED: uncharacterized protein LOC104421870 isoform X3 [Eucalyptus 
grandis]
Length=1098

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++ AIT LKKGA LLKYGRRGKPKFCPFRL+ DES L+W  GKEEK L++N +S+IIPG
Sbjct  21   DVELAITALKKGACLLKYGRRGKPKFCPFRLANDESVLIWLSGKEEKHLKINHISKIIPG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYP+PEKEYQSFSLIY+DRSLD+ICKDKDEAEVW TGLKALI+  ++QK
Sbjct  81   QRTPIFQRYPQPEKEYQSFSLIYDDRSLDLICKDKDEAEVWFTGLKALITRRNHQK  136



>ref|XP_004140201.1| PREDICTED: uncharacterized protein LOC101207486 [Cucumis sativus]
 ref|XP_004156044.1| PREDICTED: uncharacterized LOC101207486 [Cucumis sativus]
 gb|KGN48105.1| hypothetical protein Csa_6G432780 [Cucumis sativus]
Length=1104

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+Q+I  LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQSIIALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKLLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW  GLK LIS   ++K
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFNGLKTLISRSHHRK  135



>ref|XP_010555025.1| PREDICTED: uncharacterized protein LOC104824622 [Tarenaya hassleriana]
Length=1094

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 127/206 (62%), Gaps = 42/206 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPF+LS DE+ L+W+ GKEEK L+L +VSRII G
Sbjct  20   DIEQAITALKKGAYLLKYGRRGKPKFCPFQLSNDETVLIWFSGKEEKHLKLFQVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI-----------  328
            QRT IFQRYPRPEKEYQSFSLIYN+RSLD+ICKDKDEAEVW +GLKALI           
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNERSLDLICKDKDEAEVWFSGLKALISRFHQRRWRTE  139

Query  329  ----------------------------SNGSYQKDQEDTQRSK---SLTQGGLGKAFAD  415
                                        SN S+QK   +        S  + GL K F+D
Sbjct  140  SRSDGTPSEANSPRTYTRRSSPLHSPFSSNESFQKGGSNHHLHSPYGSPPKNGLDKTFSD  199

Query  416  IVSYTASSKTHTFADTNSYSVSPLPT  493
            +  Y    K    +D+ + SV  LP+
Sbjct  200  VTLYAVPPKGFFPSDSAAVSVHSLPS  225



>emb|CDX97187.1| BnaC09g44380D [Brassica napus]
Length=1058

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY++RSLDVICKDKDEAEVW +GLKALIS   +Q+++  
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYSERSLDVICKDKDEAEVWFSGLKALISR-YHQRNRRT  138

Query  362  TQRS  373
              RS
Sbjct  139  ESRS  142



>ref|XP_009131736.1| PREDICTED: uncharacterized protein LOC103856379 [Brassica rapa]
Length=1103

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYG RGKPKFCPFRLS DES L+W+ G EEK L+L+ VSRII G
Sbjct  21   DVEQAITALKKGAYLLKYGTRGKPKFCPFRLSNDESVLIWFSGNEEKHLKLSHVSRIISG  80

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            QRT IFQRYPRPEKEYQSFSLIYN+RSLDVICKDKDEAEVW +GLKALIS
Sbjct  81   QRTPIFQRYPRPEKEYQSFSLIYNERSLDVICKDKDEAEVWFSGLKALIS  130



>ref|XP_003617281.1| Lateral signaling target protein-like protein [Medicago truncatula]
Length=1124

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 103/123 (84%), Gaps = 7/123 (6%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLS-------IDESALLWYYGKEEKQLELNR  160
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRLS        DES L+W+ GKEEK L+L+ 
Sbjct  35   DIEQAITALKKGACLLKYGRRGKPKFCPFRLSNVRVALLFDESVLIWFSGKEEKHLKLSH  94

Query  161  VSRIIPGQRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGS  340
            VSRII GQRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   
Sbjct  95   VSRIISGQRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSH  154

Query  341  YQK  349
            ++K
Sbjct  155  HRK  157



>ref|XP_009125861.1| PREDICTED: uncharacterized protein LOC103850825 [Brassica rapa]
Length=1076

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 111/130 (85%), Gaps = 5/130 (4%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIY++RSLDVICKDKDEAEVW +GLKALIS+      ++ 
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYSERSLDVICKDKDEAEVWFSGLKALISHF-----RQR  134

Query  362  TQRSKSLTQG  391
            T+R++S + G
Sbjct  135  TRRTESRSDG  144



>gb|EYU35939.1| hypothetical protein MIMGU_mgv1a019835mg, partial [Erythranthe 
guttata]
Length=1074

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +2

Query  14   AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTA  193
            AIT LKKGA LLKYGRRGKPKFCPFRL+ DES L+W+ GKEEK L+L+ VSRI+ GQRT 
Sbjct  1    AITALKKGAHLLKYGRRGKPKFCPFRLANDESVLIWFSGKEEKHLKLSHVSRIVSGQRTP  60

Query  194  IFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQEDTQRS  373
            IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDK+EAEVW +GLKALIS G  +K + +T RS
Sbjct  61   IFQRYPRPEKEYQSFSLIYNDRSLDLICKDKEEAEVWFSGLKALISRGHQRKWRTET-RS  119

Query  374  KSLTQG  391
              ++ G
Sbjct  120  DGISSG  125



>emb|CDX69686.1| BnaA10g20350D [Brassica napus]
Length=1070

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAI  LKKGA+LLKYGRRGKPKFCPFRLS DE+ L+W+ GKEEK L+L+ VSRII G
Sbjct  20   DIEQAIIALKKGAYLLKYGRRGKPKFCPFRLSNDETVLIWFSGKEEKHLKLSHVSRIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRP+KEYQSFSLIY++RSLDVICKDKDEAEVW +GLKALIS   +Q+++  
Sbjct  80   QRTPIFQRYPRPDKEYQSFSLIYSERSLDVICKDKDEAEVWFSGLKALISR-YHQRNRRT  138

Query  362  TQRS  373
              RS
Sbjct  139  ESRS  142



>ref|XP_007037300.1| Ran GTPase binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY21801.1| Ran GTPase binding protein, putative isoform 3 [Theobroma cacao]
Length=905

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 131/203 (65%), Gaps = 41/203 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QAITTLKKG +LLKYGRRGKPKFCPF LS DE +L+WY  KE+KQLEL+ VSRI+PG
Sbjct  13   DYEQAITTLKKGMYLLKYGRRGKPKFCPFSLSNDEKSLIWYSDKEKKQLELSHVSRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYP+P+KE+QSFSLIY++RSLD+ICKD+DEAE+W T LK LI  G  ++ + D
Sbjct  73   QRTAIFQRYPQPDKEHQSFSLIYSNRSLDLICKDRDEAEIWFTALKVLIWGGDNRRPKSD  132

Query  362  --------------TQRS---------------------------KSLTQGGLGKAFADI  418
                          TQR+                           +S  Q  LGKAF+++
Sbjct  133  AISDNTSSESPCTYTQRNCLSNVSSTGCDIISKDPKDIQTASVPYESSQQCRLGKAFSEV  192

Query  419  VSYTASSKTHTFADTNSYSVSPL  487
            ++YT+ +K  T  D+ +   S L
Sbjct  193  LTYTSITKALTHTDSVAKHFSSL  215



>ref|XP_007037299.1| Ran GTPase binding protein, putative isoform 2 [Theobroma cacao]
 ref|XP_007037302.1| Ran GTPase binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY21800.1| Ran GTPase binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY21803.1| Ran GTPase binding protein, putative isoform 2 [Theobroma cacao]
Length=904

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 131/203 (65%), Gaps = 41/203 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QAITTLKKG +LLKYGRRGKPKFCPF LS DE +L+WY  KE+KQLEL+ VSRI+PG
Sbjct  13   DYEQAITTLKKGMYLLKYGRRGKPKFCPFSLSNDEKSLIWYSDKEKKQLELSHVSRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYP+P+KE+QSFSLIY++RSLD+ICKD+DEAE+W T LK LI  G  ++ + D
Sbjct  73   QRTAIFQRYPQPDKEHQSFSLIYSNRSLDLICKDRDEAEIWFTALKVLIWGGDNRRPKSD  132

Query  362  --------------TQRS---------------------------KSLTQGGLGKAFADI  418
                          TQR+                           +S  Q  LGKAF+++
Sbjct  133  AISDNTSSESPCTYTQRNCLSNVSSTGCDIISKDPKDIQTASVPYESSQQCRLGKAFSEV  192

Query  419  VSYTASSKTHTFADTNSYSVSPL  487
            ++YT+ +K  T  D+ +   S L
Sbjct  193  LTYTSITKALTHTDSVAKHFSSL  215



>ref|XP_007037301.1| Ran GTPase binding protein, putative isoform 4 [Theobroma cacao]
 gb|EOY21802.1| Ran GTPase binding protein, putative isoform 4 [Theobroma cacao]
Length=935

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 131/203 (65%), Gaps = 41/203 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QAITTLKKG +LLKYGRRGKPKFCPF LS DE +L+WY  KE+KQLEL+ VSRI+PG
Sbjct  13   DYEQAITTLKKGMYLLKYGRRGKPKFCPFSLSNDEKSLIWYSDKEKKQLELSHVSRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYP+P+KE+QSFSLIY++RSLD+ICKD+DEAE+W T LK LI  G  ++ + D
Sbjct  73   QRTAIFQRYPQPDKEHQSFSLIYSNRSLDLICKDRDEAEIWFTALKVLIWGGDNRRPKSD  132

Query  362  --------------TQRS---------------------------KSLTQGGLGKAFADI  418
                          TQR+                           +S  Q  LGKAF+++
Sbjct  133  AISDNTSSESPCTYTQRNCLSNVSSTGCDIISKDPKDIQTASVPYESSQQCRLGKAFSEV  192

Query  419  VSYTASSKTHTFADTNSYSVSPL  487
            ++YT+ +K  T  D+ +   S L
Sbjct  193  LTYTSITKALTHTDSVAKHFSSL  215



>ref|XP_008450356.1| PREDICTED: uncharacterized protein LOC103491987 [Cucumis melo]
Length=1102

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  17   DVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKHLKLSHVSRIISG  76

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            QRT IFQRYPRPEKE QSFSLIYN+RSLD+ICKDKDE EVW +GLKALIS
Sbjct  77   QRTPIFQRYPRPEKECQSFSLIYNERSLDLICKDKDETEVWFSGLKALIS  126



>ref|XP_007037298.1| Ran GTPase binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY21799.1| Ran GTPase binding protein, putative isoform 1 [Theobroma cacao]
Length=940

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 131/203 (65%), Gaps = 41/203 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QAITTLKKG +LLKYGRRGKPKFCPF LS DE +L+WY  KE+KQLEL+ VSRI+PG
Sbjct  13   DYEQAITTLKKGMYLLKYGRRGKPKFCPFSLSNDEKSLIWYSDKEKKQLELSHVSRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQRYP+P+KE+QSFSLIY++RSLD+ICKD+DEAE+W T LK LI  G  ++ + D
Sbjct  73   QRTAIFQRYPQPDKEHQSFSLIYSNRSLDLICKDRDEAEIWFTALKVLIWGGDNRRPKSD  132

Query  362  --------------TQRS---------------------------KSLTQGGLGKAFADI  418
                          TQR+                           +S  Q  LGKAF+++
Sbjct  133  AISDNTSSESPCTYTQRNCLSNVSSTGCDIISKDPKDIQTASVPYESSQQCRLGKAFSEV  192

Query  419  VSYTASSKTHTFADTNSYSVSPL  487
            ++YT+ +K  T  D+ +   S L
Sbjct  193  LTYTSITKALTHTDSVAKHFSSL  215



>ref|XP_004139058.1| PREDICTED: uncharacterized protein LOC101219074 [Cucumis sativus]
Length=1103

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  17   DVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKHLKLSHVSRIISG  76

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            QRT IFQRYPRPEKE QSFSLIYN+RSLD+ICKDKDE EVW +GLKALIS
Sbjct  77   QRTPIFQRYPRPEKECQSFSLIYNERSLDLICKDKDETEVWFSGLKALIS  126



>ref|XP_004154652.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226798 
[Cucumis sativus]
Length=1103

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII G
Sbjct  17   DVEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKHLKLSHVSRIISG  76

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            QRT IFQRYPRPEKE QSFSLIYN+RSLD+ICKDKDE EVW +GLKALIS
Sbjct  77   QRTPIFQRYPRPEKECQSFSLIYNERSLDLICKDKDETEVWFSGLKALIS  126



>ref|XP_010670475.1| PREDICTED: uncharacterized protein LOC104887522 [Beta vulgaris 
subsp. vulgaris]
Length=1090

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 120/186 (65%), Gaps = 38/186 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+ AIT LKKG  LLKYGRRGKPKFCPFRLS DES L+W+ G EEK L+L+ VSRIIPG
Sbjct  14   DIELAITALKKGTNLLKYGRRGKPKFCPFRLSNDESLLVWFSGNEEKHLKLSHVSRIIPG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS----------  331
            QRT IFQR+PRPEKEYQSFSLIY+DRSLD+ICKDKDEAEVW TGLKALIS          
Sbjct  74   QRTPIFQRHPRPEKEYQSFSLIYSDRSLDLICKDKDEAEVWFTGLKALISRYHRRARTDP  133

Query  332  ----NGSYQKDQEDTQRSKSLT------------------------QGGLGKAFADIVSY  427
                +      +  TQRS  L+                        + GL KA +D++ Y
Sbjct  134  RSGLSSEANSPKAQTQRSSPLSSPFGSGDGSQKDGLDPLYPYESPQKNGLEKALSDVILY  193

Query  428  TASSKT  445
            +  SK+
Sbjct  194  SVPSKS  199



>ref|XP_006827182.1| hypothetical protein AMTR_s00010p00256680 [Amborella trichopoda]
 gb|ERM94419.1| hypothetical protein AMTR_s00010p00256680 [Amborella trichopoda]
Length=1080

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 125/213 (59%), Gaps = 72/213 (34%)
 Frame = +2

Query  11   QAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRT  190
            +AIT LKKGA+LLKYGRRGKPKFCPFRL+ DES LLWY GKEEKQL+L++VSRIIPGQRT
Sbjct  2    EAITALKKGAYLLKYGRRGKPKFCPFRLANDESILLWYSGKEEKQLKLSQVSRIIPGQRT  61

Query  191  -------------------------------------AIFQRYPRPEKEYQSFSLIYNDR  259
                                                 AIFQRYPRPEKEYQSFSLIYNDR
Sbjct  62   SVSFAKSFALKLSLVCYQAYQYLEDSVSFEGCQRKNLAIFQRYPRPEKEYQSFSLIYNDR  121

Query  260  SLDVICKDKDEAEVWLTGLKALISNGSYQK------------------------------  349
            SLD+ICKDKDEAEVW  GLKALIS G+++K                              
Sbjct  122  SLDLICKDKDEAEVWFVGLKALISRGTHRKWRIESRSDRASSDTNSPSTYTRRNSPLGSP  181

Query  350  -DQEDTQRSK----SLTQGGLGKAFADIVSYTA  433
             D  D Q  +    S  + G+GKAF+D++ +TA
Sbjct  182  YDVGDNQSGQSPYDSPPRNGIGKAFSDVILFTA  214



>emb|CDX70876.1| BnaC03g09600D [Brassica napus]
Length=1115

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +2

Query  14   AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTA  193
            AIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ G EEK L+L+ VSRII GQRT 
Sbjct  49   AITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGNEEKHLKLSHVSRIISGQRTP  108

Query  194  IFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            IFQRYPRPEKEYQSFSLIYN+RSLDVICKDKDEAEVW +GLKALIS
Sbjct  109  IFQRYPRPEKEYQSFSLIYNERSLDVICKDKDEAEVWFSGLKALIS  154



>ref|XP_011024954.1| PREDICTED: uncharacterized protein LOC105125966 isoform X2 [Populus 
euphratica]
Length=1103

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 127/206 (62%), Gaps = 42/206 (20%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D +QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKE+K L+L+ VS+II G
Sbjct  20   DNEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEKKLLKLSDVSKIISG  79

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRT IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAE W  GLKALIS    QK + +
Sbjct  80   QRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEAWFHGLKALISRSCPQKWRTE  139

Query  362  ----------------TQRSKSLT--------------------------QGGLGKAFAD  415
                            T+RS  L                           + GL K F+D
Sbjct  140  SRSDGILSEVNSPRTYTRRSSPLNSPFSSNDSLQKDADHLRIHSPYESPPKNGLDKTFSD  199

Query  416  IVSYTASSKTHTFADTNSYSVSPLPT  493
            +V Y    K+   +D+ S SV  L +
Sbjct  200  VVLYAVPPKSFFPSDSASGSVHSLSS  225



>emb|CDX88891.1| BnaA03g07580D [Brassica napus]
Length=1135

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +2

Query  14   AITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTA  193
            AIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ G EEK L+L+ VSRII GQRT 
Sbjct  57   AITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGNEEKHLKLSHVSRIISGQRTP  116

Query  194  IFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            IFQRYPRPEKEYQSFSLIYN+RSLDVICKDKDEAEVW +GLKALIS
Sbjct  117  IFQRYPRPEKEYQSFSLIYNERSLDVICKDKDEAEVWFSGLKALIS  162



>ref|XP_002298476.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE83281.2| zinc finger family protein [Populus trichocarpa]
Length=1115

 Score =   193 bits (491),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  23   TLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTAIFQ  202
             LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L+ VSRII GQRT IFQ
Sbjct  38   ALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHVSRIISGQRTPIFQ  97

Query  203  RYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQEDTQRSKSL  382
            RYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAEVW +GLKALIS   ++K + +++    L
Sbjct  98   RYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALISRSHHRKSRTESRSDGIL  157

Query  383  TQ  388
            ++
Sbjct  158  SE  159



>ref|XP_006390980.1| hypothetical protein EUTSA_v10018063mg [Eutrema salsugineum]
 gb|ESQ28266.1| hypothetical protein EUTSA_v10018063mg [Eutrema salsugineum]
Length=1023

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 118/173 (68%), Gaps = 29/173 (17%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT+LKKG++LLKYGRRGKPKFCPF+LS DES L+WY GKEEKQ+++++V RI+PG
Sbjct  13   DVEQAITSLKKGSYLLKYGRRGKPKFCPFQLSSDESTLVWYSGKEEKQIKVSQVMRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTA F+RYPRPEKEYQSFSLI  DRSLD+ICKDKDEAEVW+ GLKALI+     K    
Sbjct  73   QRTATFKRYPRPEKEYQSFSLICPDRSLDLICKDKDEAEVWVVGLKALITRVKVSKWKNT  132

Query  350  -------------------------DQEDTQRSKSLTQGGLGKAFADIVSYTA  433
                                     DQ      ++     +GK F+DIVS TA
Sbjct  133  IKPEITSVECPTPHARRVSPFVTVLDQVIQPSPETSAPNRMGKVFSDIVSITA  185



>ref|XP_010547351.1| PREDICTED: uncharacterized protein LOC104819132 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010547352.1| PREDICTED: uncharacterized protein LOC104819132 isoform X1 [Tarenaya 
hassleriana]
Length=1071

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DID  +T+LKKGA LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRIIPG
Sbjct  23   DIDLTLTSLKKGAHLLKYGRRGKPKFCPFRLSNDESTLIWFSGKEEKHLKLSHVSRIIPG  82

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNG  337
            QRT IFQR+PRPEKEYQSFSLIY++ SLD+ICKDKDEAEVW TGLK++IS G
Sbjct  83   QRTEIFQRHPRPEKEYQSFSLIYDEDSLDLICKDKDEAEVWFTGLKSIISRG  134



>gb|EYU35847.1| hypothetical protein MIMGU_mgv1a018189mg, partial [Erythranthe 
guttata]
Length=905

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D  QAI  LKKG++LLKYGR GKPKFCPF+LS DE+ L+WY GKE+KQL+L++VSRIIPG
Sbjct  12   DTVQAINALKKGSYLLKYGRWGKPKFCPFQLSNDETTLIWYVGKEQKQLQLSKVSRIIPG  71

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRTAIFQRYP+PEKEYQSFSLIY  RSLDVICKDK EAE+W   L+ALIS G+ QK
Sbjct  72   QRTAIFQRYPQPEKEYQSFSLIYGKRSLDVICKDKSEAEIWFVALRALISQGNVQK  127



>ref|NP_001190338.1| regulator of chromosome condensation-like protein with FYVE zinc 
finger domain [Arabidopsis thaliana]
 gb|AED92704.1| regulator of chromosome condensation-like protein with FYVE zinc 
finger domain [Arabidopsis thaliana]
Length=1139

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +2

Query  11   QAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRT  190
             AIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII GQRT
Sbjct  58   HAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRT  117

Query  191  AIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
             IFQRYPRPEKEYQSFSLIY++RSLD+ICKDKDEAEVW +GLKALIS
Sbjct  118  PIFQRYPRPEKEYQSFSLIYDERSLDLICKDKDEAEVWFSGLKALIS  164



>ref|XP_011024953.1| PREDICTED: uncharacterized protein LOC105125966 isoform X1 [Populus 
euphratica]
Length=1104

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 125/203 (62%), Gaps = 42/203 (21%)
 Frame = +2

Query  11   QAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRT  190
            QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKE+K L+L+ VS+II GQRT
Sbjct  24   QAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEKKLLKLSDVSKIISGQRT  83

Query  191  AIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED---  361
             IFQRYPRPEKEYQSFSLIYNDRSLD+ICKDKDEAE W  GLKALIS    QK + +   
Sbjct  84   PIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEAWFHGLKALISRSCPQKWRTESRS  143

Query  362  -------------TQRSKSLT--------------------------QGGLGKAFADIVS  424
                         T+RS  L                           + GL K F+D+V 
Sbjct  144  DGILSEVNSPRTYTRRSSPLNSPFSSNDSLQKDADHLRIHSPYESPPKNGLDKTFSDVVL  203

Query  425  YTASSKTHTFADTNSYSVSPLPT  493
            Y    K+   +D+ S SV  L +
Sbjct  204  YAVPPKSFFPSDSASGSVHSLSS  226



>ref|XP_009620351.1| PREDICTED: uncharacterized protein LOC104112201 [Nicotiana tomentosiformis]
 ref|XP_009620352.1| PREDICTED: uncharacterized protein LOC104112201 [Nicotiana tomentosiformis]
Length=949

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            +++QAIT LK+G +LLKYGRRGKPKFCPFRLS DE+ L+WY  KEEKQL+L++VSRIIPG
Sbjct  13   NVEQAITALKRGTYLLKYGRRGKPKFCPFRLSTDETRLIWYVDKEEKQLQLSQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTAIFQR+PRPEKEYQSFSL+Y   SLD+ICKDK+EAEVW   L+ALIS  + QK   D
Sbjct  73   QRTAIFQRFPRPEKEYQSFSLLYGKSSLDLICKDKEEAEVWFVALRALISWVNCQKWTSD  132

Query  362  TQRSKSLTQG  391
             +   + ++G
Sbjct  133  IRHDATSSEG  142



>ref|XP_010227829.1| PREDICTED: uncharacterized protein LOC100836916 [Brachypodium 
distachyon]
Length=261

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAI  LKKG  LLKYGRRGKPKFC FRLS DE+ L+WY G+ EKQL L +VS+IIPG
Sbjct  85   DVEQAIAALKKGTHLLKYGRRGKPKFCLFRLSNDETMLIWYSGRMEKQLNLIQVSKIIPG  144

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQE  358
            QRTAIF RYPRP+KEYQSFSLIY  RSLD+ICKDKDEAE W  GLKALIS  S +  +E
Sbjct  145  QRTAIFLRYPRPDKEYQSFSLIYGQRSLDLICKDKDEAEAWFVGLKALISGRSCKWPRE  203



>ref|XP_002980107.1| hypothetical protein SELMODRAFT_112120 [Selaginella moellendorffii]
 gb|EFJ18977.1| hypothetical protein SELMODRAFT_112120 [Selaginella moellendorffii]
Length=1090

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPFRLS DE+ L+WY GKEEK L L+ ++RI+PG
Sbjct  13   DIEQAITALKKGAQLLKYGRRGKPKFCPFRLSNDETHLIWYSGKEEKSLRLSSITRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIY-NDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQE  358
            QRTA FQRYPR EKEYQSFSLIY NDRSLD+ICKDKDEAEVW  GLKAL+S G   + + 
Sbjct  73   QRTANFQRYPRLEKEYQSFSLIYGNDRSLDLICKDKDEAEVWFVGLKALVSGGQLSRLRF  132

Query  359  DTQ  367
            D++
Sbjct  133  DSR  135



>ref|XP_007146310.1| hypothetical protein PHAVU_006G029700g [Phaseolus vulgaris]
 gb|ESW18304.1| hypothetical protein PHAVU_006G029700g [Phaseolus vulgaris]
Length=125

 Score =   175 bits (443),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L +VSRI   
Sbjct  22   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKPLKLTKVSRIKSE  81

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVW  304
            QRT IFQRYPRPEKEYQSFSL YNDRSLD+ICKDKDEA+VW
Sbjct  82   QRTPIFQRYPRPEKEYQSFSLFYNDRSLDLICKDKDEADVW  122



>gb|EMT20664.1| Putative E3 ubiquitin-protein ligase HERC1 [Aegilops tauschii]
Length=1115

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 117/190 (62%), Gaps = 45/190 (24%)
 Frame = +2

Query  29   KKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTAIFQRY  208
            KKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEKQL L+ VSRIIPGQRTAIFQRY
Sbjct  62   KKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHVSRIIPGQRTAIFQRY  121

Query  209  PRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQEDTQRSKSLTQ  388
            PRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LIS  S+Q+      RS  L+ 
Sbjct  122  PRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISR-SHQRKWRTESRSDMLSS  180

Query  389  G--------------------------------------------GLGKAFADIVSYTAS  436
            G                                            GL KAF+DIVSY A 
Sbjct  181  GTTSPRTYTRRSSPLSSPFSSNDSVHKDGSENYRLRSPYGSPPKVGLDKAFSDIVSYAAP  240

Query  437  SKTHTFADTN  466
             +    +D+N
Sbjct  241  PRPFFPSDSN  250



>ref|XP_004966829.1| PREDICTED: uncharacterized protein LOC101764879 [Setaria italica]
Length=1010

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 115/165 (70%), Gaps = 9/165 (5%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAIT LKKG  LLKYGRRGKPKFCPF+LS DE+ L+WY G+ EKQL LN+VSRIIPG
Sbjct  14   DVEQAITGLKKGTHLLKYGRRGKPKFCPFKLSNDETVLIWYTGRVEKQLRLNQVSRIIPG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQ-----  346
            QRTAIF RYPRP+KE+QSFSLIY  RSLD+ICKDKDEAE W   LKALIS  + +     
Sbjct  74   QRTAIFLRYPRPDKEFQSFSLIYGHRSLDLICKDKDEAEAWFVSLKALISRWNCERWVIE  133

Query  347  -KDQEDTQRSKSLTQGGLGKAFADIVSYTASSKTHTFADTNSYSV  478
             KD +D        QG    AF     Y + +K   F + +++ V
Sbjct  134  TKDDKDFDTRAKHIQGDSPLAFP---FYGSDAKNKDFQNIDAHEV  175



>ref|XP_009770546.1| PREDICTED: uncharacterized protein LOC104221230 isoform X2 [Nicotiana 
sylvestris]
Length=949

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 108/136 (79%), Gaps = 7/136 (5%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            +++QAIT LK+G +LLKYGRRGKPKFCPFRLS DE+ L+WY  KEEKQL+L++VSRIIPG
Sbjct  13   NVEQAITALKRGTYLLKYGRRGKPKFCPFRLSTDETRLIWYVDKEEKQLQLSQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTAIF R+PRPEKEYQSFSL+Y   SLD+ICKDK+EAEVW   L+ALIS  + QK    
Sbjct  73   QRTAIFLRFPRPEKEYQSFSLLYGKSSLDLICKDKEEAEVWFVALRALISRVNCQKWTSN  132

Query  350  ---DQEDTQRSKSLTQ  388
               D   ++ S ++TQ
Sbjct  133  IGHDATSSEGSTAVTQ  148



>emb|CBI15243.3| unnamed protein product [Vitis vinifera]
Length=264

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 113/187 (60%), Gaps = 40/187 (21%)
 Frame = +2

Query  11   QAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRT  190
            QAIT LKKG +LLKYGRRGKP FCPFR+S DE  LLWY G+EEKQL+L +VSRII GQ T
Sbjct  20   QAITALKKGTYLLKYGRRGKPTFCPFRISNDEKVLLWYAGREEKQLQLCQVSRIIQGQHT  79

Query  191  AIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK-------  349
            A F++YPR EKE QSFSL+Y D SLD+ICKDKDEAEVW   L+ALIS  +Y         
Sbjct  80   ATFRQYPRLEKEDQSFSLMYKDGSLDIICKDKDEAEVWFVALRALISQCNYHNWINETRS  139

Query  350  ------DQEDTQRSKSLTQGG---------------------------LGKAFADIVSYT  430
                     D +R+  LT                              LG+AF+DI+SYT
Sbjct  140  DSGSLDHHTDIRRNTPLTVSANSSDIISKDPENVQTILIPFQHPRKKRLGRAFSDIISYT  199

Query  431  ASSKTHT  451
             ++K  T
Sbjct  200  GATKGFT  206



>gb|EMT20640.1| Putative E3 ubiquitin-protein ligase HERC1 [Aegilops tauschii]
Length=1170

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = +2

Query  20   TTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTAIF  199
            T LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L+ VSRI+PGQRTAIF
Sbjct  109  TALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHVSRIMPGQRTAIF  168

Query  200  QRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQEDTQRSKS  379
            QRYPRPEKE QSFSLI +DRSLD+ICKDKDEAEVW  GLK LIS  S+Q+      RS +
Sbjct  169  QRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISR-SHQRKWRTGSRSDT  227

Query  380  LT  385
            ++
Sbjct  228  IS  229



>ref|XP_009770543.1| PREDICTED: uncharacterized protein LOC104221230 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009770544.1| PREDICTED: uncharacterized protein LOC104221230 isoform X1 [Nicotiana 
sylvestris]
Length=962

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 108/136 (79%), Gaps = 7/136 (5%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            +++QAIT LK+G +LLKYGRRGKPKFCPFRLS DE+ L+WY  KEEKQL+L++VSRIIPG
Sbjct  13   NVEQAITALKRGTYLLKYGRRGKPKFCPFRLSTDETRLIWYVDKEEKQLQLSQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK----  349
            QRTAIF R+PRPEKEYQSFSL+Y   SLD+ICKDK+EAEVW   L+ALIS  + QK    
Sbjct  73   QRTAIFLRFPRPEKEYQSFSLLYGKSSLDLICKDKEEAEVWFVALRALISRVNCQKWTSN  132

Query  350  ---DQEDTQRSKSLTQ  388
               D   ++ S ++TQ
Sbjct  133  IGHDATSSEGSTAVTQ  148



>emb|CDY13998.1| BnaC09g38280D [Brassica napus]
Length=1116

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 123/202 (61%), Gaps = 43/202 (21%)
 Frame = +2

Query  11   QAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRT  190
             A+T LK GA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII GQRT
Sbjct  34   MAVTALKMGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRT  93

Query  191  AIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED---  361
             IFQR PRPEKEYQSFSLIY++RSLD+ICKDKDEA+VW TGLKA+IS    ++ + D   
Sbjct  94   PIFQRCPRPEKEYQSFSLIYDERSLDLICKDKDEAQVWFTGLKAVISRCHQRRFRTDSRS  153

Query  362  -------------TQRSKSL---------------------------TQGGLGKAFADIV  421
                         T+RS  L                            + G+GKAF+D+ 
Sbjct  154  DETPSEANSPRTYTRRSSPLHSPFSSNDSFLKDGSNHHCLHTPYESPPKNGIGKAFSDMT  213

Query  422  SYTASSKTHTFADTNSYSVSPL  487
             Y    K +  +D  S SV  L
Sbjct  214  LYALPPKGYFPSDPASISVHSL  235



>ref|XP_009120889.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103845756 
[Brassica rapa]
Length=1103

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 128/207 (62%), Gaps = 45/207 (22%)
 Frame = +2

Query  2    DID-QAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRI-I  175
            DID +A+T LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRI I
Sbjct  22   DIDIEAVTALKKGAYLLKYGRRGKPKFCPFRLSSDESVLIWFSGKEEKHLKLSHVSRICI  81

Query  176  PGQRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQ  355
             GQRT IFQR PRPEKEYQSFSLI+++RSLD+ICKDKDEA+VW TGLKALIS    ++ +
Sbjct  82   SGQRTPIFQRCPRPEKEYQSFSLIHDERSLDLICKDKDEAQVWFTGLKALISRSHQRRWR  141

Query  356  ED----------------TQRSKSL---------------------------TQGGLGKA  406
             D                T+RS  L                            + G+GKA
Sbjct  142  TDSRSDETPSEANSPRTYTRRSSPLHSPFSSNDSFLKDGSNHHCLHSPYESPPKNGIGKA  201

Query  407  FADIVSYTASSKTHTFADTNSYSVSPL  487
            F+D+  Y    K +  +D  S SV  L
Sbjct  202  FSDMTLYALPPKGYFPSDPASISVHSL  228



>ref|XP_008356820.1| PREDICTED: uncharacterized protein LOC103420538 [Malus domestica]
Length=1077

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  38   AFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTAIFQRYPRP  217
            A LLKYGRRGKPKFCPFRLS DES L+WY GKEEK L+L++VSRI+PGQRT  FQRYPRP
Sbjct  31   AQLLKYGRRGKPKFCPFRLSNDESVLIWYSGKEEKYLKLSQVSRIVPGQRTQTFQRYPRP  90

Query  218  EKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQEDTQ  367
            EKEYQSFSLI NDRSLD+ICKDKDEAEVW TGLKALIS G +QK + +++
Sbjct  91   EKEYQSFSLICNDRSLDLICKDKDEAEVWFTGLKALISRGLHQKGRPESR  140



>emb|CDX92532.1| BnaA10g15710D [Brassica napus]
Length=1114

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 123/202 (61%), Gaps = 43/202 (21%)
 Frame = +2

Query  11   QAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRT  190
             A+T LKKGA+LLKYG RGKPKFCPFRLS DES L+W+ GKEEK L+L+ VSRII GQRT
Sbjct  38   MAVTALKKGAYLLKYGTRGKPKFCPFRLSSDESVLIWFSGKEEKHLKLSHVSRIISGQRT  97

Query  191  AIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED---  361
             IFQR PRPEKEYQSFSLI+++RSLD+ICKDKDEA+VW TGLKALIS    ++ + D   
Sbjct  98   PIFQRCPRPEKEYQSFSLIHDERSLDLICKDKDEAQVWFTGLKALISRSHQRRWRTDSRS  157

Query  362  -------------TQRSKSL---------------------------TQGGLGKAFADIV  421
                         T+RS  L                            + G+GKAF+D+ 
Sbjct  158  DETPSEANSPRTYTRRSSPLHSPFSSNDSFLKDGSNHHCLHSPYESPPKNGIGKAFSDMT  217

Query  422  SYTASSKTHTFADTNSYSVSPL  487
             Y    K +  +D  S SV  L
Sbjct  218  LYALPPKGYFPSDPASISVHSL  239



>ref|XP_002991915.1| hypothetical protein SELMODRAFT_430200, partial [Selaginella 
moellendorffii]
 gb|EFJ07026.1| hypothetical protein SELMODRAFT_430200, partial [Selaginella 
moellendorffii]
Length=253

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  26   LKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQRTAIFQR  205
            +++GA LLKYGRRGKPKFCPFRLS DE+ L+WY GKEEK L L+ ++RI+PGQRTA FQR
Sbjct  14   IEQGAQLLKYGRRGKPKFCPFRLSNDETHLIWYSGKEEKSLRLSSITRIVPGQRTANFQR  73

Query  206  YPRPEKEYQSFSLIY-NDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQEDTQ  367
            YPR EKEYQSFSLIY NDRSLD+ICKDKDEAEVW  GLKAL+S G   + + D++
Sbjct  74   YPRLEKEYQSFSLIYGNDRSLDLICKDKDEAEVWFVGLKALVSGGQLSRLRFDSR  128



>ref|XP_011071628.1| PREDICTED: uncharacterized protein LOC105157032 [Sesamum indicum]
 ref|XP_011071629.1| PREDICTED: uncharacterized protein LOC105157032 [Sesamum indicum]
 ref|XP_011071630.1| PREDICTED: uncharacterized protein LOC105157032 [Sesamum indicum]
 ref|XP_011071631.1| PREDICTED: uncharacterized protein LOC105157032 [Sesamum indicum]
Length=947

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 5/140 (4%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D  QAI  LKKG++LLKYGR GKPKFCPFRLS DE  L+WY G+E+KQL+L++VSRIIPG
Sbjct  12   DTVQAINALKKGSYLLKYGRWGKPKFCPFRLSNDEKTLIWYVGEEQKQLQLSQVSRIIPG  71

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTA+FQRYP+PEKEYQSFSLIY   SLDVICKDK EAE+W   L+ALIS G+ Q+    
Sbjct  72   QRTAVFQRYPQPEKEYQSFSLIYGKNSLDVICKDKYEAEIWFVALRALISRGNSQR----  127

Query  362  TQRSKSLTQGGLGKAFADIV  421
              R++  T+G L    +D +
Sbjct  128  -WRTEIRTEGILSDCSSDQI  146



>ref|XP_006364189.1| PREDICTED: uncharacterized protein LOC102590844 [Solanum tuberosum]
Length=946

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            +++QAIT LK+G++LLKYGR+GKPKFCPFRLS DE+ L+WY  KEEKQL+L++VSRIIPG
Sbjct  13   NVEQAITALKRGSYLLKYGRKGKPKFCPFRLSTDETRLIWYVEKEEKQLQLSQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTA FQR+PRPEKEYQSFSL+Y   SLD+ICKDK+EAEVW   L+AL S    QK   D
Sbjct  73   QRTANFQRFPRPEKEYQSFSLLYGKSSLDLICKDKEEAEVWFVALRALTSRVDCQKWTND  132

Query  362  TQRSKSLTQG  391
             +   + + G
Sbjct  133  IRHDIAYSDG  142



>ref|XP_010663866.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100243300 
[Vitis vinifera]
Length=930

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 114/176 (65%), Gaps = 27/176 (15%)
 Frame = +2

Query  5    IDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQ  184
            I +AIT LKKG +LLKYGRRGKP FCPFR+S DE  LLWY G+EEKQL+L +VSRII GQ
Sbjct  4    IWKAITALKKGTYLLKYGRRGKPTFCPFRISNDEKVLLWYAGREEKQLQLCQVSRIIQGQ  63

Query  185  RTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQK-----  349
             TA F++YPR EKE QSFSL+Y D SLD+ICKDKDEAEVW   L+ALIS  +Y       
Sbjct  64   HTATFRQYPRLEKEDQSFSLMYKDGSLDIICKDKDEAEVWFVALRALISQCNYHNWINET  123

Query  350  --------DQEDTQRSKSLTQGG--------------LGKAFADIVSYTASSKTHT  451
                       D +R+  LT                 LG+AF+DI+SYT ++K  T
Sbjct  124  RSDSGSLDHHTDIRRNTPLTVSANSSDIISKHPRKKRLGRAFSDIISYTGATKGFT  179



>ref|XP_010503375.1| PREDICTED: uncharacterized protein LOC104780573 isoform X2 [Camelina 
sativa]
Length=955

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +2

Query  8    DQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQR  187
            +QAI  LKKGA+LLKYGRRGKPKF PFRLS DE  LLWYYGK+EK+L L+ V+RIIPGQR
Sbjct  15   EQAIAILKKGAYLLKYGRRGKPKFYPFRLSSDEIYLLWYYGKKEKRLNLSSVTRIIPGQR  74

Query  188  TAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            TA+F+RYP+P KEYQSFSLIY DRSLD++CKDKDEAE WLT L+AL+S
Sbjct  75   TAVFRRYPQPTKEYQSFSLIYGDRSLDLVCKDKDEAEFWLTTLRALLS  122



>ref|XP_010547813.1| PREDICTED: X-linked retinitis pigmentosa GTPase regulator isoform 
X1 [Tarenaya hassleriana]
Length=995

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +2

Query  8    DQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQR  187
            DQAI  LKKGA+LLKYGRRGKPKF PFRLS DE+ LLWY GK+EK+L+L+ VS+IIPGQR
Sbjct  53   DQAIAILKKGAYLLKYGRRGKPKFYPFRLSSDETVLLWYCGKKEKRLKLSSVSKIIPGQR  112

Query  188  TAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            TA+F+RYP+PEKEYQSFSLIY DRSLD++CKD+DEAE W+T ++AL+S
Sbjct  113  TAVFKRYPQPEKEYQSFSLIYGDRSLDLVCKDRDEAEFWITTIRALLS  160



>ref|XP_010318794.1| PREDICTED: uncharacterized protein LOC101257851 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318795.1| PREDICTED: uncharacterized protein LOC101257851 isoform X1 [Solanum 
lycopersicum]
Length=946

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            +++QAIT LK+G++LLKYGRRGKPKFCPFRLS DE+ L+WY  KEEKQL+L++VSRIIPG
Sbjct  13   NVEQAITALKRGSYLLKYGRRGKPKFCPFRLSTDETRLIWYVEKEEKQLQLSQVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQED  361
            QRTA F R+PRPEKEYQSFSL+Y   SLD+ICKDK+EAEVW   L+AL S    QK   D
Sbjct  73   QRTANFLRFPRPEKEYQSFSLLYGKSSLDLICKDKEEAEVWFVALRALTSRVDCQKWTSD  132



>ref|XP_010426213.1| PREDICTED: uncharacterized protein LOC104711231 [Camelina sativa]
 ref|XP_010426214.1| PREDICTED: uncharacterized protein LOC104711231 [Camelina sativa]
Length=955

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +2

Query  8    DQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQR  187
            +QAI  LKKGA+LLKYGRRGKPKF PFRLS DE  LLWY GK+EK+L L+ V+RIIPGQR
Sbjct  15   EQAIAILKKGAYLLKYGRRGKPKFYPFRLSSDEIYLLWYCGKKEKRLNLSSVTRIIPGQR  74

Query  188  TAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            TA+F+RYP+P KEYQSFSLIY DRSLD++CKDKDEAE WLT L+AL+S
Sbjct  75   TAVFRRYPQPTKEYQSFSLIYGDRSLDLVCKDKDEAEFWLTTLRALLS  122



>ref|XP_001761845.1| predicted protein [Physcomitrella patens]
 gb|EDQ73286.1| predicted protein [Physcomitrella patens]
Length=1131

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 124/177 (70%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA LLKYGRRGKPKFCPF+LS DE+AL+WY G EEK+L L+ VSRIIPG
Sbjct  13   DIEQAITALKKGAQLLKYGRRGKPKFCPFKLSSDENALIWYSGGEEKRLWLSTVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYN--DRSLDVICKDKDEAEVWLTGLKALISNGSYQKDQ  355
            QRT +F RYPRPEKE QS SL+++  +RSLDVICKDKDEAEVW  GLKA ++    +K +
Sbjct  73   QRTPVFLRYPRPEKECQSLSLLHSNEERSLDVICKDKDEAEVWFVGLKASVAGAQLRKSK  132

Query  356  EDT---QRSKSLTQGGLGKAFADIVSYTASS-----KTHTFADTNSYSVSPLPTDVG  502
             +    +R+  +    L +  + + S   S+     ++  F  T+S+  SPL ++ G
Sbjct  133  FNNVRHERTVDIVSPALTRNSSPLTSPFGSTDNLQQESGDFFKTSSFIGSPLQSEKG  189



>gb|AFW83944.1| putative regulator of chromosome condensation (RCC1) family protein 
[Zea mays]
Length=1131

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 107/244 (44%), Positives = 126/244 (52%), Gaps = 82/244 (34%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DI+QAIT LKKGA+LLKYGRRGKPKFCPFRLS DES L+W+ GKEEK L L+ +S+IIPG
Sbjct  19   DIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHISKIIPG  78

Query  182  QRT---------------------------------------AIFQRYPRPEKEYQSFSL  244
            QRT                                       +IFQRYPRPEKE QSFSL
Sbjct  79   QRTLNSIVNEQKLYVSLEVFPFSIRDEIGCLTLLTRPFFIIQSIFQRYPRPEKECQSFSL  138

Query  245  IYNDRSLDVICKDKDEAEVWLTGLKALIS-------------------------------  331
            I +DRSLDVICKDKDEAEVW  GLK LIS                               
Sbjct  139  ISHDRSLDVICKDKDEAEVWFAGLKTLISRCHQRKWRTESRSDLLSSGATSPRTYTRRSS  198

Query  332  --------NGSYQKDQEDTQRSK----SLTQGGLGKAFADIVSYTASSKTHTFADTNSYS  475
                    N S  KD  D  R +    S  + GL KAF+D++ Y    +    +D+N+ S
Sbjct  199  PLSSPFSSNDSIHKDGSDNYRLRTPYGSPPKNGLEKAFSDVMLYAVPPRGFFPSDSNAGS  258

Query  476  VSPL  487
            V  +
Sbjct  259  VHSM  262



>ref|XP_002992739.1| hypothetical protein SELMODRAFT_430894 [Selaginella moellendorffii]
 gb|EFJ06220.1| hypothetical protein SELMODRAFT_430894 [Selaginella moellendorffii]
Length=982

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 107/142 (75%), Gaps = 4/142 (3%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++QAI  LKKG+ LLKYGRRG+PKF PFRLS DE+ L+W+ G++E+QL L+ V++IIPG
Sbjct  14   DVEQAIIALKKGSQLLKYGRRGRPKFAPFRLSNDETTLIWFSGRKERQLRLDAVTKIIPG  73

Query  182  QRTAIFQRYPRPEKEYQSFSLIYN----DRSLDVICKDKDEAEVWLTGLKALISNGSYQK  349
            QRTA FQRYPRPEKEYQSFSLIY     +RSLD+ICKDKDEAEVW  GLKA +S+    K
Sbjct  74   QRTANFQRYPRPEKEYQSFSLIYGSGGEERSLDLICKDKDEAEVWFVGLKARVSSNRTLK  133

Query  350  DQEDTQRSKSLTQGGLGKAFAD  415
                ++ + S     LG+A  D
Sbjct  134  VDNKSEGTLSDVNSPLGRALRD  155



>ref|XP_004290546.1| PREDICTED: uncharacterized protein LOC101304637 [Fragaria vesca 
subsp. vesca]
Length=1126

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 101/122 (83%), Gaps = 2/122 (2%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAI +LKKGA LLKYGR+GKPKFCPFRLS DES+L+W     E+ L+L  VSRIIPG
Sbjct  13   DIDQAIISLKKGAQLLKYGRKGKPKFCPFRLSSDESSLIWISSSGERTLKLASVSRIIPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYND--RSLDVICKDKDEAEVWLTGLKALISNGSYQKDQ  355
            QRTA+FQRY RPEK+Y SFSLIYN+  RSLD+ICKDK EAEVW+ GLKALIS+G+  + +
Sbjct  73   QRTAVFQRYLRPEKDYLSFSLIYNNGKRSLDLICKDKVEAEVWIAGLKALISSGTGGRSK  132

Query  356  ED  361
             D
Sbjct  133  ID  134



>ref|XP_009150226.1| PREDICTED: uncharacterized protein LOC103873573 [Brassica rapa]
Length=957

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +2

Query  8    DQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQR  187
            +QAI  LKKGA+LLKYGRRGKPKF PFRLS DE  LLWY GK EK+L+L+ V+RIIPGQR
Sbjct  15   EQAIAILKKGAYLLKYGRRGKPKFYPFRLSSDEIFLLWYCGKTEKRLKLSSVTRIIPGQR  74

Query  188  TAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            T++F+RYP+P KEYQSFSLIY DRSLD++CKDKDEAE W+T L+AL+S
Sbjct  75   TSVFRRYPQPTKEYQSFSLIYGDRSLDLVCKDKDEAEFWITTLRALLS  122



>emb|CDY21795.1| BnaA06g20640D [Brassica napus]
Length=957

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +2

Query  8    DQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQR  187
            +QAI  LKKGA+LLKYGRRGKPKF PFRLS DE  LLWY GK EK+L+L+ V+RIIPGQR
Sbjct  15   EQAIAILKKGAYLLKYGRRGKPKFYPFRLSSDEIFLLWYCGKTEKRLKLSSVTRIIPGQR  74

Query  188  TAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            T++F+RYP+P KEYQSFSLIY DRSLD++CKDKDEAE W+T L+AL+S
Sbjct  75   TSVFRRYPQPTKEYQSFSLIYGDRSLDLVCKDKDEAEFWITTLRALLS  122



>emb|CDX77871.1| BnaC03g53480D [Brassica napus]
Length=949

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +2

Query  8    DQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPGQR  187
            +QAI  LKKGA+LLKYGRRGKPKF PFRLS DE  LLWY GK EK+L+L+ V+RIIPGQR
Sbjct  15   EQAIAILKKGAYLLKYGRRGKPKFYPFRLSSDEIFLLWYCGKTEKRLKLSSVTRIIPGQR  74

Query  188  TAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALIS  331
            T++F+RYP+P KEYQSFSLIY DRSLD++CKDKDEAE W+T L+AL+S
Sbjct  75   TSVFRRYPQPTKEYQSFSLIYGDRSLDLVCKDKDEAEFWITTLRALLS  122



>ref|XP_010095965.1| putative E3 ubiquitin-protein ligase HERC1 [Morus notabilis]
 gb|EXB62658.1| putative E3 ubiquitin-protein ligase HERC1 [Morus notabilis]
Length=1060

 Score =   176 bits (446),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            D++ AIT LKKGA LLKYGRRGKPKFCPFRLS DE  L+WY  KEEK ++++ +SRII G
Sbjct  15   DVELAITALKKGANLLKYGRRGKPKFCPFRLSNDECFLIWYSRKEEKCIKISHISRIIRG  74

Query  182  QRTAIFQRYPRPEKEYQSFSLIYNDRSLDVICKDKDEAEVWLTGLKALI  328
            QRT  FQRYPRP+KEYQSFS++Y D+SLD+ICKDK+EAEVW TGLKA+I
Sbjct  75   QRTPTFQRYPRPDKEYQSFSILYKDKSLDLICKDKEEAEVWFTGLKAII  123



>ref|XP_007201762.1| hypothetical protein PRUPE_ppa000526mg [Prunus persica]
 gb|EMJ02961.1| hypothetical protein PRUPE_ppa000526mg [Prunus persica]
Length=1114

 Score =   176 bits (445),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  2    DIDQAITTLKKGAFLLKYGRRGKPKFCPFRLSIDESALLWYYGKEEKQLELNRVSRIIPG  181
            DIDQAI  LKKGA LLKYGR+GKPKFCPFRLS DES+L+W     E+ L+L  VSRI+PG
Sbjct  13   DIDQAIIALKKGAQLLKYGRKGKPKFCPFRLSTDESSLIWISSSGERSLKLASVSRIVPG  72

Query  182  QRTAIFQRYPRPEKEYQSFSLIYND--RSLDVICKDKDEAEVWLTGLKALISNG  337
            QRTA+FQRY RPEK+Y SFSLIYN+  RSLD+ICKDK EAEVW+ GLKALIS+G
Sbjct  73   QRTAVFQRYLRPEKDYLSFSLIYNNGKRSLDLICKDKVEAEVWIAGLKALISSG  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 704648528304